BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17807_g1_i1 len=1535 path=[1513:0-1534]

Length=1535
                                                                      Score     E

ref|XP_009782424.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    640   0.0      
ref|XP_009624957.1|  PREDICTED: O-acyltransferase WSD1-like             639   0.0      
ref|XP_009759664.1|  PREDICTED: O-acyltransferase WSD1-like             638   0.0      
ref|XP_006367474.1|  PREDICTED: O-acyltransferase WSD1-like             628   0.0      
ref|XP_004243360.1|  PREDICTED: O-acyltransferase WSD1                  617   0.0      
ref|XP_011100361.1|  PREDICTED: O-acyltransferase WSD1-like             609   0.0      
ref|XP_002517893.1|  conserved hypothetical protein                     593   0.0      Ricinus communis
ref|XP_009588555.1|  PREDICTED: O-acyltransferase WSD1-like             583   0.0      
ref|XP_002274522.1|  PREDICTED: O-acyltransferase WSD1                  567   0.0      Vitis vinifera
ref|XP_009784406.1|  PREDICTED: O-acyltransferase WSD1-like             566   0.0      
gb|EYU28206.1|  hypothetical protein MIMGU_mgv1a021941mg                565   0.0      
ref|XP_004251786.1|  PREDICTED: O-acyltransferase WSD1-like             564   0.0      
ref|XP_007043617.1|  O-acyltransferase family protein                   561   0.0      
ref|XP_006350139.1|  PREDICTED: O-acyltransferase WSD1-like             562   0.0      
ref|XP_009600771.1|  PREDICTED: O-acyltransferase WSD1-like             560   0.0      
emb|CDP20977.1|  unnamed protein product                                560   0.0      
gb|EYU28207.1|  hypothetical protein MIMGU_mgv1a006155mg                557   0.0      
ref|XP_002323705.2|  hypothetical protein POPTR_0017s04330g             553   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011037140.1|  PREDICTED: O-acyltransferase WSD1-like             544   0.0      
emb|CBI21867.3|  unnamed protein product                                545   0.0      
ref|XP_011001808.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    543   0.0      
ref|XP_010272425.1|  PREDICTED: O-acyltransferase WSD1-like             543   0.0      
gb|EYU28205.1|  hypothetical protein MIMGU_mgv1a006032mg                540   0.0      
ref|XP_008227240.1|  PREDICTED: O-acyltransferase WSD1-like             540   0.0      
ref|XP_007214098.1|  hypothetical protein PRUPE_ppa015879mg             540   0.0      
ref|XP_008227239.1|  PREDICTED: O-acyltransferase WSD1-like             539   0.0      
ref|XP_010689024.1|  PREDICTED: O-acyltransferase WSD1-like             533   0.0      
ref|XP_007212723.1|  hypothetical protein PRUPE_ppa018856mg             533   0.0      
ref|XP_011001806.1|  PREDICTED: O-acyltransferase WSD1-like             532   0.0      
ref|XP_006469879.1|  PREDICTED: O-acyltransferase WSD1-like             529   0.0      
ref|XP_006447283.1|  hypothetical protein CICLE_v10015126mg             528   0.0      
ref|XP_006446857.1|  hypothetical protein CICLE_v10015143mg             527   2e-180   
gb|KDP24112.1|  hypothetical protein JCGZ_25769                         527   3e-180   
ref|XP_011047658.1|  PREDICTED: O-acyltransferase WSD1-like             526   1e-179   
ref|XP_006468957.1|  PREDICTED: O-acyltransferase WSD1-like             526   1e-179   
ref|XP_003551727.1|  PREDICTED: O-acyltransferase WSD1-like             525   2e-179   
ref|XP_003552517.1|  PREDICTED: O-acyltransferase WSD1-like             522   2e-178   
ref|XP_009782425.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    520   5e-178   
ref|XP_004516682.1|  PREDICTED: O-acyltransferase WSD1-like             520   2e-177   
ref|XP_002323706.1|  hypothetical protein POPTR_0017s04300g             520   2e-177   Populus trichocarpa [western balsam poplar]
ref|XP_011001810.1|  PREDICTED: O-acyltransferase WSD1-like             519   2e-177   
ref|XP_002310400.1|  hypothetical protein POPTR_0007s00950g             519   6e-177   Populus trichocarpa [western balsam poplar]
ref|XP_007139588.1|  hypothetical protein PHAVU_008G042300g             515   9e-176   
ref|XP_007139590.1|  hypothetical protein PHAVU_008G042500g             514   2e-175   
emb|CAN62907.1|  hypothetical protein VITISV_043611                     510   3e-174   Vitis vinifera
ref|XP_003534457.1|  PREDICTED: O-acyltransferase WSD1-like             509   2e-173   
ref|XP_011001811.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    509   3e-173   
ref|XP_008229085.1|  PREDICTED: O-acyltransferase WSD1-like             508   6e-173   
gb|KHN11595.1|  O-acyltransferase WSD1                                  507   1e-172   
ref|XP_007198876.1|  hypothetical protein PRUPE_ppa022031mg             507   2e-172   
ref|XP_007198851.1|  hypothetical protein PRUPE_ppa016739mg             506   2e-172   
ref|XP_003539933.1|  PREDICTED: O-acyltransferase WSD1-like             504   2e-171   
ref|XP_008365935.1|  PREDICTED: O-acyltransferase WSD1-like             503   6e-171   
ref|XP_008228990.1|  PREDICTED: O-acyltransferase WSD1-like             503   1e-170   
ref|XP_007198906.1|  hypothetical protein PRUPE_ppa1027135mg            502   2e-170   
ref|XP_010260233.1|  PREDICTED: O-acyltransferase WSD1-like             500   9e-170   
ref|XP_007199626.1|  hypothetical protein PRUPE_ppa016286mg             497   2e-168   
ref|XP_008237425.1|  PREDICTED: O-acyltransferase WSD1-like             496   2e-168   
ref|XP_008791832.1|  PREDICTED: O-acyltransferase WSD1-like             497   2e-168   
gb|KHN47659.1|  O-acyltransferase WSD1                                  496   2e-168   
ref|XP_002319796.2|  hypothetical protein POPTR_0013s08300g             496   3e-168   Populus trichocarpa [western balsam poplar]
ref|XP_003541280.1|  PREDICTED: O-acyltransferase WSD1-like             496   4e-168   
gb|KEH30692.1|  O-acyltransferase WSD1-like protein                     496   4e-168   
ref|XP_011001809.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    492   4e-167   
ref|XP_010260232.1|  PREDICTED: O-acyltransferase WSD1-like             493   1e-166   
ref|XP_010935670.1|  PREDICTED: O-acyltransferase WSD1-like             492   2e-166   
ref|XP_008241433.1|  PREDICTED: O-acyltransferase WSD1-like             490   1e-165   
ref|XP_007203447.1|  hypothetical protein PRUPE_ppa022053mg             489   1e-165   
ref|XP_007198908.1|  hypothetical protein PRUPE_ppa025020mg             488   4e-165   
ref|XP_009334893.1|  PREDICTED: O-acyltransferase WSD1-like             487   1e-164   
ref|XP_009372230.1|  PREDICTED: O-acyltransferase WSD1-like             487   1e-164   
ref|XP_003621165.1|  O-acyltransferase WSD1                             486   2e-164   
ref|XP_004292434.1|  PREDICTED: O-acyltransferase WSD1-like             485   5e-164   
ref|XP_003607481.1|  O-acyltransferase WSD1                             484   2e-163   
gb|KEH17310.1|  O-acyltransferase WSD1-like protein                     484   2e-163   
ref|XP_008229024.1|  PREDICTED: O-acyltransferase WSD1-like             481   2e-162   
ref|XP_008368650.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    481   4e-162   
ref|XP_002323911.2|  hypothetical protein POPTR_0017s04310g             479   5e-162   Populus trichocarpa [western balsam poplar]
ref|XP_009336217.1|  PREDICTED: O-acyltransferase WSD1-like             480   7e-162   
gb|KHN07508.1|  O-acyltransferase WSD1                                  480   8e-162   
ref|XP_004489154.1|  PREDICTED: O-acyltransferase WSD1-like             478   3e-161   
ref|NP_001241558.1|  uncharacterized protein LOC100777968               478   4e-161   
ref|XP_009335177.1|  PREDICTED: O-acyltransferase WSD1-like             476   3e-160   
ref|XP_004489155.1|  PREDICTED: O-acyltransferase WSD1-like             477   5e-160   
gb|KHN35242.1|  O-acyltransferase WSD1                                  474   1e-159   
gb|KEH30693.1|  O-acyltransferase WSD1-like protein                     473   4e-159   
ref|XP_010068985.1|  PREDICTED: O-acyltransferase WSD1-like             473   4e-159   
ref|XP_008342897.1|  PREDICTED: O-acyltransferase WSD1-like             472   7e-159   
ref|XP_006603695.1|  PREDICTED: uncharacterized protein LOC100777...    472   1e-158   
ref|XP_007151640.1|  hypothetical protein PHAVU_004G063900g             471   2e-158   
ref|XP_009336220.1|  PREDICTED: O-acyltransferase WSD1-like             471   2e-158   
ref|XP_009336219.1|  PREDICTED: O-acyltransferase WSD1-like             469   9e-158   
gb|KHN35245.1|  O-acyltransferase WSD1                                  469   2e-157   
ref|XP_008362473.1|  PREDICTED: O-acyltransferase WSD1-like             475   2e-157   
ref|XP_003527429.1|  PREDICTED: O-acyltransferase WSD1-like             469   2e-157   
ref|XP_004136846.1|  PREDICTED: O-acyltransferase WSD1-like             467   5e-157   
gb|KGN43650.1|  hypothetical protein Csa_7G051300                       467   1e-156   
ref|XP_004516681.1|  PREDICTED: O-acyltransferase WSD1-like             466   1e-156   
gb|KHN36647.1|  O-acyltransferase WSD1                                  464   2e-155   
ref|XP_008455536.1|  PREDICTED: O-acyltransferase WSD1-like             463   2e-155   
ref|XP_003541905.1|  PREDICTED: O-acyltransferase WSD1-like             462   5e-155   
ref|XP_009396631.1|  PREDICTED: O-acyltransferase WSD1-like             463   8e-155   
ref|XP_003607478.1|  O-acyltransferase WSD1                             459   9e-154   
ref|XP_010035414.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    459   1e-153   
gb|AES89670.2|  O-acyltransferase WSD1-like protein                     456   2e-152   
ref|XP_010035413.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    454   2e-151   
ref|XP_010038538.1|  PREDICTED: O-acyltransferase WSD1-like             454   2e-151   
ref|XP_004516688.1|  PREDICTED: O-acyltransferase WSD1-like             450   6e-150   
ref|XP_008805672.1|  PREDICTED: O-acyltransferase WSD1-like             447   1e-149   
gb|KEH30682.1|  O-acyltransferase WSD1-like protein                     449   1e-149   
gb|KEH17312.1|  O-acyltransferase (WSD1-like) family protein            446   2e-149   
gb|EYU24923.1|  hypothetical protein MIMGU_mgv1a007879mg                443   1e-148   
ref|XP_004516680.1|  PREDICTED: O-acyltransferase WSD1-like             444   1e-147   
gb|KEH30678.1|  O-acyltransferase WSD1-like protein                     444   1e-147   
gb|KEH30680.1|  O-acyltransferase WSD1-like protein                     443   2e-147   
ref|XP_008241432.1|  PREDICTED: O-acyltransferase WSD1-like             440   8e-147   
gb|KEH21614.1|  O-acyltransferase WSD1-like protein                     439   1e-146   
gb|KCW57195.1|  hypothetical protein EUGRSUZ_H00010                     439   3e-146   
ref|XP_007132726.1|  hypothetical protein PHAVU_011G119700g             439   7e-146   
ref|XP_008381074.1|  PREDICTED: O-acyltransferase WSD1-like             438   9e-146   
ref|XP_004492761.1|  PREDICTED: O-acyltransferase WSD1-like             436   2e-144   
gb|KCW57197.1|  hypothetical protein EUGRSUZ_H00012                     428   4e-142   
gb|AES89684.2|  O-acyltransferase WSD1-like protein                     429   5e-142   
ref|XP_004137034.1|  PREDICTED: O-acyltransferase WSD1-like             428   1e-141   
ref|XP_007149837.1|  hypothetical protein PHAVU_005G102500g             422   2e-139   
gb|KCW46801.1|  hypothetical protein EUGRSUZ_K00605                     421   5e-139   
ref|XP_008455537.1|  PREDICTED: O-acyltransferase WSD1-like             424   7e-138   
ref|XP_006446860.1|  hypothetical protein CICLE_v10015616mg             415   1e-137   
ref|XP_004505568.1|  PREDICTED: O-acyltransferase WSD1-like             416   9e-137   
ref|XP_003623995.1|  O-acyltransferase WSD1                             416   1e-136   
ref|XP_006446856.1|  hypothetical protein CICLE_v10015143mg             411   2e-136   
ref|XP_010268803.1|  PREDICTED: O-acyltransferase WSD1-like             411   1e-134   
ref|XP_006582315.1|  PREDICTED: O-acyltransferase WSD1-like             407   7e-134   
gb|KDO53892.1|  hypothetical protein CISIN_1g036070mg                   406   1e-133   
ref|XP_011001812.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    403   6e-133   
ref|XP_007149838.1|  hypothetical protein PHAVU_005G102600g             404   4e-132   
gb|KEH30688.1|  O-acyltransferase WSD1-like protein                     401   6e-132   
ref|XP_006469878.1|  PREDICTED: O-acyltransferase WSD1-like             390   4e-128   
gb|KGN43653.1|  hypothetical protein Csa_7G051330                       385   1e-125   
gb|KDO41203.1|  hypothetical protein CISIN_1g017622mg                   380   2e-124   
gb|KCW46796.1|  hypothetical protein EUGRSUZ_K00600                     374   2e-121   
gb|KEH30689.1|  O-acyltransferase WSD1-like protein                     371   1e-120   
ref|XP_003607474.1|  O-acyltransferase WSD1                             368   7e-120   
ref|XP_010690153.1|  PREDICTED: O-acyltransferase WSD1-like             369   3e-118   
gb|KEH23372.1|  O-acyltransferase WSD1-like protein                     363   2e-117   
ref|XP_004173488.1|  PREDICTED: O-acyltransferase WSD1-like             362   2e-117   
emb|CDP14803.1|  unnamed protein product                                357   3e-116   
gb|KDP24113.1|  hypothetical protein JCGZ_25770                         350   5e-114   
ref|XP_006447284.1|  hypothetical protein CICLE_v10015554mg             345   3e-110   
ref|XP_010672070.1|  PREDICTED: O-acyltransferase WSD1-like             344   1e-108   
emb|CDP20976.1|  unnamed protein product                                335   1e-107   
ref|XP_010242035.1|  PREDICTED: O-acyltransferase WSD1-like             332   3e-104   
gb|KEH30690.1|  O-acyltransferase WSD1-like protein                     315   9e-100   
ref|XP_008244954.1|  PREDICTED: O-acyltransferase WSD1-like             307   1e-97    
ref|XP_008455535.1|  PREDICTED: uncharacterized protein LOC103495687    308   8e-97    
gb|KDP24070.1|  hypothetical protein JCGZ_25727                         305   3e-96    
ref|XP_004293155.1|  PREDICTED: O-acyltransferase WSD1-like             291   3e-91    
gb|KDP24069.1|  hypothetical protein JCGZ_25726                         286   2e-89    
gb|ADE77834.1|  unknown                                                 289   4e-87    
gb|KCW57203.1|  hypothetical protein EUGRSUZ_H00018                     282   2e-86    
gb|ADE76190.1|  unknown                                                 283   7e-85    
gb|EYU28203.1|  hypothetical protein MIMGU_mgv1a013012mg                271   4e-84    
ref|XP_004136847.1|  PREDICTED: O-acyltransferase WSD1-like             271   2e-83    
ref|XP_008345468.1|  PREDICTED: O-acyltransferase WSD1-like             269   7e-83    
ref|XP_008368651.1|  PREDICTED: uncharacterized protein LOC103432...    267   8e-81    
gb|KEH30694.1|  DNA repair and recombination RAD26-like protein, ...    276   2e-79    
gb|KGN43651.1|  hypothetical protein Csa_7G051310                       259   6e-79    
gb|KDO38197.1|  hypothetical protein CISIN_1g044955mg                   258   9e-79    
gb|KCW57201.1|  hypothetical protein EUGRSUZ_H00016                     259   1e-78    
gb|AES89677.2|  DNA repair and recombination RAD26-like protein, ...    277   2e-78    
ref|XP_003607480.1|  Chromodomain-helicase-DNA-binding protein          277   2e-78    
ref|XP_011012031.1|  PREDICTED: O-acyltransferase WSD1-like             256   2e-77    
ref|XP_002517895.1|  conserved hypothetical protein                     253   6e-76    Ricinus communis
ref|XP_006593082.1|  PREDICTED: O-acyltransferase WSD1-like             250   2e-75    
gb|KHN35224.1|  O-acyltransferase WSD1                                  251   2e-74    
emb|CDP21807.1|  unnamed protein product                                244   4e-73    
ref|XP_003607473.1|  O-acyltransferase WSD1                             240   8e-72    
gb|KDO38023.1|  hypothetical protein CISIN_1g047091mg                   236   1e-70    
ref|XP_008362450.1|  PREDICTED: O-acyltransferase WSD1-like             233   3e-69    
ref|XP_007198862.1|  hypothetical protein PRUPE_ppa018325mg             227   6e-67    
ref|XP_003607477.1|  O-acyltransferase WSD1                             228   2e-64    
gb|EPS63572.1|  hypothetical protein M569_11213                         216   2e-63    
gb|KCW57200.1|  hypothetical protein EUGRSUZ_H00015                     219   4e-63    
ref|XP_010025798.1|  PREDICTED: uncharacterized protein LOC104416056    220   1e-62    
ref|XP_007203282.1|  hypothetical protein PRUPE_ppa025603mg             213   4e-62    
gb|EPS67964.1|  hypothetical protein M569_06810                         213   4e-62    
ref|XP_010911763.1|  PREDICTED: O-acyltransferase WSD1-like             211   1e-61    
gb|KGN43654.1|  hypothetical protein Csa_7G051340                       206   2e-58    
ref|XP_006293222.1|  hypothetical protein CARUB_v10019546mg             206   7e-56    
gb|KCW57198.1|  hypothetical protein EUGRSUZ_H00013                     196   9e-56    
emb|CBI23136.3|  unnamed protein product                                203   5e-55    
ref|XP_008353775.1|  PREDICTED: uncharacterized protein LOC103417361    194   6e-55    
ref|XP_007219046.1|  hypothetical protein PRUPE_ppa004668mg             202   1e-54    
ref|XP_010662973.1|  PREDICTED: O-acyltransferase WSD1                  202   1e-54    
ref|XP_007219258.1|  hypothetical protein PRUPE_ppa018127mg             201   5e-54    
ref|XP_004309135.1|  PREDICTED: O-acyltransferase WSD1-like             201   6e-54    
ref|XP_008233155.1|  PREDICTED: O-acyltransferase WSD1-like             201   6e-54    
gb|KGN43652.1|  hypothetical protein Csa_7G051320                       190   8e-54    
ref|XP_010503567.1|  PREDICTED: O-acyltransferase WSD1-like             200   9e-54    
ref|XP_010672319.1|  PREDICTED: O-acyltransferase WSD1-like             194   1e-53    
ref|XP_006404166.1|  hypothetical protein EUTSA_v10011067mg             199   2e-53    
ref|NP_001043877.1|  Os01g0681000                                       199   2e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008234742.1|  PREDICTED: O-acyltransferase WSD1-like             199   3e-53    
ref|XP_010515263.1|  PREDICTED: O-acyltransferase WSD1                  199   4e-53    
ref|XP_008227241.1|  PREDICTED: uncharacterized protein LOC103326781    194   7e-53    
ref|XP_002440221.1|  hypothetical protein SORBIDRAFT_09g027970          198   1e-52    Sorghum bicolor [broomcorn]
ref|XP_010426423.1|  PREDICTED: O-acyltransferase WSD1-like             197   1e-52    
ref|XP_008246217.1|  PREDICTED: uncharacterized protein LOC103344399    186   1e-52    
ref|XP_004961273.1|  PREDICTED: O-acyltransferase WSD1-like             198   1e-52    
ref|XP_010095758.1|  O-acyltransferase WSD1                             197   2e-52    
ref|XP_004979823.1|  PREDICTED: O-acyltransferase WSD1-like             196   2e-52    
ref|XP_010266526.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    196   3e-52    
ref|XP_009760691.1|  PREDICTED: O-acyltransferase WSD1-like             196   4e-52    
emb|CBH32551.1|  conserved hypothetical protein, expressed              196   4e-52    
ref|XP_010482729.1|  PREDICTED: O-acyltransferase WSD1-like             194   1e-51    
ref|XP_009630816.1|  PREDICTED: O-acyltransferase WSD1-like             194   1e-51    
dbj|BAJ93204.1|  predicted protein                                      194   1e-51    
ref|XP_010266525.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    194   1e-51    
ref|XP_002877655.1|  condensation domain-containing protein             194   2e-51    
ref|XP_002865972.1|  hypothetical protein ARALYDRAFT_918418             193   2e-51    
ref|XP_003569566.1|  PREDICTED: O-acyltransferase WSD1-like             193   3e-51    
dbj|BAJ97841.1|  predicted protein                                      193   4e-51    
ref|XP_010445768.1|  PREDICTED: O-acyltransferase WSD1-like             192   4e-51    
ref|XP_010035244.1|  PREDICTED: O-acyltransferase WSD1-like             193   4e-51    
ref|XP_006401711.1|  hypothetical protein EUTSA_v10013378mg             192   5e-51    
gb|AGT16887.1|  hypothetical protein SHCRBa_165_I15_F_280               193   6e-51    
ref|XP_010537088.1|  PREDICTED: O-acyltransferase WSD1 isoform X1       191   8e-51    
ref|XP_010519416.1|  PREDICTED: O-acyltransferase WSD1-like             191   1e-50    
gb|EAY98969.1|  hypothetical protein OsI_20927                          192   1e-50    Oryza sativa Indica Group [Indian rice]
ref|XP_004979822.1|  PREDICTED: O-acyltransferase WSD1-like             191   1e-50    
emb|CDY47071.1|  BnaA03g12270D                                          191   2e-50    
dbj|BAB09801.1|  unnamed protein product                                191   2e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007051549.1|  O-acyltransferase family protein, putative         191   2e-50    
gb|KDP24675.1|  hypothetical protein JCGZ_26453                         191   2e-50    
ref|NP_200151.2|  bifunctional wax ester synthase/diacylglycerol ...    190   2e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132482.1|  PREDICTED: O-acyltransferase WSD1-like             190   2e-50    
ref|XP_006282349.1|  hypothetical protein CARUB_v10028646mg             190   3e-50    
ref|XP_004228362.1|  PREDICTED: O-acyltransferase WSD1-like             191   3e-50    
ref|XP_011092557.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    189   3e-50    
ref|XP_010442900.1|  PREDICTED: O-acyltransferase WSD1-like             190   3e-50    
gb|KHG19380.1|  O-acyltransferase WSD1                                  189   6e-50    
ref|XP_011092556.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    188   8e-50    
dbj|BAC42871.1|  unknown protein                                        188   1e-49    Arabidopsis thaliana [mouse-ear cress]
gb|EMT14089.1|  hypothetical protein F775_13804                         189   1e-49    
ref|XP_009396534.1|  PREDICTED: O-acyltransferase WSD1-like             189   1e-49    
ref|XP_011088231.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    187   2e-49    
ref|XP_009395725.1|  PREDICTED: O-acyltransferase WSD1-like             187   6e-49    
emb|CDY54346.1|  BnaC03g14900D                                          186   1e-48    
gb|KCW78187.1|  hypothetical protein EUGRSUZ_D02376                     186   1e-48    
gb|KHG26801.1|  O-acyltransferase WSD1 -like protein                    186   1e-48    
ref|XP_009392540.1|  PREDICTED: O-acyltransferase WSD1-like             185   1e-48    
ref|XP_002517894.1|  conserved hypothetical protein                     176   1e-48    Ricinus communis
ref|XP_002992800.1|  hypothetical protein SELMODRAFT_269987             185   2e-48    
ref|XP_010550528.1|  PREDICTED: O-acyltransferase WSD1-like             185   2e-48    
ref|XP_008793153.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    186   2e-48    
ref|XP_008793154.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    186   2e-48    
gb|KDO38022.1|  hypothetical protein CISIN_1g043679mg                   174   2e-48    
ref|XP_009625686.1|  PREDICTED: O-acyltransferase WSD1-like             184   3e-48    
ref|XP_011024820.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    185   4e-48    
emb|CDX85687.1|  BnaA02g01260D                                          184   4e-48    
ref|XP_002263409.1|  PREDICTED: O-acyltransferase WSD1                  184   4e-48    Vitis vinifera
ref|XP_010537089.1|  PREDICTED: O-acyltransferase WSD1 isoform X2       183   5e-48    
ref|XP_006441074.1|  hypothetical protein CICLE_v10019854mg             184   5e-48    
ref|XP_010661940.1|  PREDICTED: O-acyltransferase WSD1-like             184   6e-48    
ref|XP_010054862.1|  PREDICTED: O-acyltransferase WSD1-like             184   8e-48    
gb|EAY75973.1|  hypothetical protein OsI_03895                          184   8e-48    Oryza sativa Indica Group [Indian rice]
ref|XP_007042465.1|  O-acyltransferase family protein, putative i...    183   9e-48    
ref|XP_011024817.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    184   9e-48    
ref|XP_006345292.1|  PREDICTED: O-acyltransferase WSD1-like             186   1e-47    
emb|CDP08677.1|  unnamed protein product                                183   1e-47    
emb|CBI40540.3|  unnamed protein product                                184   1e-47    
emb|CDM83947.1|  unnamed protein product                                183   1e-47    
ref|XP_011075993.1|  PREDICTED: O-acyltransferase WSD1-like             182   2e-47    
ref|XP_002318416.2|  hypothetical protein POPTR_0012s02150g             183   2e-47    Populus trichocarpa [western balsam poplar]
gb|KFK34209.1|  hypothetical protein AALP_AA5G115000                    182   2e-47    
ref|XP_009151884.1|  PREDICTED: O-acyltransferase WSD1-like             182   2e-47    
ref|NP_001044374.1|  Os01g0770000                                       182   2e-47    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010426433.1|  PREDICTED: O-acyltransferase WSD1-like             182   3e-47    
dbj|BAK02325.1|  predicted protein                                      183   4e-47    
ref|XP_009149757.1|  PREDICTED: O-acyltransferase WSD1-like             182   4e-47    
emb|CDY08116.1|  BnaA06g16100D                                          182   5e-47    
ref|XP_009766774.1|  PREDICTED: O-acyltransferase WSD1-like             181   5e-47    
gb|KHG19161.1|  O-acyltransferase WSD1 -like protein                    181   6e-47    
gb|KDP25010.1|  hypothetical protein JCGZ_23993                         180   6e-47    
gb|EAY75974.1|  hypothetical protein OsI_03896                          181   7e-47    
emb|CDX91162.1|  BnaC02g04350D                                          181   8e-47    
gb|KDP28488.1|  hypothetical protein JCGZ_14259                         181   8e-47    
ref|XP_006390701.1|  hypothetical protein EUTSA_v10018486mg             180   1e-46    
ref|NP_190488.1|  O-acyltransferase (WSD1-like) family protein          181   1e-46    
emb|CBI40547.3|  unnamed protein product                                185   2e-46    
ref|XP_009601405.1|  PREDICTED: O-acyltransferase WSD1-like             180   2e-46    
ref|XP_009127172.1|  PREDICTED: O-acyltransferase WSD1-like             179   3e-46    
ref|XP_010445765.1|  PREDICTED: O-acyltransferase WSD1-like             177   3e-46    
ref|XP_006292398.1|  hypothetical protein CARUB_v10018611mg             179   3e-46    
ref|XP_002263252.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    179   3e-46    
ref|NP_568275.1|  O-acyltransferase (WSD1-like) family protein          178   4e-46    
emb|CBH32550.1|  conserved hypothetical protein                         178   6e-46    
ref|XP_006404165.1|  hypothetical protein EUTSA_v10010299mg             179   6e-46    
ref|XP_006339705.1|  PREDICTED: O-acyltransferase WSD1-like             178   6e-46    
ref|XP_002873570.1|  hypothetical protein ARALYDRAFT_488089             178   7e-46    
gb|EYU42683.1|  hypothetical protein MIMGU_mgv1a006065mg                177   7e-46    
emb|CDX96219.1|  BnaC02g14320D                                          178   8e-46    
ref|XP_003607487.1|  O-acyltransferase WSD1                             169   8e-46    
ref|XP_010270333.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    177   1e-45    
ref|XP_010924517.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    177   1e-45    
ref|XP_002877657.1|  hypothetical protein ARALYDRAFT_485279             177   2e-45    
gb|KHN38854.1|  O-acyltransferase WSD1                                  177   2e-45    
gb|EYU25223.1|  hypothetical protein MIMGU_mgv1a005236mg                177   2e-45    
ref|NP_190490.1|  O-acyltransferase (WSD1-like) family protein          177   2e-45    
ref|XP_009125863.1|  PREDICTED: O-acyltransferase WSD1-like             177   2e-45    
ref|XP_010231047.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    177   2e-45    
ref|XP_006339804.1|  PREDICTED: O-acyltransferase WSD1-like             176   2e-45    
emb|CDY05910.1|  BnaC08g20870D                                          177   3e-45    
ref|XP_010028434.1|  PREDICTED: O-acyltransferase WSD1-like             176   3e-45    
ref|XP_010428063.1|  PREDICTED: O-acyltransferase WSD1-like             175   5e-45    
ref|XP_009357299.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    175   6e-45    
ref|XP_002523348.1|  conserved hypothetical protein                     176   7e-45    
ref|XP_006587545.1|  PREDICTED: O-acyltransferase WSD1                  175   7e-45    
ref|XP_011088232.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    173   8e-45    
emb|CDX68518.1|  BnaC01g25960D                                          175   8e-45    
ref|NP_190489.1|  O-acyltransferase (WSD1-like) family protein          175   1e-44    
ref|XP_010671458.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    175   1e-44    
gb|ABF59162.1|  hypothetical protein At3g49200                          175   1e-44    
ref|XP_006390705.1|  hypothetical protein EUTSA_v10018487mg             174   1e-44    
ref|XP_004235106.1|  PREDICTED: O-acyltransferase WSD1-like             174   1e-44    
ref|XP_004230765.1|  PREDICTED: O-acyltransferase WSD1-like             173   2e-44    
ref|XP_010671460.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    173   2e-44    
ref|XP_004136970.1|  PREDICTED: O-acyltransferase WSD1-like             173   2e-44    
ref|XP_002877656.1|  hypothetical protein ARALYDRAFT_906195             174   2e-44    
ref|XP_010030633.1|  PREDICTED: O-acyltransferase WSD1-like             173   2e-44    
dbj|BAJ33896.1|  unnamed protein product                                173   2e-44    
ref|XP_010507342.1|  PREDICTED: O-acyltransferase WSD1-like             174   2e-44    
ref|XP_008376729.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    174   2e-44    
ref|NP_001140997.1|  uncharacterized protein LOC100273076               171   3e-44    
ref|XP_010453795.1|  PREDICTED: O-acyltransferase WSD1-like             173   3e-44    
ref|XP_010474267.1|  PREDICTED: O-acyltransferase WSD1-like             173   3e-44    
ref|XP_002987493.1|  hypothetical protein SELMODRAFT_235299             172   4e-44    
gb|KHG08035.1|  O-acyltransferase WSD1 -like protein                    173   4e-44    
ref|XP_010048502.1|  PREDICTED: O-acyltransferase WSD1-like             172   4e-44    
ref|XP_010427904.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    172   5e-44    
emb|CBI40536.3|  unnamed protein product                                172   5e-44    
ref|XP_009357297.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    172   6e-44    
gb|KFK34210.1|  hypothetical protein AALP_AA5G115100                    173   6e-44    
gb|EAZ13098.1|  hypothetical protein OsJ_03018                          171   7e-44    
ref|XP_008675193.1|  PREDICTED: O-acyltransferase WSD1-like             172   9e-44    
ref|XP_009378764.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    172   1e-43    
ref|XP_010494561.1|  PREDICTED: O-acyltransferase WSD1-like             172   1e-43    
ref|XP_009415744.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    172   1e-43    
gb|EMT13037.1|  hypothetical protein F775_19306                         171   2e-43    
ref|XP_006287621.1|  hypothetical protein CARUB_v10000833mg             171   2e-43    
ref|XP_007039033.1|  O-acyltransferase (WSD1-like) family protein...    172   2e-43    
ref|XP_010503570.1|  PREDICTED: O-acyltransferase WSD1-like             171   2e-43    
ref|XP_008376728.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    171   2e-43    
ref|XP_009378763.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    171   3e-43    
gb|EMT09727.1|  hypothetical protein F775_13549                         171   3e-43    
ref|XP_010492003.1|  PREDICTED: O-acyltransferase WSD1-like             170   4e-43    
ref|XP_004231223.1|  PREDICTED: O-acyltransferase WSD1-like             171   4e-43    
ref|XP_010520974.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    171   4e-43    
ref|XP_008376727.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    171   4e-43    
gb|KDP25009.1|  hypothetical protein JCGZ_23992                         170   4e-43    
emb|CDX78486.1|  BnaA03g03980D                                          169   5e-43    
ref|XP_009131282.1|  PREDICTED: O-acyltransferase WSD1-like             169   6e-43    
ref|XP_006444839.1|  hypothetical protein CICLE_v10019739mg             170   6e-43    
ref|XP_010666700.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    170   7e-43    
ref|XP_004969548.1|  PREDICTED: O-acyltransferase WSD1-like             170   7e-43    
ref|XP_006852653.1|  hypothetical protein AMTR_s00021p00243800          169   8e-43    
ref|XP_006290854.1|  hypothetical protein CARUB_v10016964mg             170   9e-43    
ref|XP_006302205.1|  hypothetical protein CARUB_v10020217mg             169   1e-42    
ref|XP_009378762.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    169   1e-42    
ref|XP_003588522.1|  O-acyltransferase WSD1                             169   1e-42    
ref|XP_002263137.1|  PREDICTED: O-acyltransferase WSD1-like             169   1e-42    
ref|XP_009151870.1|  PREDICTED: O-acyltransferase WSD1                  169   1e-42    
ref|XP_002870738.1|  hypothetical protein ARALYDRAFT_916278             168   1e-42    
ref|XP_010095756.1|  O-acyltransferase WSD1                             171   1e-42    
emb|CAN71951.1|  hypothetical protein VITISV_024308                     169   1e-42    
ref|XP_010492001.1|  PREDICTED: O-acyltransferase WSD1-like             168   1e-42    
ref|XP_011024821.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    169   2e-42    
ref|XP_002517896.1|  hypothetical protein RCOM_1173910                  161   2e-42    
ref|XP_007204115.1|  hypothetical protein PRUPE_ppb018294mg             161   2e-42    
ref|XP_010426427.1|  PREDICTED: O-acyltransferase WSD1-like             169   2e-42    
ref|XP_010515262.1|  PREDICTED: O-acyltransferase WSD1                  169   2e-42    
emb|CDX70475.1|  BnaC03g05590D                                          168   2e-42    
gb|AAZ08051.1|  wax synthase                                            169   2e-42    
ref|XP_004970103.1|  PREDICTED: O-acyltransferase WSD1-like             168   2e-42    
ref|XP_010415938.1|  PREDICTED: O-acyltransferase WSD1-like             167   2e-42    
ref|XP_010441804.1|  PREDICTED: O-acyltransferase WSD1-like             167   4e-42    
ref|XP_009760114.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    167   4e-42    
ref|XP_010105248.1|  O-acyltransferase WSD1                             166   4e-42    
ref|XP_010492524.1|  PREDICTED: O-acyltransferase WSD1-like             167   4e-42    
ref|XP_009588191.1|  PREDICTED: O-acyltransferase WSD1-like             167   4e-42    
ref|XP_010453319.1|  PREDICTED: O-acyltransferase WSD1-like             167   5e-42    
ref|XP_010231048.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    166   5e-42    
ref|XP_010471231.1|  PREDICTED: O-acyltransferase WSD1-like             167   5e-42    
ref|XP_010428065.1|  PREDICTED: O-acyltransferase WSD1-like             166   6e-42    
ref|NP_197139.1|  O-acyltransferase (WSD1-like) family protein          167   6e-42    
ref|XP_010420325.1|  PREDICTED: O-acyltransferase WSD1-like             166   8e-42    
ref|NP_001276179.1|  O-acyltransferase WSD1-like                        166   8e-42    
ref|XP_010428073.1|  PREDICTED: O-acyltransferase WSD1-like             166   1e-41    
ref|XP_006287603.1|  hypothetical protein CARUB_v10000814mg             166   1e-41    
ref|XP_010492521.1|  PREDICTED: O-acyltransferase WSD1-like             164   1e-41    
emb|CAN72806.1|  hypothetical protein VITISV_035309                     165   1e-41    
ref|XP_006346395.1|  PREDICTED: O-acyltransferase WSD1-like             165   1e-41    
ref|XP_006390703.1|  hypothetical protein EUTSA_v10018482mg             166   1e-41    
gb|EPS64282.1|  hypothetical protein M569_10500                         165   2e-41    
ref|XP_009350397.1|  PREDICTED: O-acyltransferase WSD1-like             167   2e-41    
ref|NP_177356.1|  O-acyltransferase (WSD1-like) family protein          165   2e-41    
ref|XP_010025797.1|  PREDICTED: uncharacterized protein LOC104416054    157   2e-41    
ref|XP_010520978.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    165   2e-41    
ref|XP_009598600.1|  PREDICTED: O-acyltransferase WSD1-like             166   2e-41    
ref|XP_002871716.1|  hypothetical protein ARALYDRAFT_488487             165   2e-41    
dbj|BAJ93623.1|  predicted protein                                      165   2e-41    
ref|XP_009777803.1|  PREDICTED: O-acyltransferase WSD1-like             166   2e-41    
gb|EYU42685.1|  hypothetical protein MIMGU_mgv1a006752mg                164   2e-41    
ref|XP_009760466.1|  PREDICTED: LOW QUALITY PROTEIN: O-acyltransf...    165   3e-41    
gb|EYU33179.1|  hypothetical protein MIMGU_mgv1a026751mg                165   3e-41    
ref|XP_010503571.1|  PREDICTED: O-acyltransferase WSD1-like             165   3e-41    
emb|CDY14418.1|  BnaC03g21770D                                          164   4e-41    
ref|XP_010492529.1|  PREDICTED: O-acyltransferase WSD1-like             164   5e-41    
ref|XP_008373840.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    164   6e-41    
ref|XP_009140411.1|  PREDICTED: O-acyltransferase WSD1-like             163   7e-41    
ref|XP_010030645.1|  PREDICTED: O-acyltransferase WSD1-like             163   8e-41    
ref|NP_197641.1|  O-acyltransferase (WSD1-like) family protein          163   8e-41    
ref|XP_002458560.1|  hypothetical protein SORBIDRAFT_03g035790          164   9e-41    
ref|XP_008454962.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    163   1e-40    
ref|XP_007199357.1|  hypothetical protein PRUPE_ppa025347mg             163   1e-40    
dbj|BAJ85619.1|  predicted protein                                      163   1e-40    
ref|XP_009150159.1|  PREDICTED: O-acyltransferase WSD1-like             163   1e-40    
gb|EMS49019.1|  O-acyltransferase WSD1                                  163   1e-40    
ref|XP_010107910.1|  O-acyltransferase WSD1                             162   2e-40    
emb|CDX78487.1|  BnaA03g03990D                                          162   2e-40    
gb|KDP45597.1|  hypothetical protein JCGZ_17204                         162   2e-40    
ref|XP_010041135.1|  PREDICTED: O-acyltransferase WSD1-like             162   2e-40    
ref|XP_002516707.1|  conserved hypothetical protein                     161   2e-40    
ref|XP_006399759.1|  hypothetical protein EUTSA_v10013397mg             162   3e-40    
dbj|BAJ84892.1|  predicted protein                                      162   3e-40    
ref|XP_006401713.1|  hypothetical protein EUTSA_v10015825mg             162   3e-40    
emb|CDM84376.1|  unnamed protein product                                161   3e-40    
ref|XP_010315460.1|  PREDICTED: LOW QUALITY PROTEIN: O-acyltransf...    162   5e-40    
ref|XP_006487043.1|  PREDICTED: O-acyltransferase WSD1-like             160   5e-40    
dbj|BAK05274.1|  predicted protein                                      162   5e-40    
ref|XP_010647731.1|  PREDICTED: O-acyltransferase WSD1-like             161   5e-40    
ref|XP_010555728.1|  PREDICTED: O-acyltransferase WSD1-like             161   5e-40    
ref|XP_011000126.1|  PREDICTED: O-acyltransferase WSD1-like             161   5e-40    
gb|EMT13303.1|  hypothetical protein F775_11197                         161   6e-40    
ref|XP_008236478.1|  PREDICTED: O-acyltransferase WSD1-like             160   8e-40    
ref|XP_008236495.1|  PREDICTED: O-acyltransferase WSD1-like             160   8e-40    
ref|XP_007201626.1|  hypothetical protein PRUPE_ppa021430mg             160   1e-39    
ref|XP_010415939.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    160   1e-39    
emb|CDM80272.1|  unnamed protein product                                160   1e-39    
ref|XP_006478431.1|  PREDICTED: O-acyltransferase WSD1-like             160   2e-39    
ref|XP_009627720.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    159   2e-39    
dbj|BAK06983.1|  predicted protein                                      157   2e-39    
gb|EYU42684.1|  hypothetical protein MIMGU_mgv1a006065mg                158   3e-39    
ref|XP_010520977.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    159   3e-39    
ref|XP_006441689.1|  hypothetical protein CICLE_v10019877mg             159   3e-39    
emb|CDY60222.1|  BnaA06g39110D                                          159   3e-39    
emb|CDX86991.1|  BnaC03g52610D                                          159   3e-39    
ref|XP_004290593.1|  PREDICTED: O-acyltransferase WSD1-like             158   4e-39    
ref|XP_010028428.1|  PREDICTED: O-acyltransferase WSD1-like             158   5e-39    
ref|XP_004984321.1|  PREDICTED: O-acyltransferase WSD1-like             159   5e-39    
emb|CDX83070.1|  BnaA01g20700D                                          158   6e-39    
gb|KDO38719.1|  hypothetical protein CISIN_1g041931mg                   158   6e-39    
ref|XP_009760121.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    157   7e-39    
ref|XP_009627721.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    157   8e-39    
ref|XP_009127897.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    157   8e-39    
gb|KEH39732.1|  O-acyltransferase (WSD1-like) family protein            157   1e-38    
ref|NP_001189709.1|  O-acyltransferase (WSD1-like) family protein       157   1e-38    
emb|CDX68517.1|  BnaC01g25950D                                          158   1e-38    
ref|XP_010661938.1|  PREDICTED: O-acyltransferase WSD1-like             157   1e-38    
ref|XP_010537087.1|  PREDICTED: O-acyltransferase WSD1-like             157   2e-38    
ref|XP_009133034.1|  PREDICTED: O-acyltransferase WSD1-like             157   2e-38    
ref|XP_009127901.1|  PREDICTED: O-acyltransferase WSD1-like             156   2e-38    
emb|CDY03658.1|  BnaA02g15790D                                          156   2e-38    
gb|EMT13687.1|  hypothetical protein F775_52291                         156   3e-38    
ref|XP_010661937.1|  PREDICTED: O-acyltransferase WSD1 isoform X2       156   3e-38    
gb|KEH39731.1|  O-acyltransferase (WSD1-like) family protein            155   4e-38    
ref|XP_002278404.1|  PREDICTED: O-acyltransferase WSD1 isoform X1       156   4e-38    
ref|XP_010428071.1|  PREDICTED: O-acyltransferase WSD1-like             155   4e-38    
ref|XP_006296409.1|  hypothetical protein CARUB_v10025587mg             155   5e-38    
ref|NP_850307.2|  O-acyltransferase (WSD1-like) family protein          155   5e-38    
ref|XP_009133323.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    155   5e-38    
emb|CDY15943.1|  BnaA04g11680D                                          155   5e-38    
ref|XP_010450747.1|  PREDICTED: O-acyltransferase WSD1-like             154   7e-38    
ref|XP_010666751.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    155   7e-38    
ref|NP_001185377.1|  O-acyltransferase (WSD1-like) family protein       155   7e-38    
ref|XP_003571567.2|  PREDICTED: O-acyltransferase WSD1-like             155   8e-38    
emb|CDM80145.1|  unnamed protein product                                155   8e-38    
ref|XP_009127896.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    154   1e-37    
ref|XP_011008179.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    154   1e-37    
ref|XP_009133324.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    154   1e-37    
ref|XP_010666825.1|  PREDICTED: O-acyltransferase WSD1-like             154   1e-37    
ref|XP_002310402.1|  hypothetical protein POPTR_0007s00970g             148   1e-37    
gb|EEE55448.1|  hypothetical protein OsJ_03604                          153   2e-37    
ref|XP_010040257.1|  PREDICTED: O-acyltransferase WSD1-like             152   2e-37    
ref|XP_010427905.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    153   2e-37    
ref|XP_010520975.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    154   2e-37    
ref|XP_010232394.1|  PREDICTED: O-acyltransferase WSD1-like             153   2e-37    
ref|XP_006401714.1|  hypothetical protein EUTSA_v10015406mg             153   2e-37    
gb|EAZ13682.1|  hypothetical protein OsJ_03605                          152   3e-37    
emb|CDX87730.1|  BnaC02g32190D                                          154   4e-37    



>ref|XP_009782424.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Nicotiana 
sylvestris]
Length=479

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/477 (64%), Positives = 378/477 (79%), Gaps = 11/477 (2%)
 Frame = +1

Query  10    MEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSI  189
             +E    E ASPS+Q+LNSS LSL ++ VLES+IPI+  +SL ++LLKDVFVPINPRFSSI
Sbjct  5     LEEEIFEPASPSSQYLNSSNLSLCVIAVLESKIPIEYEESLPLNLLKDVFVPINPRFSSI  64

Query  190   MVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLW  369
             MV+ G  G +KWKRVEVN+ +H+K P +P+ KP++FY++C S+Y+S +AME FP N+PLW
Sbjct  65    MVT-GKKGTRKWKRVEVNYEDHIKTPIFPSEKPLDFYNECFSNYISNLAMEQFPQNQPLW  123

Query  370   EIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAP  549
             EIH+FKYPT +AAG+VIFKLHHSLGDGYSLMGA+LSCLQR DNP+LPLTFPSRQR+T + 
Sbjct  124   EIHIFKYPTNDAAGSVIFKLHHSLGDGYSLMGALLSCLQRVDNPSLPLTFPSRQRTTLSS  183

Query  550   RSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
             + KA +      K +PRF  G  NTVYDFG S+ KSTLVEDDRT + SGD+GVEFRPI  
Sbjct  184   KDKAFS----VLKVVPRFFKGIVNTVYDFGESILKSTLVEDDRTAIHSGDEGVEFRPIVV  239

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAI  909
             TT +FSLD +KQIK  L VTINDV+TGI+ YGTRLYM++ ++ES   +CTALVLFNTRA+
Sbjct  240   TTKTFSLDCLKQIKASLNVTINDVITGIVEYGTRLYMQEVKQESCNGKCTALVLFNTRAL  299

Query  910   GGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASD-----PLRFVRKAHRIIKRK  1074
              GGYKSV +MIKPN++MPWGN FTFLPVSLP LT     D     PL FV+KAHR+I RK
Sbjct  300   -GGYKSVNDMIKPNSDMPWGNHFTFLPVSLPKLTNLANRDQSSINPLAFVQKAHRMIDRK  358

Query  1075  RNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGI  1254
             RNSASV+LT  LL  L K RG E TAR+IHGT KN+SM ++N+IGP+E M+LANHP KG+
Sbjct  359   RNSASVWLTSKLLDFLRKLRGPEATARFIHGTLKNTSMALTNLIGPVEEMALANHPVKGL  418

Query  1255  YFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
             YFI+ G PQS  VT+VSYV  LRIA+ VEK FID  K K C+ +AF+ I++AA+ SS
Sbjct  419   YFIVTGAPQSCSVTIVSYVDKLRIAMVVEKGFIDPNKLKSCIDYAFDTIFKAAVKSS  475



>ref|XP_009624957.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=479

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/477 (64%), Positives = 374/477 (78%), Gaps = 11/477 (2%)
 Frame = +1

Query  10    MEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSI  189
             +E    E ASPS+Q+LNSS LSL ++ VLES+IPI+  +SL ++LLKDVFVPINPRFSSI
Sbjct  5     LEEEAFEPASPSSQYLNSSNLSLCVIAVLESKIPIEYEESLPLNLLKDVFVPINPRFSSI  64

Query  190   MVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLW  369
             MV+ G  G +KWKRVEVN+ +H+K P +P+ KP++FYD+C S+Y+S +AME FP NRP W
Sbjct  65    MVT-GKKGTRKWKRVEVNYQDHIKTPIFPSEKPLDFYDECFSNYISNLAMEQFPQNRPFW  123

Query  370   EIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAP  549
             EIH+FKYPT +AAG++IFKLHHSLGDGYSLMGA+LSCLQR DNP+LPLTFPSRQR+T + 
Sbjct  124   EIHIFKYPTNDAAGSIIFKLHHSLGDGYSLMGALLSCLQRVDNPSLPLTFPSRQRTTLSS  183

Query  550   RSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
             + KA +      K +PRF  G  NTVYDFG S+ K T VEDDRT +RSGD+GVEFRPI  
Sbjct  184   KDKAFS----VLKVVPRFFKGIVNTVYDFGESILKGTFVEDDRTAIRSGDEGVEFRPIVV  239

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAI  909
             TT +FSLD +KQIK  L VTINDV+TGI+ YGTRLYM+   +ES   +CTALVLFNTRA+
Sbjct  240   TTKTFSLDSLKQIKASLNVTINDVITGIVQYGTRLYMQGVNQESCNGKCTALVLFNTRAL  299

Query  910   GGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASD-----PLRFVRKAHRIIKRK  1074
              GGYKSV +MIKPN++MPWGN F+FLPVSLP LT     D     PL FV+KAHR+I RK
Sbjct  300   -GGYKSVNDMIKPNSDMPWGNHFSFLPVSLPKLTNLAKRDHSSINPLAFVQKAHRMIDRK  358

Query  1075  RNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGI  1254
             RNSASV+LT   L  L K RG E TAR+IHG+ KN+SMG++N+IGP+E M+LANHP KG+
Sbjct  359   RNSASVWLTSKFLDTLRKLRGPEATARFIHGSLKNTSMGLTNLIGPVEEMALANHPVKGL  418

Query  1255  YFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
             YF++ G PQS  VTMVSYV  LRIA+ VEK FID  K K C+ +AF+ I++AA+ SS
Sbjct  419   YFMVTGAPQSCSVTMVSYVDKLRIAMVVEKGFIDPNKLKSCIDYAFDTIFKAAVKSS  475



>ref|XP_009759664.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana sylvestris]
Length=474

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/470 (65%), Positives = 372/470 (79%), Gaps = 6/470 (1%)
 Frame = +1

Query  7     MMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSS  186
             M E  +E  ASP +Q+LNSS LSL+++ VLES+IPI+  +S V SLLKDVF+PINPRFSS
Sbjct  1     MEEIYWERPASPGSQYLNSSNLSLSVIVVLESKIPIEIENSKVFSLLKDVFLPINPRFSS  60

Query  187   IMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPL  366
             IMV+E   G +KWK+VEVN  +HVK P +PA + + FYD+  S+YLSK+AM+ F  N+P 
Sbjct  61    IMVTEK-KGARKWKQVEVNIEDHVKTPVFPAEQSLIFYDEYFSNYLSKLAMDPFSQNKPF  119

Query  367   WEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAA  546
             WEIHL KY T+NAAGN+IFKLHHSLGDGYSLMGA+LSCLQR DNP LPLTFPSRQR+  +
Sbjct  120   WEIHLLKYSTSNAAGNLIFKLHHSLGDGYSLMGALLSCLQRVDNPLLPLTFPSRQRTILS  179

Query  547   PRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIA  726
              ++KA N +    K +P       NTV DFG SV KSTL+EDDRTP+RSGDDGVEFRPI 
Sbjct  180   TKNKAINTV----KCVPNVFMKLVNTVQDFGLSVLKSTLIEDDRTPIRSGDDGVEFRPIE  235

Query  727   TTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRA  906
               T +FSLD IKQIK KLKVTINDV+TG++IYGTRLYM+   +E+S  +CTALVLFNTRA
Sbjct  236   IATTTFSLDSIKQIKAKLKVTINDVITGVVIYGTRLYMQGINQETSNGKCTALVLFNTRA  295

Query  907   IGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSA  1086
             +GG YKSV+EMIKPN+EMPWGN FTFLPVSLP LT  ++ +PL F+ KA RIIKR+RNSA
Sbjct  296   VGG-YKSVSEMIKPNSEMPWGNHFTFLPVSLPKLTSTDSLNPLGFIEKARRIIKRQRNSA  354

Query  1087  SVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFII  1266
             SV+LTG LL+ L K  G E TA+YIH T K++SMGI+N+IGP+E M+LANHP KG+YF +
Sbjct  355   SVFLTGRLLEILRKVEGPETTAKYIHATLKHTSMGITNLIGPLEEMALANHPIKGLYFAV  414

Query  1267  AGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             AG PQSL VTMVSYV  LR+A+ VEK FID  K K C+ ++F+ I+ AA+
Sbjct  415   AGAPQSLSVTMVSYVDKLRVAIVVEKGFIDPNKLKSCIEYSFDTIFNAAV  464



>ref|XP_006367474.1| PREDICTED: O-acyltransferase WSD1-like [Solanum tuberosum]
Length=476

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/472 (65%), Positives = 372/472 (79%), Gaps = 4/472 (1%)
 Frame = +1

Query  10    MEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSI  189
             +E    E ASPSAQ+LNSS LSL+++ VLES+IPI+  DSL I+LLKDVFVPINPRFSSI
Sbjct  5     LEEEIFEPASPSAQYLNSSNLSLSVIAVLESKIPIEYEDSLPINLLKDVFVPINPRFSSI  64

Query  190   MVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLW  369
             MV+      K  KRVEVN+ +H+K P +P  KPIEFYD+C S Y+S +AME FP NRPLW
Sbjct  65    MVTGKKGTKKW-KRVEVNYQDHIKTPIFPTQKPIEFYDECFSTYISNLAMEKFPQNRPLW  123

Query  370   EIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAP  549
             EIHLFKYPT++AAGN+IFKLHHSLGDGYSLMGA+LSCLQR DNP+LPLTFPSRQ+S    
Sbjct  124   EIHLFKYPTSDAAGNIIFKLHHSLGDGYSLMGALLSCLQRVDNPSLPLTFPSRQKSNFNN  183

Query  550   RSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
              +K    IS F K +PRF  G  NT+YDFGWS  KSTL+EDDRT + SG DGVEFR    
Sbjct  184   NNKG--YISNF-KIVPRFFKGIVNTLYDFGWSTLKSTLIEDDRTAIHSGVDGVEFRSPVL  240

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAI  909
              T +F LD +KQIK  L VTINDV+TGI+IYGTRLYM++  +E+   +C+ALVLFNTRA+
Sbjct  241   VTNTFLLDSLKQIKTNLNVTINDVITGIVIYGTRLYMEEVNKETCNGKCSALVLFNTRAL  300

Query  910   GGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSAS  1089
             GG YKSV++MI+PN++MPWGN FTFLP+SLP LT   +++PL FV+KAHRII RKRNSAS
Sbjct  301   GGSYKSVSDMIRPNSDMPWGNHFTFLPISLPKLTNDKSNNPLYFVQKAHRIIDRKRNSAS  360

Query  1090  VYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIA  1269
             V+LT  LL  L K RG E TAR+IHGT KN+SM ++NMIGP+E M+LANHP KG+YF++ 
Sbjct  361   VWLTSKLLDLLRKLRGPEATARFIHGTLKNTSMALTNMIGPVEEMALANHPVKGLYFVVT  420

Query  1270  GIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
             G PQS  VT+VSYV  LRIA+ VEKDFID  K K C+ +A+E I++AA+ SS
Sbjct  421   GAPQSCSVTIVSYVDKLRIAIVVEKDFIDPNKLKYCIENAYESIFKAAINSS  472



>ref|XP_004243360.1| PREDICTED: O-acyltransferase WSD1 [Solanum lycopersicum]
Length=471

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/472 (63%), Positives = 373/472 (79%), Gaps = 5/472 (1%)
 Frame = +1

Query  10    MEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSI  189
             ME    E ASPS+Q+LNSS LSL+++ VLES++PI+  DSL I+LLKDVFVPINPRFSSI
Sbjct  1     MEEEIFEPASPSSQYLNSSNLSLSVIAVLESKVPIEYEDSLPINLLKDVFVPINPRFSSI  60

Query  190   MVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLW  369
             MV+      K  KRVEVN+ +H+K P +P  KPIEFYD+C S Y+S +A E F  NRPLW
Sbjct  61    MVTGKKGTKKW-KRVEVNYQDHIKTPIFPTQKPIEFYDECFSTYISNLATEKFSQNRPLW  119

Query  370   EIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAP  549
             EIH+FKYPT++AAGN++FKLHHSLGDGYSLMGA+LSCLQR DNP+LPLTFPSRQ+S    
Sbjct  120   EIHVFKYPTSDAAGNIVFKLHHSLGDGYSLMGALLSCLQRVDNPSLPLTFPSRQKSNLNN  179

Query  550   RSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
              +KA   I+ F K +PRF  G  NT+YDFGWS  KSTL+EDDRT + SGDDGVEFR    
Sbjct  180   SNKAKGYINNF-KIVPRFFKGIVNTLYDFGWSTLKSTLIEDDRTAIHSGDDGVEFRSPVL  238

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAI  909
              T +FSLD++KQIK  L VTIN    GI+IYGTRLYM++  +E+   +C+ALVLFNTRA+
Sbjct  239   VTKTFSLDRLKQIKANLNVTIN---AGIVIYGTRLYMEEVNKETCNGKCSALVLFNTRAL  295

Query  910   GGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSAS  1089
             GG YKSV++MI+PN++MPWGN FTFLP+SLP LT   +++PL F++KAHRII+RKRNSAS
Sbjct  296   GGSYKSVSDMIRPNSDMPWGNHFTFLPISLPKLTNNKSNNPLYFIQKAHRIIERKRNSAS  355

Query  1090  VYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIA  1269
             ++LTG LL  L K RG+E TAR+IHGT +N+SM ++NMIGP+E M+LANHP KG+YF++ 
Sbjct  356   IWLTGKLLDLLRKLRGTEATARFIHGTLRNTSMALTNMIGPVEEMALANHPVKGLYFVVT  415

Query  1270  GIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
             G PQS  VT+VSYV  LRIA+ VEKDFID  K K C+ +A+E I++AA+ SS
Sbjct  416   GAPQSCSVTIVSYVDKLRIAIVVEKDFIDPNKLKSCIEYAYESIFKAAINSS  467



>ref|XP_011100361.1| PREDICTED: O-acyltransferase WSD1-like [Sesamum indicum]
Length=472

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/465 (63%), Positives = 359/465 (77%), Gaps = 12/465 (3%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPSAQ+L SSVLSLTILGVLESE PI   DS+ I LLKDVF+PINPRFSSIMV+   
Sbjct  14    EPMSPSAQYLKSSVLSLTILGVLESEDPID--DSMTIPLLKDVFLPINPRFSSIMVTGKK  71

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
                K  K+VEVN  EHV +P +P+G   ++YD+C +DYL+K+ ME  P NRPLWEIH+ K
Sbjct  72    GVKKW-KKVEVNLQEHVNIPTFPSGMSTDYYDECFTDYLTKLGMEQLPQNRPLWEIHILK  130

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT NAAGN+IFKLHHSLGDGYSLMGA+LSCLQR DNP +PLTFPSRQ       +    
Sbjct  131   YPTKNAAGNLIFKLHHSLGDGYSLMGALLSCLQRLDNPLMPLTFPSRQSKDGGNHT----  186

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                     +PRF  G  +T  DFGWS+ KS+L++DD++P+RSG+DGVEFRPI TTT +FS
Sbjct  187   ----LLGRVPRFFTGLLHTACDFGWSLLKSSLIKDDKSPIRSGEDGVEFRPIVTTTTAFS  242

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             +DQI++IK +LKVT+NDV+TGIIIYGTRLYM++  EES KA  TALVL NTRAIGG YKS
Sbjct  243   IDQIREIKSRLKVTVNDVITGIIIYGTRLYMQKRSEESGKANSTALVLLNTRAIGG-YKS  301

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             V EM KP++EMPWGN+F FL V +P L  A   +PL+FV+ A R+IKR+RNSA+VYLTG 
Sbjct  302   VDEMTKPDSEMPWGNRFAFLQVPVPKLGAAEQENPLKFVKTARRMIKRQRNSATVYLTGQ  361

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL  + K RG E TARYIHGT KN+SM ISN+IGP+E+M+LAN P KG+YF++AG PQSL
Sbjct  362   LLNVVRKIRGPETTARYIHGTLKNTSMAISNLIGPVEQMALANQPIKGLYFVVAGAPQSL  421

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGS  1422
              VT++SYV  LRIA+++EK FID   FK C+ +AFE I +AAL S
Sbjct  422   SVTLISYVRKLRIAMTMEKGFIDPNTFKSCIEYAFEAISKAALAS  466



>ref|XP_002517893.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44411.1| conserved hypothetical protein [Ricinus communis]
Length=483

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/464 (61%), Positives = 362/464 (78%), Gaps = 8/464 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+ Q+ NSSVLS+ +LGVLESEIPI   DS  ++LL+DVF+PINPRFSSIMV++  
Sbjct  22    EPVSPTGQYFNSSVLSICVLGVLESEIPID--DSPTMTLLQDVFLPINPRFSSIMVTDK-  78

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NGGK+WKRV V    HV VPN+P G   + YD   +DY+S++A+E  P N+PLWEIH+ K
Sbjct  79    NGGKQWKRVAVKLKNHVNVPNFPTGLSPKSYDKYFNDYISRVALEPLPQNQPLWEIHVIK  138

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAAGN+IFKLHH+LGDG+SLMGA+LSCLQR DNP+LPLTFPS Q   + P   + +
Sbjct  139   YPTSNAAGNLIFKLHHALGDGFSLMGALLSCLQRVDNPSLPLTFPSLQLP-SKPEIMSKS  197

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
             K     K++   +   FNT+ DFGWS+ KS+LVED ++P+RSG+DGVEF+P   +TM+FS
Sbjct  198   KKGIVAKSL---VSSIFNTMSDFGWSLLKSSLVEDVQSPIRSGEDGVEFKPTTLSTMTFS  254

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD+IKQIK +L VTINDV+TGII YG RLYM+   +E++ +  TALVL NTR +GG YKS
Sbjct  255   LDRIKQIKSRLGVTINDVITGIIFYGIRLYMQAVGDEAANSHSTALVLLNTRIVGG-YKS  313

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             V EM+KPNAE PWGNQF FL VS+P LT A  S+PL+FV KA +IIK+KR+S +V LTG 
Sbjct  314   VKEMVKPNAESPWGNQFGFLHVSMPELTKAAVSNPLQFVEKAQQIIKKKRSSLAVNLTGR  373

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL+AL K RG EVTA+YIH T KNSSM ISN+IGP+E+M+LANHP KG+YF++ G+PQSL
Sbjct  374   LLEALRKLRGPEVTAKYIHSTLKNSSMTISNVIGPVEKMALANHPIKGLYFMVVGVPQSL  433

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALG  1419
              +TMVSY G LRIA+  EKDFID +KF+ C+ ++FE IYE + G
Sbjct  434   TITMVSYTGQLRIAVGTEKDFIDPQKFRSCIENSFEMIYEYSCG  477



>ref|XP_009588555.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=427

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/427 (65%), Positives = 341/427 (80%), Gaps = 6/427 (1%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             ++M E   E  ASP +Q+LNSS LSL+++ VLES+IPI+  DS V SLLKDVF+PINPRF
Sbjct  3     IKMEETYCERPASPISQYLNSSNLSLSVIVVLESKIPIEIEDSKVFSLLKDVFLPINPRF  62

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIM++E   G +KWK+VEVN  +HVK P  PA + + FYD+C S+YLSK+AM+ F  N+
Sbjct  63    SSIMITEK-KGARKWKQVEVNIEDHVKTPVLPAEQSLIFYDECFSNYLSKLAMDPFQQNK  121

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWEIHL KYPT+NAAGN+IFKLHHSLGDGYSLMGA+LSCLQR DNP+LPLTFPSRQ + 
Sbjct  122   PLWEIHLLKYPTSNAAGNLIFKLHHSLGDGYSLMGALLSCLQRVDNPSLPLTFPSRQSTI  181

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
              + +++A N +    K +P       N+V DFG SV KSTL+EDDRTP+RSGDDGVEFRP
Sbjct  182   LSTKNRAINIV----KCVPNVFMKLVNSVQDFGLSVLKSTLIEDDRTPIRSGDDGVEFRP  237

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             I   T +FSL+ IKQIK  LKVTINDV+TG++IYGTRLYM+   +E+S  +CTALVLFNT
Sbjct  238   IEIATTTFSLESIKQIKANLKVTINDVITGVVIYGTRLYMQGINKETSNGKCTALVLFNT  297

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             RA+GG YKSV+EMIKPN+EMPWGN FTFLPVSLP LT  ++ +PL FV+KA R+IKR+RN
Sbjct  298   RAVGG-YKSVSEMIKPNSEMPWGNHFTFLPVSLPKLTSTDSLNPLGFVQKARRVIKRQRN  356

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             SASV+LTG LL+ L K  G E TA+YIH T K++SMGI+N+IGP+E M+LANHP KG+YF
Sbjct  357   SASVFLTGRLLEILRKVEGPETTAKYIHATLKHTSMGITNLIGPLEEMALANHPIKGLYF  416

Query  1261  IIAGIPQ  1281
              + G PQ
Sbjct  417   AVVGAPQ  423



>ref|XP_002274522.1| PREDICTED: O-acyltransferase WSD1 [Vitis vinifera]
Length=473

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/468 (60%), Positives = 349/468 (75%), Gaps = 14/468 (3%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             ++  SP+ Q+ NSSVL ++I+ +LES+IPI   DS  +SLLKDVF+PINPRFSS+MV E 
Sbjct  12    DQPVSPTGQYFNSSVLQVSIMSILESDIPID--DSPTLSLLKDVFLPINPRFSSLMV-ED  68

Query  205   INGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
               G K WKRVEV   +HV VP +P G   E YDD   DYL+K+AM+ FP +RPLWEIH+ 
Sbjct  69    KKGVKHWKRVEVKLEDHVNVPIFPDGLSPESYDDYFDDYLTKIAMKEFPQSRPLWEIHII  128

Query  385   KYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
             KYPT+NAAG V+FKLHH+LGDG+SLMGA+LSCLQRADNP LP+TFPS + S        S
Sbjct  129   KYPTSNAAGTVVFKLHHALGDGFSLMGALLSCLQRADNPNLPITFPSFKVS--------S  180

Query  565   NKISG--FFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
             N  SG    +A+PR L  AFNTV DFGW + KST VEDDRTP+RSGD GVEFRP++  T+
Sbjct  181   NLDSGRSIIRAVPRALSAAFNTVSDFGWGLLKSTAVEDDRTPIRSGDPGVEFRPMSIATI  240

Query  739   SFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGG  918
             SFSLD I++IK KL VTINDV+TGII +GTRLYM+     S  A  TALVL NTR I G 
Sbjct  241   SFSLDNIQKIKAKLGVTINDVLTGIIFFGTRLYMQSMNHASRNANSTALVLLNTRVISG-  299

Query  919   YKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYL  1098
             YKS+ EM   ++   WGNQF FL V+LP L  A  + PL FV KA + I+RKRNS +V+L
Sbjct  300   YKSIKEMTASDSSSQWGNQFAFLHVTLPELADAKFTSPLDFVAKAQQTIQRKRNSLAVHL  359

Query  1099  TGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIP  1278
             TG LL+ L K RG EVTARYIHGT KNSSM ISNMIGPME+++LANHP +GIYF++ G P
Sbjct  360   TGRLLETLRKYRGPEVTARYIHGTLKNSSMTISNMIGPMEQLALANHPCRGIYFMVLGSP  419

Query  1279  QSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGS  1422
             +S+ ++++SY+G +RIA+  EK FID  KF  C+ +AF+ ++EAA+G+
Sbjct  420   ESMTISILSYMGKVRIAVGTEKGFIDPRKFNACIENAFQRVFEAAVGT  467



>ref|XP_009784406.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana sylvestris]
Length=484

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/464 (59%), Positives = 349/464 (75%), Gaps = 9/464 (2%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP+ Q+  SS LS++++ VLESEIPI   DS  ++LLKDVF+PINPRFSSIMV +  NG
Sbjct  25    VSPTGQYFTSSALSISVISVLESEIPID--DSCTMTLLKDVFLPINPRFSSIMVRDK-NG  81

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              K+WK+VEV + +H+ VP +P GK  EFYD+C ++YL+K+AME  P  RPLWEIH+FKYP
Sbjct  82    VKQWKKVEVKYKDHINVPIFPEGKSKEFYDNCFNEYLTKIAMEQLPQTRPLWEIHIFKYP  141

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T+ +AGN++FKLHHSLGDG+SLMGA+LSCLQRADNP+LPLTFP+     + P S    K 
Sbjct  142   TSKSAGNLVFKLHHSLGDGFSLMGALLSCLQRADNPSLPLTFPAFN---SNPNSGNDYK-  197

Query  574   SGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLD  753
               F   + + + G  NT  DFGWS+ KST +ED+RTP+RSGD+GVEFRPI  +TM FSLD
Sbjct  198   KRFCTNVAQMVSGVVNTFVDFGWSLLKSTSLEDERTPIRSGDEGVEFRPIHISTMDFSLD  257

Query  754   QIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVT  933
              +KQIK  LKVTINDV+ G++  G RLYM++ + E   A  TALVL NTR I  GYKSV 
Sbjct  258   HLKQIKTNLKVTINDVICGVLFLGVRLYMEEMKYEEKNANSTALVLLNTRNI-AGYKSVK  316

Query  934   EMIKPNAEMPWGNQFTFLPVSLPALTPA-NASDPLRFVRKAHRIIKRKRNSASVYLTGWL  1110
             EM++P+ E  WGNQF FL VS+P L    ++S+PL FV KA  +IKRKRNSA+V LTG L
Sbjct  317   EMLQPSNESKWGNQFAFLHVSVPKLDKGESSSNPLSFVSKAQDVIKRKRNSAAVILTGKL  376

Query  1111  LQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLC  1290
             L  L K RG EVTA+YIH T KNSSM ISNMIGPME+M+LANHP KG+YF++ G+P+SL 
Sbjct  377   LDTLQKYRGPEVTAKYIHSTLKNSSMTISNMIGPMEQMALANHPCKGLYFMVVGVPESLT  436

Query  1291  VTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGS  1422
             +TM+SY+G LR+A+  EK  +D  KFK  + +AF+ I++AA+ S
Sbjct  437   ITMMSYMGRLRVAVGTEKGLVDPHKFKTSIENAFDSIFKAAVPS  480



>gb|EYU28206.1| hypothetical protein MIMGU_mgv1a021941mg [Erythranthe guttata]
Length=459

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/470 (58%), Positives = 351/470 (75%), Gaps = 13/470 (3%)
 Frame = +1

Query  10    MEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSI  189
             ME+G  E  SP+ Q+  SS +S++++ VLE E PI  S     +LL+ VF+PINPRFSS+
Sbjct  1     MENGILEPVSPTGQYFTSSAISVSVIVVLELEFPIDQSR--FDTLLETVFLPINPRFSSL  58

Query  190   MVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLW  369
             MV +  NG K WK+VEV+  EH+K PN+P GK  EFY+DCLS+YLSK+++E  P +R LW
Sbjct  59    MVKDK-NGKKHWKKVEVDIQEHIKTPNFPRGKSSEFYEDCLSEYLSKISLEQLPESRALW  117

Query  370   EIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAP  549
             E H+  YPT NAA N++FKLHHSLGDGYSLM A+LSCLQRADNP LPLTFPS   +   P
Sbjct  118   EFHIINYPTRNAAQNLVFKLHHSLGDGYSLMRALLSCLQRADNPQLPLTFPSL--NNKKP  175

Query  550   RSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDD-GVEFRPIA  726
             +++  N            L  AF++VYDFGWSV KS ++EDD+TP+RSGDD GVEFRPI+
Sbjct  176   KTRKINICEN------NILSRAFDSVYDFGWSVLKSIVLEDDKTPIRSGDDDGVEFRPIS  229

Query  727   TTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRA  906
              TTM FS+DQIK++K  L VTINDV+ G +  G RLY+K  + + S A+ TALVL NTR 
Sbjct  230   ITTMVFSVDQIKKVKASLHVTINDVICGALFLGIRLYIKSTKHDQSNAKSTALVLLNTRN  289

Query  907   IGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSA  1086
             I G YKS++EM++P+AE PWGNQF F+ VS+P L  +N  DPL FV KAH++IKRKRNSA
Sbjct  290   ING-YKSISEMVEPDAESPWGNQFAFIHVSVPKLAFSNPIDPLSFVLKAHKVIKRKRNSA  348

Query  1087  SVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFII  1266
             ++ LTG LL  L K RG EVTA+YIH T KN+SM ISN+IGP+E+M+L+N P KG+YF++
Sbjct  349   ALILTGKLLDTLRKLRGPEVTAKYIHRTLKNTSMTISNIIGPVEKMALSNQPIKGMYFMV  408

Query  1267  AGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
              G+PQSL VTMVSY+G LR+AL  E D IDA KF+ CV +AF+ I++AAL
Sbjct  409   VGVPQSLTVTMVSYMGELRVALGTENDLIDAPKFRQCVQNAFDMIFKAAL  458



>ref|XP_004251786.1| PREDICTED: O-acyltransferase WSD1-like [Solanum lycopersicum]
Length=491

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/477 (57%), Positives = 355/477 (74%), Gaps = 10/477 (2%)
 Frame = +1

Query  13    EHGYEEAAS----PSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             E  Y+E +S    P+ Q+  SSV+S++++ VLESEIPI   DS  I+LLKDVF+PINPRF
Sbjct  13    EEDYDETSSFPVSPTGQYFTSSVMSISVICVLESEIPID--DSCTITLLKDVFIPINPRF  70

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV +  NG K+WK+VEV H +H+ VP +P GK  EFYD+C ++Y++K++ME FP +R
Sbjct  71    SSIMVKDK-NGVKQWKKVEVKHKDHINVPIFPQGKSKEFYDNCFNEYMTKISMEQFPQSR  129

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPS-RQRS  537
             PLWEIH+FKYPTT +AGN++FKLHHSLGDG+SLMGA+LSCLQRADNP+LPLTFPS    +
Sbjct  130   PLWEIHIFKYPTTKSAGNLVFKLHHSLGDGFSLMGALLSCLQRADNPSLPLTFPSFTSNN  189

Query  538   TAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFR  717
                  +  S+        + + + G  NT+ DFGWS+ KST +ED+RT +RSGD+GVEFR
Sbjct  190   NNYNHNLESDYKKRLCTNVVQRVNGVVNTLLDFGWSLMKSTNLEDERTSIRSGDEGVEFR  249

Query  718   PIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFN  897
             PI  TTM FSLD +K IK  LKVTINDV+ G++  G RLYM++ + +   A  TALVL N
Sbjct  250   PIDITTMEFSLDHLKVIKSNLKVTINDVICGVLFLGVRLYMEEMKYDQKNANSTALVLLN  309

Query  898   TRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANAS-DPLRFVRKAHRIIKRK  1074
             TR I  GYKSV EM++P  E  WGNQF FL VSLP +    +S +PL FV KA  +I+RK
Sbjct  310   TRNI-AGYKSVKEMLQPKNESKWGNQFAFLHVSLPKIDKEESSTNPLSFVFKAQDVIQRK  368

Query  1075  RNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGI  1254
             RNSA+V LTG LL  L K +G EVTA+YIH T KNSSM ISNMIGP+E+M+LANHP K +
Sbjct  369   RNSAAVILTGKLLDTLQKYKGPEVTAKYIHNTLKNSSMTISNMIGPVEKMALANHPVKSL  428

Query  1255  YFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
             YF++ G+P+SL +TM+SY+G LR+A+  EK  ID +KFKC + +AF+ I++AA+ S+
Sbjct  429   YFMVVGVPESLTITMMSYMGKLRVAVGTEKGLIDPQKFKCSIENAFDRIFKAAVPSA  485



>ref|XP_007043617.1| O-acyltransferase family protein [Theobroma cacao]
 gb|EOX99448.1| O-acyltransferase family protein [Theobroma cacao]
Length=476

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/469 (59%), Positives = 352/469 (75%), Gaps = 15/469 (3%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             E  Y E  SP+ Q+ NSS LS+ +LGVL+SEIPI   DS  + LL+DVF+PINPRFSS+M
Sbjct  17    EGEYSEPVSPTGQYFNSSALSIGVLGVLDSEIPID--DSPTMKLLEDVFLPINPRFSSVM  74

Query  193   VSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWE  372
             V +  NG K+WK+VEV   +HV VP +P G   E YD+ LSDYLSK+A E  P NRPLW 
Sbjct  75    VQDE-NGAKQWKKVEVKLVDHVNVPVFPPGLSPESYDNYLSDYLSKIATEQLPQNRPLWN  133

Query  373   IHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPR  552
             IH+ KY T+NAAG++IFKLHH+LGDGYSLMGA+LSCLQRA+NP++PLTFP+   S+A   
Sbjct  134   IHIVKYTTSNAAGSLIFKLHHALGDGYSLMGALLSCLQRAENPSVPLTFPAL--SSAPNL  191

Query  553   SKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATT  732
             S+ SN +        R L+ AFNT+ DFGWS+ KS+ +EDDRT +RSGD GV+F+P+  +
Sbjct  192   SENSNSVF-------RSLYSAFNTISDFGWSLLKSSFLEDDRTMIRSGDPGVQFKPVVIS  244

Query  733   TMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEES-SKARCTALVLFNTRAI  909
             TM+FSLD IKQIK KL VTIND +TGII +GTRLYM+    +  S    TALVL NTR I
Sbjct  245   TMTFSLDHIKQIKTKLGVTINDAITGIIFFGTRLYMQGTSSDKLSNGNSTALVLLNTRTI  304

Query  910   GGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPAL-TPANASDPLRFVRKAHRIIKRKRNSA  1086
             GG YKSV +M+KP+A+ PWGNQF FL VSLP L + A + +PL F+ KA ++I+RKRNS 
Sbjct  305   GG-YKSVKDMVKPDADSPWGNQFGFLHVSLPELASTAESCNPLEFIWKAQKLIQRKRNSK  363

Query  1087  SVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFII  1266
             +V+ TG LL+ L K RG E TA+YIH T KNSSM ISN+IGP+ERM+LA+HP K +YF++
Sbjct  364   AVFFTGQLLEGLRKYRGPEATAKYIHSTLKNSSMTISNLIGPVERMALADHPVKSLYFMV  423

Query  1267  AGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              G+PQSL +TMVSY+G L +A+  EKDF+D +KFK  V +AF+ + +AA
Sbjct  424   VGVPQSLTITMVSYMGKLTVAIGTEKDFVDPQKFKSSVENAFQMMLKAA  472



>ref|XP_006350139.1| PREDICTED: O-acyltransferase WSD1-like [Solanum tuberosum]
Length=503

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/478 (56%), Positives = 352/478 (74%), Gaps = 18/478 (4%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP+ Q+  SSV+S++++ VLESEIPI   DS  +++LKDVF+PINPRFSSIMV +  NG
Sbjct  24    VSPTGQYFTSSVMSISVICVLESEIPID--DSCTVTMLKDVFIPINPRFSSIMVKDK-NG  80

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              K+WK+VEV H +H+ VP +P GK  EFYD+C ++Y++K+AME FP +RPLWEIH+FKYP
Sbjct  81    VKQWKKVEVKHKDHIYVPIFPQGKSKEFYDNCFNEYMTKIAMEQFPQSRPLWEIHIFKYP  140

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPS-------------RQR  534
             TT +AGN++FKLHHSLGDG+SLMGA+LSCLQRADNP+LPLTFPS                
Sbjct  141   TTKSAGNLVFKLHHSLGDGFSLMGALLSCLQRADNPSLPLTFPSFTSNNNNNNNNNNHNL  200

Query  535   STAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEF  714
              +    +  S+    F   + + + G  NT+ DFGWS+ KST +ED+RT +RSGD+GVEF
Sbjct  201   ESDNNHNLESDYKKSFCTNVVQSVNGVVNTLLDFGWSLMKSTNLEDERTTIRSGDEGVEF  260

Query  715   RPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLF  894
             RPI  TTM FSLD +K+IK  LKVTINDV+ G++  G RLYM++ + +      TALVL 
Sbjct  261   RPIDITTMEFSLDHLKEIKSNLKVTINDVICGVLFLGVRLYMEETKYDQKNTNSTALVLL  320

Query  895   NTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPAL-TPANASDPLRFVRKAHRIIKR  1071
             NTR I  GYKSV EM++P  E  WGNQF FL VSLP +    ++S+PL FV KA  +I+R
Sbjct  321   NTRNI-AGYKSVKEMLQPKNESKWGNQFAFLHVSLPKIDKEESSSNPLSFVFKAQDVIQR  379

Query  1072  KRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKG  1251
             KRNSA+V LTG LL  L K RG EVTA+YIH T KNSSM ISNMIGP+E+M+LANHP K 
Sbjct  380   KRNSAAVILTGKLLNTLQKYRGPEVTAKYIHSTLKNSSMTISNMIGPVEKMALANHPVKS  439

Query  1252  IYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
             +YF++ G+P+SL +TM+SY+G LR+A+  EK  ID +KFKC + +AF+ I++AA+ S+
Sbjct  440   LYFMVIGVPESLTITMMSYMGKLRVAVGTEKGLIDPQKFKCSIENAFDRIFKAAMPSA  497



>ref|XP_009600771.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=481

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/464 (59%), Positives = 345/464 (74%), Gaps = 9/464 (2%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP+ Q+  SS LS++++ VLESEIPI   DS  + LLKDVF+PINPRFSSIMV +  NG
Sbjct  22    VSPTGQYFTSSALSISVISVLESEIPID--DSCTMKLLKDVFLPINPRFSSIMVRDK-NG  78

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              K+WK+VEV + +H+ VP +P GK  EFYD+C ++YL+K+AM   P  RPLWEIHLFKYP
Sbjct  79    VKQWKKVEVKYKDHINVPIFPEGKSKEFYDNCFNEYLTKIAMGQLPQTRPLWEIHLFKYP  138

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T+ +AGN++FKLHHSLGDG+SLMGA+LSCLQRADNP+LPLTFP+     + P S    K 
Sbjct  139   TSKSAGNLVFKLHHSLGDGFSLMGALLSCLQRADNPSLPLTFPAFN---SNPNSGNDYK-  194

Query  574   SGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLD  753
               F   + + + G  NT  DFGWS+ KST +ED+RTPVRSGD+GVEFRPI  +TM FSLD
Sbjct  195   KRFCTNVAQMVSGVVNTFLDFGWSLLKSTSLEDERTPVRSGDEGVEFRPIDISTMDFSLD  254

Query  754   QIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVT  933
              +KQIK  LKVTINDV+ G++  G RLYM++ + E   A  TALVL NTR I  GYKSV 
Sbjct  255   HLKQIKTNLKVTINDVICGVLFLGVRLYMEEMKYEQKNANSTALVLLNTRNI-AGYKSVK  313

Query  934   EMIKPNAEMPWGNQFTFLPVSLPALTPANAS-DPLRFVRKAHRIIKRKRNSASVYLTGWL  1110
             EM++P+ E  WGNQF FL VS+P L    +S +PL FV KA  +IKRKRNSA+V LTG L
Sbjct  314   EMLQPSNESKWGNQFAFLHVSVPKLDKEESSLNPLSFVFKAQDVIKRKRNSAAVILTGKL  373

Query  1111  LQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLC  1290
             L  L K RG EVTA+YIH T KNSSM ISNMIGPME+M+LANHP KG YF++ G+P+SL 
Sbjct  374   LDTLQKYRGPEVTAKYIHSTLKNSSMTISNMIGPMEQMALANHPCKGFYFMVVGVPESLT  433

Query  1291  VTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGS  1422
             +TM+SY+G LR+A+  EK  +D  KFK  + +AF+ I++AA+ S
Sbjct  434   ITMMSYMGRLRVAVGTEKGLVDPHKFKSSIENAFDMIFKAAVPS  477



>emb|CDP20977.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/485 (54%), Positives = 357/485 (74%), Gaps = 8/485 (2%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             +  ++   SP+ Q+ NSS++S  ++GVLESEIPIQ  DSL + LL+++F+PINPR SSIM
Sbjct  7     DEEFQVPVSPTGQYFNSSIMSAAVIGVLESEIPIQEDDSLTLKLLQELFLPINPRLSSIM  66

Query  193   VSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWE  372
             V +   G K WK+VEV    H+ VP +P GK IEFYD+C +DYLS MA++  P ++PLWE
Sbjct  67    VQDE-KGVKLWKKVEVIPKNHIHVPVFPEGKSIEFYDECFNDYLSNMALQPLPQSQPLWE  125

Query  373   IHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPR  552
             +H+ KYPT NAAGN++FKLHH+LGDGYS+MGA+LSCLQRAD+P+LP+TFP  Q +   P+
Sbjct  126   VHIIKYPTKNAAGNLVFKLHHALGDGYSIMGALLSCLQRADDPSLPITFPEFQTN---PK  182

Query  553   SKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATT  732
              K +N     FK +PR L G  NT+ DF WS+ KST ++DD+TP+RSG+DGVEFRP+  T
Sbjct  183   GK-NNDEGSIFKKVPRVLSGIGNTISDFAWSMLKSTFLQDDQTPIRSGEDGVEFRPMTIT  241

Query  733   TMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIG  912
             TM+F +DQIKQ+K  L V++NDV+ G+I  GTRLYM+  + E +  + +ALVL +TRAI 
Sbjct  242   TMTFCIDQIKQMKANLDVSVNDVICGVIFLGTRLYMQAIDPEKTNGKSSALVLLSTRAIR  301

Query  913   GGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASV  1092
             G YK+V EM++PN++ PWGN F F+ VS+P L  A + +PL FV +A +II+ KRNSA V
Sbjct  302   G-YKTVKEMVEPNSKTPWGNHFAFMHVSVPNLAKAGSQNPLNFVLEAQKIIRSKRNSAGV  360

Query  1093  YLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAG  1272
             YL G LL+ + K RG E TA++IH T  NSSM +SN+ GP++R++LANHPAKG+YF++AG
Sbjct  361   YLNGKLLETMRKCRGPEATAKFIHKTLTNSSMTVSNVFGPVDRLALANHPAKGMYFMMAG  420

Query  1273  IPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL--GSS*FTLLII  1446
              PQ+L +TMVSY+  LR+A+ VEK  IDAEKFK  +  AF  I  AA+  GS+     I 
Sbjct  421   SPQNLTITMVSYMKKLRVAIGVEKGMIDAEKFKSSIDEAFNMISLAAINNGSAPHQPPIS  480

Query  1447  FPFNI  1461
              P N+
Sbjct  481   TPLNV  485



>gb|EYU28207.1| hypothetical protein MIMGU_mgv1a006155mg [Erythranthe guttata]
Length=455

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/469 (57%), Positives = 349/469 (74%), Gaps = 19/469 (4%)
 Frame = +1

Query  10    MEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSI  189
             ME    E  SP+ Q+  SSV+S++++ VLE E PI   DS   +LL++VF+PINPRFSS+
Sbjct  1     MEEEITEPVSPTGQYFTSSVISVSVIAVLEFEFPI--DDSQTATLLENVFLPINPRFSSL  58

Query  190   MVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLW  369
             MV +G NG K WK+VEVN  EHVK PN+P GK  EFY++CLS+YLSK+++E F  +RPLW
Sbjct  59    MV-KGKNGKKHWKKVEVNVKEHVKTPNFPRGKSPEFYEECLSEYLSKISLEQFQESRPLW  117

Query  370   EIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAP  549
             EIH+ KYPT + AGN++FKLHHSLGDGYSLMGA+LSCLQRADNP LPLTFP   +     
Sbjct  118   EIHIIKYPTKSTAGNLVFKLHHSLGDGYSLMGALLSCLQRADNPQLPLTFPLLNQKIQTN  177

Query  550   RSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
              +K++             L  AF++VYDFGWSV KS ++EDD+TP+RSGDDGVEFRPI  
Sbjct  178   DNKSN------------ILSRAFDSVYDFGWSVLKSLVLEDDKTPIRSGDDGVEFRPITV  225

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAI  909
             TT++FSLDQIK++K  L V+INDV+ G++  G  LY K  + + S    TALVL NTR I
Sbjct  226   TTLNFSLDQIKKVKASLHVSINDVICGVLFLGIGLYAKSTKVDQS---STALVLLNTRNI  282

Query  910   GGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSAS  1089
              G YKS++EM++P+AE PWGNQF FL VS+P L  ++  DPL FV  A + I RKRNSA+
Sbjct  283   NG-YKSISEMVEPDAESPWGNQFAFLHVSVPKLVFSDQIDPLSFVLDAQKEITRKRNSAA  341

Query  1090  VYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIA  1269
             V LTG LL+ LMK RG EVTA+YIH T KN+SM ISN++GP+E+M+L+N P KG+YF++ 
Sbjct  342   VVLTGKLLEMLMKLRGPEVTAKYIHRTLKNTSMTISNIMGPLEKMALSNQPIKGMYFMVV  401

Query  1270  GIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             G+PQ+L +TMVSY+G LR+AL  E   I+A KF+ CV +AF+ IY+AA+
Sbjct  402   GVPQNLTITMVSYMGQLRVALGTENGLIEAPKFRECVQNAFDMIYKAAV  450



>ref|XP_002323705.2| hypothetical protein POPTR_0017s04330g [Populus trichocarpa]
 gb|EEF03838.2| hypothetical protein POPTR_0017s04330g [Populus trichocarpa]
Length=483

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/462 (58%), Positives = 348/462 (75%), Gaps = 9/462 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+ Q+ NSSVLS+ +L VLESE+PI   DSL ++LLKDVF+PINPRFSSIMV++  
Sbjct  23    EPVSPTGQYFNSSVLSICVLAVLESEVPID--DSLTMTLLKDVFLPINPRFSSIMVNDK-  79

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG K+WKRVEV    HV +P +P G     YD+  +DY+S+ A++ FP ++PLWEIHL K
Sbjct  80    NGEKQWKRVEVQLQNHVNIPIFPIGLSTTSYDNYFNDYISRTALKQFPQSQPLWEIHLVK  139

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+ AAGN+IFKLHH+LGDG+SLMGA+LSCLQRADNP+L LTFPS Q  +    S +  
Sbjct  140   YPTSKAAGNIIFKLHHALGDGFSLMGALLSCLQRADNPSLSLTFPSLQYPSNPDCSFSKL  199

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
              I+     +P+ +   FNT+ DFGWS+ KS+ VED R+P+RSGD+ V+F+PI  +T++FS
Sbjct  200   NIT-----VPKCIGSIFNTISDFGWSLLKSSFVEDSRSPIRSGDEEVQFKPIVISTITFS  254

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD IKQIK +L VTINDV+TGII YGTRLYM+  +++S+ A  TALVL NTR I G Y+S
Sbjct  255   LDHIKQIKSRLGVTINDVITGIIFYGTRLYMQNVDDKSTNAHSTALVLLNTRVISG-YRS  313

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             V EM+KP+AE PWGNQF FL VS+P LT +  S PL  V  A  II+RKR+S +V LTG 
Sbjct  314   VKEMVKPDAESPWGNQFGFLHVSVPELTDSRFSKPLECVTIAQEIIQRKRSSLAVNLTGR  373

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL+ L K RG E TA+YI  T  NSSM ISN+IGP+++M+LANHP KG YF++ G+PQSL
Sbjct  374   LLEVLRKFRGPEATAKYIKQTLFNSSMTISNIIGPVDKMALANHPIKGFYFMVVGVPQSL  433

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              +TMVSY G L++A+  EK F+D++KFK C+  AFE I++++
Sbjct  434   TITMVSYAGKLKVAVGTEKGFMDSQKFKSCMETAFEMIFKSS  475



>ref|XP_011037140.1| PREDICTED: O-acyltransferase WSD1-like [Populus euphratica]
Length=472

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/467 (57%), Positives = 348/467 (75%), Gaps = 9/467 (2%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             E    E  SP+ Q+ NSSVLS+ IL VLESE+PI   DS  ++LLKDVF+PINPRFSSIM
Sbjct  7     EEEVTEPVSPTGQYFNSSVLSICILAVLESEVPID--DSHTMTLLKDVFLPINPRFSSIM  64

Query  193   VSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWE  372
             V++  NG K+WKRVEV    HV +P +P G     YD   +DY+S++A++ FP ++PLWE
Sbjct  65    VNDK-NGVKQWKRVEVQLQNHVSIPIFPIGLSTTSYDSYFNDYISRLALKQFPQSQPLWE  123

Query  373   IHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPR  552
             IH+ KYPT+ AAGN+IFKLHH+LGDG+SLMGA+LSCLQRADNP+L LTFPS Q  +    
Sbjct  124   IHVVKYPTSKAAGNIIFKLHHALGDGFSLMGALLSCLQRADNPSLSLTFPSLQFPSYPDC  183

Query  553   SKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATT  732
             S +   I+     +P+ +   FNT+ DFGWS+ KS+ VED R+P+RSGD+ V+F+PI  +
Sbjct  184   SFSKLNIT-----VPKCISSIFNTISDFGWSLLKSSFVEDSRSPIRSGDEEVQFKPIVIS  238

Query  733   TMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIG  912
             T++FSLD IKQIK  L VTINDV+TGII YGTRLYM++ +++S+ A  TALVL NTR I 
Sbjct  239   TIAFSLDHIKQIKSTLGVTINDVITGIIFYGTRLYMQRVDDKSTNANSTALVLLNTRVIS  298

Query  913   GGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASV  1092
             G Y+SV EM++P+AE PWGNQF FL VS+P LT +  S+PL  V  A  II+RK++S +V
Sbjct  299   G-YRSVKEMVEPDAESPWGNQFGFLHVSVPELTDSRFSNPLECVTIAQEIIQRKKSSLAV  357

Query  1093  YLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAG  1272
              LTG LL+ L K RG E TA++I  T  NSSM ISN+IGP+++M+LANHP KG YF++ G
Sbjct  358   NLTGRLLEVLRKFRGPEATAKHIKKTLFNSSMTISNIIGPVDKMALANHPIKGFYFMVVG  417

Query  1273  IPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             +PQSL +TMVSY G LR+A+  EK F+D++KFK C+  AFE I +++
Sbjct  418   VPQSLTITMVSYAGKLRVAVGTEKGFMDSQKFKSCLETAFEMISKSS  464



>emb|CBI21867.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/448 (60%), Positives = 334/448 (75%), Gaps = 14/448 (3%)
 Frame = +1

Query  85    LGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGGKKWKRVEVNHSEHVKV  264
             + +LES+IPI   DS  +SLLKDVF+PINPRFSS+MV E   G K WKRVEV   +HV V
Sbjct  1     MSILESDIPID--DSPTLSLLKDVFLPINPRFSSLMV-EDKKGVKHWKRVEVKLEDHVNV  57

Query  265   PNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLG  444
             P +P G   E YDD   DYL+K+AM+ FP +RPLWEIH+ KYPT+NAAG V+FKLHH+LG
Sbjct  58    PIFPDGLSPESYDDYFDDYLTKIAMKEFPQSRPLWEIHIIKYPTSNAAGTVVFKLHHALG  117

Query  445   DGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKISG--FFKAMPRFLFGAF  618
             DG+SLMGA+LSCLQRADNP LP+TFPS + S        SN  SG    +A+PR L  AF
Sbjct  118   DGFSLMGALLSCLQRADNPNLPITFPSFKVS--------SNLDSGRSIIRAVPRALSAAF  169

Query  619   NTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTIND  798
             NTV DFGW + KST VEDDRTP+RSGD GVEFRP++  T+SFSLD I++IK KL VTIND
Sbjct  170   NTVSDFGWGLLKSTAVEDDRTPIRSGDPGVEFRPMSIATISFSLDNIQKIKAKLGVTIND  229

Query  799   VVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQF  978
             V+TGII +GTRLYM+     S  A  TALVL NTR I G YKS+ EM   ++   WGNQF
Sbjct  230   VLTGIIFFGTRLYMQSMNHASRNANSTALVLLNTRVISG-YKSIKEMTASDSSSQWGNQF  288

Query  979   TFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARY  1158
              FL V+LP L  A  + PL FV KA + I+RKRNS +V+LTG LL+ L K RG EVTARY
Sbjct  289   AFLHVTLPELADAKFTSPLDFVAKAQQTIQRKRNSLAVHLTGRLLETLRKYRGPEVTARY  348

Query  1159  IHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSV  1338
             IHGT KNSSM ISNMIGPME+++LANHP +GIYF++ G P+S+ ++++SY+G +RIA+  
Sbjct  349   IHGTLKNSSMTISNMIGPMEQLALANHPCRGIYFMVLGSPESMTISILSYMGKVRIAVGT  408

Query  1339  EKDFIDAEKFKCCVHHAFEGIYEAALGS  1422
             EK FID  KF  C+ +AF+ ++EAA+G+
Sbjct  409   EKGFIDPRKFNACIENAFQRVFEAAVGT  436



>ref|XP_011001808.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Populus euphratica]
Length=472

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/462 (57%), Positives = 346/462 (75%), Gaps = 9/462 (2%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP+ Q+ NSSVLS+ IL VLESE+PI   DS  ++LLKDVF+PINPRFSSIMV++  NG
Sbjct  14    VSPTGQYFNSSVLSICILAVLESEVPID--DSHTMTLLKDVFLPINPRFSSIMVNDK-NG  70

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              K+WKRVEV    HV +P +P G     YD   +DY+S++A++ FP ++PLWEIH+ KYP
Sbjct  71    VKQWKRVEVQLQNHVSIPIFPIGLSTTSYDSYFNDYISRLALKQFPQSQPLWEIHVVKYP  130

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T+ AAGN+IFKLHH+LGDG+SLMGA+LSCLQRADNP+L LTFPS Q  +    S +   I
Sbjct  131   TSKAAGNIIFKLHHALGDGFSLMGALLSCLQRADNPSLSLTFPSLQFPSYPDCSFSKLNI  190

Query  574   SGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLD  753
             +     +P+ +   FNT+ DFGWS+ KS+ VED R+P+RSGD+ V+F+PI  +T++FSLD
Sbjct  191   T-----VPKCISSIFNTISDFGWSLLKSSFVEDSRSPIRSGDEEVQFKPIVISTIAFSLD  245

Query  754   QIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVT  933
              IKQIK  L VTINDV+TGII YGTRLYM++ +++S+ A  TALVL NTR I G Y+SV 
Sbjct  246   HIKQIKSTLGVTINDVITGIIFYGTRLYMQRVDDKSTNANSTALVLLNTRVISG-YRSVK  304

Query  934   EMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLL  1113
             EM +P+AE PWGNQF FL VS+P LT +  S+PL  V  A  II+RKR+S +V LTG LL
Sbjct  305   EMFEPDAESPWGNQFGFLHVSVPELTDSRFSNPLECVTIAQEIIQRKRSSLAVNLTGRLL  364

Query  1114  QALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCV  1293
             + L K RG E TA++I  T  NSSM ISN+IGP+++M+LANHP KG YF++ G+PQSL +
Sbjct  365   EVLRKFRGPEATAKHIKKTLFNSSMTISNIIGPVDKMALANHPIKGFYFMVVGVPQSLTI  424

Query  1294  TMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALG  1419
             TMVSY G LR+A+  EK F+D++KFK C+  AFE I +++ G
Sbjct  425   TMVSYAGKLRVAVGTEKGFMDSQKFKSCLETAFEMISKSSCG  466



>ref|XP_010272425.1| PREDICTED: O-acyltransferase WSD1-like [Nelumbo nucifera]
Length=468

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/471 (57%), Positives = 345/471 (73%), Gaps = 14/471 (3%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             VE +   YE   +P+ QF NSSVLS+ IL  LE EIPI   DS  I+L+KD+F+PINPRF
Sbjct  8     VEGVSEEYE-PVTPTGQFFNSSVLSVCILAALEIEIPID--DSPTITLIKDMFLPINPRF  64

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV +  NG K+WKRVEV   +HV++P +P G   E YD  L DYL K+AME  P  R
Sbjct  65    SSIMVRDD-NGVKQWKRVEVKPEDHVRIPAFPDGLSPETYDGYLQDYLEKIAMERLPQTR  123

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWEIHL KYPT NAAG ++FKLHH+LGDG+SLMGA+ SCL+RAD+P+LPLTFPS +   
Sbjct  124   PLWEIHLIKYPTRNAAGTLVFKLHHALGDGFSLMGALFSCLKRADDPSLPLTFPSSRFK-  182

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
                  K S+ I    K +PR     FNT+ DF WS+ KS+LVEDDRT +RSG+ GVEFRP
Sbjct  183   -----KGSHSI---LKKVPRLFSIFFNTISDFSWSLLKSSLVEDDRTTIRSGEIGVEFRP  234

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             +  +T++ SLD+I QIK  +  TINDV++GI+ YGTRLYM      SSK + TALVL NT
Sbjct  235   VTISTVTLSLDRISQIKANIGGTINDVISGIVFYGTRLYMHASSPGSSKLQSTALVLLNT  294

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R I   Y+S+ EM KP A+ PWGNQF FL VS+P    A+ ++PL FV KA + IKRKR+
Sbjct  295   RIINN-YQSIQEMTKPGAKSPWGNQFGFLHVSVPESIDADTANPLDFVFKAKKTIKRKRS  353

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S +VYLTG LL+ + K RG E+TARYI+ T KNSSM +SN+IGP E+M+LA+HP+ GIYF
Sbjct  354   SLAVYLTGKLLEMMRKFRGPEITARYIYSTLKNSSMTVSNLIGPTEKMALADHPSCGIYF  413

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             ++ G+PQSL +T++SY+G LR+A+ VEK FID++KF  C+ +AFE IY+AA
Sbjct  414   MVVGVPQSLTITVMSYMGKLRVAVGVEKGFIDSQKFNLCIENAFERIYKAA  464



>gb|EYU28205.1| hypothetical protein MIMGU_mgv1a006032mg [Erythranthe guttata]
Length=460

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/471 (57%), Positives = 335/471 (71%), Gaps = 18/471 (4%)
 Frame = +1

Query  10    MEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSI  189
             ME    E  SP+ Q+  SSV+S++I+ VLE E PI  S   + +LL+ +F+PINPRFSS+
Sbjct  1     MEDEILEPVSPTGQYFTSSVISVSIIAVLELEFPIDQSR--LDTLLQTLFLPINPRFSSL  58

Query  190   MVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLW  369
             MV +  NG K WK+VEV+  EH+K+PN+P GK  EFY+DCLS YLSK+++E F  +R LW
Sbjct  59    MVKDK-NGKKYWKKVEVDIQEHIKIPNFPRGKSPEFYEDCLSRYLSKISLEQFLESRALW  117

Query  370   EIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAP  549
             E H+  YPT NAA N++FKLHHSLGDGYSLMGA+LSCLQRADNP LPLTFP   +     
Sbjct  118   EFHIINYPTKNAAQNLVFKLHHSLGDGYSLMGALLSCLQRADNPQLPLTFPLLNQKIQTN  177

Query  550   RSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
              +K +             L  AF++VYDFGWSV KS ++EDD+T +RSGDDGVEFRPI  
Sbjct  178   DNKNN------------ILSRAFDSVYDFGWSVLKSIVLEDDQTAIRSGDDGVEFRPITI  225

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEE--SSKARCTALVLFNTR  903
             TTM FS D IK++K  L VTINDV+ G +  G RLY+K  E E   S A+ TALVL NTR
Sbjct  226   TTMVFSFDMIKKVKASLHVTINDVICGALFLGIRLYIKSTEHEHDQSNAKTTALVLLNTR  285

Query  904   AIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNS  1083
              I G YKS++EM+KP+ E  WGNQF FL V +P L  ++  DPL FV  A ++IK+KRNS
Sbjct  286   NING-YKSISEMVKPDGESLWGNQFAFLHVPVPKLAISDPIDPLSFVLDAQKVIKKKRNS  344

Query  1084  ASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFI  1263
             A+V LT  LL+ L K RG EVTA YIH T KN+SM ISNMIGPMERM+L+N P KG+Y +
Sbjct  345   AAVILTSKLLETLRKLRGPEVTAEYIHKTLKNTSMTISNMIGPMERMALSNQPIKGMYVM  404

Query  1264  IAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
               G+PQSL VT++SY+G LRIAL  E D IDA KF+ CV  AF+ I+ AA+
Sbjct  405   NVGVPQSLTVTILSYMGQLRIALGTENDLIDAPKFRQCVQDAFDMIFNAAI  455



>ref|XP_008227240.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=468

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/473 (56%), Positives = 343/473 (73%), Gaps = 16/473 (3%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             +E  E G  E  SP+ Q+ NSS+LS+ IL VLE E+PI  +DS  +SLL+DVF+PINPRF
Sbjct  1     MEFREEGEVEPVSPTGQYFNSSILSVAILAVLEFELPI--NDSQALSLLQDVFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMVS+ ++  K+WKRVEV   +HV VP +P+    + YD+   DY+S +A E  P NR
Sbjct  59    SSIMVSDNVDQKKQWKRVEVKLEDHVHVPIFPSKMSPQSYDEYFDDYISNIAAERLPQNR  118

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWEIH+ KYPT++AAG +IFKLHH+LGDGYSLMGA+LSCLQ A NP++PLTFPS + S 
Sbjct  119   PLWEIHILKYPTSHAAGTLIFKLHHALGDGYSLMGALLSCLQNAQNPSVPLTFPSLKSS-  177

Query  541   AAPRSKASNK-ISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFR  717
               P++    K +S FF ++       F TV DF WS+ KS  VEDDRTP+RSG+DGVEFR
Sbjct  178   -GPKTTHKTKTVSQFFSSV-------FQTVSDFSWSILKSNFVEDDRTPIRSGEDGVEFR  229

Query  718   PIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFN  897
             PI  +T++FS+D+IK IK+KL VTINDV+ GII  GTR+YM++  ++SS  RCTALVL  
Sbjct  230   PITLSTLTFSIDEIKLIKNKLGVTINDVIAGIIFLGTRIYMQEVTQKSSNERCTALVLLR  289

Query  898   TRAIGGGYKSVTEMIKP-NAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRK  1074
             TR I  GY S+ EMI+P NA+M WGNQF FL + +P  T    S+PL FV +A ++IK+K
Sbjct  290   TRNI-EGYTSIKEMIEPNNAKMSWGNQFAFLHLPVPKST--ETSNPLDFVWEAQKMIKKK  346

Query  1075  RNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGI  1254
             R+SA+ YLT WLL  L K RG EV ARYIHGT KNSS+ +SNMIGP+E+M+L N P  G+
Sbjct  347   RSSAASYLTSWLLDVLKKFRGPEVAARYIHGTLKNSSITVSNMIGPVEKMALDNQPVGGL  406

Query  1255  YFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             YF+  G PQ L VT +SY+G LR+A   EK FID++K K  + +AF  I EA+
Sbjct  407   YFMAVGAPQCLTVTALSYMGKLRVAFGAEKGFIDSQKLKASMQNAFGVILEAS  459



>ref|XP_007214098.1| hypothetical protein PRUPE_ppa015879mg [Prunus persica]
 gb|EMJ15297.1| hypothetical protein PRUPE_ppa015879mg [Prunus persica]
Length=468

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/472 (57%), Positives = 341/472 (72%), Gaps = 14/472 (3%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             +E  E G  E  SP+ Q+ NSS+LS+ IL VLE E+PI  +DS  +SLL+DVF+PINPRF
Sbjct  1     MEFREEGEVEPVSPTGQYFNSSILSVAILAVLEFELPI--NDSQALSLLQDVFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMVS+ ++  K+WKRVEV   +HV VP +P+    E YD+   DY+S +A E FP NR
Sbjct  59    SSIMVSDNVDQKKQWKRVEVKLEDHVHVPIFPSKMSPESYDEYFDDYISNIAAEKFPQNR  118

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWEIH+ KYPT++AAG +IFKLHH+LGDGYSLMGA+LSCLQ A NP++PLTFPS + S 
Sbjct  119   PLWEIHILKYPTSHAAGTLIFKLHHALGDGYSLMGALLSCLQSAQNPSVPLTFPSLKSS-  177

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
               P++    KI      + +F    F TV DF WS+ KS  VEDDRTP+RSG+DGVEFRP
Sbjct  178   -GPQTTHKTKI------VSQFFSSVFQTVSDFSWSILKSNFVEDDRTPIRSGEDGVEFRP  230

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             I  +T++FS+D+IK IK+KL VT NDV++GII  GTR+YM++  ++SS  RCTALVL NT
Sbjct  231   ITLSTLTFSIDEIKLIKNKLGVTTNDVISGIIFLGTRIYMQEVTQKSSNERCTALVLLNT  290

Query  901   RAIGGGYKSVTEMIKPN-AEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKR  1077
             R I  GY  + EMI+PN  EM WGNQF FL VS+P  T    S+PL FV +A +IIK+KR
Sbjct  291   RNI-EGYMPIKEMIEPNHDEMSWGNQFGFLHVSVPKST--EISNPLDFVWEAQKIIKKKR  347

Query  1078  NSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIY  1257
             +SA+ YLT WLL  L K RG E  ARYIHGT KNSSM ISNMIGP+E+M+LAN P  G Y
Sbjct  348   SSAAGYLTSWLLDVLKKFRGPEGAARYIHGTLKNSSMTISNMIGPVEQMALANQPICGFY  407

Query  1258  FIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             +++ G PQ L +T +SY+G LR+A   EK FID+ K K  + +AF  I +A+
Sbjct  408   YMVVGPPQCLTITALSYMGKLRVAFGAEKGFIDSHKLKASMQNAFGVILKAS  459



>ref|XP_008227239.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=468

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/472 (57%), Positives = 338/472 (72%), Gaps = 14/472 (3%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             +E  E G  E  SP+ Q+ NSS+LS+ IL VLE E+PI  +DS  +SLL+DVF+PINPRF
Sbjct  1     MEFREEGEVEPVSPTGQYFNSSILSVAILAVLEFELPI--NDSQALSLLQDVFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMVS+ ++  K+WKRVEV   +HV VP +P+    E YD+   DY+S +A E  P NR
Sbjct  59    SSIMVSDNVDQKKQWKRVEVKLEDHVHVPIFPSKMSPESYDEYFDDYISNIAAEKLPQNR  118

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWEIH+ KYPT++AAG +IFKLHH+LGDGYSLMGA+LSCLQ A NP++PLTFPS + S 
Sbjct  119   PLWEIHILKYPTSHAAGTLIFKLHHALGDGYSLMGALLSCLQSAQNPSVPLTFPSLKSS-  177

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
               P++    KI      + +F    F TV DF WS+ KS  VEDDRTP+RSG+DGVEFRP
Sbjct  178   -GPQTTHKTKI------VSQFFSSVFQTVSDFSWSILKSNFVEDDRTPIRSGEDGVEFRP  230

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             I  +T++FS+D+IK IK+KL VT NDV+ GII  GTR+YM+   ++SS   CTALVL NT
Sbjct  231   ITLSTLTFSIDEIKLIKNKLGVTTNDVIAGIIFLGTRIYMQGVTKKSSNEHCTALVLLNT  290

Query  901   RAIGGGYKSVTEMIKP-NAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKR  1077
             R I  GY  + EMI+P N EM WGNQF FL VS+P  T    S+PL FV +AH+IIK+KR
Sbjct  291   RNI-EGYMPIKEMIEPNNDEMSWGNQFGFLHVSMPKST--EISNPLDFVWEAHKIIKKKR  347

Query  1078  NSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIY  1257
             +SA+ YLT WLL  L K RG E  ARYIHGT KNSSM ISNMIGP+E+M+LAN P  G Y
Sbjct  348   SSAAGYLTSWLLDVLKKFRGPEGAARYIHGTLKNSSMTISNMIGPVEQMALANQPVCGFY  407

Query  1258  FIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             +++ G PQ L +T +SY+G LR+A   EK FID+ K K  + +AF  I EA+
Sbjct  408   YMVVGPPQCLTITALSYMGKLRVAFGAEKGFIDSHKLKASMQNAFRVILEAS  459



>ref|XP_010689024.1| PREDICTED: O-acyltransferase WSD1-like [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/468 (54%), Positives = 344/468 (74%), Gaps = 9/468 (2%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             E   +E  SP+ Q+ NS  +S+ +LG+LESEI I  S    + LL+++F+PINPRFSSIM
Sbjct  14    EDTEDEPVSPTGQYFNSKTMSVRVLGILESEISIDTS--CAVPLLQELFLPINPRFSSIM  71

Query  193   VSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWE  372
             VS+   G KKWKRVEVN  +HV +PN+P G   E YDD   +YL+++AM+  P +RPLW+
Sbjct  72    VSDK-KGVKKWKRVEVNLPDHVNIPNFPEGLSPEAYDDYFDEYLTEIAMKPLPSDRPLWD  130

Query  373   IHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPR  552
             IHL  YPT+ AAG++IFKLHH+LGDG+SLMGA+LSC+QRADNP++PLTFP+ Q     P 
Sbjct  131   IHLITYPTSKAAGHLIFKLHHALGDGFSLMGALLSCMQRADNPSMPLTFPTLQ-----PT  185

Query  553   SKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATT  732
             SK ++K       +P+ L   +NT  DFGWS  KS+L+ DD+TP+RSG DGVEF P+  +
Sbjct  186   SKTNSKPVDDVGCLPKTLSVTYNTTCDFGWSFLKSSLIVDDKTPIRSGGDGVEFHPVQIS  245

Query  733   TMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIG  912
             T++ SLDQIKQIK  +  TINDV+TGII +GTRLYM+    +   +  TALVL NTR I 
Sbjct  246   TIALSLDQIKQIKTNIGATINDVLTGIIFFGTRLYMQATGRDFCNSESTALVLLNTRNID  305

Query  913   GGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASV  1092
             G YKS+ EM+K ++E  WGNQF F+ V+LPAL    +S+PL F+ +A  IIKRK+NS  V
Sbjct  306   G-YKSIQEMVKNDSETKWGNQFAFMHVALPALIDNKSSNPLEFISEAKEIIKRKKNSLGV  364

Query  1093  YLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAG  1272
             YLTG  L+ + K RG EV A++IH T + S+M +S+MIGP+E+M+LANH  KG+YF++ G
Sbjct  365   YLTGQSLELIRKCRGPEVAAQFIHSTLQKSTMTVSSMIGPVEKMALANHECKGLYFMVVG  424

Query  1273  IPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             +PQSL +T++SY+ ++RIA+ VEK +ID +KFK C+ +AF+ IY+AA+
Sbjct  425   VPQSLTITVLSYMRTIRIAIGVEKGYIDEQKFKSCIENAFQLIYKAAV  472



>ref|XP_007212723.1| hypothetical protein PRUPE_ppa018856mg [Prunus persica]
 gb|EMJ13922.1| hypothetical protein PRUPE_ppa018856mg [Prunus persica]
Length=469

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/472 (55%), Positives = 339/472 (72%), Gaps = 13/472 (3%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             +E  E G  E  SP+ Q+ NSS+LS+ IL VLE E+P   +DS  +SLL+DVF+PINPRF
Sbjct  1     MEFREEGEGEPVSPTGQYFNSSILSVAILAVLEFEVPF--NDSQALSLLQDVFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIM+S+  +  K+WKRVEV   +HV+VP +P+    E YD+   +Y+S +A E  P NR
Sbjct  59    SSIMISDKADQKKQWKRVEVKLEDHVRVPIFPSNMSPESYDEYFDNYISNIAAERLPQNR  118

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWEIH+ KYPT++AAG +IFKLHH+LGDGYSLMGA+LSCLQ A NP++PLTFPS + S+
Sbjct  119   PLWEIHILKYPTSHAAGTLIFKLHHALGDGYSLMGALLSCLQTAQNPSVPLTFPSLKSSS  178

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
                 +  +  +S FF ++       F T+ DF WS+ KS+ VEDDRTP+RSG+DGVEFRP
Sbjct  179   GPKTTHMTKTVSQFFSSV-------FQTLSDFSWSILKSSFVEDDRTPIRSGEDGVEFRP  231

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             I  +T++FS+D+IK IK+KL+VTINDV+ GII  GTR+YM++  ++SS  RCTALVL  T
Sbjct  232   ITLSTLTFSIDEIKLIKNKLRVTINDVIAGIIFLGTRIYMQEVTQKSSNERCTALVLLRT  291

Query  901   RAIGGGYKSVTEMIKP-NAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKR  1077
             R +  GY S  EMI+P NA M WGNQF FL   LP    +   +PL FV +A ++IK+K+
Sbjct  292   RNM-EGYLSTKEMIEPNNANMSWGNQFAFL--HLPVPKSSETLNPLDFVWEAQKMIKKKK  348

Query  1078  NSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIY  1257
             +SA+ YLT WLL  L K RG E  ARYIHGT KNSSM ISNMIGP+E+M+L N P  G+Y
Sbjct  349   SSAASYLTSWLLDVLKKFRGPEGAARYIHGTLKNSSMTISNMIGPVEKMALDNQPVGGLY  408

Query  1258  FIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             F++ G PQ L VT +SY+G LR+A   EK FID++K K  + +AF  I EA+
Sbjct  409   FMVVGPPQCLTVTALSYMGKLRVAFGAEKGFIDSQKLKASMQNAFGIILEAS  460



>ref|XP_011001806.1| PREDICTED: O-acyltransferase WSD1-like [Populus euphratica]
Length=458

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/453 (58%), Positives = 330/453 (73%), Gaps = 10/453 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPSAQ+LNSS L++++L VLE+E+PI   DS  I L++DVF+PINPRFSSIMV +  
Sbjct  11    EPVSPSAQYLNSSALNVSVLVVLETEVPI--DDSKTIPLVRDVFLPINPRFSSIMVIDE-  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG K+WKRVEV   +HV VP +P     +FYD+   DYLSK++M   P ++PLWEIHL K
Sbjct  68    NGEKRWKRVEVKLEDHVYVPIFPEEMSPQFYDEYFEDYLSKLSMLQLPQSQPLWEIHLIK  127

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAAG VIFK+HH++GDGYSLMGA+LSCLQRADNP+LPLT PS Q     PR   S 
Sbjct  128   YPTSNAAGTVIFKIHHAIGDGYSLMGALLSCLQRADNPSLPLTLPSVQ-----PRVDTSG  182

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                  FK +P+     FNTV DF  S+ KS+LVEDD +P+RSGD G+EFRPIA TTM+FS
Sbjct  183   DHRTIFKTVPQIFSLLFNTVSDFLGSLLKSSLVEDDLSPIRSGDIGIEFRPIAPTTMTFS  242

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSK-ARCTALVLFNTRAIGGGYK  924
             L QIKQIK  L VTINDV+TG I  GTRLYM++  + SS  + CTALV+ NTR     Y+
Sbjct  243   LGQIKQIKATLGVTINDVITGAIFLGTRLYMQEMSKGSSDHSNCTALVMLNTRMFRS-YQ  301

Query  925   SVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             S+ EM+KP AE PWGN F FL V LP L  +   +P+ FVRKA +I KRKR+S +VYLT 
Sbjct  302   SIKEMVKPKAESPWGNHFAFLHVQLPELVASTELNPIEFVRKAQQITKRKRSSLAVYLTA  361

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
               ++ + K +G EV A+YIH T  N+SM I+NMIGP+E+MSLANHP KG+YF +AG PQ 
Sbjct  362   AFVEFMKKLKGHEVAAQYIHKTMVNASMTITNMIGPVEKMSLANHPIKGMYFAVAGNPQR  421

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVH  1383
             L +T+VSYV +LR+ +  EK F+DA+K K C+ 
Sbjct  422   LNITIVSYVDNLRVTVGAEKGFLDAQKLKSCIE  454



>ref|XP_006469879.1| PREDICTED: O-acyltransferase WSD1-like [Citrus sinensis]
Length=465

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/465 (57%), Positives = 333/465 (72%), Gaps = 7/465 (2%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             +E+ E    E  SPS Q+LNSS LSL++LGVLESEIPI   DS   SLLKD+F+PINPRF
Sbjct  1     MELKEAEEMEPVSPSGQYLNSSALSLSVLGVLESEIPID--DSQCFSLLKDIFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV +  NG K+WKRVEV    HVKVP +P+G   E YD    DY+S++ ME FP ++
Sbjct  59    SSIMVVDE-NGEKQWKRVEVKLRNHVKVPIFPSGLSPEAYDKYFDDYISEIGMELFPQSQ  117

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWE+H+ KYPT++AAG +IFKLHHSLGDG+SLMGA+LSCLQRAD+P++PLTFPS  R  
Sbjct  118   PLWEVHIIKYPTSHAAGFLIFKLHHSLGDGFSLMGALLSCLQRADDPSVPLTFPSVNR--  175

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
               P +K     S  F  M +       TV DF WS  KS  ++DDRTP+ SGDDG+EFRP
Sbjct  176   -FPSNKKDGNNSNIFSNMYKTFCVVSETVSDFCWSFVKSAWLQDDRTPIYSGDDGIEFRP  234

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             ++  T +FSLDQIKQIK K+  T+NDV+ GII  GTRLYM++  + S +A  T LVL NT
Sbjct  235   VSVATTAFSLDQIKQIKTKVDATVNDVIAGIIFLGTRLYMQEMRQGSGEANSTTLVLLNT  294

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             RA    Y+SV +M+KP+A+ PWGN F FL VS+P L    +S+PL FV KA +I+  K+N
Sbjct  295   RAFRS-YESVKDMVKPDAKSPWGNYFAFLHVSIPKLADDWSSNPLDFVVKARQIMNVKKN  353

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S   YLTG LL+ + K RG E  ARYIH T KNSSM I+N+IGP+E+M+L NHP KG+YF
Sbjct  354   SLGAYLTGRLLEIVRKFRGPEAAARYIHSTLKNSSMTITNVIGPVEKMALNNHPCKGLYF  413

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFE  1395
             ++ G PQSL VT+VSY+G LRIA+  E  FID+ K K  + +AFE
Sbjct  414   VVTGAPQSLSVTIVSYMGKLRIAVVGEDGFIDSHKLKSSIENAFE  458



>ref|XP_006447283.1| hypothetical protein CICLE_v10015126mg [Citrus clementina]
 gb|ESR60523.1| hypothetical protein CICLE_v10015126mg [Citrus clementina]
Length=471

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/465 (57%), Positives = 333/465 (72%), Gaps = 7/465 (2%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             +E+ E    E  SPS Q+LNSS LSL++LGVLESEIPI   DS   SLLKD+F+PINPRF
Sbjct  1     MELKEAEEMEPVSPSGQYLNSSALSLSVLGVLESEIPID--DSQCFSLLKDIFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV +  NG K+WKRVEV    HVKVP +P+G   E YD    DY+S++ ME FP ++
Sbjct  59    SSIMVVDE-NGEKQWKRVEVKLRNHVKVPIFPSGLSPEAYDKYFDDYISEIGMELFPQSQ  117

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWE+H+ KYPT++AAG +IFKLHHSLGDG+SLMGA+LSCLQRAD+P++PLTFPS  R  
Sbjct  118   PLWEVHIIKYPTSHAAGFLIFKLHHSLGDGFSLMGALLSCLQRADDPSVPLTFPSVNR--  175

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
               P +K     S  F  M +       TV DF WS  KS  ++DDRTP+ SGDDG+EFRP
Sbjct  176   -FPSNKKDGNNSNIFSNMYKTFCVVSETVSDFCWSFVKSAWLQDDRTPIYSGDDGIEFRP  234

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             ++  T +FSLDQIKQIK K+  T+NDV+ GII  GTRLYM++  + S +A  T LVL NT
Sbjct  235   VSVATTAFSLDQIKQIKTKVDATVNDVIAGIIFLGTRLYMQEMRQGSGEANSTTLVLLNT  294

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             RA    Y+SV +M+KP+A+ PWGN F FL VS+P L    +S+PL FV KA +I+  K+N
Sbjct  295   RAFRS-YESVKDMVKPDAKSPWGNYFAFLHVSIPKLADDWSSNPLDFVVKARQIMNVKKN  353

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S   YLTG LL+ + K RG E  ARYIH T KNSSM I+N+IGP+E+M+L NHP KG+YF
Sbjct  354   SLGAYLTGRLLEIVRKFRGPEAAARYIHSTLKNSSMTITNVIGPVEKMALNNHPCKGLYF  413

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFE  1395
             ++ G PQSL VT+VSY+G LRIA+  E  FID+ K K  + +AFE
Sbjct  414   VVTGAPQSLSVTIVSYMGKLRIAVVGEDGFIDSHKLKSSIENAFE  458



>ref|XP_006446857.1| hypothetical protein CICLE_v10015143mg [Citrus clementina]
 gb|ESR60097.1| hypothetical protein CICLE_v10015143mg [Citrus clementina]
Length=466

 Score =   527 bits (1358),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 253/462 (55%), Positives = 327/462 (71%), Gaps = 11/462 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP  Q+ NSS+LS++IL VLE E+P    DS  I LLKD+F+PINPRFSSIMV E  
Sbjct  12    EPVSPIGQYFNSSILSISILAVLELEVPFD--DSWAIPLLKDIFLPINPRFSSIMVVEK-  68

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG K WK VEV    HV VPN+P G   +FYD CL DYLSK++ E  P ++PLWE+H+ K
Sbjct  69    NGVKHWKSVEVKLKNHVYVPNFPVGMSQQFYDKCLQDYLSKLSAEQMPQSQPLWEVHIVK  128

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAA +VIFKLHH+LGDG+SLMGA+LSCLQRAD+P+ PLTFPS        R +   
Sbjct  129   YPTSNAASSVIFKLHHALGDGFSLMGALLSCLQRADDPSRPLTFPSV-------RMRPDI  181

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
               S  FK +P+F    FNT  DF WS+ KS+L+EDD+TP+RSG     + PI  TTM+F 
Sbjct  182   NGSSIFKNVPKFFNTVFNTASDFCWSMIKSSLIEDDKTPIRSGSAAAGWLPITITTMTFP  241

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             L QIKQIKD L  T+NDVVTG I  G RLYM+   +ES+    TA+VL NTR       S
Sbjct  242   LHQIKQIKDNLGATLNDVVTGTIFLGIRLYMQAVNQESTNLHSTAVVLLNTRMFKS-ISS  300

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + EM+KP ++ PWGN F+FL +S+P LT A   +PL+F++KA  II+ KR S   YLT  
Sbjct  301   IKEMVKPGSKAPWGNHFSFLHISVPQLTNAEVQNPLKFIQKAQEIIQSKRGSFGAYLTAK  360

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL+ + K RG E  A++IHG+  NSS+ I+NM+GP+E+M+LANHP KG+YF++AG PQSL
Sbjct  361   LLETVKKLRGHETAAKFIHGSLNNSSLAITNMMGPVEKMALANHPIKGLYFMVAGSPQSL  420

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              VT+V+Y+G+LR++L  E+ FID+ K K C+ +AFE I +AA
Sbjct  421   VVTIVTYMGNLRVSLGTEEGFIDSPKLKSCIENAFEMILDAA  462



>gb|KDP24112.1| hypothetical protein JCGZ_25769 [Jatropha curcas]
Length=471

 Score =   527 bits (1357),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 260/463 (56%), Positives = 332/463 (72%), Gaps = 10/463 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+ Q+L++SVLSL I+ V+ES++PI   DS  +SLLKDVF+PINPRFSS+MV    
Sbjct  10    EPVSPTGQYLSNSVLSLCIISVVESQVPID--DSQAMSLLKDVFLPINPRFSSVMVMNK-  66

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G K+WK+VEV   +H+KVP +P G   +FY DCL DYLS +AME  P ++PLWEIH+ K
Sbjct  67    DGEKRWKKVEVQLKDHIKVPIFPTGMSTKFYSDCLDDYLSNLAMETLPQDQPLWEIHILK  126

Query  388   YPT-TNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
             YPT T  AGNVIFKLHHSLGDG+SLMGA+LSCLQRAD+P++PLTFPS Q  T     K S
Sbjct  127   YPTSTEVAGNVIFKLHHSLGDGFSLMGALLSCLQRADDPSIPLTFPSVQLHTNIESKKKS  186

Query  565   NKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSF  744
                    K+  R      NT+ DF  SV  S+ ++DD +P+RSG  GVEF P++  TMSF
Sbjct  187   -----ICKSWLRIFSSISNTISDFCSSVVISSFLKDDISPIRSGHPGVEFLPVSAVTMSF  241

Query  745   SLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYK  924
             SLDQIKQI+ KL VTINDV++G I  GTR+YM+   + S KAR  ALVL NTR  GG YK
Sbjct  242   SLDQIKQIRTKLGVTINDVISGTIFLGTRMYMEAMSKGSGKARTPALVLLNTRMFGG-YK  300

Query  925   SVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             S  EM KPN E+PWGN F FL V++P L+ +   DPL+F  KA + I+RKR S +VYLT 
Sbjct  301   SGQEMTKPNEELPWGNHFAFLSVTIPKLSGSEPKDPLQFAWKARKTIQRKRASFAVYLTA  360

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
               L+ + K RG E  ++Y+  T KNSS G++N+IGPME+M+LANHP KG YF++   PQS
Sbjct  361   KYLELVNKFRGPEAVSKYLRNTLKNSSTGLTNLIGPMEQMALANHPIKGFYFVVTNAPQS  420

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             L   +VSY+G LR+A  VEKDFID +K+K C+ +AFE I++AA
Sbjct  421   LMAGIVSYMGKLRVAALVEKDFIDQQKYKSCIENAFEMIFKAA  463



>ref|XP_011047658.1| PREDICTED: O-acyltransferase WSD1-like [Populus euphratica]
Length=474

 Score =   526 bits (1354),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 254/467 (54%), Positives = 342/467 (73%), Gaps = 10/467 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS QFLN+SVLS++I+ VLE E P    DSL I LL D+F+PINPRFSSIMV++  
Sbjct  11    EPVSPSGQFLNNSVLSISIIAVLELEEPFD--DSLAIPLLNDIFLPINPRFSSIMVTDK-  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G K+WK+VEV   +HV VP + +G   +FYD+CL DYLSKMAME FP ++PLWE+H+ K
Sbjct  68    DGVKRWKKVEVRLKDHVSVPVFASGMSTQFYDECLDDYLSKMAMEQFPQSQPLWEVHIIK  127

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT++AA N++FK HHSLGDG SLMGA+LSCL+RADNP+LPLTFPS Q       +  + 
Sbjct  128   YPTSHAASNIVFKFHHSLGDGISLMGALLSCLKRADNPSLPLTFPSVQL-----HANKNG  182

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
             +    F+ +PRFL   +NT+ +   ++ KS+L EDD+TP+RS   GVEF P++ TTM+FS
Sbjct  183   RDLSMFRKVPRFLSSVYNTLSEMCSTIAKSSLFEDDKTPIRSRHSGVEFLPVSITTMTFS  242

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD IKQIK +L VT+NDV+TG I  G R+YM+   + S  AR T+LVL NTR + GGY+S
Sbjct  243   LDHIKQIKARLGVTLNDVITGTIFLGIRIYMETVSQGSGNARSTSLVLLNTR-VHGGYRS  301

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANA-SDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             V EM+KP AE+PWGN F FL + +P LT A A ++PL+FV KA ++IKR+R+S  VYLT 
Sbjct  302   VQEMLKPGAELPWGNHFAFLNIPIPKLTDAEARNNPLQFVLKARKVIKRRRSSFGVYLTA  361

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
               LQ + K  G +  ++YIHGT +N+SMGI+N++GP+E++ + N P KG+YF++ G PQS
Sbjct  362   KYLQLVGKFSGPKRASKYIHGTLENTSMGITNLMGPVEQLVVGNSPIKGLYFVVTGAPQS  421

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
             L   +VSY G LR+AL VEK+FID +K +  +  AF  I++AA G+S
Sbjct  422   LMAGIVSYAGKLRVALLVEKNFIDPQKLRSHIDMAFGMIFKAACGTS  468



>ref|XP_006468957.1| PREDICTED: O-acyltransferase WSD1-like [Citrus sinensis]
Length=481

 Score =   526 bits (1354),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 251/462 (54%), Positives = 328/462 (71%), Gaps = 11/462 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP  Q+ NSS+LS++IL VLESE+P    DS  I LLKD+F+PINPRFSSIMV +  
Sbjct  12    EPVSPIGQYFNSSILSISILAVLESEVPFD--DSRAIPLLKDIFLPINPRFSSIMVVDK-  68

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG K WK VEV    HV VPN+P G   +FYD CL DYLSK++ E  P ++PLWE+H+ K
Sbjct  69    NGVKHWKSVEVKLKNHVYVPNFPVGMSQQFYDKCLQDYLSKLSAEQMPQSQPLWEVHIVK  128

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAA +VI KLHH+LGDG+SLMGA+LSCLQRAD+P+ PLTFPS        R +   
Sbjct  129   YPTSNAASSVILKLHHALGDGFSLMGALLSCLQRADDPSRPLTFPSV-------RMRPDI  181

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
               S  FK +P+F    FNT  DF WS+ KS+L+EDD+TP+RSG     + PI  TTM+F 
Sbjct  182   NGSSIFKNVPKFFNTVFNTASDFCWSMIKSSLIEDDKTPIRSGSAAAGWLPITITTMTFP  241

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             L QIKQIKD L  T+NDV+TG I  G RLYM+   +ES+    TA+VL NTR       S
Sbjct  242   LHQIKQIKDNLGATLNDVITGTIFLGIRLYMQAVNQESTNLHSTAVVLLNTRMFKS-ISS  300

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + EM+KP+++ PWGN F FL +S+P LT A   +PL+F++KA  II+ KR+S   YLT  
Sbjct  301   IKEMVKPDSKAPWGNHFAFLHISVPQLTNAEVQNPLKFIQKAQEIIQSKRSSFGAYLTAK  360

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL+ + K RG E  A++IHG+  NSS+ I+NM+GP+E+M+LANHP KG+YF++AG PQSL
Sbjct  361   LLETVKKLRGHETAAKFIHGSLNNSSLAITNMMGPVEKMALANHPIKGLYFMVAGSPQSL  420

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              VT+V+Y+G+LR++L  E+ FID+ K K C+ +AFE I +AA
Sbjct  421   VVTIVTYMGNLRVSLGAEEGFIDSPKLKSCIENAFEMILDAA  462



>ref|XP_003551727.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
 gb|KHN13629.1| O-acyltransferase WSD1 [Glycine soja]
Length=465

 Score =   525 bits (1351),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 254/475 (53%), Positives = 333/475 (70%), Gaps = 10/475 (2%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             +E ++   EE  SP  Q+ NSSVL + I+GVLE E+PI   D    +L+KDVF+PINPRF
Sbjct  1     MEYLKEEQEEPVSPMGQYFNSSVLCIYIIGVLEFEVPIH--DLQTFALIKDVFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SS+MV +  +G K+WK+V+VN  EHV  P +P GK +E YD    DYLS MAME  P ++
Sbjct  59    SSVMVQDK-DGEKRWKQVDVNLKEHVHFPKFPKGKTVESYDKFFHDYLSSMAMEQLPQSK  117

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLW IH+  YPT +A+ ++IFKLHH+LGDGYSL+GA+LSCLQRAD+P+LPL+FPS + S 
Sbjct  118   PLWSIHIINYPTNDASSSIIFKLHHALGDGYSLVGALLSCLQRADDPSLPLSFPSLRPS-  176

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
               P+S   N    F++        AFNTV DFGWSV KS+++ DD TP+RSGD+G EFRP
Sbjct  177   -KPQSSTEN----FWRRFSWMCSSAFNTVSDFGWSVLKSSIISDDETPIRSGDEGTEFRP  231

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             I  ++M FS+D IK IK +L VTINDV+TGI+ YGTRLYM+  + +S  A  TALVL NT
Sbjct  232   ICISSMDFSIDHIKDIKSRLGVTINDVITGIVFYGTRLYMQDMDSKSKTADSTALVLLNT  291

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R I G Y+S+ EM+   A+ PWGN+ +FL V +P L     S+PL F+  +H IIKRK+ 
Sbjct  292   RNIEG-YQSINEMLNNKAKGPWGNKISFLHVPIPKLNQNKMSNPLDFIWDSHNIIKRKKQ  350

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S +V LTG LL    K RG E  A+++ GT   SS  IS+++GPM++MSLANHP KG+YF
Sbjct  351   SLAVALTGILLDTESKFRGQEAVAKHLRGTVTKSSAVISSLVGPMQQMSLANHPVKGLYF  410

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
              +AG P+SL ++++SYVG LR+ L  EKDFID EK K C+  AF+ I EAA   S
Sbjct  411   TLAGGPESLAISIMSYVGVLRVTLKTEKDFIDEEKLKSCIQSAFQMILEAATAHS  465



>ref|XP_003552517.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=467

 Score =   522 bits (1345),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 255/473 (54%), Positives = 339/473 (72%), Gaps = 15/473 (3%)
 Frame = +1

Query  10    MEHGYEEAA---SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             MEH  EE A   SP  Q+ NSSVL + I+GVLE E+PI   D    +LLKDVF+PINPRF
Sbjct  1     MEHQKEEQAEPVSPVGQYFNSSVLCIYIIGVLEFEVPI--DDLQTYALLKDVFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV +  +G K+WK+V VN  +HVK+P +P GK +E YD    DYLS +AME  P +R
Sbjct  59    SSIMVQDK-DGEKRWKQVAVNLKDHVKIPTFPEGKTVETYDKYFQDYLSSIAMEQLPQSR  117

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLW+IH+  + T++A+  +IFKLHH+LGDGYSLMGA+LSCLQRADNP+LPL+FPS ++S 
Sbjct  118   PLWDIHIINHRTSDASSTIIFKLHHALGDGYSLMGALLSCLQRADNPSLPLSFPSLKQSK  177

Query  541   AAPRSKA-SNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFR  717
               P +K+ S KIS    +       AFNTV DFGWSV KS+++ DD+TP+R GD+G +F+
Sbjct  178   PEPSTKSFSRKISWMCSS-------AFNTVSDFGWSVLKSSIITDDKTPIRFGDEGADFQ  230

Query  718   PIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFN  897
             PI+ ++M+FS+D I++IK +L+VTINDVVTGII YGTRLYM+  + +S  A+ TALVL N
Sbjct  231   PISISSMTFSIDHIREIKSRLEVTINDVVTGIIFYGTRLYMQDIDSKSKTAQSTALVLLN  290

Query  898   TRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKR  1077
             TR I G Y+S+ +M+   A+ PWGN+ TFL V +P L     S+PL FV  +H IIKRK+
Sbjct  291   TRNIEG-YQSINDMLNTKAKGPWGNRITFLHVPIPKLNETRNSNPLEFVWDSHNIIKRKK  349

Query  1078  NSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIY  1257
              S  V LTG LL+   K RG E  A+ I GT   SS  ISN++GP+++M+LANHP KG+Y
Sbjct  350   QSLGVVLTGTLLEIEGKLRGQEAVAKRIRGTLTKSSAVISNLVGPIQQMALANHPVKGLY  409

Query  1258  FIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             F +AG P+SL ++++SY+G LR+ L  EK FID  K K C+  AF+ I +AA+
Sbjct  410   FTLAGGPESLVISIMSYMGVLRVTLKTEKGFIDEHKLKSCMQSAFDKILQAAM  462



>ref|XP_009782425.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Nicotiana 
sylvestris]
Length=439

 Score =   520 bits (1339),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 253/387 (65%), Positives = 307/387 (79%), Gaps = 11/387 (3%)
 Frame = +1

Query  10    MEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSI  189
             +E    E ASPS+Q+LNSS LSL ++ VLES+IPI+  +SL ++LLKDVFVPINPRFSSI
Sbjct  5     LEEEIFEPASPSSQYLNSSNLSLCVIAVLESKIPIEYEESLPLNLLKDVFVPINPRFSSI  64

Query  190   MVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLW  369
             MV+ G  G +KWKRVEVN+ +H+K P +P+ KP++FY++C S+Y+S +AME FP N+PLW
Sbjct  65    MVT-GKKGTRKWKRVEVNYEDHIKTPIFPSEKPLDFYNECFSNYISNLAMEQFPQNQPLW  123

Query  370   EIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAP  549
             EIH+FKYPT +AAG+VIFKLHHSLGDGYSLMGA+LSCLQR DNP+LPLTFPSRQR+T + 
Sbjct  124   EIHIFKYPTNDAAGSVIFKLHHSLGDGYSLMGALLSCLQRVDNPSLPLTFPSRQRTTLSS  183

Query  550   RSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
             + KA +      K +PRF  G  NTVYDFG S+ KSTLVEDDRT + SGD+GVEFRPI  
Sbjct  184   KDKAFS----VLKVVPRFFKGIVNTVYDFGESILKSTLVEDDRTAIHSGDEGVEFRPIVV  239

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAI  909
             TT +FSLD +KQIK  L VTINDV+TGI+ YGTRLYM++ ++ES   +CTALVLFNTRA+
Sbjct  240   TTKTFSLDCLKQIKASLNVTINDVITGIVEYGTRLYMQEVKQESCNGKCTALVLFNTRAL  299

Query  910   GGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASD-----PLRFVRKAHRIIKRK  1074
              GGYKSV +MIKPN++MPWGN FTFLPVSLP LT     D     PL FV+KAHR+I RK
Sbjct  300   -GGYKSVNDMIKPNSDMPWGNHFTFLPVSLPKLTNLANRDQSSINPLAFVQKAHRMIDRK  358

Query  1075  RNSASVYLTGWLLQALMKTRGSEVTAR  1155
             RNSASV+LT  LL  L K RG EVT R
Sbjct  359   RNSASVWLTSKLLDFLRKLRGPEVTGR  385



>ref|XP_004516682.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=470

 Score =   520 bits (1338),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 254/469 (54%), Positives = 327/469 (70%), Gaps = 11/469 (2%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             E    E  SP+ Q+LNSS L + ILGVLE EIPI  +D   +SLL+DVF+PIN RFSSIM
Sbjct  6     EEEITEPVSPTGQYLNSSALCIYILGVLEFEIPI--NDCQTLSLLQDVFLPINTRFSSIM  63

Query  193   VSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIE-FYDDCLSDYLSKMAMEAFPPNRPLW  369
             + + ING KKWK+VEVN  EH+K+P +P+ +     YD+CL +Y+SK+AME  P  RPLW
Sbjct  64    IRDQINGEKKWKKVEVNLEEHIKIPIFPSNESSNSLYDECLDEYMSKIAMERLPQQRPLW  123

Query  370   EIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAP  549
             EIH+ KYPT NAAG +IFKLHH+LGDGYSLMGA+LSCL+RADNP+LP T PS QR  +  
Sbjct  124   EIHIIKYPTKNAAGTLIFKLHHALGDGYSLMGALLSCLERADNPSLPFTLPSSQRPKSIF  183

Query  550   RSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
              +KA       FK  P      F +++DFGWS+ KS+L+EDD TP+RS  D V+ R I  
Sbjct  184   NTKA------IFKRFPSIFSSVFRSMFDFGWSIAKSSLIEDDLTPIRSRADDVKLRQITI  237

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAI  909
             + +SF ++ IK+IK +L V+INDV+ G+I +G RLYM +   ES KA  TALVL NTR+I
Sbjct  238   SNVSFFMEHIKEIKSRLGVSINDVIAGLIFFGIRLYMLEVNRESRKANSTALVLLNTRSI  297

Query  910   GGGYKSVTEMI-KPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSA  1086
              G YKSV EM+ K N    WGNQF FL V +P L      +PL F+ +AH+ I RK+NS 
Sbjct  298   KG-YKSVKEMVSKNNNGAAWGNQFAFLHVPIPELNDPKFENPLEFIWEAHKEINRKKNSL  356

Query  1087  SVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFII  1266
                LTG LL  +   RG E  ARY+H T +NSS  ISN+IGP+E+M+L NHP KG+YF++
Sbjct  357   VTPLTGMLLNMVKTLRGPEAAARYVHSTLRNSSTTISNIIGPVEQMALDNHPVKGLYFMV  416

Query  1267  AGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              G P+SL VT++SY+G LRIA   EKDFID +K KCC+  + E I +A+
Sbjct  417   VGPPESLTVTIMSYMGKLRIAFGSEKDFIDKQKIKCCMEKSLEMIIKAS  465



>ref|XP_002323706.1| hypothetical protein POPTR_0017s04300g [Populus trichocarpa]
 gb|EEF03839.1| hypothetical protein POPTR_0017s04300g [Populus trichocarpa]
Length=473

 Score =   520 bits (1338),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 260/467 (56%), Positives = 328/467 (70%), Gaps = 10/467 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS QFL++S+LSL+I+ V+E E P    DS  I  LKDVF+P+NPRFSSIMV +  
Sbjct  11    EPVSPSGQFLSNSILSLSIIAVMEFEAPFD--DSQAIPFLKDVFLPVNPRFSSIMVVDK-  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G K+WKRVEV  ++HV  P +  G   +FYD+C  +YLSK AME  P ++PLWE+H+  
Sbjct  68    DGVKRWKRVEVRLTDHVNFPVFTTGMSTQFYDECFDEYLSKTAMEQLPQSQPLWEVHIIN  127

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT++AA N+IFKLHHSLGDG+SLMGA+LSCLQRAD P LPLTFPS    T         
Sbjct  128   YPTSHAASNMIFKLHHSLGDGFSLMGALLSCLQRADAPPLPLTFPSVHLHT-----NTYG  182

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
             + S  F+ +PRF    +NT  DF  S  KS LV+DD+TP+RSG  GVEF P+A TTM+FS
Sbjct  183   RNSSMFRKVPRFFSSVYNTASDFCSSFIKSCLVKDDKTPIRSGHSGVEFLPVAITTMAFS  242

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LDQIKQIK KL VTIND +TGII  G R+YM+   + S  A  T+LVL NTR + GGYK 
Sbjct  243   LDQIKQIKAKLGVTINDAITGIIFLGARMYMETVSQGSGSACSTSLVLLNTR-MHGGYKP  301

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANA-SDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             + EM+KP+AE PWGN F FL V +P L  A   ++PL+FV  A +IIKRKR+S  VYLT 
Sbjct  302   IQEMVKPDAESPWGNHFAFLNVRIPKLRDAEVKNNPLKFVLNARKIIKRKRSSFGVYLTA  361

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
               LQ   K RG    ++YI+GT KN+SMGISN+ GPME+M+LAN+P  G+YF++ G PQS
Sbjct  362   KYLQLAAKFRGPNGASKYIYGTMKNTSMGISNVRGPMEQMALANNPINGLYFVVTGAPQS  421

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
             L   + SYVG LR++L VEKDFID +K K  +  AF+ I+EAA   S
Sbjct  422   LMAGVTSYVGKLRVSLLVEKDFIDPQKLKSHIEKAFDMIFEAACRES  468



>ref|XP_011001810.1| PREDICTED: O-acyltransferase WSD1-like [Populus euphratica]
Length=465

 Score =   519 bits (1337),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 256/463 (55%), Positives = 331/463 (71%), Gaps = 10/463 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E ASP+ Q+ NSS L+++IL VLE+E+PI   DS  I LL+DVF+PINPRFSSIMV +  
Sbjct  11    EPASPTGQYFNSSALNVSILSVLETEVPI--DDSNTIPLLRDVFLPINPRFSSIMVIDE-  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG KKWK+VEV   +HV VP +P     +FYD+ L DYLSK++M   P ++PLWEIHL K
Sbjct  68    NGEKKWKKVEVELKDHVSVPIFPEEMSPQFYDNYLEDYLSKLSMLQLPQSQPLWEIHLIK  127

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAAG +IFK+HH++GDGYSLMGA+LSCLQR DNP+LPLT PS Q     PR     
Sbjct  128   YPTSNAAGTIIFKIHHAIGDGYSLMGALLSCLQRVDNPSLPLTLPSVQ-----PRVDTFG  182

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                  FK +P+     F+TV DF  S+ KS+LVEDD +P+RSGD G+EFRPIA  +M+FS
Sbjct  183   DHGTIFKTVPKIFSLLFDTVSDFWESLMKSSLVEDDLSPIRSGDIGIEFRPIAHASMTFS  242

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSK-ARCTALVLFNTRAIGGGYK  924
             L QIKQIK  L VTINDV+TG I  GTRLYM++  + SS  + CTALVL NTR     Y+
Sbjct  243   LGQIKQIKATLGVTINDVITGAIFLGTRLYMQEMSKGSSDHSNCTALVLLNTRMFRS-YQ  301

Query  925   SVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             S+ EM+KP AE PWGN F FL V LP L  +   +P+ FVRKA +IIKRKR+S +VYLT 
Sbjct  302   SIKEMVKPKAESPWGNHFAFLHVQLPELVASTELNPIEFVRKAQQIIKRKRSSLAVYLTA  361

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
               ++ + K +G EV A+YI+ T  NSSM I+N+IGP+E+MSLANHP K +YF++ G PQ 
Sbjct  362   AFIEIVKKLKGHEVAAQYIYKTLLNSSMSITNIIGPVEKMSLANHPIKDMYFVLGGNPQG  421

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             L +T++SY+ +LR+ +   K FID +K K  +  AF+ I ++A
Sbjct  422   LTITIISYMDNLRVIVGAVKGFIDVQKLKSYIEEAFQMILKSA  464



>ref|XP_002310400.1| hypothetical protein POPTR_0007s00950g [Populus trichocarpa]
 gb|EEE90850.1| hypothetical protein POPTR_0007s00950g [Populus trichocarpa]
Length=474

 Score =   519 bits (1336),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 251/467 (54%), Positives = 340/467 (73%), Gaps = 10/467 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS QFLN+SVLS++I+ VLE E P    DSL I LL D+F+PINPRFSSIMV++  
Sbjct  11    EPVSPSGQFLNNSVLSISIIAVLELEEPFD--DSLAIPLLNDLFLPINPRFSSIMVTDK-  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G K+WK+VEV   +HV VP + +G   +FYD+CL DYLSKMAME FP ++PLWE+H+ K
Sbjct  68    DGVKRWKKVEVRLKDHVSVPVFASGMSTQFYDECLDDYLSKMAMEQFPQSQPLWEVHIIK  127

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT++AA N++FK HHSLGDG SLMGA+LSCL+RADNP+LPLTFPS Q       +  + 
Sbjct  128   YPTSHAASNIVFKFHHSLGDGISLMGALLSCLKRADNPSLPLTFPSVQL-----HANKNG  182

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
             +    F+ +PRFL   +NT+ +   ++ KS+L EDD+TP+RS   GVEF P++ TTM+FS
Sbjct  183   RDLSMFRKVPRFLSSVYNTLSEMCSTIAKSSLFEDDKTPIRSRHSGVEFLPVSITTMAFS  242

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD IKQIK +L VT+NDV+TG I  G R+YM+   + S  AR T+LVL NTR +  GY+S
Sbjct  243   LDHIKQIKARLGVTLNDVITGTIFLGVRIYMETVSQGSGNARSTSLVLLNTR-VHRGYRS  301

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANA-SDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             V EM+KP AE+PWGN F FL + +P L    A ++PL+FV KA ++IKR+R+S  VYLT 
Sbjct  302   VQEMLKPGAELPWGNHFAFLNIPIPKLRDEEARNNPLQFVLKARKVIKRRRSSFGVYLTA  361

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
               LQ + K  G +  ++YIHGT +N+S+GI+N++GP+E++++ N P KG+YF++ G PQS
Sbjct  362   KYLQLVGKFSGPKRASKYIHGTLENTSIGITNLMGPIEQLAVGNSPIKGLYFVVTGSPQS  421

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
             L   +VSY G LR+AL VEKDFID +K +  +  AF  I++AA G+S
Sbjct  422   LMTGIVSYAGKLRVALLVEKDFIDPQKLRSHIDKAFGMIFKAACGTS  468



>ref|XP_007139588.1| hypothetical protein PHAVU_008G042300g [Phaseolus vulgaris]
 gb|ESW11582.1| hypothetical protein PHAVU_008G042300g [Phaseolus vulgaris]
Length=465

 Score =   515 bits (1327),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 250/475 (53%), Positives = 337/475 (71%), Gaps = 13/475 (3%)
 Frame = +1

Query  10    MEHGYEEAA---SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             M+H  EE A   SP  Q+ NSS L + I+GVLE E+PI   D    +L+KDVF+PINPRF
Sbjct  1     MDHLNEEQAEPVSPMGQYFNSSALCIYIIGVLEFEVPIH--DLQTFTLIKDVFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV +  +G K+WK+VEVN  +HV  P +P GK +E YD    DYLS +AME  P +R
Sbjct  59    SSIMVQDK-DGEKRWKQVEVNLKDHVHFPKFPKGKTVESYDKFFHDYLSSIAMEQLPQSR  117

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWEIH+  YP+ +A+G++IFKLHH+LGDGYSL+GA+LSCLQRAD+P+LPL+FP+ +  +
Sbjct  118   PLWEIHVISYPSKDASGSIIFKLHHALGDGYSLVGALLSCLQRADDPSLPLSFPTLR--S  175

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
               P+S   +    F++        A NT  DFGWSV KS+++ DD+TP+RSGD+G EFRP
Sbjct  176   LKPQSSTKS----FWRRFSWMFSSAINTATDFGWSVLKSSIISDDKTPIRSGDEGTEFRP  231

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             I+ +TM+FS+D IK IK +L VTINDV+TGI+ YGTRLYM+  + +S  A  TALVL NT
Sbjct  232   ISISTMNFSIDHIKIIKSRLGVTINDVITGIVFYGTRLYMQDVDLKSKTADSTALVLLNT  291

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R I G Y+++ +M+   A+ PWGN+ +FL V +P L     S+PL F+  +H IIKRK+ 
Sbjct  292   RNIEG-YQTINDMLNSKAKGPWGNKISFLHVPIPKLNQNRMSNPLDFIWDSHNIIKRKKQ  350

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S +V LTG LL    K +G E  A+++ GT  NSS  IS+++GP+++MSLANHP KG+YF
Sbjct  351   SLAVALTGTLLDMESKFKGQEAVAKHLRGTVTNSSAVISSLVGPIQQMSLANHPVKGLYF  410

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
              +AG P+SL ++++SYVG LRI L  EKDFID EK K C+ +AF  I +AA  +S
Sbjct  411   TLAGGPESLAISIMSYVGVLRITLKTEKDFIDEEKLKSCIQNAFHTILKAATENS  465



>ref|XP_007139590.1| hypothetical protein PHAVU_008G042500g [Phaseolus vulgaris]
 gb|ESW11584.1| hypothetical protein PHAVU_008G042500g [Phaseolus vulgaris]
Length=470

 Score =   514 bits (1324),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 250/472 (53%), Positives = 330/472 (70%), Gaps = 13/472 (3%)
 Frame = +1

Query  10    MEHGYEEAA---SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             MEH  EE A   SP  Q+ NSSVL + I+GVLE ++PI   D    +LL+DVF+PINPRF
Sbjct  1     MEHQKEELAEPVSPVGQYFNSSVLCIYIIGVLEFDVPID--DLQTYALLRDVFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV +   G K+WK+V+VN  +HV +P +P GK +E +D    DYLS ++ME  P +R
Sbjct  59    SSIMVQDK-EGEKQWKQVDVNLKDHVNIPIFPEGKTVEVHDKYFHDYLSSISMEQLPQSR  117

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWEIH+  YPT+ A   +IFKLHH+LGDGYSLMGA+LSCL RADNP LPL+FPS ++S 
Sbjct  118   PLWEIHMINYPTSAACSTIIFKLHHALGDGYSLMGALLSCLHRADNPLLPLSFPSLKQSN  177

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
               P +K+   +S  F  M   L  AFNTV DFGWSV KS+++ DD+TP+R GDDG +F+P
Sbjct  178   PEPSTKS---LSRKFSWM---LSSAFNTVSDFGWSVLKSSIISDDKTPIRFGDDGADFQP  231

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             I+ ++M+FS+D IK IK +L VTINDV+TGI+ YGTRLYM+  + +S  +  TALVL NT
Sbjct  232   ISISSMTFSIDHIKDIKSRLGVTINDVITGIVFYGTRLYMQDMDSKSKSSHSTALVLLNT  291

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R I G Y+S+ +M+   A+ PWGN+ TFL V +P L     S PL F+R +H IIKRK+ 
Sbjct  292   RNIEG-YQSINDMLNTKAKGPWGNKITFLHVPIPKLNETRISTPLEFIRDSHNIIKRKKQ  350

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S  V LTG LL    K RG E  A+ I GT   SS  ISN++GP+++M+L NHP KG+YF
Sbjct  351   SFGVVLTGTLLDMEGKLRGQEAVAKRIRGTLTKSSAVISNLVGPVQQMALVNHPVKGLYF  410

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
              +AG P+SL ++++SY+G +R+ L  EKDFID +K   C+  AFE I  AA+
Sbjct  411   TLAGGPESLVISIMSYMGVIRVTLKTEKDFIDEQKLMACIQSAFEMILRAAM  462



>emb|CAN62907.1| hypothetical protein VITISV_043611 [Vitis vinifera]
Length=438

 Score =   510 bits (1314),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 257/421 (61%), Positives = 312/421 (74%), Gaps = 14/421 (3%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             ++  SP+ Q+ NSSVL ++I+ +LES+IPI   DS  +SLLKDVF+PINPRFSS+MV E 
Sbjct  12    DQPVSPTGQYFNSSVLQVSIMSILESDIPID--DSPTLSLLKDVFLPINPRFSSLMV-ED  68

Query  205   INGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
              NG K WKRVEV   +HV VP +P G   E YDD   D L+K+AM+ FP +RPLWEIH+ 
Sbjct  69    KNGVKHWKRVEVKLEDHVNVPIFPDGLSPESYDDYFDDCLTKIAMKEFPQSRPLWEIHII  128

Query  385   KYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
             KYPT+NAAG V+FKLHH+LGDG+SLMGA+LSCLQRADNP LP+TFPS + S        S
Sbjct  129   KYPTSNAAGTVVFKLHHALGDGFSLMGALLSCLQRADNPNLPITFPSFKVS--------S  180

Query  565   NKISG--FFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
             N  SG    +A+PR L  AFNTV DFGW + KST VEDDRTP+RSGD GVEFRP++  T+
Sbjct  181   NLDSGRSIIRAVPRALSAAFNTVSDFGWGLLKSTAVEDDRTPIRSGDPGVEFRPMSIATI  240

Query  739   SFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGG  918
             SFSLD I++IK KL VTINDV+TGII +GTRLYM+     S  A  TALVL NTR I  G
Sbjct  241   SFSLDNIQKIKAKLGVTINDVLTGIIFFGTRLYMQSMNHASRNANSTALVLLNTRVI-SG  299

Query  919   YKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYL  1098
             YKS+ EM   ++   WGNQF FL V+LP L  A  + PL FV KA + I+RKRNS +V+L
Sbjct  300   YKSLKEMTASDSSSQWGNQFAFLHVTLPELVDAKFTSPLDFVAKAQQTIQRKRNSLAVHL  359

Query  1099  TGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIP  1278
             TG LL+ L K RG EVTARYIHGT KNSSM ISNMIGPME+++LANHP +G+YF+  G P
Sbjct  360   TGRLLETLRKYRGPEVTARYIHGTLKNSSMTISNMIGPMEQVALANHPCRGMYFMTLGSP  419

Query  1279  Q  1281
             +
Sbjct  420   E  420



>ref|XP_003534457.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=471

 Score =   509 bits (1312),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 247/472 (52%), Positives = 328/472 (69%), Gaps = 12/472 (3%)
 Frame = +1

Query  10    MEHGYEEA---ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             MEH  EE     SP  Q+ NSSVL + I+GVLE E+PI   D    +LLKDVF+PINPRF
Sbjct  1     MEHQKEEQLEPVSPVGQYFNSSVLCIYIIGVLEFEVPI--DDLQTYALLKDVFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV +  +G K+WK+V+VN ++HV +P +P GK  E YD    DYLS +AME  P +R
Sbjct  59    SSIMVQDK-DGEKRWKQVDVNLTDHVNIPTFPEGKTAESYDKYFHDYLSSIAMEQLPQSR  117

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLW+IH+  Y T++A+  +IFKLHH+LGDGYSLMGA+LSCLQRAD+P+LPL+FPS ++S 
Sbjct  118   PLWDIHIINYLTSDASSTIIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSLKQSK  177

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
               P S  S     F +        AFNTV DFGWSV KS+++ DD+TP+R GD+G +++P
Sbjct  178   QEPSSTKS-----FCRKFSWMCSSAFNTVSDFGWSVLKSSIISDDKTPIRFGDEGADYQP  232

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             I+ ++M+FS+D I+ IK +L VTINDVVTGI+ YGTRLYM+  + +S  A  TALVL NT
Sbjct  233   ISISSMTFSIDHIRDIKSRLGVTINDVVTGIVFYGTRLYMQDMDSKSKTAHSTALVLLNT  292

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R + G Y+S+ +M+   A  PWGN+ TFL V +P L     ++PL F+   H IIKRK+ 
Sbjct  293   RNVEG-YQSINDMLNTKATGPWGNRITFLHVPIPKLNETRTTNPLEFIWDTHNIIKRKKQ  351

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S  V LTG LL+   K RG E  A+ I GT   SS  ISN+ GP+++M+LANHP KG+YF
Sbjct  352   SLGVVLTGTLLKIEGKLRGQEAVAKRIRGTLTKSSAVISNLAGPIQQMALANHPVKGLYF  411

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
              +AG P+SL ++++SY+G L + L  EKDFID  K K C+  AFE I +AA+
Sbjct  412   TLAGGPESLVISVMSYMGVLSVTLKTEKDFIDEHKLKLCMQSAFEIILQAAM  463



>ref|XP_011001811.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Populus euphratica]
Length=473

 Score =   509 bits (1311),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 262/467 (56%), Positives = 332/467 (71%), Gaps = 10/467 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS QFL+SS+LSL+I+ V+E E P   S +  I  LKDVF+PINPRFSSIMV++  
Sbjct  11    EPVSPSGQFLSSSILSLSIIAVMEFEAPFDNSQA--IPFLKDVFLPINPRFSSIMVADK-  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G K+WKRVEV  ++HV  P +  G   +FYD+C  +YLSKMAME  P ++PLWE+H+  
Sbjct  68    DGVKRWKRVEVRLTDHVNFPVFTTGMSTQFYDECFDEYLSKMAMEQLPQSQPLWEVHIIN  127

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT++AA N+IFKLHHSLGDG+SLMGA+LSCLQRAD P LPLTFPS Q  T       S 
Sbjct  128   YPTSHAASNIIFKLHHSLGDGFSLMGALLSCLQRADAPPLPLTFPSVQLHT-----NTSG  182

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
             +    F+ +PRF    +NT  DF  S+ +S LV+DD+TP+RSG  GVEF P+A TTM+FS
Sbjct  183   RNCSMFRKVPRFFSSVYNTASDFCSSIIQSCLVKDDKTPIRSGHSGVEFLPVAITTMTFS  242

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LDQIKQIK KL VTINDV+TGII  G R+YM+   + S  A  T+LVL NTR + GGYKS
Sbjct  243   LDQIKQIKAKLGVTINDVITGIIFLGARMYMETVSQGSGSACSTSLVLLNTR-MHGGYKS  301

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANA-SDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             + EM+KP+AE PWGN F FL V +P L  A A ++PL+F+  A +IIK+KR S  V LT 
Sbjct  302   IQEMVKPDAESPWGNHFAFLNVRIPKLRDAEAKNNPLKFILNARKIIKKKRTSFGVNLTA  361

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
               LQ + K RG    ++YI+GT +N+SMGISN+ GPME+M+LAN+P  G+YF++ G PQS
Sbjct  362   KYLQLVAKFRGPNGASKYIYGTMENTSMGISNVRGPMEQMALANNPINGLYFVVTGAPQS  421

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
             L   + SYVG LR+AL VEKDFID  K K     AF+ I+EAA   S
Sbjct  422   LVAGVTSYVGKLRVALLVEKDFIDPRKLKSHTEKAFDMIFEAACRES  468



>ref|XP_008229085.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=463

 Score =   508 bits (1308),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 248/459 (54%), Positives = 333/459 (73%), Gaps = 18/459 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+ Q+ +S V++L++L VLE EIPI   +S  +SLLK+VF+PI+PRFSSIMV    
Sbjct  10    EPVSPNGQYFSSDVITLSVLAVLEFEIPIDI-ESQTMSLLKNVFLPISPRFSSIMVEN--  66

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G K+WKRVEV   +HV +P++P+    E YD+ L +Y+SK++ E +P  +PLWE+H+ K
Sbjct  67    DGKKEWKRVEVKLEDHVNIPSFPSNLSPESYDEYLEEYMSKLSTERYPQGKPLWEVHIIK  126

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAAGN+IFK HH+LGDGYSLMGA++S LQRADNP+LPLTFPSRQ S +  R     
Sbjct  127   YPTSNAAGNIIFKFHHALGDGYSLMGALISTLQRADNPSLPLTFPSRQLSESKKR-----  181

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                 FF  + +    A NT+ D  W + K TL EDD TP++S +D +EFRP    TM+FS
Sbjct  182   --ENFF--VTKIFSSACNTISDIWWGISK-TLKEDDLTPIKSSNDAIEFRPSTIATMTFS  236

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LDQ+K IK+KL VT+NDV+TG+I +GTRLYM++ ++ SS A CTA+VL NTR I G Y  
Sbjct  237   LDQLKSIKNKLGVTLNDVLTGMIFFGTRLYMQEIDQSSSTADCTAMVLLNTR-IMGDYMP  295

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTP-ANASDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             + EMIKPN++MPWGN+FTFL V +P LT  +NA D   F+R  H++IK+KRNS +VY T 
Sbjct  296   IEEMIKPNSKMPWGNRFTFLQVPIPKLTELSNADD---FIRNTHKMIKKKRNSLAVYFTS  352

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
              LL+ + K    E ++RYIH T KNSSM ISNMIGP+E+MSLANHP KG YF++ G+PQ 
Sbjct  353   RLLEIVNKFGSHEASSRYIHRTLKNSSMVISNMIGPVEQMSLANHPIKGFYFLVPGLPQG  412

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGI  1401
               +T+VSY+G +R+A  +EK  ID +K K C+ +A + I
Sbjct  413   FDITIVSYMGKVRLAFKMEKGIIDPQKLKSCMENALDMI  451



>gb|KHN11595.1| O-acyltransferase WSD1 [Glycine soja]
Length=471

 Score =   507 bits (1306),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 246/472 (52%), Positives = 328/472 (69%), Gaps = 12/472 (3%)
 Frame = +1

Query  10    MEHGYEEA---ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             MEH  EE     SP  Q+ NSS+L + I+GVLE E+PI   D    +LLKDVF+PINPRF
Sbjct  1     MEHQKEEQLEPVSPVGQYFNSSMLCIYIIGVLEFEVPI--DDLQTYALLKDVFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV +  +G K+WK+V+VN ++HV +P +P GK  E YD    DYLS +AME  P +R
Sbjct  59    SSIMVQDK-DGEKRWKQVDVNLTDHVNIPTFPEGKTAESYDKYFHDYLSSIAMEQLPQSR  117

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLW+IH+  Y T++A+  +IFKLHH+LGDGYSLMGA+LSCLQRAD+P+LPL+FPS ++S 
Sbjct  118   PLWDIHIINYLTSDASSTIIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSLKQSK  177

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
               P S  S     F +        AFNTV DFGWSV KS+++ DD+TP+R GD+G +++P
Sbjct  178   QEPSSTKS-----FCRKFSWMCSSAFNTVSDFGWSVLKSSIISDDKTPIRFGDEGADYQP  232

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             I+ ++M+FS+D I+ IK +L VTINDVVTGI+ YGTRLYM+  + +S  A  TALVL NT
Sbjct  233   ISISSMTFSIDHIRAIKSRLGVTINDVVTGIVFYGTRLYMQDMDSKSKTAHSTALVLLNT  292

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R + G Y+S+ +M+   A  PWGN+ TFL V +P L     ++PL F+   H IIKRK+ 
Sbjct  293   RNVEG-YQSINDMLNTKATGPWGNRITFLHVPIPKLNETRTTNPLEFIWDTHNIIKRKKQ  351

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S  V LTG LL+   K RG E  A+ I GT   SS  ISN+ GP+++M+LANHP KG+YF
Sbjct  352   SLGVVLTGTLLKIEGKLRGQEAVAKRIRGTLTKSSAVISNLAGPIQQMALANHPVKGLYF  411

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
              +AG P+SL ++++SY+G L + L  EKDFID  K K C+  AFE I +AA+
Sbjct  412   TLAGGPESLVISVMSYMGVLSVTLKTEKDFIDEHKLKLCMQSAFEIILQAAM  463



>ref|XP_007198876.1| hypothetical protein PRUPE_ppa022031mg [Prunus persica]
 gb|EMJ00075.1| hypothetical protein PRUPE_ppa022031mg [Prunus persica]
Length=464

 Score =   507 bits (1305),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 246/459 (54%), Positives = 332/459 (72%), Gaps = 17/459 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+ Q+ +S V++L++L VLE EIPI  ++S  +SLLK+VF+PI+PRFSSIMV    
Sbjct  10    EPVSPNGQYFSSDVITLSVLAVLEFEIPIIDAESQTMSLLKNVFLPISPRFSSIMVEN--  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G K+W+RVEV   +HV +P +P+    E YD  L DYLS+++ E +P  +PLWE+H+ K
Sbjct  68    DGKKEWRRVEVKLEDHVMIPIFPSNLSPESYDQYLEDYLSRLSTERYPQGKPLWEVHIIK  127

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAAGNV+FK HH+LGDGYSLMGA++S LQRADNP+LPLTFPSRQRS +  R     
Sbjct  128   YPTSNAAGNVVFKFHHALGDGYSLMGALISTLQRADNPSLPLTFPSRQRSESKKR-----  182

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                 FF  + +    A NT+ D  W + K TL EDD TP++S +D +EFRP    TM+FS
Sbjct  183   --ENFF--VTKIFSSACNTISDIWWGISK-TLKEDDLTPIKSSNDAIEFRPSTIATMTFS  237

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LDQ+K IK+K  VT+NDV+TG+I +GTRLYM++ ++ SS A CTA+VL NTR + G Y  
Sbjct  238   LDQLKSIKNKFGVTLNDVLTGMIFFGTRLYMQEIDQSSSTADCTAMVLLNTRLM-GDYMP  296

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTP-ANASDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             + EMIKPN++MPWGN+FTFL V +P LT  +NA D   F+R  H++IKRKRNS + + T 
Sbjct  297   IEEMIKPNSKMPWGNRFTFLQVPIPNLTELSNAED---FIRHTHKMIKRKRNSLAAHFTS  353

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
              LL+ + K    E ++RYIH T KNSSM ISNMIGP+E+MSLANHP KG YF++ G+PQ 
Sbjct  354   RLLEIVNKFGSREASSRYIHRTLKNSSMVISNMIGPVEQMSLANHPIKGFYFLVPGLPQG  413

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGI  1401
               +T+VSY+G++R+A  +EK  ID +K K C+ +A + I
Sbjct  414   FDITIVSYMGNVRLAFKMEKGIIDPQKLKSCMENALDMI  452



>ref|XP_007198851.1| hypothetical protein PRUPE_ppa016739mg [Prunus persica]
 gb|EMJ00050.1| hypothetical protein PRUPE_ppa016739mg [Prunus persica]
Length=464

 Score =   506 bits (1304),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 246/459 (54%), Positives = 332/459 (72%), Gaps = 17/459 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+ Q+ +S V++L++L VLE EIPI  ++S  +SLLK+VF+PI+PRFSSIMV    
Sbjct  10    EPVSPNGQYFSSDVITLSVLAVLEFEIPIIDAESQTMSLLKNVFLPISPRFSSIMVEN--  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G K+W+RVEV   +HV +P +P+    E YD  L DYLS+++ E +P  +PLWE+H+ K
Sbjct  68    DGKKEWRRVEVKLEDHVMIPIFPSNLSPESYDQYLEDYLSRLSTERYPQGKPLWEVHIIK  127

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAAGNV+FK HH+LGDGYSLMGA++S LQRADNP+LPLTFPSRQRS +  R     
Sbjct  128   YPTSNAAGNVVFKFHHALGDGYSLMGALISTLQRADNPSLPLTFPSRQRSESKKR-----  182

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                 FF  + +    A NT+ D  W + K TL EDD TP++S +D +EFRP    TM+FS
Sbjct  183   --ENFF--VTKIFSSACNTISDILWGISK-TLKEDDLTPIKSSNDAIEFRPSTIATMTFS  237

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LDQ+K IK+K  VT+NDV+TG+I +GTRLYM++ ++ SS A CTA+VL NTR + G Y  
Sbjct  238   LDQLKSIKNKFGVTLNDVLTGMIFFGTRLYMQEIDQSSSTADCTAMVLLNTRLM-GDYMP  296

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTP-ANASDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             + EMIKPN++MPWGN+FTFL V +P LT  +NA D   F+R  H++IKRKRNS + + T 
Sbjct  297   IEEMIKPNSKMPWGNRFTFLQVPIPNLTELSNAED---FIRHTHKMIKRKRNSLAAHFTS  353

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
              LL+ + K    E ++RYIH T KNSSM ISNMIGP+E+MSLANHP KG YF++ G+PQ 
Sbjct  354   RLLEIVNKFGSREASSRYIHRTLKNSSMVISNMIGPVEQMSLANHPIKGFYFLVPGLPQG  413

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGI  1401
               +T+VSY+G++R+A  +EK  ID +K K C+ +A + I
Sbjct  414   FDITIVSYMGNVRLAFKMEKGIIDPQKLKSCMENALDMI  452



>ref|XP_003539933.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
 gb|KHN35218.1| O-acyltransferase WSD1 [Glycine soja]
Length=470

 Score =   504 bits (1299),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 243/463 (52%), Positives = 334/463 (72%), Gaps = 9/463 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS +F N++VL   + G LESE+PI+ S +    L +DVF+P+NP FSSIMV +  
Sbjct  9     EPVSPSGRFFNTTVLCAYVFGFLESEVPIEFSQAKY--LFEDVFLPVNPHFSSIMVRDE-  65

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
              G  KWKRVEV   +HVK+P +P  + +E YD    DY++K+ ME  P ++PLWEIH+ K
Sbjct  66    EGEMKWKRVEVKFEDHVKIPTFPENESLELYDQYFDDYVTKILMERTPQDKPLWEIHVIK  125

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAAG +IFKLHH+LGDGYSL+GA+LSCLQRAD+P+LPL+FPSR+ S ++     S 
Sbjct  126   YPTSNAAGTLIFKLHHALGDGYSLVGALLSCLQRADDPSLPLSFPSRKSSASS-----SP  180

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                GFF+     LF  FN++ DFGWS+ KS++VEDD TP+RSG++GVE  P   + +SF 
Sbjct  181   SKKGFFRLFSSTLFSFFNSISDFGWSIVKSSIVEDDETPIRSGEEGVESLPCVISNISFD  240

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LDQ+K+IK KL VT+NDV+TG I YG RLYM++ + ++ KA  T LV+ +TR IG  Y+S
Sbjct  241   LDQVKKIKSKLGVTVNDVITGAIFYGIRLYMQEIDNKAGKANSTGLVMLSTRNIGS-YQS  299

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + EM+K +++ PWGN  +FL V +P L+ A+ S+PL FV KA +IIKRKR S +V+L  W
Sbjct  300   IQEMMKADSKSPWGNHISFLHVPIPKLSQASLSNPLEFVWKAQKIIKRKRKSFTVFLIEW  359

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL   +K RG E  A++I+GT +NSS+ +SN+IGP+E M+LANHP KG+YF + G P+S+
Sbjct  360   LLDMELKLRGHEAVAKHIYGTLRNSSVVVSNLIGPIEPMALANHPVKGLYFTMTGGPESI  419

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
              + ++SY  +LRI L  +K FID +KFK CV  AFE I +AA+
Sbjct  420   NIAVISYTKTLRITLKTQKGFIDEKKFKFCVVKAFEVISKAAM  462



>ref|XP_008365935.1| PREDICTED: O-acyltransferase WSD1-like [Malus domestica]
Length=478

 Score =   503 bits (1296),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 251/469 (54%), Positives = 332/469 (71%), Gaps = 18/469 (4%)
 Frame = +1

Query  22    YEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSE  201
             Y E  SP+ Q LN+SVLS+++LGVLESE+PI   +S ++S L+DVF+ INPRF SIMV  
Sbjct  12    YNEPVSPTGQCLNTSVLSMSVLGVLESEVPID--ESKIMSFLQDVFLHINPRFCSIMVD-  68

Query  202   GINGGKKWKRVEVNHSEHVKVPNYPAGK-PIEFYDDCLSDYLSKMAMEAFPPNRPLWEIH  378
              ++G K+WK+VEV  ++HV VP +P+G  P E YD  L DY+SK+ +E +P ++PLWE+H
Sbjct  69    -VDGEKQWKKVEVKLTDHVHVPIFPSGVLPPESYDLYLGDYISKVVLEKYPEDKPLWEVH  127

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
             + KYPT+ AAGN+IFKLHH+LGDGYS M A LSCLQRAD+P+LPLTFPSR+ S    R  
Sbjct  128   IIKYPTSTAAGNLIFKLHHALGDGYSFMSAFLSCLQRADDPSLPLTFPSRRGSE---RKG  184

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
               N      + + + L  AF  V D GWS F    VEDDRTP+RSG+ GVEF P+  +++
Sbjct  185   LDNYYKSALRWVSQKLTSAFYAVKDLGWSAF----VEDDRTPIRSGNSGVEFLPMDISSL  240

Query  739   SFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQC----EEESSKARCTALVLFNTRA  906
              FSLD+IK IK+KL VTINDV  GI+ + TRLYM++     ++ SS A C ALVL NTR 
Sbjct  241   IFSLDEIKLIKNKLNVTINDVTCGIVFFATRLYMQEIINNNQKSSSAASCRALVLVNTRI  300

Query  907   IGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSA  1086
               G YK V +MI PN+EMPWGN+  F+PVS+P LT    S+PL FV +A + IKRKR+S 
Sbjct  301   THGDYKPVKQMIGPNSEMPWGNRIAFMPVSMPNLT--EISNPLDFVFEAQKRIKRKRSSF  358

Query  1087  SVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFII  1266
             SVY    L + + K RG E  +RY+H     SS+ ISNMIGP+E+++LA+HP KG+YF++
Sbjct  359   SVYFYNKLFEIVSKLRGHEAASRYMHNRLMKSSLMISNMIGPVEKIALADHPIKGVYFMV  418

Query  1267  AGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              GIPQ + +T+VSY+G LRI+   +K FID +KFK C+ +AFE I E  
Sbjct  419   LGIPQDIIITIVSYMGDLRISFGTQKGFIDPQKFKSCLKNAFEMILEVT  467



>ref|XP_008228990.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=473

 Score =   503 bits (1294),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 252/471 (54%), Positives = 338/471 (72%), Gaps = 18/471 (4%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             +E   HG  E  SP+ Q LNSSVLS++ILGVLE EIPI  ++S ++S L+DVF+ I+PRF
Sbjct  1     MEYEVHG-NEPVSPTGQCLNSSVLSMSILGVLEFEIPI--NESKILSFLQDVFLNISPRF  57

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV   ING K+WKRVEV   +HV VP +P+G   + YDD   DY+S + +E +P ++
Sbjct  58    SSIMVD--INGEKQWKRVEVKLRDHVHVPIFPSGMSPKSYDDHFHDYISNIILEQYPKDK  115

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWE+H+ KYPT++AAGN+IFKLHH+LGDGYS M A+LSCLQRADNP LPLT PSRQ S 
Sbjct  116   PLWEVHIIKYPTSSAAGNLIFKLHHALGDGYSFMSALLSCLQRADNP-LPLTLPSRQGSQ  174

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
                R   S  I   F+ +       F+T+ DF W+    +L +DDRTP+RSG+ GVEF P
Sbjct  175   ---RGGDSGSI---FRWVSETSASVFDTLKDFSWN----SLFQDDRTPIRSGNYGVEFLP  224

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             +  ++++FSLD+IK IK KL  T+NDV++G + + TRLYM++  ++SS A CTALVL NT
Sbjct  225   MTVSSITFSLDEIKLIKTKLNATVNDVISGALFFATRLYMQEKSQKSSTASCTALVLVNT  284

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R   G YK + E+IKP++EMPWGN+  F+PV++P LT    S+PL FV KA ++IKRKR+
Sbjct  285   RITHGDYKPIKEIIKPDSEMPWGNRMAFMPVTMPKLT--EFSNPLDFVFKAQKLIKRKRS  342

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S +VY+   + + + K RG E  +RY+H   KNSS  ISNMIGP E+M+LA+HP +G+YF
Sbjct  343   SFAVYINSKMSEIVKKIRGYEGASRYMHSRLKNSSFMISNMIGPTEQMALADHPVRGVYF  402

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             ++ GIPQ L +T+VSY+G LRIA   +K  ID EKFK C+ +AF+ I EA 
Sbjct  403   MVLGIPQDLIITVVSYMGKLRIAFGTQKGLIDPEKFKACMENAFKMILEAT  453



>ref|XP_007198906.1| hypothetical protein PRUPE_ppa1027135mg [Prunus persica]
 gb|EMJ00105.1| hypothetical protein PRUPE_ppa1027135mg [Prunus persica]
Length=491

 Score =   502 bits (1293),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 249/466 (53%), Positives = 336/466 (72%), Gaps = 17/466 (4%)
 Frame = +1

Query  16    HGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMV  195
             HG  E  SP  Q LNSSVLS++ILGVLE EIPI  ++S ++S L+DVF+ I+PRFSSIMV
Sbjct  6     HG-NEPVSPIGQCLNSSVLSMSILGVLEFEIPI--NESKILSFLQDVFLNISPRFSSIMV  62

Query  196   SEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
                +NG K+WKRVEV   +HV VP +P+G   + YDD   DY+S + +E +P ++PLWE+
Sbjct  63    D--VNGEKQWKRVEVKLRDHVHVPIFPSGMSPKSYDDHFQDYISNIILEQYPKDKPLWEV  120

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRS  555
             H+ KYPT++AAGN+IFK HH+LGDGYS M A+LSCLQRADNP LPLTFPSR+ S     S
Sbjct  121   HIVKYPTSSAAGNLIFKFHHALGDGYSFMSALLSCLQRADNP-LPLTFPSRRGSKPGGDS  179

Query  556   KASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTT  735
             +     S F   +       F+TV DF W+    +L++DDRTP+RSG+ GVEF P+  ++
Sbjct  180   E-----SIFRWDVSETFASVFDTVKDFSWN----SLLQDDRTPIRSGNYGVEFLPMTVSS  230

Query  736   MSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGG  915
             ++FSLD+IK IK KL  T+NDV++G + + TRLYM++  ++SS A CTALVL NTR   G
Sbjct  231   ITFSLDEIKLIKTKLNATVNDVISGALFFATRLYMQEKSQKSSTASCTALVLVNTRITQG  290

Query  916   GYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVY  1095
              YK + EM KP++EMPWGN+  F+PV++P LT    S+PL FV KA ++IKRKR+S +VY
Sbjct  291   DYKPIKEMNKPDSEMPWGNRMAFMPVTMPKLT--EFSNPLDFVFKAQKLIKRKRSSFAVY  348

Query  1096  LTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGI  1275
             +   +L+ + K RG E  +RY+H   KNSS+ ISNMIGP E+M+LA+HP +G+YF++ GI
Sbjct  349   INNKMLEIVKKIRGYEGASRYMHNRLKNSSLMISNMIGPAEQMALADHPVRGVYFMVLGI  408

Query  1276  PQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             PQ L VT+VSY+G LRIA+  +   ID +KFK C+ +AF+ I EA 
Sbjct  409   PQDLIVTVVSYMGKLRIAIGTQNGLIDPDKFKACMENAFKMILEAT  454



>ref|XP_010260233.1| PREDICTED: O-acyltransferase WSD1-like [Nelumbo nucifera]
Length=474

 Score =   500 bits (1288),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 245/463 (53%), Positives = 325/463 (70%), Gaps = 8/463 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E ASP AQ+LNSS LSL IL  LE E+PI   DS  ++L+K++F+PINPRFSSI+V +  
Sbjct  18    ELASPHAQYLNSSALSLCILAALEIEVPID--DSQTVALIKEMFLPINPRFSSILVKDD-  74

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
              G  +W+RV V   +HV VP +P G     YD    DY+SK++ E   P+RP WEIHLFK
Sbjct  75    QGIGQWRRVSVKPEDHVHVPVFPGGLSTAAYDGYFQDYMSKISTETLRPDRPPWEIHLFK  134

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT++AAG V+FKLHH+LGDG+SLMGA+ SCLQRADNP+LPLTFP+   S + P  +  +
Sbjct  135   YPTSSAAGTVVFKLHHALGDGFSLMGALFSCLQRADNPSLPLTFPA---SLSKP-IQDDH  190

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                G      R++   FN+  +F WS+ +S   EDD+TP+RSGD G+EFRP   +T++ S
Sbjct  191   GSCGILTRTLRYISMVFNSTSEFAWSLLRSNFWEDDKTPIRSGDAGIEFRPKIVSTLTLS  250

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             +DQI+QIKDK+  TINDV+ GII YGTRLYM    ++SS    TALVL NTR IG   + 
Sbjct  251   IDQIRQIKDKIGATINDVLCGIIFYGTRLYMHTSSKKSSNLCSTALVLLNTRIIGN-IQP  309

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + EM+K   + PWGN F FL V +P L  ++ ++PL FV KA +II++KR+S +VYL G 
Sbjct  310   IKEMMKQGTKAPWGNHFAFLHVPIPTLADSDTANPLDFVLKAKQIIRKKRSSLAVYLNGK  369

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             L+  + + RG E TA+YIH T + +SMGISNM+GP E+M LA +P  G+YF++ G PQ +
Sbjct  370   LIDTMRQLRGPEKTAQYIHSTIRKTSMGISNMVGPKEKMCLAGYPIGGLYFLVTGAPQCV  429

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
              VT VSY+G+LRIA++VEK FID + FK C+  AFE I EAAL
Sbjct  430   SVTAVSYMGNLRIAVAVEKGFIDNQLFKSCMEKAFERISEAAL  472



>ref|XP_007199626.1| hypothetical protein PRUPE_ppa016286mg [Prunus persica]
 gb|EMJ00825.1| hypothetical protein PRUPE_ppa016286mg [Prunus persica]
Length=466

 Score =   497 bits (1279),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 252/467 (54%), Positives = 327/467 (70%), Gaps = 24/467 (5%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP+  +  SSVLS++ L VLE+EIP   S ++   L+++VF+PI+PRFSSIMV    NG
Sbjct  12    VSPTGHYFTSSVLSVSNLAVLETEIPFDESQTMY--LVQNVFLPISPRFSSIMVEN--NG  67

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              K+WKRVEV   +HV +P +P+    E YD  L DY+SK+A+E   P +PLWE H+ KYP
Sbjct  68    KKRWKRVEVKLEDHVNIPIFPSSLSPEAYDKYLDDYISKLAVERLSPEKPLWEFHIIKYP  127

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T+NAAGNVI KLHH+LGDG+SLM A+LSCLQRAD+P LPLTFPSRQRS   P+S++    
Sbjct  128   TSNAAGNVIIKLHHALGDGFSLMSALLSCLQRADDPRLPLTFPSRQRS--QPKSES----  181

Query  574   SGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLD  753
                   + +     FNT+ DF W +  ST+ EDD TP+RSG  G+EF+PIA +TM+FSLD
Sbjct  182   -----LVTKVCSSVFNTLSDFWWGISNSTMDEDDLTPIRSG-KGIEFQPIAVSTMTFSLD  235

Query  754   QIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVT  933
             QIK IK KL VTINDV+TG+I  GTRLYM++ ++ S KAR TA+VL NTR + G Y S+ 
Sbjct  236   QIKLIKSKLGVTINDVLTGMIFLGTRLYMQEIDKSSRKARGTAVVLLNTRMM-GDYTSIQ  294

Query  934   EMIKPNAEMPWGNQFTFLPVSLPALTPANASDP-------LRFVRKAHRIIKRKRNSASV  1092
             EMIKPN++MPWGN FTFL V +P L       P       L FV KA +II  KRNS ++
Sbjct  295   EMIKPNSKMPWGNHFTFLHVPIPNLFLPEDDHPHEYSNIALEFVSKAQKIISTKRNSLAI  354

Query  1093  YLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAG  1272
             YLT   L+ L K  G E  A+YI  T KNSSM ISN+IGP+E+M+L NH  KG+YF++ G
Sbjct  355   YLTSRFLEILNKFGGHEAAAKYIRSTLKNSSMVISNLIGPVEQMALGNHRIKGLYFLVLG  414

Query  1273  IPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              P+ L VT+VSY+G +R+A  +EK  ID +KFK C+ +AFE I +A+
Sbjct  415   SPEGLDVTIVSYMGKVRVAFKMEKGLIDPQKFKSCMENAFEMILKAS  461



>ref|XP_008237425.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=466

 Score =   496 bits (1278),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 253/467 (54%), Positives = 327/467 (70%), Gaps = 25/467 (5%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGG  216
             SP+  +  SSVLS++ L VLE+EIP   S ++  SL+++VF+PI+PRFSSIMV    NG 
Sbjct  12    SPTGHYFTSSVLSVSNLAVLETEIPFDESQTM--SLVQNVFLPISPRFSSIMVEN--NGK  67

Query  217   KKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYPT  396
             K+WKRVEV   +HV +P +P     E YD  L DY+SK+A+E   P +PLWE H+ KYPT
Sbjct  68    KRWKRVEVKLEDHVTIPIFPPNLSPESYDKYLDDYISKLAVERLSPEKPLWEFHIIKYPT  127

Query  397   TNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKIS  576
             +NAAGNVI KLHH+LGDG+SLM A+LSCLQRAD+P LPLTFPSRQRS   P+S++     
Sbjct  128   SNAAGNVIIKLHHALGDGFSLMSALLSCLQRADDPRLPLTFPSRQRS--QPKSES-----  180

Query  577   GFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLDQ  756
                  + +     FNT+ DF W +  ST+ EDD TP+RSG  G+EF+PIA +TM+FSLDQ
Sbjct  181   ----LVTKVCSSVFNTLSDFWWGISNSTMDEDDLTPIRSG-KGIEFQPIAVSTMTFSLDQ  235

Query  757   IKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVTE  936
             IK IK KL VTINDV+TG+I  GTRLYM++ ++ S KAR TA+VL NTR + G Y S+ E
Sbjct  236   IKLIKRKLGVTINDVLTGMIFLGTRLYMQEIDKSSRKARGTAVVLLNTRMM-GDYTSIQE  294

Query  937   MIKPNAEMPWGNQFTFLPVSLPALTPANASDP--------LRFVRKAHRIIKRKRNSASV  1092
             MIKPN++MPWGN FTFL V +P L       P        L FV KA +II  KRNS ++
Sbjct  295   MIKPNSKMPWGNHFTFLHVPIPNLFLPEDDHPHEYSSIIALEFVSKAQKIISTKRNSLAI  354

Query  1093  YLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAG  1272
             YLT   L+ L +  G E  A+YI  T KNSSM ISNMIGP+E+M+L NH  KG+YF++ G
Sbjct  355   YLTSRFLEILNRFGGHEAAAKYIRSTLKNSSMVISNMIGPVEQMALGNHRIKGLYFLVLG  414

Query  1273  IPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              P+ L VT+VSY+G +R+A  +EK  ID +KFK C+ +AFE I +A+
Sbjct  415   SPEGLDVTIVSYMGKVRVAFKMEKGLIDPQKFKSCMENAFEMILKAS  461



>ref|XP_008791832.1| PREDICTED: O-acyltransferase WSD1-like [Phoenix dactylifera]
Length=478

 Score =   497 bits (1279),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 244/476 (51%), Positives = 334/476 (70%), Gaps = 17/476 (4%)
 Frame = +1

Query  4     EMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFS  183
             E  E  Y E  SP+ Q+ NSS LS+ IL V ES++PI   DS  +S L+++F+PINPRFS
Sbjct  8     EGEEAAYNEPVSPTGQYFNSSALSICILVVFESDVPID--DSPTMSTLENLFLPINPRFS  65

Query  184   SIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRP  363
             SIMV +  NG ++WKRV+V   +HV VP +P G  +E YD C+ DYLS++A+E  P +RP
Sbjct  66    SIMVKDE-NGVQQWKRVKVKLGDHVNVPTFPTG--LESYDQCVQDYLSQIALEKLPQSRP  122

Query  364   LWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTA  543
             LW++H+ KYPT+NA G ++FKLHH+LGDG+SLMGA+ SCL RAD+P+LPLTFP+      
Sbjct  123   LWDLHIIKYPTSNAEGTMVFKLHHALGDGFSLMGALFSCLHRADDPSLPLTFPT------  176

Query  544   APRSKASNK--ISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFR  717
              PR KA  K         +PR L    NT+ D GWS++KSTL EDD TP+RSG  G+EFR
Sbjct  177   -PRDKAMKKSLWGSICGVVPRVLSVCANTIRDVGWSLWKSTLAEDDTTPLRSGTPGLEFR  235

Query  718   PIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSK--ARCTALVL  891
             PI  + + FSLD I++IK  +  T+NDV++GII YGT+LYM++  E   +  AR TA+VL
Sbjct  236   PITISCVEFSLDDIRKIKAAVGGTVNDVISGIIFYGTKLYMQRVGEGQRRRAARVTAMVL  295

Query  892   FNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKR  1071
              NTR +   Y++V +M K NA+ PWGNQF FL VS+P    A  +DPL F+RKA +IIK 
Sbjct  296   LNTRIVSR-YETVEKMTKTNAKSPWGNQFGFLHVSIPTSKNAEKADPLYFIRKARKIIKA  354

Query  1072  KRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKG  1251
             KR+S +VYLTG LL+ L K +G E  A YIH T + SSM +SN++GP+E+  +A HP + 
Sbjct  355   KRSSFAVYLTGRLLEMLRKLKGPEAAALYIHTTLRKSSMTVSNLVGPIEQTIIAGHPVRS  414

Query  1252  IYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALG  1419
              +F++ G+PQSL +T++SY+G L++A+ VEK FID+E     +  +FE I+EAA+G
Sbjct  415   FHFMVVGVPQSLTITVISYMGKLKVAMGVEKGFIDSELLISSLKKSFERIFEAAIG  470



>gb|KHN47659.1| O-acyltransferase WSD1 [Glycine soja]
Length=467

 Score =   496 bits (1278),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 244/465 (52%), Positives = 331/465 (71%), Gaps = 14/465 (3%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP+ Q+L SS LS+ ILGVLE+E+PI   DS  + LL+++F+PIN RFSSIM+ + 
Sbjct  10    EEPVSPTGQYLTSSSLSVYILGVLETEVPID--DSQTVPLLQNLFLPINSRFSSIMIRDK  67

Query  205   INGGKKWKRVEVNHSEHVKVPNYPAGKPIEF-YDDCLSDYLSKMAMEAFPPNRPLWEIHL  381
              NG K+WK+VEV   +H+KVP +P GK   F YD+ L +YLS +A+E  P NRPLWE+H+
Sbjct  68    -NGEKRWKKVEVKLEDHIKVPTFPNGKSSNFLYDEYLDEYLSTIAVEYLPHNRPLWELHI  126

Query  382   FKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKA  561
              KYPT NA G ++FKLHH+LGDG+SLMGA+LSC+QRADN +LP T PS  R    P++  
Sbjct  127   IKYPTNNAKGTLVFKLHHALGDGFSLMGALLSCMQRADNTSLPFTLPSSLR----PKASI  182

Query  562   SNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMS  741
             SN   G FK +P   F    T+ +FGWS  KS ++EDD+TP+RS  +  + R I  + ++
Sbjct  183   SN-TKGVFKKLPSIFF---QTISEFGWSFLKSNMIEDDQTPIRSCAEDFKTRQITISDVT  238

Query  742   FSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGY  921
             FSLD IK++K KL V+INDV+ G+I +G RLYM++   +SS+ + TALVL NTR I G Y
Sbjct  239   FSLDLIKEVKSKLGVSINDVLAGVIFFGIRLYMQEINLKSSQTQSTALVLLNTRNIEG-Y  297

Query  922   KSVTEMI-KPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYL  1098
             KSV EMI K N+   WGNQ+ FL V +P L+ +  ++PL F+R+AH  + +K+NS +  L
Sbjct  298   KSVKEMINKTNSRSSWGNQYAFLHVPIPELSDSKYANPLEFIREAHMDMTKKKNSLATPL  357

Query  1099  TGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIP  1278
             TG LL  L K RG E  ARY+  T +NSS  ISN+IGP+E+M++ANHP KG YF++AG P
Sbjct  358   TGMLLDMLRKLRGPEAAARYLRNTLRNSSTTISNIIGPVEQMAVANHPIKGFYFMVAGSP  417

Query  1279  QSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             +SL +T++SY+G +RIA  VEKDFID + FK C+ ++ E I EAA
Sbjct  418   ESLTMTIMSYMGKIRIAFGVEKDFIDKQLFKSCLENSLEMIKEAA  462



>ref|XP_002319796.2| hypothetical protein POPTR_0013s08300g [Populus trichocarpa]
 gb|EEE95719.2| hypothetical protein POPTR_0013s08300g [Populus trichocarpa]
Length=455

 Score =   496 bits (1276),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 249/465 (54%), Positives = 322/465 (69%), Gaps = 27/465 (6%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+ Q+ NSS L++++LGVLE+E+PI   DS  I  L DVF+PINPRFSSIMV +  
Sbjct  11    EPVSPTGQYFNSSALNVSVLGVLETEVPID--DSKTIPFLMDVFLPINPRFSSIMVIDE-  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG K+WK+VEV   +HV VP +PA    +FYD                 N+PLWEIH  K
Sbjct  68    NGEKRWKKVEVKFKDHVYVPIFPAEMSPQFYD-----------------NQPLWEIHFIK  110

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAAG VIFK+HHS+GDGYSL+GA+LSCLQRADNP+LPLT PS Q     PR   S 
Sbjct  111   YPTSNAAGTVIFKIHHSIGDGYSLVGALLSCLQRADNPSLPLTLPSVQ-----PRVDTSG  165

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                  FK +P+     F TV DF  S+ KS+LVEDD +P+RSGD G+EFRPIA  +M+FS
Sbjct  166   DHGTIFKTVPKIFSLLFYTVSDFLGSLMKSSLVEDDLSPIRSGDIGIEFRPIALASMTFS  225

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSK-ARCTALVLFNTRAIGGGYK  924
             L QIKQIK  L VTINDV+TG I  GTRLYM++  + SS  + CTALVL NTR     Y+
Sbjct  226   LGQIKQIKATLGVTINDVITGAIFLGTRLYMQEMSKGSSNHSNCTALVLLNTRMFRS-YQ  284

Query  925   SVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             S+ EM+KP AE PWGN F FL V LP L  +   +P+ FVRK+ +IIKRKR+S +V+LT 
Sbjct  285   SIKEMVKPKAESPWGNHFAFLHVQLPELVASTELNPIEFVRKSQQIIKRKRSSWAVHLTA  344

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
               ++ + K +G EV A+ IH T  N+S+ I+NMIGP+E+MSLANHP K ++F++AG PQS
Sbjct  345   AFVETVKKLKGHEVAAQCIHKTLLNASVLITNMIGPVEKMSLANHPIKDMFFVLAGNPQS  404

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALG  1419
             L +T+ SY+ +LR+ +  EK F+D +K K C+  AF+ I ++A G
Sbjct  405   LTITIASYMDNLRVTVGAEKGFVDVQKLKSCIEEAFQMILKSAAG  449



>ref|XP_003541280.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=467

 Score =   496 bits (1276),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 244/465 (52%), Positives = 331/465 (71%), Gaps = 14/465 (3%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP+ Q+L SS LS+ ILGVLE+E+PI   DS  + LL+++F+PIN RFSSIM+ + 
Sbjct  10    EEPVSPTGQYLTSSSLSVYILGVLETEVPID--DSQTVPLLQNLFLPINSRFSSIMIRDK  67

Query  205   INGGKKWKRVEVNHSEHVKVPNYPAGKPIEF-YDDCLSDYLSKMAMEAFPPNRPLWEIHL  381
              NG KKW++VEV   +H+KVP +P GK   F YD+ L +YLS +A+E  P NRPLWE+H+
Sbjct  68    -NGEKKWEKVEVKLEDHIKVPTFPNGKSSNFLYDEYLDEYLSTIAVEHLPHNRPLWELHI  126

Query  382   FKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKA  561
              KYPT NA G ++FKLHH+LGDG+SLMGA+LSC+QRADN +LP T PS  R    P++  
Sbjct  127   IKYPTNNAKGTLVFKLHHALGDGFSLMGALLSCMQRADNTSLPFTLPSSLR----PKASI  182

Query  562   SNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMS  741
             SN   G FK +P   F    T+ +FGWS  KS ++EDD+TP+RS  +  + R I  + ++
Sbjct  183   SN-TKGVFKKLPSIFF---QTISEFGWSFLKSNMIEDDQTPIRSCAEDFKTRQITISDVT  238

Query  742   FSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGY  921
             FSLD IK++K KL V+INDV+ G+I +G RLYM++   +SS+ + TALVL NTR I G Y
Sbjct  239   FSLDLIKEVKSKLGVSINDVLAGVIFFGIRLYMQEINLKSSQTQSTALVLLNTRNIEG-Y  297

Query  922   KSVTEMI-KPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYL  1098
             KSV EMI K N+   WGNQ+ FL V +P L+ +  ++PL F+R+AH  + +K+NS +  L
Sbjct  298   KSVKEMINKTNSRSSWGNQYAFLHVPIPELSDSKYANPLEFIREAHMDMTKKKNSLATPL  357

Query  1099  TGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIP  1278
             TG LL  L K RG E  ARY+  T +NSS  ISN+IGP+E+M++ANHP KG YF++AG P
Sbjct  358   TGMLLDMLRKLRGPEAAARYLRNTLRNSSTTISNIIGPVEQMAVANHPIKGFYFMVAGSP  417

Query  1279  QSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             +SL +T++SY+G +RIA  VEKDFID + FK C+ ++ E I EAA
Sbjct  418   ESLTMTIMSYMGKIRIAFGVEKDFIDKQLFKSCLENSLEMIKEAA  462



>gb|KEH30692.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=471

 Score =   496 bits (1277),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 234/462 (51%), Positives = 332/462 (72%), Gaps = 10/462 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS Q+ N+  L   + G LE EIPI   DS  + L++ +F+PINPRFSSI+V +  
Sbjct  9     EPVSPSGQYFNTPPLCSYVFGFLELEIPID--DSQAMYLIQHLFLPINPRFSSIIVRDK-  65

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G  KWK+VEVN  +H KVP +P  + IEFYD    DY+SK+ +E  P ++PLWEIH+ K
Sbjct  66    DGNMKWKKVEVNPKDHFKVPVFPKNESIEFYDQDFDDYVSKILIERTPKDKPLWEIHVIK  125

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAA  +IFKLHH+LGDGYSLMGA+LSCL RAD+P+LPL+FP+R+ S      +   
Sbjct  126   YPTSNAAYTIIFKLHHALGDGYSLMGALLSCLHRADDPSLPLSFPNRKSSQLLTPKR---  182

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                GFFK  P  +F  FN++ DFGWS+ KS+++EDD++P+ +G++G EF P A + +SFS
Sbjct  183   ---GFFKWFPSTIFSLFNSISDFGWSILKSSIIEDDKSPIWNGEEGSEFLPCALSNLSFS  239

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD+I  IK KL VTINDV+TG+I YG RLYM++ + +++ +  T LVL +TR IG  Y+S
Sbjct  240   LDEIITIKSKLGVTINDVITGVIFYGIRLYMQEIDNKATTSNSTGLVLLSTRNIGS-YQS  298

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + +M K +++ PWGN  +FL + +P L+  + S+PL FV KA +IIKRKR++ +V+LT W
Sbjct  299   IQDMTKADSKSPWGNHISFLHIPIPKLSQPSLSNPLDFVWKAQKIIKRKRSTFTVFLTEW  358

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL   +K RG E  A++++GT +NSS+ +SN+IGP+E M+LANHP KG+YFI++G P+S+
Sbjct  359   LLDMQLKLRGHEAVAKHLYGTLRNSSVVMSNLIGPVEPMALANHPVKGLYFIMSGAPESI  418

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              + ++SY   LRI L  +KD ID +KFK C+  A+E I +AA
Sbjct  419   DIAVMSYARILRITLKTQKDLIDEQKFKLCMARAYEIISKAA  460



>ref|XP_011001809.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Populus euphratica]
Length=422

 Score =   492 bits (1266),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 241/416 (58%), Positives = 312/416 (75%), Gaps = 9/416 (2%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP+ Q+ NSSVLS+ IL VLESE+PI   DS  ++LLKDVF+PINPRFSSIMV++  NG
Sbjct  14    VSPTGQYFNSSVLSICILAVLESEVPID--DSHTMTLLKDVFLPINPRFSSIMVNDK-NG  70

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              K+WKRVEV    HV +P +P G     YD   +DY+S++A++ FP ++PLWEIH+ KYP
Sbjct  71    VKQWKRVEVQLQNHVSIPIFPIGLSTTSYDSYFNDYISRLALKQFPQSQPLWEIHVVKYP  130

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T+ AAGN+IFKLHH+LGDG+SLMGA+LSCLQRADNP+L LTFPS Q  +    S +   I
Sbjct  131   TSKAAGNIIFKLHHALGDGFSLMGALLSCLQRADNPSLSLTFPSLQFPSYPDCSFSKLNI  190

Query  574   SGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLD  753
             +     +P+ +   FNT+ DFGWS+ KS+ VED R+P+RSGD+ V+F+PI  +T++FSLD
Sbjct  191   T-----VPKCISSIFNTISDFGWSLLKSSFVEDSRSPIRSGDEEVQFKPIVISTIAFSLD  245

Query  754   QIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVT  933
              IKQIK  L VTINDV+TGII YGTRLYM++ +++S+ A  TALVL NTR I  GY+SV 
Sbjct  246   HIKQIKSTLGVTINDVITGIIFYGTRLYMQRVDDKSTNANSTALVLLNTRVI-SGYRSVK  304

Query  934   EMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLL  1113
             EM +P+AE PWGNQF FL VS+P LT +  S+PL  V  A  II+RKR+S +V LTG LL
Sbjct  305   EMFEPDAESPWGNQFGFLHVSVPELTDSRFSNPLECVTIAQEIIQRKRSSLAVNLTGRLL  364

Query  1114  QALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQ  1281
             + L K RG E TA++I  T  NSSM ISN+IGP+++M+LANHP KG YF++ G+PQ
Sbjct  365   EVLRKFRGPEATAKHIKKTLFNSSMTISNIIGPVDKMALANHPIKGFYFMVVGVPQ  420



>ref|XP_010260232.1| PREDICTED: O-acyltransferase WSD1-like [Nelumbo nucifera]
Length=470

 Score =   493 bits (1268),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 244/465 (52%), Positives = 326/465 (70%), Gaps = 7/465 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP AQ+LNSSVLS+ +L VLESE+PI  S + V  LL+ + +PINPRFSSIMV +  
Sbjct  13    EPVSPHAQYLNSSVLSICVLAVLESEVPIDDSQTTV--LLEKMLLPINPRFSSIMVLDD-  69

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G   WK+VEV   +HV+V  +P G P   YD+C  +Y+SK++ME  P +RPLWEIHLFK
Sbjct  70    HGVGHWKKVEVKLEDHVRVAVFPDGLPATTYDECFQEYMSKISMEMLPQSRPLWEIHLFK  129

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAAG V+ K HH+LGDG+SLMGA+ SC +RAD+P+LPLTFPS  R    P +  + 
Sbjct  130   YPTSNAAGTVVLKFHHALGDGFSLMGALFSCTRRADDPSLPLTFPS-SRPKPIPNNHGAG  188

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
              +S   KA   F+   FN+  DF WS+ KS+ +ED++ P+RSG  GVEFRP   +T++ S
Sbjct  189   GLSILKKAH-GFVSLLFNSASDFAWSLLKSSFLEDEQNPIRSGTAGVEFRPKTVSTVNLS  247

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD+I QIK+K+  TINDV+ G+I YG RLYM      SS    TALVL NTR I    +S
Sbjct  248   LDRIGQIKEKIGGTINDVLCGVIFYGVRLYMYNSNRSSSHISSTALVLLNTRIINN-IQS  306

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + EM+KP+ + PWGN F FL VS+P L  A+ + PL FV KA +I+KRKR+S +VYL   
Sbjct  307   IQEMMKPDTKAPWGNYFAFLHVSIPILD-ADTTTPLDFVLKARQIVKRKRSSLAVYLNAK  365

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL+   K RG E  A+ IH T KN+S+ I+NM+GP E+++LA HP  G+YF ++G+PQSL
Sbjct  366   LLETTRKFRGPERAAQIIHSTLKNTSLAITNMVGPKEKVTLAGHPVSGLYFTVSGVPQSL  425

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGS  1422
              +T VSY+G+LR+ +  EKDFID ++FK C+  AF  I+EAAL +
Sbjct  426   TITAVSYMGTLRLGVEAEKDFIDNQQFKSCIEEAFRKIFEAALSA  470



>ref|XP_010935670.1| PREDICTED: O-acyltransferase WSD1-like [Elaeis guineensis]
Length=475

 Score =   492 bits (1266),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 246/474 (52%), Positives = 329/474 (69%), Gaps = 12/474 (3%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             VE  +    +  SP  Q+ +SS LS+ IL + ESEIPI   DS  +  L+++F+PINPRF
Sbjct  3     VEGGQVAENQPVSPMGQYFSSSALSVNILAIFESEIPID--DSQAMWTLENLFLPINPRF  60

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV    +G   W++V++N  EHV +P +P G  +EFYDD + +YLSK+  E  P +R
Sbjct  61    SSIMVKNE-HGILTWRKVKINLEEHVNIPVFPPG--LEFYDDYVQEYLSKIGTELLPHDR  117

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLW IH+  YPT +A G ++FKLHH+LGDG+SLMGA+ SCLQRAD+P+LPL FPS   S 
Sbjct  118   PLWGIHIINYPTRDAPGTMVFKLHHALGDGFSLMGALFSCLQRADDPSLPLNFPSSGES-  176

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
                 S+   K     K++ RFL   FNT +DFG S   S  +EDDRTP+RSGD G+E RP
Sbjct  177   ----SRQFAKWIRIDKSIYRFLHMCFNTFWDFGRSFLMSNCMEDDRTPIRSGDSGIEIRP  232

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSK-ARCTALVLFN  897
             I  +T +FSL  IKQIK KLK T+NDVVTGII YG +LYM+   + + K +R TALV  N
Sbjct  233   ITLSTATFSLHDIKQIKAKLKATVNDVVTGIIFYGIQLYMQAASQGNIKTSRVTALVTLN  292

Query  898   TRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKR  1077
             TRAI   Y+S+ EM KPN++  WGN F FL VS+P    A  +DPL FV KA RII+ KR
Sbjct  293   TRAIKS-YQSIQEMTKPNSKSRWGNHFAFLHVSIPKCKDAENADPLEFVHKAKRIIRSKR  351

Query  1078  NSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIY  1257
             NS ++YLT  LL+ L K +G E  ARYIH TSKN+++ ISNMIGPME++ +A HP K +Y
Sbjct  352   NSLAIYLTSGLLELLRKLKGPEAAARYIHATSKNTTLVISNMIGPMEQVQIAGHPIKSLY  411

Query  1258  FIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALG  1419
             F++  +PQSL VT++SY+G +++A+ +EK FI++E F  C+  +F+ IY+AA+G
Sbjct  412   FMMVHVPQSLTVTIISYMGKVKMAVGMEKGFINSEVFVSCMEKSFQRIYKAAVG  465



>ref|XP_008241433.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=470

 Score =   490 bits (1261),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 243/467 (52%), Positives = 323/467 (69%), Gaps = 17/467 (4%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             +E+ E   +E  SP+ Q+ +S+V+SL++L V E EIP       +  L+K+VF+P++PRF
Sbjct  1     MELEELEGQEPVSPNGQYFSSNVISLSVLAVWEFEIPFDLESQTIPLLIKNVFLPVSPRF  60

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV    NG K+WKRVEV   +H+  P +P+G  +E YD    DY+SK+  E FP  +
Sbjct  61    SSIMVEN--NGKKEWKRVEVKLEDHLYTPTFPSGLSLESYDKYFDDYISKLLTERFPQGK  118

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWEIH+  YPT+NAA NVIFKLHH+LGDGYSLMGA++S +QRADNP+LPLTFPSR+RS 
Sbjct  119   PLWEIHIINYPTSNAAANVIFKLHHALGDGYSLMGALISSMQRADNPSLPLTFPSRKRSE  178

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
             +   +  +   SGF            NT+ D  WS    T+  D  TP+RSG+D +E+RP
Sbjct  179   SKRENFVTKTFSGF-----------CNTISDL-WSGTLKTMNGDVLTPIRSGNDAIEYRP  226

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
                +TM+FSLDQIK IKDKL VT+NDV+TG+I YGTRLYM++  + SSKA CTA+VL NT
Sbjct  227   ATVSTMTFSLDQIKSIKDKLGVTVNDVLTGMIFYGTRLYMQEMNQSSSKADCTAMVLLNT  286

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R I G Y  + EMIKPN++ PWGN+FTF+ V +P LT    S+ L F+    +IIKRKRN
Sbjct  287   R-IMGDYVPIEEMIKPNSKAPWGNRFTFMHVPIPKLT--ELSNALDFIWNTRKIIKRKRN  343

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S + Y    LL+ + K    E   +YIH T KNSSM ISN+IGP+E+MSLANHP KG YF
Sbjct  344   SFAAYFNSRLLEIVHKFGSHEACGKYIHRTLKNSSMIISNLIGPVEQMSLANHPIKGFYF  403

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGI  1401
             ++ G P SL +T+VSY+G +R+A ++EKD ID +K K C+ +A + I
Sbjct  404   VVGGGPLSLEMTIVSYMGKVRVAFNMEKDVIDPQKLKSCMENALQMI  450



>ref|XP_007203447.1| hypothetical protein PRUPE_ppa022053mg [Prunus persica]
 gb|EMJ04646.1| hypothetical protein PRUPE_ppa022053mg [Prunus persica]
Length=462

 Score =   489 bits (1260),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 244/467 (52%), Positives = 324/467 (69%), Gaps = 17/467 (4%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             +E+ E   +E  SP+ Q+ +S+V+SL++L V E EIPI      +  L+K+VF+P++PRF
Sbjct  1     MELEELEGQEPVSPNGQYFSSNVISLSVLAVWEFEIPIDPESQTIPLLIKNVFLPVSPRF  60

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV     G K+WKRVEV   +HV  P++P+G  +E YD    DY+SK+  E FP  +
Sbjct  61    SSIMVEN--KGKKQWKRVEVKLEDHVYTPSFPSGLSLESYDKYFDDYISKLLTERFPQGK  118

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWEIH+  YPT+NAA NVIFKLHH+LGDGYSLMGA++S LQRADNP+LPLTFPSR+RS 
Sbjct  119   PLWEIHIINYPTSNAAANVIFKLHHALGDGYSLMGALISSLQRADNPSLPLTFPSRKRSE  178

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
             +   +  +   SGF            NT+ D  WS    T+  D  TP+RSG+D +EFRP
Sbjct  179   SKRENFVTKTFSGF-----------CNTISDL-WSGTLKTMNGDVVTPIRSGNDAIEFRP  226

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
                +TM+FSLDQIK IKDKL VT+NDV+TG+I +GTRLYM++  + SSKA CTA+VL NT
Sbjct  227   ATVSTMTFSLDQIKSIKDKLGVTVNDVLTGMIFFGTRLYMQEMNQSSSKADCTAMVLLNT  286

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R I G Y  + EMIKPN++ PWGN+FTF+ V +P LT    S+ L F+  A + IKRKRN
Sbjct  287   R-IMGDYLPIEEMIKPNSKAPWGNRFTFMHVPIPKLT--ELSNALDFIWNACKTIKRKRN  343

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S + Y    LL+ + K  G E   +YIH T KNSSM ISN+IGP+E+MSLANHP KG+YF
Sbjct  344   SFAAYFNSRLLEIVHKFGGHEACGKYIHRTLKNSSMLISNLIGPVEQMSLANHPIKGLYF  403

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGI  1401
             ++ G P S  +T+VSY+G +R+A ++EK  ID +K K C+ +A + I
Sbjct  404   VVGGGPLSFEITIVSYMGKVRVAFNMEKGVIDPQKLKSCMENALQMI  450



>ref|XP_007198908.1| hypothetical protein PRUPE_ppa025020mg [Prunus persica]
 gb|EMJ00107.1| hypothetical protein PRUPE_ppa025020mg [Prunus persica]
Length=458

 Score =   488 bits (1255),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 240/467 (51%), Positives = 331/467 (71%), Gaps = 19/467 (4%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             +E+ E G  E  SP+ Q+ +S  LSL+ L VLESEIPI   +S  + LLK+VF+PI+PRF
Sbjct  1     MELEELGGLEPVSPNGQYFSSDALSLSFLAVLESEIPIDL-ESQSMFLLKNVFLPISPRF  59

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV    NG K+WKRVEV   +H+ +P +P+    + YD  + DYLSK++ E FP  +
Sbjct  60    SSIMVEN--NGKKEWKRVEVKLEDHLHIPTFPSNLSPKSYDKYIDDYLSKLSTERFPQGK  117

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWE+H+  YPT+NAAGN+IFK HH+LGDGYSLMGA++S LQRAD+P+LPLTFPS+QRS 
Sbjct  118   PLWEVHIVNYPTSNAAGNIIFKFHHALGDGYSLMGALISSLQRADDPSLPLTFPSQQRSE  177

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
             +       N ++  F A+        NT+ DF WS     + EDD TP++SG+D +EFRP
Sbjct  178   S-----KENFVTKTFSAVG-------NTISDF-WSASLKIMKEDDLTPIKSGNDAIEFRP  224

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
                +TM+FSLDQIK +K+KL +T+NDV+TG+I +GTRLYM++  + SSKA CT+++L NT
Sbjct  225   STVSTMTFSLDQIKSMKNKLGMTVNDVLTGMIFFGTRLYMQEINQSSSKADCTSIMLINT  284

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R I G Y  + EM+KPN + PWGN+FT++ + +P LT    S+ L F+    +IIK+KR+
Sbjct  285   RLI-GDYVPIEEMMKPNGKTPWGNRFTWVHIPVPKLT--QLSNALDFIWNTQKIIKKKRS  341

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S + Y +  LL+ L K    E ++RYIH T KNSS+ ISNMIGP+E+MSLANHP KG+YF
Sbjct  342   SLAAYFSSRLLEILDKFGSHEASSRYIHHTVKNSSIVISNMIGPVEKMSLANHPIKGLYF  401

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGI  1401
             ++ GIPQ   +T+VSY+G +R+   +EK  ID +KFK C+ +A+E I
Sbjct  402   LMGGIPQGFQITIVSYMGKVRLGFKMEKGLIDPQKFKSCMQNAWEMI  448



>ref|XP_009334893.1| PREDICTED: O-acyltransferase WSD1-like [Pyrus x bretschneideri]
Length=478

 Score =   487 bits (1254),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 246/474 (52%), Positives = 331/474 (70%), Gaps = 28/474 (6%)
 Frame = +1

Query  22    YEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSE  201
             Y E  SP+ Q LN+SVLS+++LGVLESE+PI   +S ++S L+DVF+ INPRF SIMV  
Sbjct  12    YNEPVSPTGQCLNTSVLSMSVLGVLESEVPID--ESKIMSFLQDVFLHINPRFCSIMVD-  68

Query  202   GINGGKKWKRVEVNHSEHVKVPNYPAG--KPIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
              ++G K+WK+VEV  ++HV VP +P+G   P E YD  L DY+SK+ +E +P ++PLWE+
Sbjct  69    -VDGEKQWKKVEVKLTDHVHVPIFPSGVLSP-ESYDLYLGDYISKVVLEKYPEDKPLWEV  126

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRS  555
             H+ KYPT+ AAGN+IFKLHH+LGDGYS M A++SCLQRAD+P+ PLTFPSRQ S    R 
Sbjct  127   HIVKYPTSTAAGNLIFKLHHALGDGYSFMSALVSCLQRADDPSRPLTFPSRQGSERKGRD  186

Query  556   KASNKISGFFKAMPRF----LFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPI  723
                     ++K+  R+    L  AF  V D GW+ F    VEDDRT +RSG+ GVEF P+
Sbjct  187   D-------YYKSALRWVSQNLASAFYAVKDLGWNAF----VEDDRTLIRSGNSGVEFLPM  235

Query  724   ATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQC----EEESSKARCTALVL  891
               +++ FSLD+IK IK+KL VTINDV+ GI+ + TRLYM++     ++ SS A C ALVL
Sbjct  236   DISSLIFSLDEIKLIKNKLNVTINDVICGIVFFATRLYMQEMINNNQKSSSAASCRALVL  295

Query  892   FNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKR  1071
              NTR   G YK V +MI PN+EMPWGN+  F+P+S+P LT     +PL FV +A + IKR
Sbjct  296   VNTRITHGDYKPVKQMIGPNSEMPWGNRIAFMPISMPKLT--EILNPLDFVFEAQKRIKR  353

Query  1072  KRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKG  1251
             KR+S SV     L + + K RG E  +RY+H     SS+ ISNMIGP+E+ +LA+HP KG
Sbjct  354   KRSSFSVSFYNKLFEIVSKLRGHEAASRYMHNRLMKSSLMISNMIGPVEKAALADHPIKG  413

Query  1252  IYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             +YF++ GIPQ + +T+VSY+G LRI+   +K FID +KFK C+ +AFE I E  
Sbjct  414   VYFMVLGIPQDIIITIVSYMGDLRISFGTQKGFIDPQKFKSCLKNAFEMILEVT  467



>ref|XP_009372230.1| PREDICTED: O-acyltransferase WSD1-like [Pyrus x bretschneideri]
Length=478

 Score =   487 bits (1254),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 246/474 (52%), Positives = 330/474 (70%), Gaps = 28/474 (6%)
 Frame = +1

Query  22    YEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSE  201
             Y E  SP+ Q LN+SVLS+++LGVLESE+PI   +S ++S L+DVF+ INPRF SIMV  
Sbjct  12    YNEPVSPTGQCLNTSVLSMSVLGVLESEVPID--ESKIMSFLQDVFLHINPRFCSIMVD-  68

Query  202   GINGGKKWKRVEVNHSEHVKVPNYPAG--KPIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
              ++G K+WK+VEV  ++HV VP +P+G   P E YD  L DY+SK+ +E +P ++PLWE+
Sbjct  69    -VDGEKQWKKVEVKLTDHVHVPIFPSGVLSP-ESYDLYLGDYISKVVLEKYPEDKPLWEV  126

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRS  555
             H+ KYPT+ AAGN+IFKLHH+LGDGYS M A+LSCLQRAD+P+ PLTFPSRQ S    R 
Sbjct  127   HIVKYPTSTAAGNLIFKLHHALGDGYSFMSALLSCLQRADDPSRPLTFPSRQGSERKGRD  186

Query  556   KASNKISGFFKAMPRF----LFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPI  723
                     ++K+  R+    L  AF  V D GW+ F    VEDDRTP+RSG+ GVEF P+
Sbjct  187   D-------YYKSALRWVSQNLASAFYAVKDLGWNAF----VEDDRTPIRSGNSGVEFLPM  235

Query  724   ATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQC----EEESSKARCTALVL  891
               +++ FSLD+IK IK+KL VTINDV+ GI+ + TRLYM++     ++ SS A C ALVL
Sbjct  236   DISSLIFSLDEIKLIKNKLNVTINDVICGIVFFATRLYMQEMINNNQKSSSAASCRALVL  295

Query  892   FNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKR  1071
              NTR   G YK V + I PN+EMPWGN+  F+P+S+P LT     +PL FV +A + IKR
Sbjct  296   VNTRITHGDYKPVKQTIGPNSEMPWGNRIAFMPISMPKLT--EILNPLDFVFEAQKRIKR  353

Query  1072  KRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKG  1251
             KR+S SV     L + + K  G E  +RY+H     SS+ ISNMIGP+E+ +LA+HP KG
Sbjct  354   KRSSFSVSFYNKLFEIVSKLSGHEAASRYMHNRLMKSSLMISNMIGPVEKAALADHPIKG  413

Query  1252  IYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             +YF++ GIPQ + +T+VSY+G LRI+   +K FID +KFK C+ +AFE I E  
Sbjct  414   VYFMVLGIPQDIIITIVSYMGDLRISFGTQKGFIDPQKFKSCLKNAFEMILEVT  467



>ref|XP_003621165.1| O-acyltransferase WSD1 [Medicago truncatula]
 gb|AES77383.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=471

 Score =   486 bits (1252),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 232/469 (49%), Positives = 324/469 (69%), Gaps = 11/469 (2%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             E   +E  SP  Q+ NSS L L I+ VLE E+ I   D    +LL+DVF+PI+PRFSSIM
Sbjct  6     EEQLQEPVSPIGQYFNSSSLCLYIIAVLEFEVSI--DDLQAFTLLRDVFLPISPRFSSIM  63

Query  193   VSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWE  372
             V +  N  K+WK+V+VN  +HVK P +  GK +EFYD    DYLS +A+E  P  +PLWE
Sbjct  64    VQDK-NEDKRWKQVDVNLKDHVKKPIFSKGKKVEFYDKSFQDYLSTIAIEPLPQGKPLWE  122

Query  373   IHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPR  552
             +H+  YPT N+ G +IFKLHH+LGDGYSLMGA+LSCLQRAD+P+LPL+FPS + S   P 
Sbjct  123   VHIVNYPTKNSLGTIIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSLKPSKLEPY  182

Query  553   SKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATT  732
             +K+      F++     +   FNT  DFGWSV KS+++ DD+TP+RSGD+G +F+PI+ +
Sbjct  183   NKS------FWRKFSWTMSSVFNTASDFGWSVLKSSIIVDDKTPIRSGDEGADFQPISIS  236

Query  733   TMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIG  912
              ++FS+D IK IK KL VT+NDVVTGI+ YGTRLYM++ + +S  +  TALVL NTR + 
Sbjct  237   NIAFSIDHIKDIKSKLGVTMNDVVTGIVFYGTRLYMQEMDSKSKTSNSTALVLLNTRNV-  295

Query  913   GGYKSVTEMIK-PNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSAS  1089
              GY+S+ +M+    ++ PWGN+ +FL V +P L     S+PL F+   H II RK+ S +
Sbjct  296   EGYQSIDDMLNTKKSKGPWGNKLSFLHVPIPKLNENRISNPLEFIYDTHNIINRKKQSLA  355

Query  1090  VYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIA  1269
             V LTG LL    K RG E  A++I  T   SS  ++N++GP+++MSLANHP KG+YF +A
Sbjct  356   VALTGTLLDIEGKLRGQEAVAQHIRRTITMSSTVVTNLVGPVQQMSLANHPVKGLYFTLA  415

Query  1270  GIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             G P+SL ++++SY+G LR+    EK FID ++ + C+  AFE IY++A+
Sbjct  416   GGPESLVISIMSYMGVLRVTFKTEKGFIDEQRLESCMQSAFEMIYQSAM  464



>ref|XP_004292434.1| PREDICTED: O-acyltransferase WSD1-like [Fragaria vesca subsp. 
vesca]
Length=465

 Score =   485 bits (1249),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 250/478 (52%), Positives = 337/478 (71%), Gaps = 28/478 (6%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             +E  E G +   SP  Q+  + VLS++ LGVLE E+PI   +  V+SL+ +VF+PI+PRF
Sbjct  1     MEFEEEGLQ-PVSPLGQYFANRVLSVSNLGVLEIEVPIH--ELPVMSLITNVFLPISPRF  57

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SS+MV     G K+WKRVEV   +HV +P +P+G  +  YD  L DYLSK+A+E  P +R
Sbjct  58    SSMMVE--TRGKKQWKRVEVELEDHVYIPIFPSGLSLASYDRYLDDYLSKLAVERLPEHR  115

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWEIH+ KYPTT+AAG +IFKLH +LGDG+SLMGA+LSCLQRA+NP+LPLTFPSR+RS+
Sbjct  116   PLWEIHIIKYPTTSAAGTIIFKLHQALGDGFSLMGALLSCLQRAENPSLPLTFPSRKRSS  175

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
               PR+K  N ++  F ++       +NT+ D    +  S + EDD+TP+RSG+DG+EF+P
Sbjct  176   -QPRNKNGNFVTKVFSSV-------YNTISD----ILNSNMEEDDQTPIRSGNDGIEFKP  223

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             IA +TM+ SLD++K IK +L VTINDV+T +I  GTRLYM++  + SS+AR TA+VL NT
Sbjct  224   IAVSTMTISLDRLKLIKSRLGVTINDVLTAMIFLGTRLYMQEINKSSSEARGTAVVLLNT  283

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALT-------PANASDPLRFVRKAHR  1059
             R + G + SV EM KPN+++PWGN  + L V +P L        P NA D   FV KAH+
Sbjct  284   RML-GNFTSVEEMNKPNSKLPWGNHISLLHVPIPKLLTNSEEQFPDNALD---FVWKAHK  339

Query  1060  IIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANH  1239
             II+ KR+S  +YLT   L+ L K  G E  A+YI  + KNSSM ISNMIGP+E+MSLANH
Sbjct  340   IIRSKRHSWGIYLTAGFLEILNKFGGHEAAAKYIRKSLKNSSMIISNMIGPVEQMSLANH  399

Query  1240  PAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             P KG+YF++ G P+ L VT+VSY+G +RIA  +EK  ID  KFK C+  +FE I +A+
Sbjct  400   PIKGLYFLVFGSPEGLDVTIVSYMGKVRIAFKMEKGLIDPPKFKSCMEKSFEMILKAS  457



>ref|XP_003607481.1| O-acyltransferase WSD1 [Medicago truncatula]
 gb|AES89678.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=469

 Score =   484 bits (1246),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 234/464 (50%), Positives = 325/464 (70%), Gaps = 11/464 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS QF N+  L   + G LE EIP+   DS  + L ++ F+PINPRFSSIMV +  
Sbjct  9     EPVSPSGQFFNTPPLCSYVFGFLELEIPMD--DSQTMYLFQN-FLPINPRFSSIMVRDQ-  64

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G   WK++E    +H+KVP +P  + IE YD    DY+SK+ ME  P ++PLWE+HL K
Sbjct  65    DGKMMWKKIEAKPEDHMKVPIFPKSESIELYDQYFDDYVSKIMMERTPQDKPLWEMHLIK  124

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NA G +IFKLHH+LGDGYSLMGA+LSCLQR D+P+LPL+FPSR+ S      K   
Sbjct  125   YPTSNAKGTLIFKLHHALGDGYSLMGALLSCLQRVDDPSLPLSFPSRKPSQLLSPKK---  181

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                GFFK  P  +F  FN+  DFGWS+ KS++++DD+TP+ +G++GVE +P   + +SFS
Sbjct  182   ---GFFKWFPSTIFPFFNSFSDFGWSIAKSSMLKDDKTPIWNGEEGVESQPCVLSNLSFS  238

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD+IK IK KL VTINDV+TG+I YG RLYM++ + +++ +  T LVL +TR IG  Y+S
Sbjct  239   LDEIKTIKSKLGVTINDVITGVIFYGIRLYMQEIDNKATTSNSTGLVLLSTRNIGS-YQS  297

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + +M K +++ PWGN  +FL + +P L   + S+PL FV KA +IIKRKR++ +V+LT W
Sbjct  298   IQDMTKADSKSPWGNHISFLHIPIPKLCQPSLSNPLDFVWKAQKIIKRKRSTFTVFLTEW  357

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL   +K RG E  A++I+GT +NSS+ ISN+IGP+E M+LANHP KG+YF + G P+S+
Sbjct  358   LLDMELKLRGHEAVAKHIYGTLRNSSVVISNLIGPVEPMALANHPVKGLYFTMTGGPESI  417

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALG  1419
              + ++SY   LRI L  +K FID +KFK C+  AFE I +  +G
Sbjct  418   NIAIMSYTRILRITLKTQKGFIDEQKFKLCIVRAFEVISKEVMG  461



>gb|KEH17310.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=482

 Score =   484 bits (1246),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 247/464 (53%), Positives = 331/464 (71%), Gaps = 12/464 (3%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP+ Q+LNSS LS+ ILGVLESEI I   D+  +SLL +VF+PI+ RFSSIM+ +  NG
Sbjct  12    VSPTGQYLNSSSLSVCILGVLESEISISIDDNQTLSLLNNVFLPISTRFSSIMIKDH-NG  70

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              KKWK+V+V   +HV +P +P  K    YD+ L DY+SK+AME  P +RPLWEIH+ KYP
Sbjct  71    EKKWKKVDVKVEDHVYIPMFPTSKS-SLYDEYLDDYMSKIAMEHLPQDRPLWEIHIIKYP  129

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T NAAG ++FKLHH+LGDGYSLMGA+LSCL+RADNP LP T PS   S   P+S  + K 
Sbjct  130   TKNAAGTLVFKLHHALGDGYSLMGALLSCLERADNPFLPFTLPS---SKIRPKSIFNTK-  185

Query  574   SGFFK-AMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSL  750
               FFK + P      F+T+ DFGWS+ KS+LVEDD TP+RS +D ++ R I  +++SFS+
Sbjct  186   -AFFKRSFPSIFSKVFDTISDFGWSMLKSSLVEDDVTPIRSCEDDIKLRKINISSVSFSM  244

Query  751   DQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSV  930
             D+IK++K +L V+ NDV+ G+I +G RLYM Q  ++SSK + TALVL NTR IGG YKSV
Sbjct  245   DRIKEVKSRLGVSTNDVIAGLIFFGIRLYMHQMNQDSSKNQSTALVLLNTRNIGG-YKSV  303

Query  931   TEMI---KPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLT  1101
              EM+     N    WGNQF FL VS+P L+     +P+ F+ +AH+ I RK+NS +  LT
Sbjct  304   KEMVDIKNNNDGSAWGNQFAFLHVSIPKLSDKKYENPIEFIWEAHKEINRKKNSLATPLT  363

Query  1102  GWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQ  1281
             G +L  + K RG E +A++++ T +NSS  ISN+IGPME+M+LANHP KG+YF++ G P+
Sbjct  364   GMILNMVKKLRGPEASAKFVYNTLRNSSTTISNIIGPMEQMALANHPIKGLYFMVVGPPE  423

Query  1282  SLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             SL +T++SY+G LRIA  +EKDFID +KF  C+  + E I  AA
Sbjct  424   SLTITIMSYMGKLRIAFGLEKDFIDKQKFISCMESSLEMIITAA  467



>ref|XP_008229024.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=451

 Score =   481 bits (1238),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 240/459 (52%), Positives = 318/459 (69%), Gaps = 30/459 (7%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+ Q+ +S V++L++L VLE EIPI  ++S  +SLLK+V                 
Sbjct  10    EPVSPNGQYFSSDVITLSVLAVLEFEIPIIDAESQTMSLLKNV---------------EN  54

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G K+WKRVEV   +HV +P +P+    E YD  L DYLSK++ E +P  +PLWE+H+ K
Sbjct  55    DGKKEWKRVEVKLEDHVNIPIFPSNLSPESYDQYLEDYLSKLSTERYPQGKPLWEVHIIK  114

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAAGNVIFK HH+LGDGYSLMGA++S LQRADNP+LPLTFPSRQRS    R     
Sbjct  115   YPTSNAAGNVIFKFHHALGDGYSLMGALISTLQRADNPSLPLTFPSRQRSELKKR-----  169

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                 FF  + +    A NT+ D  W + K TL ED+ TP++S +D +EFRP    TM+FS
Sbjct  170   --ENFF--VTKIFSSACNTISDIWWGISK-TLKEDELTPIKSSNDAIEFRPSTIATMTFS  224

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             L Q+K IK+KL VT+NDV+TG+I +GTRLYM++ ++ SS A CTA+VL NTR I G Y  
Sbjct  225   LGQLKSIKNKLGVTLNDVLTGMIFFGTRLYMQEIDQSSSTADCTAMVLLNTR-IMGDYMP  283

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTP-ANASDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             + EMIKPN++MPWGN+FTFL V +P LT  +NA D   F+R  H++IK+KRNS +VY T 
Sbjct  284   IEEMIKPNSKMPWGNRFTFLQVPIPKLTELSNADD---FIRNTHKMIKKKRNSLAVYFTS  340

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
              LL+ + K    E ++RYIH T KNSSM ISNMIGP+E+MSLANHP KG YF++ G+PQ 
Sbjct  341   RLLEIVNKFGSHEASSRYIHRTLKNSSMVISNMIGPVEQMSLANHPIKGFYFLVPGLPQG  400

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGI  1401
               +T+VSY+G +R+A  +EK  ID  K K C+ +AF+ I
Sbjct  401   FDITIVSYMGKVRLAFKMEKGIIDPHKLKSCMENAFDMI  439



>ref|XP_008368650.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Malus domestica]
Length=467

 Score =   481 bits (1237),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 241/470 (51%), Positives = 328/470 (70%), Gaps = 20/470 (4%)
 Frame = +1

Query  10    MEHGYE--EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFS  183
             ME G E  +  SP+  + NSSVLS++ILGVLE EIPI   DS  +SLL++VF+PIN RFS
Sbjct  1     MEIGGEGLDPVSPTGHYFNSSVLSISILGVLEFEIPID--DSQTLSLLENVFLPINSRFS  58

Query  184   SIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRP  363
             SI +    NG K+WK+VEV   +HVK P +P+    E YD    DY+S +A   FP ++P
Sbjct  59    SIXIEN--NGKKQWKKVEVKLEDHVKSPIFPSNLSNESYDKYFDDYISNIATTRFPEDKP  116

Query  364   LWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTA  543
             LWEIH+ KYP +NAAGNVIFKLHH+LGDGYSLMGA++SCL+RADNP+LPLTFPSR  S  
Sbjct  117   LWEIHVIKYPNSNAAGNVIFKLHHALGDGYSLMGALISCLRRADNPSLPLTFPSRLPS--  174

Query  544   APRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPI  723
               + K+ N ++  F  +        NT+ D  W + KS + EDDR+P++S ++G+EF PI
Sbjct  175   --KPKSENVMTTTFSCL-------LNTISDSWWGISKSIMGEDDRSPIKSXNNGLEFAPI  225

Query  724   ATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTR  903
               +TM+ SLD I+ IK +L VTINDV+TG++  G RLYM++  + S +A  T+LVL NTR
Sbjct  226   TVSTMTISLDLIRLIKSRLGVTINDVLTGVVFLGARLYMQEMNKSSREAHSTSLVLLNTR  285

Query  904   AIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNS  1083
              I   Y S+ EMIKP+++ PWGN+FTFL V +P LT    S+ L FV KA +II +KRNS
Sbjct  286   -IMANYTSIEEMIKPDSKSPWGNRFTFLQVPIPKLT--EFSNVLDFVWKAQKIINQKRNS  342

Query  1084  ASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFI  1263
              ++Y    LL+ L K  G E  +RYI  T KNSSM I+NMIGP+E+MSLANHP KG+YF+
Sbjct  343   FTIYFISXLLEMLNKFGGHEAASRYIRSTIKNSSMVITNMIGPLEQMSLANHPIKGLYFL  402

Query  1264  IAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             + G PQ L +++ SY+G +++A +++K  ID +K K C+ +A + I+ A+
Sbjct  403   VVGTPQDLDISIXSYMGKVKLAFTMKKGIIDPQKLKLCMENALDMIFNAS  452



>ref|XP_002323911.2| hypothetical protein POPTR_0017s04310g [Populus trichocarpa]
 gb|EEF04044.2| hypothetical protein POPTR_0017s04310g [Populus trichocarpa]
Length=422

 Score =   479 bits (1232),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 229/403 (57%), Positives = 291/403 (72%), Gaps = 7/403 (2%)
 Frame = +1

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG K+WK+VEV   +HV VP +P     +FYD+   DYLSK++M   P ++PLWEIHL K
Sbjct  18    NGEKRWKKVEVELKDHVFVPIFPEEMSPQFYDEYFEDYLSKLSMLQLPQSQPLWEIHLIK  77

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAA  +IFK+HH++GDGYSLMGA+LSCLQRADNP+LPLT PS Q     PR   S 
Sbjct  78    YPTSNAASTIIFKIHHAIGDGYSLMGALLSCLQRADNPSLPLTLPSVQ-----PRVDTSG  132

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                  FK +P+     FNTV DF  S+ KS+LVEDD +P+RSGD G+EFRPIA TTM+FS
Sbjct  133   DHRTIFKTVPKIFSLLFNTVSDFLGSLMKSSLVEDDLSPIRSGDIGIEFRPIAPTTMTFS  192

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSK-ARCTALVLFNTRAIGGGYK  924
             L QIKQIK  L VTINDV+TG I+ GTRLYM++  + SS  + CTALV+ NTR     Y+
Sbjct  193   LGQIKQIKATLGVTINDVITGAILLGTRLYMQEMSKGSSDHSNCTALVMLNTRMFRS-YQ  251

Query  925   SVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             S+TEM+KP AE PWGN F FL V LP L  +   +P+ F+RKA +IIKRKR+S +VYLT 
Sbjct  252   SITEMVKPKAESPWGNHFAFLHVQLPELVASTELNPIEFIRKAQQIIKRKRSSLAVYLTA  311

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
               ++ + K +G EV A+YIH T  N+SM ++NMIGP+E+MSLANHP KG+YF +AG PQS
Sbjct  312   AFIEIVKKLKGHEVAAQYIHKTMVNASMTVTNMIGPVEKMSLANHPIKGMYFAVAGNPQS  371

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             L +T+VSYV  LR+ L  EK FIDA+K K C+  AF+ I ++ 
Sbjct  372   LNITIVSYVDKLRLTLGAEKGFIDAQKLKSCIEEAFQMILKSV  414



>ref|XP_009336217.1| PREDICTED: O-acyltransferase WSD1-like [Pyrus x bretschneideri]
Length=463

 Score =   480 bits (1235),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 236/462 (51%), Positives = 326/462 (71%), Gaps = 18/462 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+  + NSSVLS++IL +LE EIPI   DS  +SLL++VF+PINPRFSSIM+ +  
Sbjct  9     EPVSPNGHYFNSSVLSVSILAILEYEIPID--DSQFLSLLENVFLPINPRFSSIMIEK--  64

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG K+WK+VEV   +H+K P +P+    E YD+   DY+S +A + FP ++PLWE+H+ K
Sbjct  65    NGKKQWKKVEVKLEDHLKTPIFPSNLSNESYDEYFDDYISSIATKRFPQDKPLWEVHVIK  124

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YP +NAAGN+IFKLHH+LGDGYSLMGA+LSCLQRADNP+LPLTFPS   S     +K+ N
Sbjct  125   YPNSNAAGNLIFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPSLLPS----ETKSEN  180

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                     M + +    +T+ DF W + KS   EDD +P++S  +G+EF PI  + ++ S
Sbjct  181   -------VMTKTISSLLSTISDFWWGISKSFRGEDDPSPIKSSKNGLEFAPITISMITIS  233

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD+I+ IK KL VTIND++TG++  GTRLYM++  + S +A  T+LVL NTR +   Y S
Sbjct  234   LDRIRLIKSKLGVTINDILTGMVFLGTRLYMQEMNQGSREAHSTSLVLLNTRFM-TNYAS  292

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + EM+KPN + PWGN+F FL V +P LT    S+ L FV  AH+IIK+KRNS+++Y T  
Sbjct  293   IEEMVKPNGKSPWGNRFAFLHVPIPKLT--EFSNVLEFVWNAHKIIKQKRNSSAIYFTSG  350

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL+ L K  G E  +RYIH T KNSS+ I+NMIGP+E+MSLAN P KG+YF++AG P+ L
Sbjct  351   LLEMLNKFGGHEAASRYIHSTLKNSSLVITNMIGPVEKMSLANQPIKGLYFLLAGTPKDL  410

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              +++VSY+G +++A +V+K  ID +K K C+ +A   I  AA
Sbjct  411   DISIVSYMGKVKLAFTVKKGIIDPQKLKLCMENALNMISNAA  452



>gb|KHN07508.1| O-acyltransferase WSD1 [Glycine soja]
Length=469

 Score =   480 bits (1235),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 242/462 (52%), Positives = 332/462 (72%), Gaps = 14/462 (3%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGG  216
             SP+ Q+L SS LS+ ILGVLESE+PI   DS  + LL+++F+PIN RFSSIM+ +  NG 
Sbjct  14    SPTGQYLTSSSLSVYILGVLESEVPID--DSQTVPLLQNLFLPINSRFSSIMIRDK-NGE  70

Query  217   KKWKRVEVNHSEHVKVPNYPAGKP--IEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKY  390
             KKWK+VEV   +H+KVP +P GK   +  YD+ L +Y+S +A+E  P NRPLWE+H+ KY
Sbjct  71    KKWKKVEVKLEDHIKVPTFPNGKSSNLFLYDEYLDEYMSTIAVEHLPQNRPLWELHIIKY  130

Query  391   PTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNK  570
             PT+NA G ++FKLHH+LGDG+SLMGA+LSC+QRADN +LP T PS QR    P++ + + 
Sbjct  131   PTSNAKGTLVFKLHHALGDGFSLMGALLSCMQRADNTSLPFTLPSSQR----PKASSISN  186

Query  571   ISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSL  750
               GFFK +P   F    T+ +FGWS  KS L+EDD+TP+RS  +  + R +  + ++FSL
Sbjct  187   TKGFFKKLPSIFF---QTISEFGWSFLKSKLIEDDQTPIRSCAEDFKTRQMTISDVTFSL  243

Query  751   DQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSV  930
             D IK +K KL V+INDV+ G+I +G RLYM++   +SS+ + TALVL NTR I  GYKSV
Sbjct  244   DLIKDVKSKLGVSINDVLAGVIFFGIRLYMQEINLKSSQTQSTALVLLNTRNI-EGYKSV  302

Query  931   TEMI-KPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
              EMI K N+   WGNQ+ FL VS+P L+ +  ++PL F+R+AH+ + +K+NS +  LTG 
Sbjct  303   KEMIEKTNSRSAWGNQYAFLHVSIPELSDSKYANPLEFIREAHKDMTKKKNSLATPLTGM  362

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL  L K RG E  A Y+  T +NSS  ISN+IGP+E+M++ANHP KG YF++AG P+SL
Sbjct  363   LLDMLRKLRGPEAAASYLRSTLRNSSTTISNIIGPVEQMAVANHPIKGFYFMVAGSPESL  422

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              +T++SY+G +RIA  VEKDFID + FK C+ ++ E I EAA
Sbjct  423   TMTIMSYMGKIRIAFGVEKDFIDKQLFKSCLENSLEMIKEAA  464



>ref|XP_004489154.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=471

 Score =   478 bits (1231),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 236/462 (51%), Positives = 321/462 (69%), Gaps = 11/462 (2%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP  Q+ NSSV+ L I+GVLE E+PI   D    +L KDVF+PI+PRFSSIMV +  N 
Sbjct  13    VSPIGQYFNSSVICLHIIGVLEFEVPID--DLQAFALFKDVFLPISPRFSSIMVLDK-NE  69

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              K WK+VEV+  +HVK+P +  GK IE+YD C  +YLS +AME  P  +PLWEIH+  YP
Sbjct  70    KKIWKQVEVDLKDHVKIPTFSEGKTIEYYDKCFHNYLSTIAMEKLPQEKPLWEIHIVNYP  129

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T+++ G +IFKLHH+LGDGYSLMGA+LSCLQRAD+ +LPL+FPS +     P    S+  
Sbjct  130   TSDSLGTIIFKLHHALGDGYSLMGALLSCLQRADDSSLPLSFPSLR-----PSKSESSSK  184

Query  574   SGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLD  753
             S + +   R +   FNT  DFGWSV KS +++DD+TP+R GD G +F+PI+ +TM FS+D
Sbjct  185   SIWIR-FSRTMSSVFNTASDFGWSVLKSRIIDDDKTPIRFGDKGADFQPISISTMEFSID  243

Query  754   QIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVT  933
              IK IK +L VT+NDVVTGI+ YGTRLYMK  + +S  A  TALVL NTR I  GY+S+ 
Sbjct  244   HIKDIKSRLGVTVNDVVTGIVFYGTRLYMKDKDSKSKTANSTALVLLNTRNI-EGYQSID  302

Query  934   EMI-KPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWL  1110
             +M+ K      WGN+ +FL V +P L  +  S+PL F+   H+IIKRK+ S  V LTG L
Sbjct  303   DMLNKKKTNCRWGNKISFLHVPIPKLNESIISNPLDFILHTHKIIKRKKQSLGVALTGTL  362

Query  1111  LQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLC  1290
             L+   K RG E+ A++I  T   SS  ++N++GP+E+MSL+NHP KG+YF +AG  +SL 
Sbjct  363   LEIEGKLRGQEIIAKHIRRTITKSSTVLTNLVGPVEKMSLSNHPVKGLYFTLAGGAESLT  422

Query  1291  VTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             ++++SY+G LR+ L  EKDFI+ E+ K  +  AFE I++ A+
Sbjct  423   ISIMSYMGVLRVTLKTEKDFIEEERLKSFIQSAFEIIFKEAM  464



>ref|NP_001241558.1| uncharacterized protein LOC100777968 [Glycine max]
 gb|ACU18073.1| unknown [Glycine max]
Length=469

 Score =   478 bits (1230),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 241/462 (52%), Positives = 332/462 (72%), Gaps = 14/462 (3%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGG  216
             SP+ Q+L SS LS+ ILGVLESE+PI   DS  + LL+++F+PIN RFSSIM+ +  NG 
Sbjct  14    SPTGQYLTSSSLSVYILGVLESEVPID--DSQTVPLLQNLFLPINSRFSSIMIRDK-NGE  70

Query  217   KKWKRVEVNHSEHVKVPNYPAGKP--IEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKY  390
             KKWK+VEV   +H+KVP +P GK   +  YD+ L +Y+S +A+E  P NRPLWE+H+ KY
Sbjct  71    KKWKKVEVKLEDHIKVPTFPNGKSSNLFLYDEYLDEYMSTIAVEHLPQNRPLWELHIIKY  130

Query  391   PTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNK  570
             PT+NA G ++FKLHH+LGDG+SLMGA+LSC+QRADN +LP T PS QR    P++ + + 
Sbjct  131   PTSNAKGTLVFKLHHALGDGFSLMGALLSCMQRADNTSLPFTLPSSQR----PKASSISN  186

Query  571   ISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSL  750
               GFFK +P   F    T+ +FGWS  KS L+EDD+TP+RS  +  + R +  + ++FSL
Sbjct  187   TKGFFKKLPSIFF---QTISEFGWSFLKSKLIEDDQTPIRSCAEDFKTRQMTISDVTFSL  243

Query  751   DQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSV  930
             D IK +K KL V+INDV+ G+I +G RLYM++   +SS+ + TALVL NTR I  GYKSV
Sbjct  244   DLIKDVKSKLGVSINDVLAGVIFFGIRLYMQEINLKSSQTQSTALVLLNTRNI-EGYKSV  302

Query  931   TEMI-KPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
              EMI K N+   WGNQ+ FL VS+P L+ +  ++PL F+R+AH+ + +K+NS +  LTG 
Sbjct  303   KEMIEKTNSRSAWGNQYAFLHVSIPELSDSKYANPLEFIREAHKDMTKKKNSLATPLTGM  362

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL  L K RG E  A Y+  T +NSS  ISN+IGP+E+M++ANHP KG YF++AG P+SL
Sbjct  363   LLDMLRKLRGPEAAASYLRSTLRNSSTTISNIIGPVEQMAVANHPIKGFYFMVAGSPESL  422

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              +T++SY+G +RIA  VEK+FID + FK C+ ++ E I EAA
Sbjct  423   TMTIMSYMGKIRIAFGVEKNFIDKQLFKSCLENSLEMIKEAA  464



>ref|XP_009335177.1| PREDICTED: O-acyltransferase WSD1-like [Pyrus x bretschneideri]
Length=483

 Score =   476 bits (1226),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 253/486 (52%), Positives = 340/486 (70%), Gaps = 38/486 (8%)
 Frame = +1

Query  10    MEHGYE------EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPIN  171
             MEH  E      E  SP+AQ+  SSVLS++ +GV+E E P+  S+S  ISLLK +F+PI+
Sbjct  1     MEHLEEDEVVVLEPVSPTAQYFTSSVLSVSNIGVMELENPL--SESQAISLLKTLFLPIS  58

Query  172   PRFSSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFP  351
             PRFSSI+V   ING K+WKRVEV   EH+ VP  P+    E Y+  L  Y+SK+A+E   
Sbjct  59    PRFSSIVVE--INGKKRWKRVEVKLEEHISVPVIPSNLSTESYEKYLDGYISKLALERLS  116

Query  352   PNRPLWEIHLFKYPT--TNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPS  525
              ++PLWE+H+  YPT   NAA N+IFKLHH+LGDG+SLM AILSCL+RADNP+LPLTFPS
Sbjct  117   QDKPLWELHILNYPTRNNNAACNLIFKLHHALGDGFSLMSAILSCLRRADNPSLPLTFPS  176

Query  526   RQRSTAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDG  705
             RQRS      + S++       + R +   FNT+ D    +++ST+ EDD +P+RSG+ G
Sbjct  177   RQRS-----QQMSDE-----SFLSRTISSVFNTLSD----IWRSTVGEDDLSPIRSGN-G  221

Query  706   VEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTAL  885
             +EF+PI   TM+FSLDQIK IK KL VT+NDV+ G+I  GTRLYM++    SSKAR TA+
Sbjct  222   IEFQPITVATMTFSLDQIKSIKSKLGVTVNDVLAGMIFLGTRLYMQEINRSSSKARGTAV  281

Query  886   VLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALT---------PANA-SDPL  1035
             VL NTR +G  Y S+ EM+KP+++MPWGN FTFL V +P L+         PA+  S+ L
Sbjct  282   VLLNTRMMGK-YTSIQEMMKPDSKMPWGNHFTFLHVPIPNLSLPEDHDHDFPADQHSNAL  340

Query  1036  RFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPM  1215
              FV +A +II RKR+S ++YLT   L+ L K  G E  ARYIH T KN+SM ISN+IGP+
Sbjct  341   DFVWEAQKIITRKRSSLAIYLTCRFLEFLNKFGGHEAAARYIHSTLKNTSMMISNLIGPV  400

Query  1216  ERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFE  1395
             E+M+LAN+P KG+YF++ G P+ L VT+VSY+G +R+A  +EK  I+ +KFK C+ +AFE
Sbjct  401   EQMALANNPVKGMYFLVFGSPEGLDVTIVSYMGKVRVAFKMEKGLIEPQKFKSCMQNAFE  460

Query  1396  GIYEAA  1413
              I +A+
Sbjct  461   MIRKAS  466



>ref|XP_004489155.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=513

 Score =   477 bits (1227),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 237/461 (51%), Positives = 326/461 (71%), Gaps = 11/461 (2%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP  Q+ NSSVL L I+GVLE E+PI   D    SLL+DVF+PI+PRFSSIM+ +  NG
Sbjct  55    VSPIGQYFNSSVLCLYIIGVLEFEVPID--DLQTFSLLQDVFLPISPRFSSIMIQDK-NG  111

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              K+WK+V+VN  +HVK P +  GK +EFY+ C  DYLS +AME  P  RPLWE+H+  YP
Sbjct  112   EKRWKQVDVNLKDHVKTPIFSKGKTLEFYEKCFVDYLSTIAMEQLPQERPLWEVHIVNYP  171

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T+++ G +IFKLHH+LGDGYSLMGA+LSCLQRAD+ +LPL+FPS +     P    S+  
Sbjct  172   TSDSLGTIIFKLHHALGDGYSLMGALLSCLQRADDSSLPLSFPSLR-----PSKSESSSK  226

Query  574   SGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLD  753
             S + +   R +   FNT  DFGWSV KS++++DD+TP+R GD+G +F+PI+ ++++FS+D
Sbjct  227   SIWIR-FSRTMSSVFNTASDFGWSVLKSSIIDDDKTPIRFGDEGADFQPISISSIAFSID  285

Query  754   QIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVT  933
              IK IK +L VT+NDVVTGI+ YGTRLYM+  + +S  A  TALVL NTR I  GY+S+ 
Sbjct  286   HIKDIKSRLGVTLNDVVTGIVFYGTRLYMQNLDSKSKTANSTALVLLNTRNI-EGYQSID  344

Query  934   EMIK-PNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWL  1110
             EM+     + PWGN+ +FL V +P L  +N S+PL F+   H IIKRK+ S  V LTG L
Sbjct  345   EMLNTKKTKGPWGNKISFLHVPIPKLNGSNISNPLEFIWDTHNIIKRKKQSLGVALTGTL  404

Query  1111  LQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLC  1290
             L    K RG E  A++I  T  NSS  ++N++GP+++MSLANHP KG YF +AG P+SL 
Sbjct  405   LDIEGKFRGQEAVAKHIRRTITNSSAVVTNLVGPIQKMSLANHPVKGFYFTLAGGPESLV  464

Query  1291  VTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             ++++SY+  +R+ L  EK+FID ++ K C+  +FE I++AA
Sbjct  465   ISIMSYMEVVRVTLKTEKEFIDEQRLKSCMQSSFEMIFKAA  505



>gb|KHN35242.1| O-acyltransferase WSD1 [Glycine soja]
Length=472

 Score =   474 bits (1221),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 235/473 (50%), Positives = 318/473 (67%), Gaps = 13/473 (3%)
 Frame = +1

Query  7     MMEHGYEEA---ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPR  177
             M +  YEE     SP  Q+ NSSV+   + G LE  +PI   DS  I LLKDVF+PINPR
Sbjct  1     MDQQFYEEVQEPVSPPGQYFNSSVICSYVFGFLEMAVPI--DDSQTIPLLKDVFLPINPR  58

Query  178   FSSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPN  357
             FSSIMV +  +G  KWKRV+V   EHVKVP +P     E YD    DY++++  E  P N
Sbjct  59    FSSIMVRDQ-DGRMKWKRVQVKPEEHVKVPKFPECNSPELYDQYFGDYVTRILTERTPQN  117

Query  358   RPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRS  537
             +PLWEIH+  YPT+NAAG +IFKLHH+LGDGYSLMGA+LSCLQR+D+P+LPLTFPSR  S
Sbjct  118   KPLWEIHIINYPTSNAAGTLIFKLHHALGDGYSLMGALLSCLQRSDDPSLPLTFPSRTSS  177

Query  538   TAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFR  717
              +    K+       FK +P F+   FN++ DFG S+ K+ ++ DD+TP+RSG +G E  
Sbjct  178   NSQQAKKS------MFKKLPSFISSFFNSMSDFGSSLIKTRMIVDDKTPIRSGYEGTESM  231

Query  718   PIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFN  897
             P   + +S S+D IK IK KL VTINDV+TG+I YG RLYM++ +  + KA  T +V+ N
Sbjct  232   PFTLSNISLSIDNIKAIKSKLGVTINDVITGLIFYGIRLYMQEIDRMARKANSTCVVMLN  291

Query  898   TRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKR  1077
             TR + G Y+SV EM K   +  WGN+ +FL V +P L  +  S+PL F+  A + IK+KR
Sbjct  292   TRNVRG-YQSVKEMQKSKVKGLWGNKISFLQVPIPKLGQSKISNPLEFIWNARKQIKKKR  350

Query  1078  NSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIY  1257
              S SVYL G LL   MK RG E  A+ I+ T +NSS+ ISN+ GPME+M+LANHP  G+Y
Sbjct  351   RSFSVYLIGLLLDLEMKIRGPEAVAKIIYKTLRNSSVVISNLFGPMEQMTLANHPISGLY  410

Query  1258  FIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             F + G P+++ +T++SYV  +RI L   K F+D +KFK C+  A++ +++AA+
Sbjct  411   FTMTGGPENVDITIMSYVKVIRITLRTLKGFVDEQKFKFCIEKAYDVMFKAAM  463



>gb|KEH30693.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=465

 Score =   473 bits (1217),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 234/451 (52%), Positives = 321/451 (71%), Gaps = 10/451 (2%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS Q+ N+  L   + G LES+IPI   DS  + L + VF+PINPRFSSIMV +  
Sbjct  9     EPVSPSGQYFNTPPLCSYVFGFLESQIPI--DDSQTMYLFQHVFLPINPRFSSIMVRDK-  65

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G  KWK+VEV   +H+ VP +P  + IE YD    DY+SK+ ME  P ++PLWEIHL K
Sbjct  66    DGKMKWKKVEVKPEDHMHVPIFPKSESIELYDQYFDDYVSKIMMERTPQDKPLWEIHLIK  125

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT NA G +IFKLHH+LGDGYSLMGA+LSCLQRAD+P+LPL+FPSR+ S      K   
Sbjct  126   YPTRNAKGTLIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSRKPSQLLSPKK---  182

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                GFFK  P  +F  FN+  DFGWS+ KS++++DD+TP+ +G++GVE +P   + +SFS
Sbjct  183   ---GFFKWFPSTIFSFFNSFSDFGWSIAKSSMLKDDKTPIWNGEEGVESQPCVLSNLSFS  239

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD+IK IK KL VTINDV+TG+I YG RLYM++ ++++  +  T LVL +TR +G  Y+S
Sbjct  240   LDEIKTIKSKLGVTINDVITGVIFYGIRLYMQEMDKKARTSNSTGLVLLSTRNVGS-YQS  298

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + +M K +++ PWGN  +FL VS+P L+ A+ S+PL F+ KA +IIKRKRN+ +V+L  W
Sbjct  299   IQDMTKADSKSPWGNHISFLHVSIPKLSKASLSNPLEFIWKAQKIIKRKRNTFTVFLIEW  358

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL   +K RG E  A++I+ T +NSS+ ISN+IGP+E M+LANHP KG+YF + G P+S+
Sbjct  359   LLDMELKLRGHEAVAKHIYDTLRNSSVVISNLIGPVEPMALANHPVKGLYFTMTGGPESI  418

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCV  1380
              + ++SY   LRI L  +K FID +KFK C+
Sbjct  419   NIAVMSYTRILRITLKTQKGFIDEQKFKFCM  449



>ref|XP_010068985.1| PREDICTED: O-acyltransferase WSD1-like [Eucalyptus grandis]
 gb|KCW57194.1| hypothetical protein EUGRSUZ_H00010 [Eucalyptus grandis]
Length=473

 Score =   473 bits (1218),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 241/469 (51%), Positives = 331/469 (71%), Gaps = 17/469 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+ ++ NS V+S++ILG+LESEIPI   DS   +L+KDVF+PINPRFSSIMV  G 
Sbjct  11    EPVSPTGEYFNSKVMSVSILGILESEIPID--DSQATALIKDVFLPINPRFSSIMVM-GK  67

Query  208   NGGKKWKRVEVNHSEHVKVPNY--PAGK--PIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
              G +KWK+VEVN   HV VP++  P G   P E  D  L  Y+S++AM+ FP  +PLWEI
Sbjct  68    KGARKWKKVEVNVENHVHVPSFSFPKGSSSPSE-NDSFLKTYISQIAMQPFPQGQPLWEI  126

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRS  555
             H+ K PT+ A G +IFKLHH+LGDGYSL+GA+LSCLQRADNP+LP+TFPS    ++A + 
Sbjct  127   HIIKCPTSEAQGTLIFKLHHALGDGYSLVGALLSCLQRADNPSLPITFPSVSNFSSANKD  186

Query  556   KASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTT  735
                ++  G  K + R      NTV DFGWSVFKST +EDD +P+R G +   F+P   +T
Sbjct  187   ---DRNIGLRKVVSRCFSPLVNTVKDFGWSVFKSTCIEDDLSPIRCGSES--FQPFLVST  241

Query  736   MSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESS-KARCTALVLFNTRAIG  912
             ++FSLD+IK+IK +L+VT+NDV+ G I   TR+YM++    S+     TALVL NTR + 
Sbjct  242   VTFSLDRIKEIKSRLRVTVNDVIMGTIFLATRMYMQRASTNSNLSTNSTALVLLNTRNLR  301

Query  913   GGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANA--SDPLRFVRKAHRIIKRKRNSA  1086
               YKSV +M++PN+E PWGN F FL V +P + P+++  SDPL+FV +AH +IKRKR+S 
Sbjct  302   D-YKSVRDMVRPNSESPWGNNFAFLHVPIPKVKPSDSQFSDPLKFVHEAHEVIKRKRSSF  360

Query  1087  SVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFII  1266
              V LTG LL  + K R +E  A++I  T +NSSM ISN++GP+E++SLANHP KG+Y+ +
Sbjct  361   GVILTGKLLGIMKKCRNAEAVAKHISRTLRNSSMVISNVMGPVEKLSLANHPVKGMYYTV  420

Query  1267  AGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             AG P+SL +T+ SY G+LR+A+  E+ FID+E +   + +AF+ I   A
Sbjct  421   AGTPESLRITIFSYAGNLRVAVGAEQGFIDSELYTRSLVNAFDAILRDA  469



>ref|XP_008342897.1| PREDICTED: O-acyltransferase WSD1-like [Malus domestica]
Length=467

 Score =   472 bits (1215),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 236/462 (51%), Positives = 321/462 (69%), Gaps = 18/462 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+  + NSSVLS+++LGVLE EIPI+  DS  +SLL++VF+PINPRFSSIM+    
Sbjct  9     EPVSPNGHYFNSSVLSISVLGVLEFEIPIE--DSQTLSLLENVFLPINPRFSSIMIEN--  64

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG K+WKRVEV   +HVK P +P+    E YD+   DY+S +A + FP ++PLWE+H+ K
Sbjct  65    NGKKQWKRVEVKLEDHVKTPIFPSNLSNESYDEYFDDYVSSIATKRFPQDKPLWEVHVIK  124

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YP +NAAGNVIFKLHH+LGDGYSLMGA+LSCLQRADNP+LPLTFPS       P    S 
Sbjct  125   YPNSNAAGNVIFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPS-----LLPSETKSE  179

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
              I      M + +    +TV DF W + KS   EDD +P++S  +G+EF PI  +T++ S
Sbjct  180   NI------MTKTISSLLSTVSDFWWGISKSFKGEDDPSPIKSSKNGLEFAPITISTITIS  233

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD+I+ IK KL VTIN V+TG++  G+RLYM++  + S +A  TALVL NTR I   Y S
Sbjct  234   LDRIRLIKSKLGVTINGVLTGMVFLGSRLYMQEMNQSSREAHSTALVLLNTR-IMANYTS  292

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + EM+KP+++ PWGN FTF+ V +P LT    S+ L +V K H+IIK+KRNS+++Y T  
Sbjct  293   IEEMVKPDSKSPWGNHFTFVHVPIPKLT--EFSNVLDYVWKTHKIIKQKRNSSAIYFTSG  350

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL+ L K  G E  +RY+  T KNSS+  ++MIGP+E+MSLAN P KG YF+  G P+ L
Sbjct  351   LLKMLNKFGGXEAASRYVCSTLKNSSVVXTSMIGPVEKMSLANQPIKGFYFLTVGTPEEL  410

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              +++VSY+G +++A +V+K  ID +K K C+ +A   I  AA
Sbjct  411   DISIVSYMGRVKLAFTVKKGIIDPQKLKLCMENALNMISNAA  452



>ref|XP_006603695.1| PREDICTED: uncharacterized protein LOC100777968 isoform X1 [Glycine 
max]
Length=478

 Score =   472 bits (1215),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 242/472 (51%), Positives = 332/472 (70%), Gaps = 23/472 (5%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP+ Q+L SS LS+ ILGVLESE+PI   DS  + LL+++F+PIN RFSSIM+ +  NG
Sbjct  13    VSPTGQYLTSSSLSVYILGVLESEVPID--DSQTVPLLQNLFLPINSRFSSIMIRDK-NG  69

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKP--IEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
              KKWK+VEV   +H+KVP +P GK   +  YD+ L +Y+S +A+E  P NRPLWE+H+ K
Sbjct  70    EKKWKKVEVKLEDHIKVPTFPNGKSSNLFLYDEYLDEYMSTIAVEHLPQNRPLWELHIIK  129

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NA G ++FKLHH+LGDG+SLMGA+LSC+QRADN +LP T PS QR    P++ + +
Sbjct  130   YPTSNAKGTLVFKLHHALGDGFSLMGALLSCMQRADNTSLPFTLPSSQR----PKASSIS  185

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                GFFK +P   F    T+ +FGWS  KS L+EDD+TP+RS  +  + R +  + ++FS
Sbjct  186   NTKGFFKKLPSIFF---QTISEFGWSFLKSKLIEDDQTPIRSCAEDFKTRQMTISDVTFS  242

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD IK +K KL V+INDV+ G+I +G RLYM++   +SS+ + TALVL NTR I  GYKS
Sbjct  243   LDLIKDVKSKLGVSINDVLAGVIFFGIRLYMQEINLKSSQTQSTALVLLNTRNI-EGYKS  301

Query  928   VTEMI-KPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             V EMI K N+   WGNQ+ FL VS+P L+ +  ++PL F+R+AH+ + +K+NS +  LTG
Sbjct  302   VKEMIEKTNSRSAWGNQYAFLHVSIPELSDSKYANPLEFIREAHKDMTKKKNSLATPLTG  361

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIP--  1278
              LL  L K RG E  A Y+  T +NSS  ISN+IGP+E+M++ANHP KG YF++AG P  
Sbjct  362   MLLDMLRKLRGPEAAASYLRSTLRNSSTTISNIIGPVEQMAVANHPIKGFYFMVAGSPEI  421

Query  1279  -------QSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
                    QSL +T++SY+G +RIA  VEK+FID + FK C+ ++ E I EAA
Sbjct  422   INILTELQSLTMTIMSYMGKIRIAFGVEKNFIDKQLFKSCLENSLEMIKEAA  473



>ref|XP_007151640.1| hypothetical protein PHAVU_004G063900g [Phaseolus vulgaris]
 gb|ESW23634.1| hypothetical protein PHAVU_004G063900g [Phaseolus vulgaris]
Length=468

 Score =   471 bits (1213),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 234/465 (50%), Positives = 325/465 (70%), Gaps = 15/465 (3%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+ Q+L SS LS+ IL V+E+EIPI   DS  + LL+++F+PIN RFSSIM+ +  
Sbjct  11    EPVSPTGQYLTSSSLSIYILAVMETEIPID--DSQTVPLLQNLFLPINSRFSSIMIKDK-  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIE--FYDDCLSDYLSKMAMEAFPPNRPLWEIHL  381
             NG KKWK+VEV   +H+KVP + +G       YD+ L +Y+SK+A+E  P +RPLWE+H+
Sbjct  68    NGDKKWKKVEVKLGDHIKVPKFQSGNESSNFLYDEYLDEYMSKIAVEHLPQHRPLWELHI  127

Query  382   FKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKA  561
              KYPT+ A G ++FKLHH+LGDG+SLMGA+LSC++RAD  +LP T PS QR    P+S  
Sbjct  128   VKYPTSKAMGTLVFKLHHALGDGFSLMGALLSCMERADKASLPFTLPSSQR----PKSPI  183

Query  562   SNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMS  741
             SN     FK +P        T+ +FGWS+ KS LVEDD+TP+RS  +  + R I  + +S
Sbjct  184   SN-TKVVFKRLPSIFL---RTISEFGWSLLKSNLVEDDQTPIRSCSEDTKMRHINISDVS  239

Query  742   FSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGY  921
             FSLD +K++K KL V+INDV+ G+I +G RLYM++   +SS+ + TALVL NTR I  GY
Sbjct  240   FSLDLVKEVKSKLGVSINDVLAGVIFFGIRLYMQEISLKSSQGQSTALVLLNTRNI-EGY  298

Query  922   KSVTEMI-KPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYL  1098
             KS+ EM+ K N    WGNQ+ FL V +P LT +  ++PL F+ +AH+ + +K+NS +  L
Sbjct  299   KSIKEMVEKTNTSSAWGNQYAFLHVPIPELTDSKYANPLEFIWEAHKEMIKKKNSLATPL  358

Query  1099  TGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIP  1278
             TG LL  L K RG E  A+Y++ T +NSS  ISNMIGP+E+M++AN P KG YF++AG P
Sbjct  359   TGMLLDMLRKLRGPEAAAKYLYSTLRNSSTTISNMIGPVEQMAVANIPIKGFYFMVAGSP  418

Query  1279  QSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             +SL +T++SY+G +RIA  VEKDFID + FK  + ++ E I EAA
Sbjct  419   ESLTMTIMSYMGKIRIAFGVEKDFIDKQLFKSSLENSLEMIVEAA  463



>ref|XP_009336220.1| PREDICTED: O-acyltransferase WSD1-like [Pyrus x bretschneideri]
Length=463

 Score =   471 bits (1211),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 236/471 (50%), Positives = 322/471 (68%), Gaps = 19/471 (4%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             +E+ E G E   SP+  + N+SVLS+++L VLE EIPI   DS  +SLL++VF+PINPRF
Sbjct  1     MEISEEGLE-PVSPTGHYFNNSVLSISVLAVLEYEIPID--DSQFLSLLENVFLPINPRF  57

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
              SI + +  NG K+WKRVEV   +HVK P +P+    E YD+   DYLS +A + FP ++
Sbjct  58    FSIRLKK--NGKKQWKRVEVKLEDHVKTPIFPSNLSNESYDEYFDDYLSNLATKRFPQDK  115

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWE H+ KYP +NAAGNV+FKLHH+LGDGYSLMGA+LSCLQRADNP+LPLTFPSRQ S 
Sbjct  116   PLWEFHVIKYPNSNAAGNVVFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPSRQSS-  174

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
               P+++           M R      NT+ D  W + KS   EDD +P++S + G EF P
Sbjct  175   -KPKNE---------NVMTRTFSSLLNTMSDIWWGISKSITGEDDGSPIKSSNIGFEFAP  224

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             I  +T++ SLD IK IK +L VTINDV+TG++  GTRLYM++  + S +A  TAL+L NT
Sbjct  225   ITVSTVTISLDHIKLIKSRLGVTINDVLTGMVFLGTRLYMQEMNQSSREAHSTALILLNT  284

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R + G Y SV EM+KP+++ PWGN  TFL + +P LT    S+ L FV KA + IK KRN
Sbjct  285   RVM-GNYTSVEEMVKPDSKSPWGNHITFLQIPIPNLT--EFSNILDFVWKAQKCIKTKRN  341

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S ++Y T  LL+ L +  G E  +R+IH T  NSSM  +N+IGP+E+MSLAN P KG+YF
Sbjct  342   SLAIYFTSGLLKMLNRFGGHEAASRFIHRTLTNSSMAFTNLIGPVEQMSLANQPIKGLYF  401

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             +I G P  L ++++SY+G +R+ L+++K  ID +K K C+ +A + I  A+
Sbjct  402   MIVGSPLDLDISVLSYMGKVRLTLTMKKGIIDPQKLKLCMENAHDMILNAS  452



>ref|XP_009336219.1| PREDICTED: O-acyltransferase WSD1-like [Pyrus x bretschneideri]
Length=467

 Score =   469 bits (1208),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 233/462 (50%), Positives = 323/462 (70%), Gaps = 18/462 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+  + N+SVLSL+IL +LE EIPI   DS  +SLL++VF+ INPRFSS+M+ +  
Sbjct  9     EPVSPNGHYFNNSVLSLSILAILEYEIPID--DSQFLSLLENVFLRINPRFSSVMIEQ--  64

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG K+WK+VEV   +H+K P +P+    E YD+   DY+S +A + FP ++PLWE+H+ K
Sbjct  65    NGKKQWKKVEVKLEDHLKTPIFPSNLSNESYDEYFDDYISSIATKRFPQDKPLWEVHVIK  124

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YP +NAAGN+IFKLHH+LGDGYSLMGA+LSCLQRADNP+LPLTFPS   S     +K+ N
Sbjct  125   YPNSNAAGNLIFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPSLLPS----ETKSEN  180

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                     M + +    +T+ D  W + KS   EDD +P++S  +G+EF PI  +T++ S
Sbjct  181   -------VMTKTMSSLLSTISDVWWGISKSFRGEDDPSPIKSSKNGLEFAPITISTITIS  233

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD+I+ IK KL VT NDV+TG+I  G+RLYM+   + S +A  T+LVL NTR +   Y S
Sbjct  234   LDRIRLIKSKLGVTTNDVLTGMIFLGSRLYMQALNQSSREAHSTSLVLLNTRFM-ANYAS  292

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + EMIKPN++  WGN FTFL V +P LT    S+ L FV  AH+IIK+KRNS+++Y T  
Sbjct  293   IEEMIKPNSKSSWGNHFTFLHVPIPKLT--EFSNVLDFVWNAHKIIKQKRNSSAIYFTSG  350

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL+ L K  G E  +RYIH T KNSS+ I++MIGP+E+MSLAN P KG+YF + G P++L
Sbjct  351   LLEMLNKFGGHEAASRYIHSTLKNSSVVITSMIGPVEKMSLANQPIKGLYFFVVGTPEAL  410

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              +++VSY+G++++A +V+K  ID +K K C+ +A   I  AA
Sbjct  411   DISIVSYMGNVKLAFTVKKGIIDPQKLKLCMENALNMISNAA  452



>gb|KHN35245.1| O-acyltransferase WSD1 [Glycine soja]
Length=471

 Score =   469 bits (1206),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 237/472 (50%), Positives = 313/472 (66%), Gaps = 13/472 (3%)
 Frame = +1

Query  10    MEHGYEEA---ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             M+  YEE     SP   + NSSV+   + G LE  +PI   DS  I LL+DVF+PINPRF
Sbjct  1     MDQFYEEVQEPVSPHGHYFNSSVICSYVFGFLEMAVPI--DDSQTIPLLEDVFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIM+ +   G  +WKRV+VN  EHVKVP +P     E YD    +Y++++  E  P N+
Sbjct  59    SSIMIRDQA-GKMRWKRVQVNPEEHVKVPRFPECNSAELYDHYFDEYVTRILNERTPQNK  117

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWE+HL KYPT+NAAG +IFK HHSLGDGYSLMGA+LSCLQR D+P+LPLTFPSR  S 
Sbjct  118   PLWEVHLIKYPTSNAAGTIIFKFHHSLGDGYSLMGALLSCLQRTDDPSLPLTFPSRVSSN  177

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
                  K        FK +   +   F+++ DFG SV K+ ++EDD+TP+RSG +G + + 
Sbjct  178   PQHAKKT------MFKKLHSVISSFFSSMLDFGSSVIKAKMIEDDKTPIRSGYEGTKPQH  231

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
                + +S SLD IK IK  L VTINDV+TGII YG RLYM++ +  + KA  TALV+ NT
Sbjct  232   FTLSNISLSLDHIKAIKSNLGVTINDVITGIIFYGIRLYMQEIDYMTRKANSTALVVLNT  291

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R I G Y+SV EM KP  +  WGN+ +FL + +P L     S+PL FV  A + IKRK++
Sbjct  292   RNIRG-YQSVKEMQKPKVKGLWGNKISFLQIPIPKLDQPKISNPLEFVWNARKQIKRKKH  350

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S SVYL G LL   MK RG EV ++  + T  N S+ ISNM GP+E+M+LANHP +G+YF
Sbjct  351   SFSVYLIGLLLDLEMKLRGPEVASKTFYNTLGNCSVLISNMFGPLEQMALANHPVRGVYF  410

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
              ++G PQ++ V ++SYVG LRI L   K FID +KFK C+  AF+ I++ A+
Sbjct  411   AMSGGPQNVNVAIMSYVGELRITLKTLKGFIDEQKFKFCIEKAFDEIFKDAM  462



>ref|XP_008362473.1| PREDICTED: O-acyltransferase WSD1-like [Malus domestica]
Length=645

 Score =   475 bits (1222),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 235/462 (51%), Positives = 319/462 (69%), Gaps = 18/462 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+  + NSSVLS+++L VLE EIPI   DS  +SLL++VF+PI+PRFSSIM+ +  
Sbjct  189   EPVSPNGHYFNSSVLSVSVLAVLEYEIPID--DSQTLSLLENVFLPISPRFSSIMIEK--  244

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG K+WK+VEV   +HVK P +P+    E YD+   DY+S +A + FP ++PLWE+H+ K
Sbjct  245   NGKKQWKKVEVKLEDHVKTPIFPSNMSNESYDEYFDDYISSIATKRFPQDKPLWEVHVIK  304

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YP +NAAGNVIFKLHH+LGDGYSLMGA+LSCLQRADNP+LPLTFPSR  S     +  + 
Sbjct  305   YPNSNAAGNVIFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPSRLPSETKSENVVTK  364

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
              IS              +T+ DF W + KS   EDD +P++S + G+EF PI  +T++ S
Sbjct  365   TISSL-----------LSTISDFWWGISKSFRGEDDPSPIKSSNHGLEFAPITISTITIS  413

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD+IK IK +L VTIND++TG++  G+RLYM++  + S +   TALVL NTR +   Y S
Sbjct  414   LDRIKLIKSRLGVTINDILTGMVFLGSRLYMQEMNQSSREVHSTALVLLNTRFM-ANYAS  472

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
               EMIKPN++ PWGN+F FL V +P LT    SD L FV  A +IIK+KR S ++Y T  
Sbjct  473   TEEMIKPNSKSPWGNRFAFLHVPIPKLT--EFSDVLDFVWNAQKIIKQKRXSLAIYFTSG  530

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL+ L K  G E  +RY+H T KNSSM IS+MIGP+++MSLAN P KG+YF++ G P+ L
Sbjct  531   LLEMLNKFGGHEAASRYVHSTLKNSSMMISSMIGPVQKMSLANQPIKGLYFLVVGTPEEL  590

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              +++VSY+G +R+A + +K  ID +K K C+ +A   I  AA
Sbjct  591   DISIVSYMGKVRLAXTAKKGIIDPQKLKLCMENALNMISNAA  632


 Score =   225 bits (574),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 137/179 (77%), Gaps = 5/179 (3%)
 Frame = +1

Query  1    VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
            +E  E G E   SP+    N+SVLS++IL VLE EIPI   DS  +SLL++VF+PINPRF
Sbjct  1    MENWEEGLE-PVSPTGHXFNNSVLSISILAVLEYEIPID--DSQFLSLLENVFLPINPRF  57

Query  181  SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
            SSIM+ +  NG K+WKRVEV   +HVK P +P+    E YD+   DYLS +A + FP ++
Sbjct  58   SSIMIEK--NGKKQWKRVEVKLEDHVKTPIFPSNLSNESYDEYFDDYLSNVATKRFPQDK  115

Query  361  PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRS  537
            PLWEIH+ KYPT+NA GNV+FKLHH+LGDGYSLMGA+LSCLQRADNP+LPLTFPSR+ S
Sbjct  116  PLWEIHVIKYPTSNAVGNVVFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPSRKPS  174



>ref|XP_003527429.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=471

 Score =   469 bits (1206),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 237/472 (50%), Positives = 313/472 (66%), Gaps = 13/472 (3%)
 Frame = +1

Query  10    MEHGYEEA---ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             M+  YEE     SP   + NSSV+   + G LE  +PI   DS  I LL+DVF+PINPRF
Sbjct  1     MDQFYEEVQEPVSPHGHYFNSSVICSYVFGFLEMAVPI--DDSQTIPLLEDVFLPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIM+ +   G  +WKRV+VN  EHVKVP +P     E YD    +Y++++  E  P N+
Sbjct  59    SSIMIRDQA-GKMRWKRVQVNPEEHVKVPRFPECNSAELYDHYFDEYVTRILNERTPQNK  117

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLWE+HL KYPT+NAAG +IFK HHSLGDGYSLMGA+LSCLQR D+P+LPLTFPSR  S 
Sbjct  118   PLWEVHLIKYPTSNAAGTIIFKFHHSLGDGYSLMGALLSCLQRTDDPSLPLTFPSRVSSN  177

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
                  K        FK +   +   F+++ DFG SV K+ ++EDD+TP+RSG +G + + 
Sbjct  178   PQHAKKT------IFKKLHSVISSFFSSMLDFGSSVIKAKMIEDDKTPIRSGYEGTKPQH  231

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
                + +S SLD IK IK  L VTINDV+TGII YG RLYM++ +  + KA  TALV+ NT
Sbjct  232   FTLSNISLSLDHIKAIKSNLGVTINDVITGIIFYGIRLYMQEIDYMTRKANSTALVVLNT  291

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R I G Y+SV EM KP  +  WGN+ +FL + +P L     S+PL FV  A + IKRK++
Sbjct  292   RNIRG-YQSVKEMQKPKVKGLWGNKISFLQIPIPKLDQPKISNPLEFVWNARKQIKRKKH  350

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S SVYL G LL   MK RG EV ++  + T  N S+ ISNM GP+E+M+LANHP +G+YF
Sbjct  351   SFSVYLIGLLLDLEMKLRGPEVASKTFYNTLGNCSVLISNMFGPLEQMALANHPVRGVYF  410

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
              ++G PQ++ V ++SYVG LRI L   K FID +KFK C+  AF+ I++ A+
Sbjct  411   AMSGGPQNVNVAIMSYVGELRITLKTLKGFIDEQKFKFCIEKAFDEIFKDAM  462



>ref|XP_004136846.1| PREDICTED: O-acyltransferase WSD1-like [Cucumis sativus]
Length=464

 Score =   467 bits (1202),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 228/471 (48%), Positives = 329/471 (70%), Gaps = 11/471 (2%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             E  + E  SP+AQ LN+S LS++++ VLE EIPI   ++ +I   KD F+P+N  FSSI 
Sbjct  4     EDEFLEPMSPTAQCLNTSSLSISVIAVLEFEIPID--EAKIICYAKD-FIPLNSLFSSIT  60

Query  193   VSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWE  372
             V++ ING +KWK+VEV   E + V   P+   IE  D   ++Y++K++++    N+PLWE
Sbjct  61    VND-INGERKWKKVEVKVEEQIVVATPPSDLSIELNDAFFNEYITKLSVQELDQNKPLWE  119

Query  373   IHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPR  552
             IH+   PT+ AA N+I K HHSLGDGYS+MG +LS ++RADNP+LPLTFP   +      
Sbjct  120   IHILNCPTSTAAANLILKFHHSLGDGYSVMGLLLSTMKRADNPSLPLTFPFNGKMI---N  176

Query  553   SKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATT  732
             SK   +IS     +  FL  + N+V DFG S+ KS+++ED+ TP+RSG DGVEF+P    
Sbjct  177   SKKLGQISS---GVSHFLLSSINSVLDFGLSLIKSSVLEDELTPIRSGGDGVEFKPTEIW  233

Query  733   TMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIG  912
             T++FSL QIKQIK KL+VT+NDVV G++  G RLYM++   +S+K+  TALVL NTR  G
Sbjct  234   TITFSLHQIKQIKSKLRVTVNDVVAGMLFLGIRLYMEETHPDSTKSNSTALVLLNTRMFG  293

Query  913   GGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASV  1092
               YK + +M+ PN+  PWGN+F FL + +P LT  N S+PL+FV+ A ++IKRKR+S++V
Sbjct  294   T-YKCMEDMLNPNSNTPWGNRFGFLHIDIPKLTDFNLSNPLQFVQAAQKLIKRKRDSSAV  352

Query  1093  YLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAG  1272
             +L   L++ + K RGSEV ++Y++ T KNSS+ I+N+IGP E+M+L  HP KG+YF + G
Sbjct  353   FLVDKLMEIIHKFRGSEVASKYVYKTIKNSSLSITNLIGPKEKMTLTGHPVKGMYFTVVG  412

Query  1273  IPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
             IPQSL ++++SY+ +LRIA   EK+FID EK   C+  AF+ I++A++  S
Sbjct  413   IPQSLKISVISYMENLRIAFGSEKEFIDQEKLTSCMKKAFDHIHKASIDVS  463



>gb|KGN43650.1| hypothetical protein Csa_7G051300 [Cucumis sativus]
Length=464

 Score =   467 bits (1201),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 228/471 (48%), Positives = 329/471 (70%), Gaps = 11/471 (2%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             E  + E  SP+AQ LN+S LS++++ VLE EIPI   ++ +I   KD F+P+N  FSSI 
Sbjct  4     EDEFLEPMSPTAQCLNTSSLSISVIAVLEFEIPID--EAKIICYAKD-FIPLNSLFSSIT  60

Query  193   VSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWE  372
             V++ ING +KWK+VEV   E + V   P+   IE  D   ++Y++K++++    N+PLWE
Sbjct  61    VND-INGERKWKKVEVKVEEQIVVATPPSDLSIELNDAFFNEYITKLSVQELDQNKPLWE  119

Query  373   IHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPR  552
             IH+   PT+ AA N+I K HHSLGDGYS+MG +LS ++RADNP+LPLTFP   +      
Sbjct  120   IHILNCPTSTAAANLILKFHHSLGDGYSVMGLLLSTMKRADNPSLPLTFPFNGKMI---N  176

Query  553   SKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATT  732
             SK   +IS     +  FL  + N+V DFG S+ KS+++ED+ TP+RSG DGVEF+P    
Sbjct  177   SKKLGQISS---GVSHFLLSSINSVLDFGLSLIKSSVLEDELTPIRSGGDGVEFKPTEIW  233

Query  733   TMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIG  912
             T++FSL QIKQIK KL+VT+NDVV G++  G RLYM++   +S+K+  TALVL NTR  G
Sbjct  234   TITFSLHQIKQIKSKLRVTVNDVVAGMLFLGIRLYMEETHPDSTKSNSTALVLLNTRMFG  293

Query  913   GGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASV  1092
               YK + +M+ PN+  PWGN+F FL + +P LT  N S+PL+FV+ A ++IKRKR+S++V
Sbjct  294   T-YKCMEDMLNPNSNTPWGNRFGFLHIDIPKLTDFNLSNPLQFVQAAQKLIKRKRDSSAV  352

Query  1093  YLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAG  1272
             +L   L++ + K RGSEV ++Y++ T KNSS+ I+N+IGP E+M+L  HP KG+YF + G
Sbjct  353   FLVDKLMEIIHKFRGSEVASKYVYKTIKNSSLSITNLIGPKEKMTLTGHPVKGMYFTVVG  412

Query  1273  IPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
             IPQSL ++++SY+ +LRIA   EK+FID EK   C+  AF+ I++A++  S
Sbjct  413   IPQSLKISVISYMENLRIAFGGEKEFIDQEKLTSCMKKAFDHIHKASIDVS  463



>ref|XP_004516681.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=469

 Score =   466 bits (1200),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 240/465 (52%), Positives = 322/465 (69%), Gaps = 11/465 (2%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP+ Q+LNSS L + ILGVLE E+PI   +   +SLL +VF+PIN RFSSIM+ + 
Sbjct  9     EEPVSPTGQYLNSSSLCVYILGVLEFEVPID-DNIQTLSLLHNVFLPINTRFSSIMIKDK  67

Query  205   INGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
              NG KKWK+VEV   EHVK P +P+ K    YD+ + DY+S +AME  P +RPLWEIHL 
Sbjct  68    -NGEKKWKKVEVKLEEHVKNPVFPSRKS-SLYDEYVDDYISTIAMEHLPEHRPLWEIHLI  125

Query  385   KYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
             KYPT N A  ++FKLHH+LGDGYSLMGA+LSCLQR DNP+LP T PS Q   +   +K  
Sbjct  126   KYPTKNGASTLVFKLHHALGDGYSLMGALLSCLQRVDNPSLPFTLPSTQTPKSIFNTKPF  185

Query  565   NKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSF  744
             +K     ++ P      FNT+ DFGWS+ KS+LVEDD TP+RS  D ++ R I  +++SF
Sbjct  186   SK-----RSFPSIFPKVFNTISDFGWSILKSSLVEDDLTPIRSCADDMKLRHITISSVSF  240

Query  745   SLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYK  924
             S+++IK++K +L V INDV+ G+I +G RLYM+Q  E+S K + TALVL NTR   G YK
Sbjct  241   SMNRIKEVKSRLGVGINDVIAGLIFFGIRLYMQQINEDSIKYKSTALVLMNTRNFKG-YK  299

Query  925   SVTEMIKPNAE--MPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYL  1098
             S+ EM+  N      WGNQF FL + +P L+     +PL F+ +AH+ I RK+NS +  L
Sbjct  300   SIKEMVDKNNSNGSTWGNQFAFLHIPIPELSDTKFENPLEFIWEAHKEINRKKNSLATPL  359

Query  1099  TGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIP  1278
              G LL  +   RG E +ARYI+ T +NSS  ISN+IGP+E+M+LANHP KG+YF++ G P
Sbjct  360   NGMLLNMVKILRGPEASARYIYNTLRNSSTTISNVIGPVEQMALANHPVKGLYFMVVGPP  419

Query  1279  QSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             +SL +T++SY+G LRIA  +EKD+ID +KF  C+ ++ E I  AA
Sbjct  420   ESLTITIMSYMGQLRIAFGLEKDYIDKQKFMSCIENSLEMIITAA  464



>gb|KHN36647.1| O-acyltransferase WSD1 [Glycine soja]
Length=468

 Score =   464 bits (1193),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 224/459 (49%), Positives = 317/459 (69%), Gaps = 11/459 (2%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGG  216
             SP A +L+SS++++ +LGVLESEIPI   DS    LLK+ F+PI+ RFSSI+V +   G 
Sbjct  13    SPMADYLSSSLINVFVLGVLESEIPID--DSRAEPLLKNAFLPISTRFSSILVMDK-KGN  69

Query  217   KKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYPT  396
             K WK+V+VN  EH+K+P +    P++ YD+CL +Y+SK+AME  P ++PLWE+H+FKYPT
Sbjct  70    KGWKQVDVNVKEHIKIPTFTYAMPLKLYDECLDEYMSKIAMEQLPLDKPLWEMHIFKYPT  129

Query  397   TNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKIS  576
             +NAAG  IFKLHH+LGDGYS M  +LSC+Q A+NP++P+ FPS  RS  +  +K   K+ 
Sbjct  130   SNAAGTFIFKLHHALGDGYSFMTTLLSCVQNAENPSVPIKFPS-SRSVESKSTKIMPKL-  187

Query  577   GFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLDQ  756
                  +P+ +   F + +DFGWS+ K +L+ DD+TP+RSG   V FRP++ T +S SL  
Sbjct  188   -----LPQTVSMVFKSAFDFGWSLLKDSLIPDDQTPIRSGHKDVGFRPMSVTDVSLSLGN  242

Query  757   IKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVTE  936
             IK++KDKLKV++NDV+ G+I  G +LYM     +SS+A  TALVL NTR I   YKS   
Sbjct  243   IKEVKDKLKVSVNDVLVGVIFLGIQLYMSAKNHKSSRAESTALVLLNTRKIRA-YKSAEM  301

Query  937   MIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQ  1116
             M   N+E PWGN+F F+ V +P L+  N  +PL +V +A++ I RKRNS +V LTG LL+
Sbjct  302   MDHTNSEAPWGNRFHFMHVPMPMLSDTNYLNPLEYVLEANKNINRKRNSLAVPLTGVLLR  361

Query  1117  ALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVT  1296
              L K RG +    Y++    N+S+ IS+M+GPME+++LANHP KG+YF+  G+ QS+ VT
Sbjct  362   LLNKIRGPQAATNYVYKILNNTSLSISHMVGPMEKVALANHPIKGLYFMTVGLSQSITVT  421

Query  1297  MVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             + SY+G LR+   VE+ FID  + K C   + E I +AA
Sbjct  422   ITSYMGYLRVGFGVEEGFIDEYQLKSCFETSLEMILKAA  460



>ref|XP_008455536.1| PREDICTED: O-acyltransferase WSD1-like [Cucumis melo]
Length=456

 Score =   463 bits (1192),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 230/464 (50%), Positives = 315/464 (68%), Gaps = 19/464 (4%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             ++  SP A++L+S +LSL++L +LE ++PI   D  +   L+++F+PINPRFSSI+V+  
Sbjct  7     QQPLSPIAEYLSSPMLSLSVLAILEFQVPIHTLD--LAPNLRNLFLPINPRFSSILVTNE  64

Query  205   INGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
               G KKWKRV V   EHVK P +P G  IE Y     +YL+K++ME F P++PLWE HLF
Sbjct  65    -QGEKKWKRVNVEVEEHVKDPIFPPGLTIESYKAHFDEYLTKISMEEFRPDKPLWETHLF  123

Query  385   KYPTT-NAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKA  561
             KYPT+   AG +I KLHHSLGDGYSLMG +LSCL  A +P +PLTFPSR       R + 
Sbjct  124   KYPTSPTVAGTMILKLHHSLGDGYSLMGVVLSCLHTASDPNVPLTFPSR-------RQRR  176

Query  562   SNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMS  741
              N  +G  K++   +     T  D GWSVFK     D++TP+RSG +G++F P+ T T+S
Sbjct  177   FN--NGVVKSLTGIVSAVCRTASDLGWSVFKGI---DEKTPIRSGREGLQFMPMNTFTVS  231

Query  742   FSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGY  921
             FSL+ IK+IK KL+VT+NDV+TGII  G RLYM++ E+ S +   TAL + NTR IG  Y
Sbjct  232   FSLNDIKKIKTKLQVTVNDVITGIIFMGLRLYMEEIEKNSGEVAATALTIVNTRVIGN-Y  290

Query  922   KSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLT  1101
             +S TEM KP ++  WGNQ ++L + +P +T  N ++PL FV  AHR I  KR S ++++ 
Sbjct  291   RSATEMAKPESKGLWGNQLSYLEIMIPKMT--NVTNPLEFVMAAHRSINNKRTSFTIHVV  348

Query  1102  GWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQ  1281
               LL  L K RG +  A+++H   KN++  ISN+IGP+++M+L NHP  G+YF I G PQ
Sbjct  349   AHLLNLLRKLRGHQEVAKFLHNLLKNTTTVISNVIGPLQQMALDNHPISGLYFTIVGTPQ  408

Query  1282  SLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             S+ VTM+SY+G LR+A   EKDFIDA K  CC+  AFE I+EAA
Sbjct  409   SVTVTMLSYMGKLRVAFRTEKDFIDAHKLNCCMEDAFEKIFEAA  452



>ref|XP_003541905.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=468

 Score =   462 bits (1190),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 224/459 (49%), Positives = 317/459 (69%), Gaps = 11/459 (2%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGG  216
             SP A +L+SS++++ +LGVLESEIPI   DS    LLK+ F+PI+ RFSSI+V +   G 
Sbjct  13    SPMADYLSSSLINVFVLGVLESEIPID--DSRAEPLLKNAFLPISTRFSSILVMDK-KGN  69

Query  217   KKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYPT  396
             K WK+V+VN  EH+K+P +    P++ YD+CL +Y+SK+AME  P ++PLWE+H+FKYPT
Sbjct  70    KGWKQVDVNVKEHIKIPTFTYTMPLKLYDECLDEYMSKIAMEQLPLDKPLWEMHIFKYPT  129

Query  397   TNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKIS  576
             +NAAG  IFKLHH+LGDGYS M  +LSC+Q A+NP++P+ FPS  RS  +  +K   K+ 
Sbjct  130   SNAAGTFIFKLHHALGDGYSFMTTLLSCVQNAENPSVPIKFPS-SRSVESKSTKIMPKL-  187

Query  577   GFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLDQ  756
                  +P+ +   F + +DFGWS+ K +L+ DD+TP+RSG   V FRP++ T +S SL  
Sbjct  188   -----LPQTVSMMFKSAFDFGWSLLKDSLIPDDQTPIRSGHKDVGFRPMSVTDVSLSLGN  242

Query  757   IKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVTE  936
             IK++KDKLKV++NDV+ G+I  G +LYM     +SS+A  TALVL NTR I   YKS   
Sbjct  243   IKEVKDKLKVSVNDVLVGVIFLGIQLYMSAKNHKSSRAESTALVLLNTRKIRA-YKSAEM  301

Query  937   MIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQ  1116
             M   N+E PWGN+F F+ V +P L+  N  +PL +V +A++ I RKRNS +V LTG LL+
Sbjct  302   MDHTNSEAPWGNRFHFMHVPMPMLSDTNYLNPLEYVLEANKNINRKRNSLAVPLTGVLLR  361

Query  1117  ALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVT  1296
              L K RG +    Y++    N+S+ IS+M+GPME+++LANHP KG+YF+  G+ QS+ VT
Sbjct  362   LLNKIRGPQAATNYVYKILNNTSLSISHMVGPMEKVALANHPIKGLYFMTVGLSQSITVT  421

Query  1297  MVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             + SY+G LR+   VE+ FID  + K C   + E I +AA
Sbjct  422   ITSYMGYLRVGFGVEEGFIDEYQLKSCFETSLEMILKAA  460



>ref|XP_009396631.1| PREDICTED: O-acyltransferase WSD1-like [Musa acuminata subsp. 
malaccensis]
Length=497

 Score =   463 bits (1191),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 230/473 (49%), Positives = 323/473 (68%), Gaps = 9/473 (2%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             VE+ E   ++  SP+ Q+ NSSVLS+ IL + ES++ I   DS  +S L+++F+PI+PRF
Sbjct  27    VEVEETVVDDPVSPTGQYFNSSVLSIGILAIFESDVAID--DSPTMSTLENLFLPIHPRF  84

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SS+MV +  +G ++WKRV +   +HV VP +PAG  +E YDD +  Y+S +A+  F  +R
Sbjct  85    SSVMVKDD-HGVRRWKRVALKLEDHVNVPVFPAG--LETYDDYIRGYISDIAVAEFSQSR  141

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLW++H+ KYPT +AAG ++F++HH+LGDG+SLM A+ SC +RAD+P+LPLTFPS   S 
Sbjct  142   PLWDLHILKYPTKSAAGTMVFRIHHALGDGFSLMSALFSCFRRADDPSLPLTFPS---SR  198

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
             A    + S      ++ +PR L    NTV DFGWS+ K+  + DD TPVRS + GVEFRP
Sbjct  199   ATKPVQGSGAWWRAWRNVPRALSVCMNTVRDFGWSLLKTNYLADDWTPVRSEEAGVEFRP  258

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
             +  +T++ SLD+++ +K KL  T+NDV++G I YGT+LY +     S +AR TALVL NT
Sbjct  259   MEISTVTLSLDEVRHVKAKLGGTVNDVISGTIFYGTQLYFQATAPGSKEARVTALVLLNT  318

Query  901   RAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN  1080
             R I   Y+S+ EM  P+A  PWGN+F FL V +P     +ASDPL FV KA +IIK K++
Sbjct  319   RMIAS-YQSLKEMAGPDATNPWGNRFGFLHVPVPVSGNPDASDPLSFVLKARQIIKAKKS  377

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             S +V+L G LL+ + K RG+E  ARYIH T +N+SM ISN+ GPME+M +A HP    YF
Sbjct  378   SLAVHLNGRLLETIRKLRGAETAARYIHSTLRNTSMTISNLSGPMEQMIIAGHPIGSFYF  437

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALG  1419
             +  G PQSL V++VSY+G L++A+  EK FIDA     C+  +F  I EAA G
Sbjct  438   MTVGSPQSLTVSVVSYMGKLKVAMGTEKGFIDAGLLVSCMEQSFRRISEAAAG  490



>ref|XP_003607478.1| O-acyltransferase WSD1 [Medicago truncatula]
 gb|AES89675.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=455

 Score =   459 bits (1180),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 227/444 (51%), Positives = 318/444 (72%), Gaps = 11/444 (2%)
 Frame = +1

Query  85    LGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGGKKWKRVEVNHSEHVKV  264
              G LE EIP+   DS  + L ++ F+PINPRFSSIMV +  +G   WK++E    +H+KV
Sbjct  5     FGFLELEIPM--DDSQTMYLFQN-FLPINPRFSSIMVRDQ-DGKMMWKKIEAKPEDHMKV  60

Query  265   PNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLG  444
             P +P  + IE YD    DY+SK+ ME  P ++PLWE+HL KYPT+NA G +IFKLHH+LG
Sbjct  61    PIFPKSESIELYDQYFDDYVSKIMMERTPQDKPLWEMHLIKYPTSNAKGTLIFKLHHALG  120

Query  445   DGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKISGFFKAMPRFLFGAFNT  624
             DGYSLMGA+LSCLQRAD+P+LPL+FPSR+ S      K      GFFK  P  +F  FN+
Sbjct  121   DGYSLMGALLSCLQRADDPSLPLSFPSRKPSQLLSPKK------GFFKWFPSTIFSFFNS  174

Query  625   VYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVV  804
               DFGWS+ KS++++DD+TP+ +G++GVE +P   + +SFSLD+IK IK KL VTINDV+
Sbjct  175   FSDFGWSIAKSSMLKDDKTPIWNGEEGVESQPCVLSNLSFSLDEIKTIKSKLGVTINDVI  234

Query  805   TGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTF  984
             TG+I YG RLYM++ ++++  +  T LVL +TR +G  Y+S+ +M K +++ PWGN  +F
Sbjct  235   TGVIFYGIRLYMQEMDKKARTSNSTGLVLLSTRNVGS-YQSIQDMTKADSKSPWGNHISF  293

Query  985   LPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIH  1164
             L VS+P L+ A+ S+PL F+ KA +IIKRKRN+ +V+L  WLL   +K RG E  A++I+
Sbjct  294   LHVSIPKLSKASLSNPLEFIWKAQKIIKRKRNTFTVFLIEWLLDMELKLRGHEAVAKHIY  353

Query  1165  GTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEK  1344
              T +NSS+ ISN+IGP+E M+LANHP KG+YF + G P+S+ + ++SY   LRI L  +K
Sbjct  354   DTLRNSSVVISNLIGPVEPMALANHPVKGLYFTMTGGPESINIAVMSYTRILRITLKTQK  413

Query  1345  DFIDAEKFKCCVHHAFEGIYEAAL  1416
              FID +KFK C+  AFE I +A++
Sbjct  414   GFIDEQKFKFCMVRAFEVISKASM  437



>ref|XP_010035414.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW46794.1| hypothetical protein EUGRSUZ_K00600 [Eucalyptus grandis]
Length=473

 Score =   459 bits (1181),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 233/468 (50%), Positives = 329/468 (70%), Gaps = 15/468 (3%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS Q+LNS V+S++ILG+LE EIPI   DS  +S  +D+F+PINPRFSSIMV+ G 
Sbjct  11    EPVSPSGQYLNSKVMSVSILGILELEIPID--DSQAMSFFRDIFLPINPRFSSIMVT-GE  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFY---DDCLSDYLSKMAMEAFPPNRPLWEIH  378
              G +KWK+V VN   HV VP++ + K        D  L  Y+S++AM+ FP  +PLWEIH
Sbjct  68    KGARKWKKVGVNMENHVHVPSFSSPKGSSSPSENDSFLKSYISQIAMQPFPQGQPLWEIH  127

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
             + K PT+ A   +IFKLHH+LGDGYSL+ A+LSCLQRAD+P+LP+T PS ++ ++A +  
Sbjct  128   IIKCPTSEAQETLIFKLHHALGDGYSLVAALLSCLQRADDPSLPVTSPSVKKFSSANKD-  186

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
               ++  G  K + R      NTV DFGWS+ KST V+DD +P+RSG + ++  P + +T+
Sbjct  187   --DRNIGLRKVVSRCFSPLVNTVRDFGWSLLKSTCVKDDLSPIRSGSESLQ--PYSVSTI  242

Query  739   SFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESS-KARCTALVLFNTRAIGG  915
             +FSLDQIK+IK +L+VT+NDV++G+I   TRLYM++    S+     TALVL NTR +  
Sbjct  243   TFSLDQIKEIKSRLRVTVNDVISGVIFLATRLYMQRVSTNSNLSTNSTALVLLNTRNLRD  302

Query  916   GYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANA--SDPLRFVRKAHRIIKRKRNSAS  1089
              YK V +M++PN+E PWGN F FL V +P + P+++  SDPL+FV K H +IKRKR+S  
Sbjct  303   -YKPVRDMVRPNSESPWGNHFAFLHVPIPKVKPSDSQFSDPLKFVHKTHEVIKRKRSSFG  361

Query  1090  VYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIA  1269
             V LTG LL+ + K R +E  A++I  T++NSSMGISN+IGP+ ++SLANHP +G+YF +A
Sbjct  362   VILTGKLLEIMQKCRNAEAVAKHISRTARNSSMGISNVIGPIHKLSLANHPLRGVYFTVA  421

Query  1270  GIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             GIP +L +T+ SY G+LR+A+  E+ FID+E +   +  AF+ I   A
Sbjct  422   GIPWNLLITIFSYAGNLRVAVGAEQGFIDSELYNHSLLDAFDMILRDA  469



>gb|AES89670.2| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=470

 Score =   456 bits (1173),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 236/466 (51%), Positives = 320/466 (69%), Gaps = 15/466 (3%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             +E  SP  Q+ NSSV+   + G LE  IPI   DS  + LLKDVF+PINPRFSSIMV + 
Sbjct  9     QEPVSPHGQYFNSSVICSYVFGFLELAIPI--DDSQTMPLLKDVFLPINPRFSSIMVRDK  66

Query  205   INGGKKWKRVEVNHSEHVKVPNYP--AGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIH  378
              +G  +W+RVEV   EH+K+P +P         YD+ LSDY++ +     P ++PLWEIH
Sbjct  67    -DGKMRWQRVEVKLEEHIKIPKFPETTNSSSILYDNYLSDYVTSILTSRTPQDKPLWEIH  125

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
             L KYPT+NA G +IFKLHH+LGDGYSLMGA+LSCLQRAD+P+LPL+FPSR      P+  
Sbjct  126   LIKYPTSNAKGTLIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSR------PQLN  179

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
             +     G FK +   +   F+++ DFG S+ K+ ++EDD+TP+RSG +G E +P   + +
Sbjct  180   SKYAKKGLFKKLCLDISSFFSSISDFGSSLIKTRMIEDDKTPIRSGYEGTESQPFTLSNI  239

Query  739   SFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGG  918
             S SLDQIK+IK KL VTINDV++G+I YG RLYM++  E++ K+  TA+V+ NTR I G 
Sbjct  240   SLSLDQIKEIKSKLGVTINDVLSGVIFYGIRLYMEEMNEKTKKSNSTAVVMLNTRNIEG-  298

Query  919   YKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYL  1098
             Y+S+ EM KP ++  WGNQ +FL + +P L+    SDPL FV KA ++IKRKR S  VYL
Sbjct  299   YQSLKEMQKPESKSLWGNQISFLQIPIPKLS---QSDPLEFVWKARKLIKRKRRSFGVYL  355

Query  1099  TGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIP  1278
              G LL   MK +GSE  A+ I+ T  NSS+ ISN++GP+E+M+LANHP  G YF + G P
Sbjct  356   IGLLLNLEMKLKGSESVAKIIYNTMGNSSVVISNLVGPVEKMALANHPINGFYFTMTGGP  415

Query  1279  QSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             +++ +T++SYV  LRI L   K FID  KFK C+  A E I++AA+
Sbjct  416   ENVDITIMSYVKILRITLRTLKGFIDERKFKFCMEKAVEVIFKAAM  461



>ref|XP_010035413.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW46795.1| hypothetical protein EUGRSUZ_K00600 [Eucalyptus grandis]
Length=476

 Score =   454 bits (1167),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 233/471 (49%), Positives = 329/471 (70%), Gaps = 18/471 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS Q+LNS V+S++ILG+LE EIPI   DS  +S  +D+F+PINPRFSSIMV+ G 
Sbjct  11    EPVSPSGQYLNSKVMSVSILGILELEIPID--DSQAMSFFRDIFLPINPRFSSIMVT-GE  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFY---DDCLSDYLSKMAMEAFPPNRPLWEIH  378
              G +KWK+V VN   HV VP++ + K        D  L  Y+S++AM+ FP  +PLWEIH
Sbjct  68    KGARKWKKVGVNMENHVHVPSFSSPKGSSSPSENDSFLKSYISQIAMQPFPQGQPLWEIH  127

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
             + K PT+ A   +IFKLHH+LGDGYSL+ A+LSCLQRAD+P+LP+T PS ++ ++A +  
Sbjct  128   IIKCPTSEAQETLIFKLHHALGDGYSLVAALLSCLQRADDPSLPVTSPSVKKFSSANK--  185

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
               ++  G  K + R      NTV DFGWS+ KST V+DD +P+RSG + ++  P + +T+
Sbjct  186   -DDRNIGLRKVVSRCFSPLVNTVRDFGWSLLKSTCVKDDLSPIRSGSESLQ--PYSVSTI  242

Query  739   SFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESS-KARCTALVLFNTRAIGG  915
             +FSLDQIK+IK +L+VT+NDV++G+I   TRLYM++    S+     TALVL NTR +  
Sbjct  243   TFSLDQIKEIKSRLRVTVNDVISGVIFLATRLYMQRVSTNSNLSTNSTALVLLNTRNL-R  301

Query  916   GYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANA--SDPLRFVRKAHRIIKRKRNSAS  1089
              YK V +M++PN+E PWGN F FL V +P + P+++  SDPL+FV K H +IKRKR+S  
Sbjct  302   DYKPVRDMVRPNSESPWGNHFAFLHVPIPKVKPSDSQFSDPLKFVHKTHEVIKRKRSSFG  361

Query  1090  VYLTGWLLQALMKTRGSE---VTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             V LTG LL+ + K R +E     A++I  T++NSSMGISN+IGP+ ++SLANHP +G+YF
Sbjct  362   VILTGKLLEIMQKCRNAEYLQAVAKHISRTARNSSMGISNVIGPIHKLSLANHPLRGVYF  421

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              +AGIP +L +T+ SY G+LR+A+  E+ FID+E +   +  AF+ I   A
Sbjct  422   TVAGIPWNLLITIFSYAGNLRVAVGAEQGFIDSELYNHSLLDAFDMILRDA  472



>ref|XP_010038538.1| PREDICTED: O-acyltransferase WSD1-like [Eucalyptus grandis]
 gb|KCW46800.1| hypothetical protein EUGRSUZ_K00605 [Eucalyptus grandis]
Length=476

 Score =   454 bits (1167),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 235/471 (50%), Positives = 328/471 (70%), Gaps = 18/471 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS Q+LNS V+S++ILG+LE EIPI   DS  +SL +D F+PINPRFSSIMV+ G 
Sbjct  11    EPVSPSGQYLNSKVMSVSILGILELEIPID--DSQAMSLFRDDFLPINPRFSSIMVT-GD  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFY---DDCLSDYLSKMAMEAFPPNRPLWEIH  378
              G +KWK+V VN   HV VP++ + K        D  L  Y+S++AM+ FP  +PLWEIH
Sbjct  68    KGARKWKKVGVNMENHVHVPSFSSPKGSSSPSENDSFLKSYISQIAMQPFPQGQPLWEIH  127

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
             + K PT+ A   +IFKLHH+LGDGYSL+ A+LSCLQRAD+P+LP+TFPS ++ ++A +  
Sbjct  128   IIKCPTSEAQETLIFKLHHALGDGYSLVAALLSCLQRADDPSLPVTFPSVKKFSSANK--  185

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
               ++  G  K + R      NTV DFGWS+ KST V+DD +P+RSG + ++  P + +T+
Sbjct  186   -DDRNIGLRKVVSRCFSPLVNTVRDFGWSLLKSTCVKDDLSPIRSGSESLQ--PFSVSTI  242

Query  739   SFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESS-KARCTALVLFNTRAIGG  915
             +FSLDQIK+IK +L+VT+NDV+ G+I   TRLYM++    S+     TALVL NTR +  
Sbjct  243   TFSLDQIKEIKSRLRVTVNDVILGVIFLATRLYMQRVSTNSNLSTNSTALVLLNTRNL-R  301

Query  916   GYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANA--SDPLRFVRKAHRIIKRKRNSAS  1089
              YK V +M++PN+E PWGN F FL V +P + P+++  SDPL+FV K H +IKRKR+S  
Sbjct  302   DYKPVKDMVRPNSESPWGNHFAFLHVPIPKVKPSDSQFSDPLKFVHKTHEVIKRKRSSFG  361

Query  1090  VYLTGWLLQALMKTRGSE---VTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             V LTG LL+ + K R +E     A++I  T++NSSM ISN+IGP++ +SLANHP KG+Y+
Sbjct  362   VILTGKLLEIMQKCRNAEYLQAVAKHISRTARNSSMCISNLIGPVDNLSLANHPLKGMYY  421

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
              IAG P+SL +T+ SY G+LR+A+  E+ FID+E +   +  AF+ I   A
Sbjct  422   TIAGTPESLRITIFSYAGNLRVAVGAEQGFIDSELYNHSLLDAFDMILRDA  472



>ref|XP_004516688.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=482

 Score =   450 bits (1157),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 236/458 (52%), Positives = 313/458 (68%), Gaps = 13/458 (3%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP+AQ+LNSS L + IL V+  E+PI   D   +SLL++ F+P+N RFSSIM+ E  NG
Sbjct  12    VSPTAQYLNSSSLCVYILSVIAFEVPID--DIPALSLLQEKFIPMNTRFSSIMI-EDKNG  68

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              KKWK+VEV   EHVK P +P+ K    YD+   +Y+SK+AME  P +RPLWE+HL KYP
Sbjct  69    EKKWKKVEVKLEEHVKTPIFPSSKS-SLYDEHFDEYMSKLAMERLPEDRPLWEVHLIKYP  127

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T NAAG+ I KLHH+LGDGYSLMGA+LSC  R DNP+LP T PS Q     P+S  + K 
Sbjct  128   TKNAAGSAILKLHHALGDGYSLMGALLSCFVRVDNPSLPFTLPSTQ----TPKSIFNTK-  182

Query  574   SGFFKAMPRFLF-GAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSL  750
                FK     +F   FNT+ DFGWSV KS+LV+DD TP++S  +  +F  I  +++S ++
Sbjct  183   -DVFKNYIFSIFSNVFNTISDFGWSVLKSSLVKDDFTPIKSNANDTKFLQITVSSISITM  241

Query  751   DQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSV  930
             D IK+IK +L V+INDV+ GII  G RLYM++  ++SSK + TALVL NTR+I  GYKS+
Sbjct  242   DHIKEIKSRLGVSINDVLVGIIFLGIRLYMQEMNKDSSKYKSTALVLMNTRSI-KGYKSI  300

Query  931   TEMI-KPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
              EM+ K N   PWGNQF FL   +P L   N  +PL F+ +AH  I RK+NS    LTG 
Sbjct  301   KEMVDKNNKNGPWGNQFAFLHTPIPELNDTNIENPLDFILEAHEEINRKKNSLGAPLTGL  360

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL  + K RG E +ARYI+ T  NSS+ ISN++GPME+M++AN+  K IY I+ G+P S+
Sbjct  361   LLNVMKKLRGPEASARYIYNTIGNSSLTISNLVGPMEQMTVANYRVKSIYHIVTGVPNSI  420

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGI  1401
              V++VSY+G LRI  ++EKDF D EKF  C+  + + I
Sbjct  421   AVSIVSYMGMLRITFALEKDFFDKEKFMSCMEKSLQLI  458



>ref|XP_008805672.1| PREDICTED: O-acyltransferase WSD1-like [Phoenix dactylifera]
Length=421

 Score =   447 bits (1149),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 223/429 (52%), Positives = 296/429 (69%), Gaps = 12/429 (3%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             VE  +    +  SP  Q+ +SSVLS+ IL + ESEIP+   DS  +  L+++F+PINPRF
Sbjct  3     VEGGQMARNQPVSPMGQYFSSSVLSVNILAIFESEIPM--DDSKAMWALENLFLPINPRF  60

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV    +G   W++V+V   EHV +P +P G  +EFYDD + +YLSK+  E  P +R
Sbjct  61    SSIMVKNE-HGILTWRKVKVKLEEHVNIPLFPPG--LEFYDDSMQEYLSKVGTELLPHDR  117

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
             PLW+IH+ KYPT NA G + FKLHHSLGDG+SLMGA+ SCL+RAD+P+LPLTFPS   S 
Sbjct  118   PLWDIHIIKYPTRNAPGTMAFKLHHSLGDGFSLMGALFSCLRRADDPSLPLTFPSSSES-  176

Query  541   AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
                 S+   K     K++ R     FNT  DFGWS   S  +EDDRTP+RSGD G+EFRP
Sbjct  177   ----SRHFAKWIRIDKSIYRLFNTCFNTFRDFGWSFLMSNCMEDDRTPMRSGDAGIEFRP  232

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSK-ARCTALVLFN  897
             I  +T++FSL+ IKQIK KLK T+NDV+TGII YG +LYM+   +  +K +R TALV  N
Sbjct  233   ITLSTITFSLNDIKQIKAKLKATVNDVITGIIFYGIQLYMQAASQGKTKTSRVTALVTLN  292

Query  898   TRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKR  1077
             TRAI   Y+S+ EM KPN++  WGN F FL VS+P       +DPL FV KA RII+ KR
Sbjct  293   TRAIKS-YQSIQEMTKPNSKSQWGNHFAFLHVSIPRYKDVENADPLEFVLKAKRIIRSKR  351

Query  1078  NSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIY  1257
             NS ++YLTG LL+ L K +G E  ARYI+ T++ +++ ISNMIGPME++ +A HP + +Y
Sbjct  352   NSLAIYLTGGLLELLRKLKGPEAAARYIYATAQKTTLVISNMIGPMEQVQIAGHPVQSLY  411

Query  1258  FIIAGIPQS  1284
             F++  +PQS
Sbjct  412   FMMVHVPQS  420



>gb|KEH30682.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=467

 Score =   449 bits (1154),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 230/467 (49%), Positives = 319/467 (68%), Gaps = 12/467 (3%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             +E  SP  Q+ NSSV+   +   LE  IP    +SL I LLKDVF+PINPRFSSIMV + 
Sbjct  9     QEPVSPHGQYFNSSVICSYVFAFLELAIPF--DNSLAIPLLKDVFIPINPRFSSIMVKDK  66

Query  205   INGGKKWKRVEVNHSEHVKVPNYPA---GKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
               G  +W++VEV   EH+K+P +P        E YD+ LSDY++ +  +  P ++PLWEI
Sbjct  67    -EGEMRWQKVEVKPEEHLKIPIFPETINSSSCELYDNYLSDYVTSILAKKTPQDKPLWEI  125

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRS  555
             H+  YPTTNAA  +IFKLHH LGDGYSLMGA+LSCLQRAD+P+LPL+FPS++    +  +
Sbjct  126   HVINYPTTNAACTIIFKLHHGLGDGYSLMGALLSCLQRADDPSLPLSFPSKRPQLDSKYA  185

Query  556   KASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTT  735
             K S      FK +   +   F+++ DFG S+ K+T++EDD+TP+RSG +G E +P+  +T
Sbjct  186   KKS-----LFKKLCIDISSFFSSISDFGSSILKTTMIEDDKTPIRSGYEGNESQPVTMST  240

Query  736   MSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGG  915
             +S SLDQIK+IK KLKVTINDVV G++ YG RLYMK+  E++ +A  TA+V+ NTR IGG
Sbjct  241   ISLSLDQIKEIKTKLKVTINDVVCGMVFYGIRLYMKEMNEKTKRANSTAVVMLNTRNIGG  300

Query  916   GYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVY  1095
              Y+S+TEM KP  +  WGNQ +FL + +P ++ +  S+PL FV  +  +IKRKR S SVY
Sbjct  301   -YQSLTEMQKPECKGLWGNQISFLQIPIPKVSQSVISNPLEFVWNSRELIKRKRRSFSVY  359

Query  1096  LTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGI  1275
             L   L+   M+ RG E  A+ I+ T  NSS+ +SN++GP+E+M+LANHP  G+YF   G 
Sbjct  360   LVAMLMDLEMRLRGPEAVAKIIYNTIGNSSVLMSNLVGPVEKMTLANHPVYGLYFTATGG  419

Query  1276  PQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             P+ L +T++SY   LRIA+  +K FID  K K  +  A E I++AA+
Sbjct  420   PEDLTITIISYEKILRIAMKTQKGFIDEHKLKFYIEKASEIIFKAAM  466



>gb|KEH17312.1| O-acyltransferase (WSD1-like) family protein [Medicago truncatula]
Length=407

 Score =   446 bits (1147),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 216/411 (53%), Positives = 284/411 (69%), Gaps = 8/411 (2%)
 Frame = +1

Query  199   EGINGGKKWKRVEVNHSEHVKVPNYPAGKPIE-FYDDCLSDYLSKMAMEAFPPNRPLWEI  375
             +  +G KKWK+VEVN  EH+KVP +P+ K    FYD+ L DY+SK+AME  P +RPLWEI
Sbjct  2     DQFDGEKKWKKVEVNLEEHIKVPEFPSDKSSNSFYDEHLDDYMSKIAMEHLPQDRPLWEI  61

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRS  555
             H+ KYPT NAAG ++FKLHH+LGDGYSLMGA+LSCL+RADNP+LP T PS   S   P+S
Sbjct  62    HIIKYPTKNAAGTLVFKLHHALGDGYSLMGALLSCLERADNPSLPFTLPS---SKIRPKS  118

Query  556   KASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTT  735
               + K     K  P        ++ DFGWS+ KS+++EDD TP+RS  D V+ R I  + 
Sbjct  119   IFNTK--AIIKRFPSIFSSTIWSMLDFGWSILKSSMIEDDLTPIRSRADDVKLRQITISN  176

Query  736   MSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGG  915
             +SF+++ IK++K +L V+INDV+ G+I +G RLYM +  +ES KA  TALVL NTR I G
Sbjct  177   VSFTMEHIKEVKTRLGVSINDVIAGLIFFGIRLYMLEVNKESRKANSTALVLLNTRNIKG  236

Query  916   GYKSVTEMI-KPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASV  1092
              YKSV EM+ K N    WGNQF FL V +P L      +PL F+ +AH+ I RK+NS   
Sbjct  237   -YKSVKEMVSKNNNGAAWGNQFAFLHVPIPELNDPKFENPLEFIWEAHKEISRKKNSLVT  295

Query  1093  YLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAG  1272
              LTG LL  +   RG E  ARY+H T +NSS  ISN+IGP+E+M+LANHP KG+YF++ G
Sbjct  296   PLTGMLLNMVKTLRGPEAAARYVHSTLRNSSTTISNIIGPVEQMALANHPVKGLYFMVVG  355

Query  1273  IPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
              P+SL VT++SY+G LRIA   EKDFID +K KCC+  + E I +A+  +S
Sbjct  356   PPESLTVTIMSYMGKLRIAFGSEKDFIDKQKIKCCMEKSLEMIIKASRKTS  406



>gb|EYU24923.1| hypothetical protein MIMGU_mgv1a007879mg [Erythranthe guttata]
Length=392

 Score =   443 bits (1140),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/393 (56%), Positives = 283/393 (72%), Gaps = 22/393 (6%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             V+M E    E  SPSAQ+L SS LSLTIL VLE + P++  DS+ I L+K+VF+PINPRF
Sbjct  11    VDMEEQVPLEPMSPSAQYLKSSALSLTILAVLELQHPME--DSIAIKLVKEVFLPINPRF  68

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
             SSIMV+ G NG KKWKRVEVN  +H+ VP +PA +   ++D+   +Y S+MA E  PP+R
Sbjct  69    SSIMVAGG-NGEKKWKRVEVNVDDHIHVPVFPATE-TGYHDEFFGEYFSRMAAEELPPDR  126

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQ---  531
             PLWEIH+ K+ T  AA +V+FKLHHSLGDGYSLMGA+LSCLQR D+P++PLTFP+ +   
Sbjct  127   PLWEIHMVKHRTRTAAESVVFKLHHSLGDGYSLMGALLSCLQRLDDPSIPLTFPAGKFCV  186

Query  532   ------RSTAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRS  693
                               ++ GFFK M        NT  DFGWSV KS+L+EDD +P+RS
Sbjct  187   GGGGGGGGGGGGGCSVLRRVRGFFKGM-------VNTASDFGWSVLKSSLIEDDESPIRS  239

Query  694   GDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKAR  873
             G+DGVEFRPI T+T +FS+DQIK+IK KL VTINDVVTGII+ GTRLYM++  + SS+A+
Sbjct  240   GEDGVEFRPIVTSTTTFSIDQIKEIKTKLNVTINDVVTGIIMLGTRLYMQKASQISSEAK  299

Query  874   CTALVLFNTRAI--GGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVR  1047
              TALVL NTRA   G GYKSV+EM++P ++MPWGN+F FL V +P L+     DPL FV+
Sbjct  300   STALVLLNTRAAARGAGYKSVSEMVEPGSKMPWGNRFAFLHVPIPKLSDVELQDPLIFVK  359

Query  1048  KAHRIIKRKRNSASVYLTGWLLQALMKTRGSEV  1146
             K HR IK++RNSA +YLTG LL  + K +G EV
Sbjct  360   KVHRTIKKRRNSAGIYLTGQLLDLIRKIKGPEV  392



>ref|XP_004516680.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=473

 Score =   444 bits (1141),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 232/458 (51%), Positives = 310/458 (68%), Gaps = 13/458 (3%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP+ Q+LNSS L + ILG++  E+PI   D   +SLL++ F+P N RFSSIM+ E  NG
Sbjct  12    VSPTGQYLNSSSLCVYILGMINFEVPID--DIPALSLLQEKFIPTNTRFSSIMI-EDKNG  68

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              KKWK+VEV   EHVK P +P+ K    YD+   +Y+SK+AME  P +RPLWE+HL KYP
Sbjct  69    EKKWKKVEVKLEEHVKTPIFPSSKS-SLYDEHFDEYMSKLAMERLPEDRPLWEVHLIKYP  127

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T NAAG+ I KLHH+LGDGYSLMGA+LSC  R DNP+LP T PS Q     P+S  +NK 
Sbjct  128   TKNAAGSAILKLHHALGDGYSLMGALLSCFVRVDNPSLPFTLPSTQ----TPKSIFNNK-  182

Query  574   SGFFKAMPRFLF-GAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSL  750
                FK     +F   FNT+ DFGWSV KS+LV+DD TP++S  +  +   I  +++S ++
Sbjct  183   -DVFKNYIFSIFSNVFNTISDFGWSVLKSSLVKDDFTPIKSNANDTKLLQITVSSISVTM  241

Query  751   DQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSV  930
             D IK+IK +L V+INDV+ GII  G RLYM++  ++SSK + TALVL NTR+I  GYKS+
Sbjct  242   DHIKEIKSRLGVSINDVLVGIIFLGIRLYMQEMNKDSSKYKSTALVLMNTRSI-KGYKSI  300

Query  931   TEMI-KPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
              EM+ K N   PWGNQF FL   +P L      +PL F+ +AH  I RK+NS    LTG 
Sbjct  301   KEMVDKNNKNGPWGNQFAFLHTPIPELNDTKIENPLEFILEAHEEINRKKNSLGAPLTGL  360

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL  + K RG E +ARYI+ T  NSS+ ISN++GPME+M++AN+    IY I+ G+P S+
Sbjct  361   LLNVMKKLRGPEASARYIYNTIGNSSLTISNLVGPMEQMTVANYRVNSIYHIVTGVPNSI  420

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGI  1401
              V+++SY+G LRI  ++EKDF D EKF  C+  + + I
Sbjct  421   SVSILSYMGMLRITFALEKDFFDKEKFMSCIEKSLQLI  458



>gb|KEH30678.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=467

 Score =   444 bits (1141),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 227/464 (49%), Positives = 319/464 (69%), Gaps = 15/464 (3%)
 Frame = +1

Query  10    MEHGYEEA---ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             M+  YEE     SP  Q+ NSSV+   + G LE  IP    +SLVI LLKDVF+PINPRF
Sbjct  1     MDKFYEEVQEPVSPHGQYFNSSVICSYVFGFLEFAIPF--DNSLVIPLLKDVFIPINPRF  58

Query  181   SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPA---GKPIEFYDDCLSDYLSKMAMEAFP  351
             SSIMV +   G  +W++VEV   EH+K+P +P        E YD+  +DY++ +  E  P
Sbjct  59    SSIMVKDK-EGKMRWRKVEVKPEEHLKIPIFPETINSSSCELYDNYFNDYVTSILAERTP  117

Query  352   PNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQ  531
              ++PLWEIH+  YPTTN A  +IFKLHH+LGDGYSLMGA+LSCLQRAD+P+LPL+FPS++
Sbjct  118   QDKPLWEIHIINYPTTNEACTIIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSQR  177

Query  532   RSTAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVE  711
                 +  +K +      FK +   +   F+++ DFG S+ K+ ++EDD+TP+RSG +G E
Sbjct  178   PQLDSKYAKIN-----LFKKLCFDISSFFSSISDFGSSIIKTRMIEDDKTPIRSGYEGNE  232

Query  712   FRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVL  891
              +P+  +T+S SLDQIK+IK KLKVTINDVV G++ YG RLYMK+  E++  A  TA+V+
Sbjct  233   SQPVTLSTISLSLDQIKEIKSKLKVTINDVVCGMVFYGIRLYMKEMNEKTKIANSTAVVM  292

Query  892   FNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKR  1071
              NTR IGG Y+S+ EM KP ++  WGNQ +FL + +P ++ +  S+PL FV  +  +IKR
Sbjct  293   LNTRNIGG-YRSLMEMQKPESKGLWGNQISFLQIPIPKVSQSVISNPLEFVWNSRELIKR  351

Query  1072  KRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKG  1251
             KR+S SVYL   L+   M+ RG E  A+ I+ T +NSS+ +SN++GP+E+M+LANHP  G
Sbjct  352   KRHSFSVYLIALLMDLEMRLRGPEAVAKIIYNTIRNSSVFMSNLVGPIEKMALANHPVNG  411

Query  1252  IYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVH  1383
             +YF +AG P++L +T++SY   LRIA+  +K FID  K K C+ 
Sbjct  412   LYFTVAGGPENLTITIISYEKILRIAMKTQKGFIDEYKLKFCIE  455



>gb|KEH30680.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=475

 Score =   443 bits (1140),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 226/456 (50%), Positives = 312/456 (68%), Gaps = 12/456 (3%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             +E  SP  Q+ NSSV+   +   LE  IP    +SL I LLKDVF+PINPRFSSIMV + 
Sbjct  17    QEPVSPHGQYFNSSVICSYVFAFLELAIPF--DNSLAIPLLKDVFIPINPRFSSIMVKDK  74

Query  205   INGGKKWKRVEVNHSEHVKVPNYPA---GKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
               G  +W++VEV   EH+K+P +P        E YD+ LSDY++ +  +  P ++PLWEI
Sbjct  75    -EGEMRWQKVEVKPEEHLKIPIFPETINSSSCELYDNYLSDYVTSILAKKTPQDKPLWEI  133

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRS  555
             H+  YPTTNAA  +IFKLHH LGDGYSLMGA+LSCLQRAD+P+LPL+FPS++    +  +
Sbjct  134   HVINYPTTNAACTIIFKLHHGLGDGYSLMGALLSCLQRADDPSLPLSFPSKRPQLDSKYA  193

Query  556   KASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTT  735
             K S      FK +   +   F+++ DFG S+ K+T++EDD+TP+RSG +G E  P+  +T
Sbjct  194   KKS-----LFKKLCIDISSFFSSISDFGSSILKTTMIEDDKTPIRSGYEGNESHPVTLST  248

Query  736   MSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGG  915
             +S SLDQIK+IK KLKVTINDVV G++ YG RLYMK+  E++ +A  TA+V+ NTR IGG
Sbjct  249   ISLSLDQIKEIKTKLKVTINDVVCGMVFYGIRLYMKEMNEKTKRANSTAVVMLNTRNIGG  308

Query  916   GYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVY  1095
              Y+S+TEM KP  +  WGNQ +FL + +P ++ +  S+PL FV  +  +IKRKR S SVY
Sbjct  309   -YQSLTEMQKPECKGLWGNQISFLQIPIPKVSQSVISNPLEFVWNSRELIKRKRRSFSVY  367

Query  1096  LTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGI  1275
             L   L+   M+ RG E  A+ I+ T  NSS+ +SN++GP+E+M+LANHP  G+YF   G 
Sbjct  368   LVAMLMDLEMRLRGPEAVAKIIYNTIGNSSVLMSNLVGPVEKMTLANHPVYGLYFTATGG  427

Query  1276  PQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVH  1383
             P++L +T++SY   LRIA+  +K FID  K K C+ 
Sbjct  428   PENLTITIISYEKILRIAMKTQKGFIDEYKLKFCIE  463



>ref|XP_008241432.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=425

 Score =   440 bits (1131),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 218/418 (52%), Positives = 287/418 (69%), Gaps = 20/418 (5%)
 Frame = +1

Query  163   PINPR---FSSIMVSEGI--NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLS  327
             P++P    FSS ++S  +  NG K+WKRVEV   +H+  P +P+G  +E YD    DY+S
Sbjct  11    PVSPNGQYFSSNVISLSVENNGKKEWKRVEVKLEDHLYTPTFPSGLSLESYDKYFDDYIS  70

Query  328   KMAMEAFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPAL  507
             K+  E FP  +PLWEIH+  YPT+NAA NVIFK HH+LGDGYSLMGA++S +QRADNP+L
Sbjct  71    KLLTERFPQGKPLWEIHIISYPTSNAAANVIFKFHHALGDGYSLMGALISSMQRADNPSL  130

Query  508   PLTFPSRQRSTAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPV  687
             PLTFPSR+RS +   +  +   SGF            NT+ D  WS    T+ ED  TP+
Sbjct  131   PLTFPSRKRSESKRENFVTKTFSGF-----------CNTISDL-WSGTLKTMNEDVPTPI  178

Query  688   RSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSK  867
             RSG+D +EFRP   +TM+FSLDQIK IKDKL VT+NDV+TG+I +GTRLYM++  + SSK
Sbjct  179   RSGNDAIEFRPATVSTMTFSLDQIKSIKDKLGVTVNDVLTGMIFFGTRLYMQEMNQSSSK  238

Query  868   ARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVR  1047
             A CTA+VL NTR I G Y  + EMIKPN++ PWGN+FTF+ + +P LT    S+ L F+ 
Sbjct  239   ADCTAMVLLNTR-IMGDYVPIEEMIKPNSKAPWGNRFTFMHIPIPKLT--ELSNALDFIW  295

Query  1048  KAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMS  1227
              A +IIKRKRNS + Y    LL+ + K    E   +YIH T KNSSM ISN+IGP+E+MS
Sbjct  296   NARKIIKRKRNSFAAYFNSRLLEIVHKFGSHEACGKYIHRTLKNSSMLISNLIGPVEQMS  355

Query  1228  LANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGI  1401
             LANHP KG+YF++ G P    +T+VSY+G +R+A  +EKD ID +K K C+  A + I
Sbjct  356   LANHPIKGLYFLVGGGPLGFEITIVSYMGKVRVAFKMEKDVIDPQKLKSCMESALQMI  413



>gb|KEH21614.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=421

 Score =   439 bits (1130),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 213/424 (50%), Positives = 292/424 (69%), Gaps = 11/424 (3%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             E   +E  SP  Q+ NSS L L I+ VLE E+ I   D    +LL+DVF+PI+PRFSSIM
Sbjct  6     EEQLQEPVSPIGQYFNSSSLCLYIIAVLEFEVSID--DLQAFTLLRDVFLPISPRFSSIM  63

Query  193   VSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWE  372
             V +  N  K+WK+V+VN  +HVK P +  GK +EFYD    DYLS +A+E  P  +PLWE
Sbjct  64    VQDK-NEDKRWKQVDVNLKDHVKKPIFSKGKKVEFYDKSFQDYLSTIAIEPLPQGKPLWE  122

Query  373   IHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPR  552
             +H+  YPT N+ G +IFKLHH+LGDGYSLMGA+LSCLQRAD+P+LPL+FPS + S   P 
Sbjct  123   VHIVNYPTKNSLGTIIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSLKPSKLEPY  182

Query  553   SKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATT  732
             +K+      F++     +   FNT  DFGWSV KS+++ DD+TP+RSGD+G +F+PI+ +
Sbjct  183   NKS------FWRKFSWTMSSVFNTASDFGWSVLKSSIIVDDKTPIRSGDEGADFQPISIS  236

Query  733   TMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIG  912
              ++FS+D IK IK KL VT+NDVVTGI+ YGTRLYM++ + +S  +  TALVL NTR + 
Sbjct  237   NIAFSIDHIKDIKSKLGVTMNDVVTGIVFYGTRLYMQEMDSKSKTSNSTALVLLNTRNV-  295

Query  913   GGYKSVTEMIK-PNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSAS  1089
              GY+S+ +M+    ++ PWGN+ +FL V +P L     S+PL F+   H II RK+ S +
Sbjct  296   EGYQSIDDMLNTKKSKGPWGNKLSFLHVPIPKLNENRISNPLEFIYDTHNIINRKKQSLA  355

Query  1090  VYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIA  1269
             V LTG LL    K RG E  A++I  T   SS  ++N++GP+++MSLANHP KG+YF +A
Sbjct  356   VALTGTLLDIEGKLRGQEAVAQHIRRTITMSSTVVTNLVGPVQQMSLANHPVKGLYFTLA  415

Query  1270  GIPQ  1281
             G P+
Sbjct  416   GGPE  419



>gb|KCW57195.1| hypothetical protein EUGRSUZ_H00010 [Eucalyptus grandis]
Length=428

 Score =   439 bits (1128),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 223/425 (52%), Positives = 302/425 (71%), Gaps = 17/425 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+ ++ NS V+S++ILG+LESEIPI   DS   +L+KDVF+PINPRFSSIMV  G 
Sbjct  11    EPVSPTGEYFNSKVMSVSILGILESEIPID--DSQATALIKDVFLPINPRFSSIMVM-GK  67

Query  208   NGGKKWKRVEVNHSEHVKVPNY--PAGK--PIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
              G +KWK+VEVN   HV VP++  P G   P E  D  L  Y+S++AM+ FP  +PLWEI
Sbjct  68    KGARKWKKVEVNVENHVHVPSFSFPKGSSSPSE-NDSFLKTYISQIAMQPFPQGQPLWEI  126

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRS  555
             H+ K PT+ A G +IFKLHH+LGDGYSL+GA+LSCLQRADNP+LP+TFPS    ++A + 
Sbjct  127   HIIKCPTSEAQGTLIFKLHHALGDGYSLVGALLSCLQRADNPSLPITFPSVSNFSSANK-  185

Query  556   KASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTT  735
                ++  G  K + R      NTV DFGWSVFKST +EDD +P+R G +   F+P   +T
Sbjct  186   --DDRNIGLRKVVSRCFSPLVNTVKDFGWSVFKSTCIEDDLSPIRCGSES--FQPFLVST  241

Query  736   MSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESS-KARCTALVLFNTRAIG  912
             ++FSLD+IK+IK +L+VT+NDV+ G I   TR+YM++    S+     TALVL NTR + 
Sbjct  242   VTFSLDRIKEIKSRLRVTVNDVIMGTIFLATRMYMQRASTNSNLSTNSTALVLLNTRNL-  300

Query  913   GGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANA--SDPLRFVRKAHRIIKRKRNSA  1086
               YKSV +M++PN+E PWGN F FL V +P + P+++  SDPL+FV +AH +IKRKR+S 
Sbjct  301   RDYKSVRDMVRPNSESPWGNNFAFLHVPIPKVKPSDSQFSDPLKFVHEAHEVIKRKRSSF  360

Query  1087  SVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFII  1266
              V LTG LL  + K R +E  A++I  T +NSSM ISN++GP+E++SLANHP KG+Y+ +
Sbjct  361   GVILTGKLLGIMKKCRNAEAVAKHISRTLRNSSMVISNVMGPVEKLSLANHPVKGMYYTV  420

Query  1267  AGIPQ  1281
             AG P+
Sbjct  421   AGTPE  425



>ref|XP_007132726.1| hypothetical protein PHAVU_011G119700g [Phaseolus vulgaris]
 gb|ESW04720.1| hypothetical protein PHAVU_011G119700g [Phaseolus vulgaris]
Length=469

 Score =   439 bits (1129),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 227/464 (49%), Positives = 314/464 (68%), Gaps = 10/464 (2%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP  Q+ NSSV+   + G LE  IPI   DS  +SL+KDVF+PINPRFSSIM+ + 
Sbjct  9     EEPVSPPGQYFNSSVICSYVFGFLEIAIPI--DDSKTVSLIKDVFLPINPRFSSIMIRDQ  66

Query  205   INGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
              +G ++W+RVEV   EHVK+P +P G   E YD    DY++ +  E  P N+PLWEIH+ 
Sbjct  67    -DGKRRWRRVEVKPEEHVKIPKFPEGNSPELYDHYFDDYVTTILTERTPQNKPLWEIHII  125

Query  385   KYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
             KYPT+NAAG +IFKLHH+LGDGYSLMGA+LSCLQR D+P+LPLTFPSR  S++    K  
Sbjct  126   KYPTSNAAGTIIFKLHHALGDGYSLMGALLSCLQRIDDPSLPLTFPSRTSSSSQGSKK--  183

Query  565   NKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSF  744
                   F+ +P  +   F+++ DFG S+ K+T+  D++TPVRSG +G E  P A + +S 
Sbjct  184   ----NMFQKLPSVISSFFSSMSDFGSSLVKTTMDVDEKTPVRSGYEGTESMPFALSNISL  239

Query  745   SLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYK  924
             SLD +K IK KL VTINDV+TG+  YG RLYM + +  + KA+ TA+V+ NTR +  GYK
Sbjct  240   SLDHVKAIKTKLGVTINDVITGMFFYGIRLYMLEIDNMARKAKSTAVVMLNTRNV-KGYK  298

Query  925   SVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             S+ EM     +  WGN+ +FL + +P L+ + + +PL FV  A ++I +K+ S SVYL G
Sbjct  299   SLKEMQNSKVKGLWGNKISFLQIPIPKLSQSRSHNPLEFVWNARKLINKKKRSFSVYLIG  358

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
              LL   MK +G E  A+ I+ T  N S+ ISN+ GPME+M+LAN+P  G+YF + G P++
Sbjct  359   LLLDLEMKLKGPEAVAKIIYKTLGNCSVVISNIFGPMEQMALANNPITGLYFTMTGGPEN  418

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             + +T++SYV  LRI L   K FID +K K C+  AF+ I++AA+
Sbjct  419   IDITIMSYVKVLRITLRTLKGFIDEQKLKFCMEKAFDVIFKAAM  462



>ref|XP_008381074.1| PREDICTED: O-acyltransferase WSD1-like [Malus domestica]
Length=457

 Score =   438 bits (1127),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 239/452 (53%), Positives = 312/452 (69%), Gaps = 40/452 (9%)
 Frame = +1

Query  10    MEHGYE------EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPIN  171
             MEH  E      E  SP+AQ+  SSVLS++ +GV+E E P+  S+S  ISLLK +F+PI+
Sbjct  1     MEHLEEDEVVVLEPVSPTAQYFTSSVLSVSNIGVMELENPL--SESQAISLLKTLFLPIS  58

Query  172   PRFSSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFP  351
             PRFSSI+V   ING K+WKRVEV   EH+ VP  P+    E Y+  L  Y+SK+A+E   
Sbjct  59    PRFSSIVVV--INGKKRWKRVEVKPEEHISVPIIPSNLSTESYEKYLDGYISKLAVERLS  116

Query  352   PNRPLWEIHLFKYPT--TNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPS  525
              ++PLWE+H+  YPT   NAA N+IFKLHH+LGDG+SLM AILSCL+RADNP+LPLTFPS
Sbjct  117   EDKPLWELHILNYPTRNNNAACNLIFKLHHALGDGFSLMSAILSCLRRADNPSLPLTFPS  176

Query  526   RQRST-AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDD  702
             RQRS   +  S  S  IS             FNT+ D    +++ST+ EDD +P+RSG+ 
Sbjct  177   RQRSQQTSDESFVSRTISS-----------VFNTLSD----IWRSTVGEDDLSPIRSGN-  220

Query  703   GVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTA  882
             G+EF+PI   TM+FSLDQIK IK KL VT+NDV+ G+I  GTRLYM++    SSKAR TA
Sbjct  221   GIEFQPITLATMTFSLDQIKSIKSKLGVTVNDVLAGMIFLGTRLYMQEINRSSSKARGTA  280

Query  883   LVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALT---------PANA-SDP  1032
             +VL NTR +G  Y S+ EM+KP+++MPWGN FTFL V +P L+         PA+  S+ 
Sbjct  281   VVLLNTRMMGK-YTSIQEMMKPDSKMPWGNHFTFLHVPIPNLSLPDDHDHDFPADQYSNA  339

Query  1033  LRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGP  1212
             L FV +A +II RKR+S ++YLT   L+ L K  G E  ARYIH T KN+SM ISN+IGP
Sbjct  340   LDFVWEAQKIITRKRSSLAIYLTCRFLEFLNKFGGHEAAARYIHSTLKNTSMMISNLIGP  399

Query  1213  MERMSLANHPAKGIYFIIAGIPQSLCVTMVSY  1308
             +E+M+LAN+P  G+YF++ G P+ L VT+VSY
Sbjct  400   VEQMALANNPVNGMYFLVFGSPEGLDVTIVSY  431



>ref|XP_004492761.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=476

 Score =   436 bits (1121),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 226/464 (49%), Positives = 310/464 (67%), Gaps = 13/464 (3%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP  Q LN++ L   IL  LE E+PI   D  ++SL++D F+ I P F+SIMV++   G
Sbjct  13    VSPMGQCLNNTSLCSYILAFLEFEVPIH--DLPIVSLVEDAFLSI-PHFTSIMVNDE-RG  68

Query  214   GKKWKRVEVNHSEHVKVPNY-PAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKY  390
              K+WK+VEV   EH+  P     G  ++ YD   +DY+S+MA+E  PP +PLW++H+FKY
Sbjct  69    VKRWKQVEVKLEEHIIEPKLIDDGISVDLYDKHFADYISRMALEKLPPTKPLWQVHVFKY  128

Query  391   PTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNK  570
             PT+NAAG ++FKLHH++GDGYSLM  ILS LQRAD+P+LPL+FPS ++S+        NK
Sbjct  129   PTSNAAGTLVFKLHHAIGDGYSLMSVILSSLQRADDPSLPLSFPSSRKSSKP------NK  182

Query  571   ISGFF-KAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
              S  F   MP+FL   FN+V +FG S+ KSTL+EDD+TP+RSG + VEFRP   + ++FS
Sbjct  183   FSRLFLNKMPQFLSIPFNSVSEFGSSLLKSTLLEDDKTPIRSGVEAVEFRPTKLSNVTFS  242

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             +D IKQIK  L VTINDV+TGII YG RLYM+  +  S     TALV+ +TR I   Y+ 
Sbjct  243   IDHIKQIKSNLGVTINDVITGIIFYGIRLYMQDVDYRSRTLNSTALVIASTRHIKD-YQR  301

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             V +M+   A+  WGN+ T+  VS+P L     S+PL+FV KAH  IKRK NS +  L   
Sbjct  302   VQDMMLKTAKSAWGNRITYYHVSIPKLEDIPISNPLQFVMKAHTSIKRKNNSFAPLLVTK  361

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LLQ  +K  G EV A+Y+H T + SS+ ISN++GP+E+M+ ANHP  G  F +AG PQSL
Sbjct  362   LLQMKVKFEGPEVVAKYVHNTLRKSSLIISNVVGPIEQMAWANHPIGGFSFTLAGFPQSL  421

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALG  1419
              +T++SY+G LR+  S E+ FID +K    ++ AFE I   ++ 
Sbjct  422   VITIMSYMGVLRVTSSTEEGFIDEQKLMQYMNKAFEIIRHESIA  465



>gb|KCW57197.1| hypothetical protein EUGRSUZ_H00012 [Eucalyptus grandis]
Length=439

 Score =   428 bits (1101),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 221/454 (49%), Positives = 309/454 (68%), Gaps = 25/454 (6%)
 Frame = +1

Query  70    LSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGGKKWKRVEVNHS  249
             +S++ILG+LE EIPI   DS   +L++D+F+PINPRFSSIMV  G  G +KWK+V VN  
Sbjct  1     MSVSILGILELEIPID--DSQATALIRDIFLPINPRFSSIMVM-GEKGARKWKKVGVNME  57

Query  250   EHVKVPNYPAGKPIEFY---DDCLSDYLSKMAMEAFPPNRPLWEIHLFKYPTTNAAGNVI  420
              HV VP++ + K        D  L  Y+S++AM+ FP  +PLWEIH+   PT+ A G +I
Sbjct  58    NHVHVPSFSSSKGSSSPSENDSFLKSYISQIAMQPFPQGQPLWEIHIINCPTSEAQGTLI  117

Query  421   FKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKISGFFKAMPR  600
             FKLHH+LGDGYSL+GA+LSCLQRAD+P+LP+TFPS ++ ++A +    ++  G  K + R
Sbjct  118   FKLHHALGDGYSLVGALLSCLQRADDPSLPVTFPSVKKFSSANKV---DRTIGLRKVVSR  174

Query  601   FLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLDQIKQIKDKL  780
                   NTV DFGWS+ KST V+DD +P+R G +   FRP + +T++FSLD IK+IK +L
Sbjct  175   CFSPLVNTVRDFGWSLLKSTCVKDDLSPIRYGSES--FRPFSVSTVTFSLDHIKEIKSRL  232

Query  781   KVTINDVVTGIIIYGTRLYMKQCEEESS-KARCTALVLFNTRAIGGGYKSVTEMIKPNAE  957
             +VT+NDV+ G+I   TRLYM++    S+     TALVL NTR +   YK+          
Sbjct  233   RVTVNDVILGVIFLATRLYMQRVSTNSNLSTNSTALVLLNTRNLRD-YKT----------  281

Query  958   MPWGNQFTFLPVSLPALTPANA--SDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKT  1131
              PWGN F FL V +P + P+++  SDPL+FV K H +IKRKR+S  V LTG LL+ + K 
Sbjct  282   SPWGNHFAFLHVPIPKVKPSDSQFSDPLKFVHKTHEVIKRKRSSFGVILTGKLLEIMQKC  341

Query  1132  RGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYV  1311
             R +E  A++I GT +NSSM ISN+IGP +++SLANHP KG+Y+ +AG P+SL +T+ SY 
Sbjct  342   RNAEAVAKHISGTLRNSSMAISNLIGPTDKLSLANHPLKGMYYTVAGTPESLRITIFSYA  401

Query  1312  GSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             G+LR+A+  E+ FID+E +   +  AF+ I   A
Sbjct  402   GNLRVAVGAEQGFIDSELYNHSLLDAFDMILRDA  435



>gb|AES89684.2| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=475

 Score =   429 bits (1104),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 221/467 (47%), Positives = 315/467 (67%), Gaps = 12/467 (3%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             +E  SP  Q+ NSSV+   + G LE  IP    +SL I LLKDVF+PINPRFSSIMV + 
Sbjct  9     QEPVSPHGQYFNSSVMCSYVFGFLELAIPFD--NSLAIPLLKDVFIPINPRFSSIMVKD-  65

Query  205   INGGKKWKRVEVNHSEHVKVPNYPA---GKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
             + G  +W++VEV   EH+K+P +P        E YD  +S+Y++ +     P N+PLWEI
Sbjct  66    VEGKMRWQKVEVKPEEHLKIPIFPETINSSSCELYDKYVSNYVTSILNGRTPQNKPLWEI  125

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRS  555
             H+  YPTTNAA  +IFKL+H+LGDGYSLM A+LSCLQRAD+P+LPL+FPS++    +  +
Sbjct  126   HIINYPTTNAACTIIFKLNHALGDGYSLMSALLSCLQRADDPSLPLSFPSQRPQLNSKYA  185

Query  556   KASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTT  735
             K +      F+ +   +   F+++ DFG S+ K+ +++DD+TP+RSG +G E +P   + 
Sbjct  186   KIN-----LFEKLCFVISSFFSSISDFGSSILKTRMIKDDKTPIRSGYEGAESQPFILSN  240

Query  736   MSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGG  915
             ++ SLDQIK +K KL VTINDVVTG+I YG RLYM++  E++  +  TA+V+ NTR IGG
Sbjct  241   ITLSLDQIKGVKTKLGVTINDVVTGMIFYGIRLYMEEKNEKTKTSNSTAVVMLNTRNIGG  300

Query  916   GYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVY  1095
              Y+SV EM KP ++  WGN+ +FL + +P +  +  S+PL FV     +IKRKR S SVY
Sbjct  301   -YQSVKEMQKPESKGLWGNKISFLQIPIPKMCQSKISNPLEFVWNTRELIKRKRRSFSVY  359

Query  1096  LTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGI  1275
             L   LL   MK RGSEV A+ I+ T+ NSS+ +SN++GP+E+M+LANHP  G+ F +   
Sbjct  360   LIALLLDLEMKLRGSEVVAKIIYNTTGNSSVLMSNIVGPVEKMTLANHPVNGLCFTMTNG  419

Query  1276  PQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             P+++ +T++SY+  LRI L   K FID +K K C+  A + I EAA+
Sbjct  420   PENVNITIISYMNVLRITLKTLKGFIDEQKLKFCIEKAVKVISEAAM  466



>ref|XP_004137034.1| PREDICTED: O-acyltransferase WSD1-like [Cucumis sativus]
 ref|XP_004170041.1| PREDICTED: O-acyltransferase WSD1-like [Cucumis sativus]
Length=473

 Score =   428 bits (1101),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 217/471 (46%), Positives = 304/471 (65%), Gaps = 12/471 (3%)
 Frame = +1

Query  22    YEEAA---SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             YE++    SP +Q+ N+  + +++LGV+E E PI + +  + S++ DV VP NPRF+SIM
Sbjct  4     YEDSTAPMSPLSQYFNTCEMCVSVLGVIELETPISSWED-ISSIVTDVLVPANPRFTSIM  62

Query  193   VSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWE  372
             V E     +KWK  +VN  +H+ +PN+P       YD    +Y +K A + F    PLWE
Sbjct  63    VKEKTEE-RKWKTTKVNPKDHIYIPNFPMELSSYEYDAYFDEYATKTATKPFSQAIPLWE  121

Query  373   IHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPR  552
             IH+F YPTT+A  ++IFK+HHS+ DG+ LM  +LSCL+RAD+P+LPLTFPSRQRS     
Sbjct  122   IHVFNYPTTHATCSIIFKVHHSIADGFCLMNTLLSCLKRADDPSLPLTFPSRQRSKQPGN  181

Query  553   SKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEF-RPIAT  729
                  ++S F     RF     N V +FGWS+ K+T VEDD TP++   D ++  +PIA 
Sbjct  182   EPKFFRLSHF---PARFFSSISNFVLNFGWSIMKNTFVEDDPTPIKPQKDSMQLVKPIAI  238

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAI  909
             +TM+FSLDQIKQIK+KL  ++NDV+TGII  G RLYM++   ESS A  +AL+L NTR  
Sbjct  239   STMTFSLDQIKQIKNKLNASVNDVLTGIIFLGIRLYMQEHNPESSGANSSALILLNTRK-  297

Query  910   GGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPAL--TPANASDPLRFVRKAHRIIKRKRNS  1083
                YKSV EM+K +++ PWGN+  FLP+ +P L  +P  +S PL FV K    I  +R+ 
Sbjct  298   AKAYKSVKEMVKKDSDAPWGNKIAFLPIPIPKLIDSPVVSSTPLEFVEKVKEKIMLQRSP  357

Query  1084  ASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFI  1263
              SV+L   + + L    G E+ A+      KNSS+ ISNMIGP+E+M+L N P KG+YF 
Sbjct  358   LSVFLAAKVFEILKNVTGPEIGAKLFKRKLKNSSIMISNMIGPVEKMALVNLPVKGLYFT  417

Query  1264  IAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             + G+PQSL +T+VSY+G LRI    EK FI+ +K K C+  AF+ I   A+
Sbjct  418   VPGMPQSLMITIVSYMGDLRIVFGGEKCFINQQKLKVCIEDAFQRILAKAV  468



>ref|XP_007149837.1| hypothetical protein PHAVU_005G102500g [Phaseolus vulgaris]
 gb|ESW21831.1| hypothetical protein PHAVU_005G102500g [Phaseolus vulgaris]
Length=461

 Score =   422 bits (1085),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/460 (45%), Positives = 303/460 (66%), Gaps = 13/460 (3%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGG  216
             SP A + +SS++++ +L V+ESEIPI   +S    LLK+  +PI  RFSSIMV++  NG 
Sbjct  13    SPMADYFSSSLINVFVLCVVESEIPID--ESKFQPLLKNKLLPICSRFSSIMVTDK-NGK  69

Query  217   KKWKRVEVNHSEHVKVPNYPAGK-PIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
             K WK+V+VN  +H+K+P + +    ++ YD+CL +Y+SK+AME    ++PLWE+H+F YP
Sbjct  70    KVWKQVDVNPEDHIKIPKFASTNGTLKLYDECLDEYMSKIAMEQLREDKPLWEVHIFNYP  129

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             TT AAG ++ KLHH+LGDGYS M   LS  Q ADNP+LP+  PS        +S  S   
Sbjct  130   TTKAAGTIVVKLHHALGDGYSFMATFLSITQSADNPSLPIKLPSS-------KSVESTST  182

Query  574   SGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLD  753
              G  K + +     F + +DFGWS  KS+++ D++TP+RSG + V FRP++ T +S SLD
Sbjct  183   KGIGKRLSQTASVVFKSAFDFGWSFMKSSVMPDEQTPLRSGHEDVGFRPMSITNVSLSLD  242

Query  754   QIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVT  933
              IK++K+KLKV++NDV+ G I +G +LYMK   ++S  +  TALVL NTR I   YKS  
Sbjct  243   TIKEVKNKLKVSVNDVLVGAIFFGIQLYMKAKNQKSGTSESTALVLLNTRKIRA-YKSAK  301

Query  934   EMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLL  1113
             EM   ++E PWGN+F F+ V +P LT  N  +PL FV +A + I R+R S +V +TG LL
Sbjct  302   EM-HNDSEAPWGNRFHFMHVPIPMLTDKNELNPLEFVFEAKKKISRQRTSLAVPMTGVLL  360

Query  1114  QALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCV  1293
               L + +G +    Y++ T  N+S+ IS+M+GP E+++LANHP KG YF+  G+ QS+ V
Sbjct  361   HLLNQIKGPQAATNYLYKTMNNASLSISHMVGPAEKVTLANHPIKGFYFMTVGLSQSITV  420

Query  1294  TMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             T+ SY+G LR+   VE+ FID  + K C   + + I EAA
Sbjct  421   TITSYMGHLRVGFGVEEGFIDEYQLKSCFETSLQQILEAA  460



>gb|KCW46801.1| hypothetical protein EUGRSUZ_K00605 [Eucalyptus grandis]
Length=446

 Score =   421 bits (1081),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 218/428 (51%), Positives = 301/428 (70%), Gaps = 18/428 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS Q+LNS V+S++ILG+LE EIPI   DS  +SL +D F+PINPRFSSIMV+ G 
Sbjct  11    EPVSPSGQYLNSKVMSVSILGILELEIPID--DSQAMSLFRDDFLPINPRFSSIMVT-GD  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFY---DDCLSDYLSKMAMEAFPPNRPLWEIH  378
              G +KWK+V VN   HV VP++ + K        D  L  Y+S++AM+ FP  +PLWEIH
Sbjct  68    KGARKWKKVGVNMENHVHVPSFSSPKGSSSPSENDSFLKSYISQIAMQPFPQGQPLWEIH  127

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
             + K PT+ A   +IFKLHH+LGDGYSL+ A+LSCLQRAD+P+LP+TFPS ++ ++A +  
Sbjct  128   IIKCPTSEAQETLIFKLHHALGDGYSLVAALLSCLQRADDPSLPVTFPSVKKFSSANK--  185

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
               ++  G  K + R      NTV DFGWS+ KST V+DD +P+RSG + ++  P + +T+
Sbjct  186   -DDRNIGLRKVVSRCFSPLVNTVRDFGWSLLKSTCVKDDLSPIRSGSESLQ--PFSVSTI  242

Query  739   SFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESS-KARCTALVLFNTRAIGG  915
             +FSLDQIK+IK +L+VT+NDV+ G+I   TRLYM++    S+     TALVL NTR +  
Sbjct  243   TFSLDQIKEIKSRLRVTVNDVILGVIFLATRLYMQRVSTNSNLSTNSTALVLLNTRNL-R  301

Query  916   GYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANA--SDPLRFVRKAHRIIKRKRNSAS  1089
              YK V +M++PN+E PWGN F FL V +P + P+++  SDPL+FV K H +IKRKR+S  
Sbjct  302   DYKPVKDMVRPNSESPWGNHFAFLHVPIPKVKPSDSQFSDPLKFVHKTHEVIKRKRSSFG  361

Query  1090  VYLTGWLLQALMKTRGSE---VTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             V LTG LL+ + K R +E     A++I  T++NSSM ISN+IGP++ +SLANHP KG+Y+
Sbjct  362   VILTGKLLEIMQKCRNAEYLQAVAKHISRTARNSSMCISNLIGPVDNLSLANHPLKGMYY  421

Query  1261  IIAGIPQS  1284
              IAG P+S
Sbjct  422   TIAGTPES  429



>ref|XP_008455537.1| PREDICTED: O-acyltransferase WSD1-like [Cucumis melo]
Length=627

 Score =   424 bits (1090),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 204/420 (49%), Positives = 293/420 (70%), Gaps = 11/420 (3%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+AQ  N+S LS++++ V+E EIPI   ++ ++   KD F+P+NP FSSIMV++ I
Sbjct  9     EPVSPTAQCFNTSALSISVIAVVEFEIPID--EAKIMCYAKD-FIPLNPLFSSIMVND-I  64

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG +KWK+VEV   E + V   P+   IE  +   ++Y++K++++ F  N+PLWEIH+  
Sbjct  65    NGERKWKKVEVKVEEQIVVATPPSNLSIELNNVYFNEYITKLSVKEFAQNKPLWEIHILN  124

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
              PT++AA N++ K HHSLGDGYS+MG +LS ++RADNP+LPLTFP   +         SN
Sbjct  125   CPTSDAAANLVLKFHHSLGDGYSVMGLLLSSMKRADNPSLPLTFPFTGKIIN------SN  178

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
             K       +  FL  + NTV DFG S+ KS+++ED+ TP+RSG DGVEF+P    T++FS
Sbjct  179   KFGQISSGVSHFLLSSINTVLDFGLSLIKSSVLEDELTPIRSGGDGVEFKPTEIWTITFS  238

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             L  IKQIK KL++T+NDVV G++  G RLYM++   ES+K+  TALVL NTR     YK 
Sbjct  239   LHHIKQIKSKLRMTVNDVVVGMLFLGIRLYMEETRPESTKSNSTALVLLNTRMFRT-YKC  297

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + +M+ PN+  PWGN+F FL + +P LT  N S+PL+ V  A ++IKRKR+S++V+L   
Sbjct  298   MEDMLNPNSNTPWGNRFAFLHIDIPKLTDFNLSNPLQLVEAAQKLIKRKRDSSAVFLVDK  357

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             L+Q + K RGSEV ++Y++ T KNSS+ ISN+IGP E+M+L  HPAKG+YF + GIPQ++
Sbjct  358   LMQMIHKFRGSEVASKYVYKTIKNSSLSISNLIGPKEKMALTGHPAKGMYFTVVGIPQTI  417


 Score =   199 bits (507),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 134/192 (70%), Gaps = 1/192 (1%)
 Frame = +1

Query  787   TINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPW  966
             TINDV++GI+  G RLYM +   +S+++  T +VL NTR  G  YKS+ +M+KPN+   W
Sbjct  416   TINDVISGIVFMGIRLYMHETCPDSTQSNVTTIVLLNTRMFGD-YKSIEDMLKPNSNASW  474

Query  967   GNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEV  1146
             GN+   L + +P LT    S+P++F++ A ++IKRKR S +++L   L++ + K +G E 
Sbjct  475   GNRIALLLIDIPKLTDYELSNPIQFIKAAQKLIKRKRYSYAIFLLDKLMEMVQKLKGPEA  534

Query  1147  TARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRI  1326
              A+ ++  ++NSS+ ISNMIGP E+M+L  HPAKGIYF I GIPQSL +T+VSY+  LRI
Sbjct  535   AAKCVYKMARNSSLSISNMIGPKEKMALLGHPAKGIYFTIFGIPQSLMITVVSYMEDLRI  594

Query  1327  ALSVEKDFIDAE  1362
             A   EK+FID E
Sbjct  595   AFGSEKEFIDQE  606



>ref|XP_006446860.1| hypothetical protein CICLE_v10015616mg [Citrus clementina]
 gb|ESR60100.1| hypothetical protein CICLE_v10015616mg [Citrus clementina]
Length=379

 Score =   415 bits (1066),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/373 (54%), Positives = 257/373 (69%), Gaps = 11/373 (3%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP  Q+ NS++LS++IL VLE E+P    DSL I LLKD+F+PINPRFSSIMV E  
Sbjct  12    EPVSPIGQYFNSTILSISILAVLELEVPF--DDSLAIPLLKDIFLPINPRFSSIMVVEK-  68

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG K WK VEV    HV VPN+P G   +FYD CL DYLSK++ E  P ++PLWE+H+ K
Sbjct  69    NGVKHWKSVEVKLKNHVYVPNFPVGMSQQFYDKCLQDYLSKLSAEQMPQSQPLWEVHIVK  128

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAA +VIFKLHH+LGDG+SLMGA+LSCLQRAD+P+ PLTFPS        R +   
Sbjct  129   YPTSNAASSVIFKLHHALGDGFSLMGALLSCLQRADDPSRPLTFPSV-------RMRPDI  181

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
               S  FK +P+F    FNT  DF WS+ KS+L+EDD+TP+RSG     + PI  TTM+F 
Sbjct  182   NGSSIFKNVPKFFNTVFNTASDFCWSMIKSSLIEDDKTPIRSGSAAAGWLPITITTMTFP  241

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             L QIKQIKD L  T+NDV+TG I  G RLYM+   +ES+    TA+VL NTR       S
Sbjct  242   LHQIKQIKDNLGATLNDVITGTIFLGIRLYMQAVNQESTNLHSTAVVLLNTRMF-KSISS  300

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + EM+KP ++ PWGN F+FL +S+P LT A   +PL+F++KA  II+ KR+S   YLT  
Sbjct  301   IKEMVKPGSKAPWGNHFSFLHISVPQLTNAEVQNPLKFIQKAQEIIQSKRSSFGAYLTAK  360

Query  1108  LLQALMKTRGSEV  1146
             LL+ + K RG EV
Sbjct  361   LLETVKKLRGHEV  373



>ref|XP_004505568.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=471

 Score =   416 bits (1069),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 214/468 (46%), Positives = 306/468 (65%), Gaps = 12/468 (3%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP+ Q+ N+S++S  ++  +E   P    +SL+I  + +VF   NPRFSSIMV  G
Sbjct  9     EEPVSPTGQYFNNSIISSYVVAFMEFANPFH--ESLLIPFITNVFFHANPRFSSIMV-RG  65

Query  205   INGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
              +G  +W++VEV   EH+K+P  P  K    YD+  ++Y++ +     P ++PLWEIHLF
Sbjct  66    EDGTMRWRKVEVYPEEHIKIPKLPEIKE-SLYDNYFNEYVTSILNARTPQDKPLWEIHLF  124

Query  385   KYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
             KYPT+ AA   IFKLHH++GDGYSLM A+LSCL RAD+P+LPL+FPSRQ+S     SK +
Sbjct  125   KYPTSKAATTAIFKLHHAIGDGYSLMSALLSCLNRADDPSLPLSFPSRQQS----HSKYA  180

Query  565   NKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSF  744
              K    F+ +       F ++ DFG S+ ++ + EDD TP+RSG +G E +P A + +  
Sbjct  181   QK--SLFQKICLTTSYFFGSILDFGSSIIQTRITEDDITPIRSGYEGTELQPFALSEIVL  238

Query  745   SLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYK  924
             SLDQIK  K KL VTIND+VTGII YG RLYM++ +E++  +   +++L NTR I G YK
Sbjct  239   SLDQIKATKSKLGVTINDLVTGIIFYGIRLYMEEKDEKTKCSNSKSVILLNTRNISG-YK  297

Query  925   SVTEMIKPNAEMP-WGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLT  1101
             S+ EM KP +E   WGNQF+ L +S+P LT +  S+PL FV ++ ++IK+KR S  VYL 
Sbjct  298   SLKEMQKPKSEGGLWGNQFSMLQISIPKLTQSRISNPLEFVWESSKLIKKKRYSFGVYLM  357

Query  1102  GWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQ  1281
               L+    K RG E  A+ +  ++ NSS  I+NMIGP+E+ ++ N P  GIYF + G P+
Sbjct  358   ALLMDFERKLRGPEAVAKVLFKSAFNSSTLITNMIGPIEKTAVENIPVNGIYFTVMGGPE  417

Query  1282  SLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
             +L ++++SYV  LRI L   K FID +K K C+  A E I++AA+  S
Sbjct  418   NLFISLISYVNILRITLRTLKGFIDEQKLKLCIEKAAEVIFKAAMDIS  465



>ref|XP_003623995.1| O-acyltransferase WSD1 [Medicago truncatula]
 gb|AES80213.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=478

 Score =   416 bits (1069),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 221/466 (47%), Positives = 308/466 (66%), Gaps = 15/466 (3%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP  Q L+++ L L IL  LE ++PI   D  + SL++D F+ I PRF+SIMV +G 
Sbjct  11    EPVSPMGQCLDNTSLCLHILAFLEFQVPIH--DLPIFSLVEDAFLYI-PRFTSIMVHDG-  66

Query  208   NGGKKWKRVEVNHSEHVKVPNY-PAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
              G K+WK++EV   EH+  P +   G  ++  D   +DY+SKMAME  P  RPLW++H+ 
Sbjct  67    RGVKRWKQIEVKLEEHIIEPKFIDDGMSVDSNDKHFADYISKMAMEDLPRTRPLWQVHVI  126

Query  385   KYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
             KYPT+NAAG ++FK HH++GDGY+LMG ILS LQRAD+P+L L+FPS +    +PR K+ 
Sbjct  127   KYPTSNAAGTLVFKFHHAIGDGYNLMGVILSSLQRADDPSLRLSFPSLK----SPRPKS-  181

Query  565   NKISGF-FKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMS  741
               IS F    M ++L   F +V +FGWS+ KSTLVEDD+TP+RSG + VEFR    + ++
Sbjct  182   --ISRFIMNKMSQYLSMPFTSVSEFGWSLLKSTLVEDDKTPIRSGVEAVEFRRTKLSNVT  239

Query  742   FSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGY  921
             FS D IK+IK  L VTINDV+TGII YG RLYM+  +  S     TALV+ NTR I   Y
Sbjct  240   FSKDHIKEIKSNLGVTINDVITGIIFYGIRLYMQNIDYRSRAFSSTALVIANTRHIKD-Y  298

Query  922   KSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLT  1101
             + V +M+K   +  WGN  T+  VS+P L     S+PL+FVRKAH  IKR +NS +  L 
Sbjct  299   QIVQDMLK-TEKGAWGNHITYYHVSVPKLQDIPISNPLQFVRKAHTSIKRNKNSFANPLI  357

Query  1102  GWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQ  1281
               LL+   K  G E  A++IHGT + SS+ ISN+ GP+E+M+ ANHP  G +F ++GIPQ
Sbjct  358   TKLLRMKNKLEGPEALAKHIHGTMRKSSLLISNVAGPIEQMAWANHPIGGFFFTLSGIPQ  417

Query  1282  SLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALG  1419
             SL +T++SY+G LR+  + E++FID +K    ++ AF+ I   ++ 
Sbjct  418   SLVITVMSYMGMLRVTTTTEEEFIDEQKLTWYLNKAFDIIRHESIA  463



>ref|XP_006446856.1| hypothetical protein CICLE_v10015143mg [Citrus clementina]
 gb|ESR60096.1| hypothetical protein CICLE_v10015143mg [Citrus clementina]
Length=373

 Score =   411 bits (1057),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/373 (54%), Positives = 255/373 (68%), Gaps = 11/373 (3%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP  Q+ NSS+LS++IL VLE E+P    DS  I LLKD+F+PINPRFSSIMV E  
Sbjct  12    EPVSPIGQYFNSSILSISILAVLELEVPF--DDSWAIPLLKDIFLPINPRFSSIMVVEK-  68

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             NG K WK VEV    HV VPN+P G   +FYD CL DYLSK++ E  P ++PLWE+H+ K
Sbjct  69    NGVKHWKSVEVKLKNHVYVPNFPVGMSQQFYDKCLQDYLSKLSAEQMPQSQPLWEVHIVK  128

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NAA +VIFKLHH+LGDG+SLMGA+LSCLQRAD+P+ PLTFPS        R +   
Sbjct  129   YPTSNAASSVIFKLHHALGDGFSLMGALLSCLQRADDPSRPLTFPSV-------RMRPDI  181

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
               S  FK +P+F    FNT  DF WS+ KS+L+EDD+TP+RSG     + PI  TTM+F 
Sbjct  182   NGSSIFKNVPKFFNTVFNTASDFCWSMIKSSLIEDDKTPIRSGSAAAGWLPITITTMTFP  241

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             L QIKQIKD L  T+NDVVTG I  G RLYM+   +ES+    TA+VL NTR       S
Sbjct  242   LHQIKQIKDNLGATLNDVVTGTIFLGIRLYMQAVNQESTNLHSTAVVLLNTRMF-KSISS  300

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             + EM+KP ++ PWGN F+FL +S+P LT A   +PL+F++KA  II+ KR S   YLT  
Sbjct  301   IKEMVKPGSKAPWGNHFSFLHISVPQLTNAEVQNPLKFIQKAQEIIQSKRGSFGAYLTAK  360

Query  1108  LLQALMKTRGSEV  1146
             LL+ + K RG E+
Sbjct  361   LLETVKKLRGHEL  373



>ref|XP_010268803.1| PREDICTED: O-acyltransferase WSD1-like [Nelumbo nucifera]
Length=483

 Score =   411 bits (1056),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 204/462 (44%), Positives = 307/462 (66%), Gaps = 18/462 (4%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGG  216
             SP +Q +NSS LS+ I+GV E   P+  S +   + L+D+F+PIN RFSS+++++   G 
Sbjct  22    SPLSQCINSSSLSIPIIGVYELGAPLNRSQT--ATFLQDIFIPINDRFSSVIITDK-KGM  78

Query  217   KKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYPT  396
             ++WK+VEV+  EH+ +P +P+G   E YDD  ++YLSK+ M+  P NRPLW +H+  YP+
Sbjct  79    QRWKKVEVDIDEHILIPTFPSGLSREDYDDYTNEYLSKITMDPLPENRPLWNVHVIPYPS  138

Query  397   TNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPS---RQRSTAAPRSKASN  567
             TNA   ++FK++H++GDGYSL+GA+ SCL+RAD+P+LPLTFPS   R        SK S 
Sbjct  139   TNAEATLVFKINHAIGDGYSLIGALFSCLKRADDPSLPLTFPSMSSRMMQGTGGLSKWSR  198

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
               S        FL    NT+ D   SV   T +EDD+T +RSG   VE+ PI+ ++++FS
Sbjct  199   LCS--------FLTVCVNTLTDSARSVLFGTFLEDDKTAIRSGLPEVEYEPISISSITFS  250

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD + +I+ K   T+N+ VTGII Y  +LYMK+  + S KAR T+LV+ N R + G +K+
Sbjct  251   LDDLGRIQSKFGGTVNEAVTGIISYAIQLYMKRVGKVSKKARITSLVVLNARMLKG-FKT  309

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             V +M+K N    WGN+F+ L VS+P+    N  DP+ FV +A + ++R+RNS +++    
Sbjct  310   VGDMLKANI---WGNRFSLLHVSVPSNVDVNKVDPMDFVVQAKKEMRRRRNSMALFFNNR  366

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             LL  L   RG E  +RYI+ T KN+S+ +++++GP ++M +A+ P    YF +AG+PQSL
Sbjct  367   LLHVLRSIRGPEAASRYIYSTWKNASITMTSLVGPTQKMVIADLPINSFYFTLAGVPQSL  426

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
               T+VSY+G LR+A+  EKDFID++ F  C++ A+E I EAA
Sbjct  427   VFTIVSYMGKLRVAVRTEKDFIDSQLFVSCMNEAYEKISEAA  468



>ref|XP_006582315.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=431

 Score =   407 bits (1046),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 210/464 (45%), Positives = 284/464 (61%), Gaps = 51/464 (11%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             +E  SP  Q+ NSSV+   + G LE  +PI   DS  I LLKDVF+PINPRFSSIMV + 
Sbjct  10    QEPVSPPGQYFNSSVICSYVFGFLEMAVPI--DDSQTIPLLKDVFLPINPRFSSIMVRDQ  67

Query  205   INGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
              +G  KWKRV+V   EHVKVP +P     E YD    DY++++  E  P N+PLWEIH+ 
Sbjct  68    -DGRMKWKRVQVKPEEHVKVPKFPECNSPELYDQYFGDYVTRILTERTPQNKPLWEIHII  126

Query  385   KYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
               PT NAAG +IFKLHH+LGDGYSLMGA+LSCLQR                         
Sbjct  127   NNPTRNAAGTLIFKLHHALGDGYSLMGALLSCLQR-------------------------  161

Query  565   NKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSF  744
                                   +FG S+ K+ ++ DD+TP+RSG +G    P   + +S 
Sbjct  162   ----------------------NFGSSLIKTRMIVDDKTPLRSGYEGTVSMPFTLSHISL  199

Query  745   SLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYK  924
              +D IK IK KL VTINDV+TG+I YG RLYM++ +  + KA  T +V+ NTR + G Y+
Sbjct  200   YIDNIKAIKSKLGVTINDVITGLIFYGIRLYMQEIDRMARKANSTCVVMLNTRNVRG-YQ  258

Query  925   SVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             SV EM K   +  WGN+ +FL V +P L  +  S+PL F+  A + IK+KR S SVYL G
Sbjct  259   SVKEMQKSKVKGLWGNKISFLQVPIPKLGQSKISNPLEFIWNARKQIKKKRRSFSVYLIG  318

Query  1105  WLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQS  1284
              LL   MK RG E  A+ I+ T +NSS+ ISN+ GPME+M+LANHP  G+YF + G P++
Sbjct  319   LLLDLEMKIRGPEAVAKIIYKTLRNSSVVISNLFGPMEQMTLANHPISGLYFTMTGGPEN  378

Query  1285  LCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             + +T++SYV  +RI L   K F+D +KFK C+  A++ +++AA+
Sbjct  379   VDITIMSYVKVIRITLRTLKGFVDEQKFKFCIEKAYDVMFKAAM  422



>gb|KDO53892.1| hypothetical protein CISIN_1g036070mg [Citrus sinensis]
Length=426

 Score =   406 bits (1043),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 220/462 (48%), Positives = 293/462 (63%), Gaps = 56/462 (12%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP+AQ+L+SS LSL IL +LE E  +   DSL++ L+KDVF+ I+PRFSS+MV +  NG
Sbjct  12    VSPTAQYLSSSTLSLCILAILEFEQVLD--DSLLMQLVKDVFLSISPRFSSVMVRDE-NG  68

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              K+ KRVEV    HVK P  P+G   E YD  L DY+S++ M+  P ++PLWEIHL + P
Sbjct  69    AKQRKRVEVKLINHVKFPFCPSGLSPESYDKYLGDYISEIGMQQLPQSQPLWEIHLIRSP  128

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T++AA  +IFKLHHSLGDG+SLMGA+LSCLQRAD+P+LPLT P    S   P SKA ++ 
Sbjct  129   TSHAACTLIFKLHHSLGDGFSLMGALLSCLQRADDPSLPLTLP----SVFLP-SKAKDES  183

Query  574   SG-FFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSL  750
             +G  F  + +      +TV DF W+  KST  EDD+TP+RSGDD VEFRP+   TM+FSL
Sbjct  184   NGSIFTRVLKIFSTVSDTVLDFCWNFVKSTTAEDDQTPIRSGDDRVEFRPVRVATMTFSL  243

Query  751   DQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSV  930
             D +KQIK K+  TINDVVTGII  GTRLYM++   +SS A+ TAL+L NTR +   Y+SV
Sbjct  244   DHVKQIKTKVVATINDVVTGIIFLGTRLYMQELRHDSSNAKSTALILLNTR-VFRSYESV  302

Query  931   TEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWL  1110
              +M+K +A  PWGN F FL +S+P LT   +S+PL FV KA +I+  K+NS +VYLTG +
Sbjct  303   KDMLKHDANAPWGNYFAFLHMSIPELTDDWSSNPLDFVVKARQIMNFKKNSLAVYLTGRV  362

Query  1111  LQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLC  1290
             L+ L   R                                              +P+SL 
Sbjct  363   LEILKNFR----------------------------------------------VPESLS  376

Query  1291  VTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             VT++SY+  LR+++  E  FID++K K CV HAFE +  A +
Sbjct  377   VTIISYMEKLRVSVVAEDGFIDSQKLKSCVEHAFEVMLNATV  418



>ref|XP_011001812.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Populus euphratica]
Length=395

 Score =   403 bits (1036),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 212/380 (56%), Positives = 268/380 (71%), Gaps = 13/380 (3%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS QFL+SS+LSL+I+ V+E E P   S +  I  LKDVF+PINPRFSSIMV++  
Sbjct  11    EPVSPSGQFLSSSILSLSIIAVMEFEAPFDNSQA--IPFLKDVFLPINPRFSSIMVADK-  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G K+WKRVEV  ++HV  P +  G   +FYD+C  +YLSKMAME  P ++PLWE+H+  
Sbjct  68    DGVKRWKRVEVRLTDHVNFPVFTTGMSTQFYDECFDEYLSKMAMEQLPQSQPLWEVHIIN  127

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT++AA N+IFKLHHSLGDG+SLMGA+LSCLQRAD P LPLTFPS Q  T       S 
Sbjct  128   YPTSHAASNIIFKLHHSLGDGFSLMGALLSCLQRADAPPLPLTFPSVQLHT-----NTSG  182

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
             +    F+ +PRF    +NT  DF  S+ +S LV+DD+TP+RSG  GVEF P+A TTM+FS
Sbjct  183   RNCSMFRKVPRFFSSVYNTASDFCSSIIQSCLVKDDKTPIRSGHSGVEFLPVAITTMTFS  242

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LDQIKQIK KL VTINDV+TGII  G R+YM+   + S  A  T+LVL NTR + GGYKS
Sbjct  243   LDQIKQIKAKLGVTINDVITGIIFLGARMYMETVSQGSGSACSTSLVLLNTR-MHGGYKS  301

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANA-SDPLRFVRKAHRIIKRKRNSASVYLTG  1104
             + EM+KP+AE PWGN F FL V +P L  A A ++PL+F+  A +IIK+KR S  V LT 
Sbjct  302   IQEMVKPDAESPWGNHFAFLNVRIPKLRDAEAKNNPLKFILNARKIIKKKRTSFGVNLTA  361

Query  1105  WLLQALMKTRGSEVTARYIH  1164
               LQ + K RG  V   ++H
Sbjct  362   KYLQLVAKFRGPNV---WVH  378



>ref|XP_007149838.1| hypothetical protein PHAVU_005G102600g [Phaseolus vulgaris]
 gb|ESW21832.1| hypothetical protein PHAVU_005G102600g [Phaseolus vulgaris]
Length=470

 Score =   404 bits (1038),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 201/460 (44%), Positives = 297/460 (65%), Gaps = 13/460 (3%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGG  216
             SP A +L+SS++++ +L  +ESEIPI   DS    LL++  +PI  RFS IMV++  NG 
Sbjct  13    SPMADYLSSSLINVFVLCAVESEIPID--DSKFQPLLENKLLPICSRFSCIMVTDK-NGK  69

Query  217   KKWKRVEVNHSEHVKVPNYPA-GKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
             K WK+V+VN  +H+K+P + +  +  + YD+CL  Y+SK+A E    ++PLWE+H+F YP
Sbjct  70    KVWKQVDVNPEDHIKIPKFASTNRTHKLYDECLDGYMSKIANEQLREDQPLWEVHIFNYP  129

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             TT AAG ++FKLHH+LGD YS M   LS  Q ADNP+LP+  PS +          S   
Sbjct  130   TTKAAGTILFKLHHALGDDYSFMATFLSITQSADNPSLPIKLPSSKLV-------ESTST  182

Query  574   SGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLD  753
              G  K + +       + +DFGWS  KS+L+ D++TP+RSG + V FRP++   +S SLD
Sbjct  183   KGMVKRLSQTASVLLKSAFDFGWSFMKSSLMPDEQTPLRSGHEDVGFRPMSIINVSLSLD  242

Query  754   QIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVT  933
              IK++K++LKV+INDV+ G I +G +LYMK   ++S  +  TALVL NTR I   YKS  
Sbjct  243   SIKEVKNELKVSINDVLVGAIFFGIQLYMKAKNQKSGTSESTALVLLNTRKIRA-YKSAK  301

Query  934   EMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLL  1113
             EM   ++E PWGN+F F+ V +P L+  N  +PL FV +A + I R+R S +V + G LL
Sbjct  302   EM-HTDSEAPWGNRFHFMHVPIPMLSDNNELNPLEFVLEAKKKINRQRTSLAVPMAGVLL  360

Query  1114  QALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCV  1293
             + L + +G +    +++ T  N+S+ IS+M+GP E+++LANHP KG+YF+  G+ QS+ V
Sbjct  361   RLLNQIKGPQAATNFLYKTMNNASLSISHMVGPAEKVTLANHPIKGLYFMTVGLSQSITV  420

Query  1294  TMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             T+ SY+G LR+   VE+ FID  + K C   + + I EA 
Sbjct  421   TITSYMGHLRVGFGVEEGFIDEYQLKSCFETSLQKILEAG  460



>gb|KEH30688.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=401

 Score =   401 bits (1030),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 202/401 (50%), Positives = 278/401 (69%), Gaps = 12/401 (3%)
 Frame = +1

Query  220   KWKRVEVNHSEHVKVPNYP--AGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
             +W+RVEV   EH+K+P +P         YD+ LSDY++ +     P ++PLWEIHL KYP
Sbjct  2     RWQRVEVKLEEHIKIPKFPETTNSSSILYDNYLSDYVTSILTSRTPQDKPLWEIHLIKYP  61

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T+NA G +IFKLHH+LGDGYSLMGA+LSCLQRAD+P+LPL+FPSR      P+  +    
Sbjct  62    TSNAKGTLIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSR------PQLNSKYAK  115

Query  574   SGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLD  753
              G FK +   +   F+++ DFG S+ K+ ++EDD+TP+RSG +G E +P   + +S SLD
Sbjct  116   KGLFKKLCLDISSFFSSISDFGSSLIKTRMIEDDKTPIRSGYEGTESQPFTLSNISLSLD  175

Query  754   QIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVT  933
             QIK+IK KL VTINDV++G+I YG RLYM++  E++ K+  TA+V+ NTR I G Y+S+ 
Sbjct  176   QIKEIKSKLGVTINDVLSGVIFYGIRLYMEEMNEKTKKSNSTAVVMLNTRNIEG-YQSLK  234

Query  934   EMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLL  1113
             EM KP ++  WGNQ +FL + +P L+    SDPL FV KA ++IKRKR S  VYL G LL
Sbjct  235   EMQKPESKSLWGNQISFLQIPIPKLS---QSDPLEFVWKARKLIKRKRRSFGVYLIGLLL  291

Query  1114  QALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCV  1293
                MK +GSE  A+ I+ T  NSS+ ISN++GP+E+M+LANHP  G YF + G P+++ +
Sbjct  292   NLEMKLKGSESVAKIIYNTMGNSSVVISNLVGPVEKMALANHPINGFYFTMTGGPENVDI  351

Query  1294  TMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             T++SYV  LRI L   K FID  KFK C+  A E I++AA+
Sbjct  352   TIMSYVKILRITLRTLKGFIDERKFKFCMEKAVEVIFKAAM  392



>ref|XP_006469878.1| PREDICTED: O-acyltransferase WSD1-like [Citrus sinensis]
Length=380

 Score =   390 bits (1003),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 204/378 (54%), Positives = 264/378 (70%), Gaps = 10/378 (3%)
 Frame = +1

Query  34    ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
              SP+AQ+L+SS LSL IL +LE E  +   DSL++ L+KDVF+ I+PRFSS+MV +  NG
Sbjct  12    VSPTAQYLSSSTLSLCILAILEFEQVLD--DSLLMQLVKDVFLSISPRFSSVMVRDE-NG  68

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              K+WKRVEV    HVK P  P+G   E YD  L DY+S++ M+  P ++PLWEIHL + P
Sbjct  69    AKQWKRVEVKLINHVKFPFCPSGLSPESYDKYLGDYISEIGMQQLPQSQPLWEIHLIRSP  128

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T++AA  +IFKLHHSLGDG+SLMGA+LSCLQRAD+P+LPLT P    S   P SKA ++ 
Sbjct  129   TSHAACTLIFKLHHSLGDGFSLMGALLSCLQRADDPSLPLTLP----SVFLP-SKAKDES  183

Query  574   SG-FFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSL  750
             +G  F  + +      +TV DF W+  K T  EDD+TP+RSGDDGVEFRP+   TM+FSL
Sbjct  184   NGSIFTRVLKIFSTVSDTVLDFCWNFVKITTAEDDQTPIRSGDDGVEFRPVRVATMTFSL  243

Query  751   DQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSV  930
             D +KQIK K+  TINDVVTGII  GTRLYM++   +SS A  TAL+L NTR +   Y+SV
Sbjct  244   DHVKQIKTKVDATINDVVTGIIFLGTRLYMQELRHDSSNAISTALILLNTR-VFRSYESV  302

Query  931   TEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWL  1110
              +M+K +A  PWGN F FL VS+P LT   +S+PL FV KA +I+  K+NS +VYLTG +
Sbjct  303   KDMLKHDANAPWGNYFAFLHVSIPELTDDWSSNPLEFVVKARQIMNFKKNSLAVYLTGRV  362

Query  1111  LQALMKTRGSEVTARYIH  1164
             L+ L K RG E+     H
Sbjct  363   LEILKKFRGPELDISTAH  380



>gb|KGN43653.1| hypothetical protein Csa_7G051330 [Cucumis sativus]
Length=413

 Score =   385 bits (989),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/403 (47%), Positives = 261/403 (65%), Gaps = 7/403 (2%)
 Frame = +1

Query  217   KKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYPT  396
             +KWK  +VN  +H+ +PN+P       YD    +Y +K A + F    PLWEIH+F YPT
Sbjct  10    RKWKTTKVNPKDHIYIPNFPMELSSYEYDAYFDEYATKTATKPFSQAIPLWEIHVFNYPT  69

Query  397   TNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKIS  576
             T+A  ++IFK+HHS+ DG+ LM  +LSCL+RAD+P+LPLTFPSRQRS          ++S
Sbjct  70    THATCSIIFKVHHSIADGFCLMNTLLSCLKRADDPSLPLTFPSRQRSKQPGNEPKFFRLS  129

Query  577   GFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEF-RPIATTTMSFSLD  753
              F     RF     N V +FGWS+ K+T VEDD TP++   D ++  +PIA +TM+FSLD
Sbjct  130   HF---PARFFSSISNFVLNFGWSIMKNTFVEDDPTPIKPQKDSMQLVKPIAISTMTFSLD  186

Query  754   QIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVT  933
             QIKQIK+KL  ++NDV+TGII  G RLYM++   ESS A  +AL+L NTR     YKSV 
Sbjct  187   QIKQIKNKLNASVNDVLTGIIFLGIRLYMQEHNPESSGANSSALILLNTRK-AKAYKSVK  245

Query  934   EMIKPNAEMPWGNQFTFLPVSLPAL--TPANASDPLRFVRKAHRIIKRKRNSASVYLTGW  1107
             EM+K +++ PWGN+  FLP+ +P L  +P  +S PL FV K    I  +R+  SV+L   
Sbjct  246   EMVKKDSDAPWGNKIAFLPIPIPKLIDSPVVSSTPLEFVEKVKEKIMLQRSPLSVFLAAK  305

Query  1108  LLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSL  1287
             + + L    G E+ A+      KNSS+ ISNMIGP+E+M+L N P KG+YF + G+PQSL
Sbjct  306   VFEILKNVTGPEIGAKLFKRKLKNSSIMISNMIGPVEKMALVNLPVKGLYFTVPGMPQSL  365

Query  1288  CVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
              +T+VSY+G LRI    EK FI+ +K K C+  AF+ I   A+
Sbjct  366   MITIVSYMGDLRIVFGGEKCFINQQKLKVCIEDAFQRILAKAV  408



>gb|KDO41203.1| hypothetical protein CISIN_1g017622mg [Citrus sinensis]
Length=368

 Score =   380 bits (977),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 189/329 (57%), Positives = 236/329 (72%), Gaps = 7/329 (2%)
 Frame = +1

Query  1    VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
            +E+ E    E  SPS Q+LNSS LSL++LGVLESEIPI   DS   SLLKD+F+PINPRF
Sbjct  1    MELKEAEETEPVSPSGQYLNSSALSLSVLGVLESEIPID--DSQCFSLLKDIFLPINPRF  58

Query  181  SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
            SSIMV +  NG K+WKRVEV    HVKVP +P+G   E YD    DY+S++ ME FP ++
Sbjct  59   SSIMVVDE-NGEKQWKRVEVKLRNHVKVPIFPSGLSPEAYDKYFDDYISEIGMELFPQSQ  117

Query  361  PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
            PLWE+H+ KYPT++AAG +IFKLHHSLGDG+SLMGA+LSCLQRAD+P++PLTFPS  R  
Sbjct  118  PLWEVHIIKYPTSHAAGFLIFKLHHSLGDGFSLMGALLSCLQRADDPSVPLTFPSVNR--  175

Query  541  AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
              P +K     S  F  M +       TV DF WS  KS  ++DDRTP+ SGDDG+EFRP
Sbjct  176  -FPSNKKDGNNSNIFSNMYKTFCVVSETVSDFCWSFVKSAWLQDDRTPIYSGDDGIEFRP  234

Query  721  IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNT  900
            ++  T +FSLDQIKQIK K+  T+NDV+ GII  GTRLYM++  + S +A  T LVL NT
Sbjct  235  VSVATTAFSLDQIKQIKTKVDATVNDVIAGIIFLGTRLYMQEMRQGSGEANSTTLVLLNT  294

Query  901  RAIGGGYKSVTEMIKPNAEMPWGNQFTFL  987
            RA    Y+SV +M+KP+A+ PWGN F FL
Sbjct  295  RAF-RSYESVKDMVKPDAKSPWGNYFAFL  322



>gb|KCW46796.1| hypothetical protein EUGRSUZ_K00600 [Eucalyptus grandis]
Length=409

 Score =   374 bits (960),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 196/398 (49%), Positives = 273/398 (69%), Gaps = 15/398 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS Q+LNS V+S++ILG+LE EIPI   DS  +S  +D+F+PINPRFSSIMV+ G 
Sbjct  11    EPVSPSGQYLNSKVMSVSILGILELEIPID--DSQAMSFFRDIFLPINPRFSSIMVT-GE  67

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFY---DDCLSDYLSKMAMEAFPPNRPLWEIH  378
              G +KWK+V VN   HV VP++ + K        D  L  Y+S++AM+ FP  +PLWEIH
Sbjct  68    KGARKWKKVGVNMENHVHVPSFSSPKGSSSPSENDSFLKSYISQIAMQPFPQGQPLWEIH  127

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
             + K PT+ A   +IFKLHH+LGDGYSL+ A+LSCLQRAD+P+LP+T PS ++ ++A +  
Sbjct  128   IIKCPTSEAQETLIFKLHHALGDGYSLVAALLSCLQRADDPSLPVTSPSVKKFSSANK--  185

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
               ++  G  K + R      NTV DFGWS+ KST V+DD +P+RSG + ++  P + +T+
Sbjct  186   -DDRNIGLRKVVSRCFSPLVNTVRDFGWSLLKSTCVKDDLSPIRSGSESLQ--PYSVSTI  242

Query  739   SFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESS-KARCTALVLFNTRAIGG  915
             +FSLDQIK+IK +L+VT+NDV++G+I   TRLYM++    S+     TALVL NTR +  
Sbjct  243   TFSLDQIKEIKSRLRVTVNDVISGVIFLATRLYMQRVSTNSNLSTNSTALVLLNTRNL-R  301

Query  916   GYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANA--SDPLRFVRKAHRIIKRKRNSAS  1089
              YK V +M++PN+E PWGN F FL V +P + P+++  SDPL+FV K H +IKRKR+S  
Sbjct  302   DYKPVRDMVRPNSESPWGNHFAFLHVPIPKVKPSDSQFSDPLKFVHKTHEVIKRKRSSFG  361

Query  1090  VYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNM  1203
             V LTG LL+ + K R +EV AR     SKN+    S++
Sbjct  362   VILTGKLLEIMQKCRNAEVCARRDDRLSKNAKYAKSDL  399



>gb|KEH30689.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=392

 Score =   371 bits (953),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 197/396 (50%), Positives = 268/396 (68%), Gaps = 15/396 (4%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             +E  SP  Q+ NSSV+   + G LE  IPI   DS  + LLKDVF+PINPRFSSIMV + 
Sbjct  9     QEPVSPHGQYFNSSVICSYVFGFLELAIPI--DDSQTMPLLKDVFLPINPRFSSIMVRDK  66

Query  205   INGGKKWKRVEVNHSEHVKVPNYP--AGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIH  378
              +G  +W+RVEV   EH+K+P +P         YD+ LSDY++ +     P ++PLWEIH
Sbjct  67    -DGKMRWQRVEVKLEEHIKIPKFPETTNSSSILYDNYLSDYVTSILTSRTPQDKPLWEIH  125

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
             L KYPT+NA G +IFKLHH+LGDGYSLMGA+LSCLQRAD+P+LPL+FPSR      P+  
Sbjct  126   LIKYPTSNAKGTLIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSR------PQLN  179

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
             +     G FK +   +   F+++ DFG S+ K+ ++EDD+TP+RSG +G E +P   + +
Sbjct  180   SKYAKKGLFKKLCLDISSFFSSISDFGSSLIKTRMIEDDKTPIRSGYEGTESQPFTLSNI  239

Query  739   SFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGG  918
             S SLDQIK+IK KL VTINDV++G+I YG RLYM++  E++ K+  TA+V+ NTR I  G
Sbjct  240   SLSLDQIKEIKSKLGVTINDVLSGVIFYGIRLYMEEMNEKTKKSNSTAVVMLNTRNI-EG  298

Query  919   YKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYL  1098
             Y+S+ EM KP ++  WGNQ +FL + +P L+    SDPL FV KA ++IKRKR S  VYL
Sbjct  299   YQSLKEMQKPESKSLWGNQISFLQIPIPKLS---QSDPLEFVWKARKLIKRKRRSFGVYL  355

Query  1099  TGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMI  1206
              G LL   MK +GSEV     + +SKN  + + ++I
Sbjct  356   IGLLLNLEMKLKGSEVCHTLFNHSSKNLMLYLFSLI  391



>ref|XP_003607474.1| O-acyltransferase WSD1, partial [Medicago truncatula]
Length=351

 Score =   368 bits (945),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 184/352 (52%), Positives = 251/352 (71%), Gaps = 10/352 (3%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SPS Q+ N+  L   + G LES+IPI   DS  + L + VF+PINPRFSSIMV +  
Sbjct  9     EPVSPSGQYFNTPPLCSYVFGFLESQIPID--DSQTMYLFQHVFLPINPRFSSIMVRDK-  65

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             +G  KWK+VEV   +H+ VP +P  + IE YD    DY+SK+ ME  P ++PLWEIHL K
Sbjct  66    DGKMKWKKVEVKPEDHMHVPIFPKSESIELYDQYFDDYVSKIMMERTPQDKPLWEIHLIK  125

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
             YPT+NA G +IFKLHH+LGDGYSLMGA+LSCLQR D+P+LPL+FPSR+ S      K   
Sbjct  126   YPTSNAEGTLIFKLHHALGDGYSLMGALLSCLQRVDDPSLPLSFPSRKPSQLLSPKK---  182

Query  568   KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
                GFFK  P  +F  FN+  DFGWS+ KS++++DD+TP+ +G++GVE +P   + +SFS
Sbjct  183   ---GFFKWFPSTIFSFFNSFSDFGWSIAKSSMLKDDKTPIWNGEEGVESQPCVLSNLSFS  239

Query  748   LDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKS  927
             LD+IK IK KL VTINDV+TG+I YG RLYM++ ++++  +  T LVL +TR + G Y+S
Sbjct  240   LDEIKTIKSKLGVTINDVITGVIFYGIRLYMQEMDKKARTSNSTGLVLLSTRNV-GSYQS  298

Query  928   VTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNS  1083
             + +M K +++ PWGN  +FL VS+P L+ A+ S+PL F+ KA +IIKRKRN+
Sbjct  299   IQDMTKADSKSPWGNHISFLHVSIPKLSKASLSNPLEFIWKAQKIIKRKRNT  350



>ref|XP_010690153.1| PREDICTED: O-acyltransferase WSD1-like [Beta vulgaris subsp. 
vulgaris]
Length=495

 Score =   369 bits (948),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 196/479 (41%), Positives = 296/479 (62%), Gaps = 18/479 (4%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+++ L S V++L +L  LE  IP+      V++ LK+ F+ I+PRFSSI++ E +
Sbjct  25    EPMSPTSECLTSEVVTLYVLAFLELAIPVDFQS--VLTFLKNDFINIHPRFSSIVI-ENM  81

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
              G K WK+V+VN  +H+KVP +P     E Y     DY++K+A    P ++PLWE+H+  
Sbjct  82    KGKKMWKQVQVNVEDHLKVPTFPKNLSSESYSKHFDDYITKIATSQLPQHKPLWELHIIN  141

Query  388   YPT-TNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK--  558
             YP   N A   IFK+HH++ DG SLMG +LSC +R D+P+LPLTFPS+ R  +  R K  
Sbjct  142   YPKDNNVASTFIFKIHHAIADGTSLMGGVLSCFKRVDDPSLPLTFPSKTRRLSNSREKRN  201

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT--T  732
              S  +S  FK +P F+     ++YDFG S+ K  + EDD+TP+RSG   +   P +T   
Sbjct  202   ISQSLSKIFKIVPNFMSSIIYSLYDFGQSL-KLIVDEDDQTPIRSGVTDMTL-PCSTRVC  259

Query  733   TMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQC---EEESSKARCTALVLFNTR  903
             +++  L+++K+IK  L VT+ND++ GII   TRLY++     E++    R TA +  N R
Sbjct  260   SVTLHLNEVKRIKTLLGVTVNDIIVGIIFLATRLYIQDITDDEQQKINKRSTASIFVNIR  319

Query  904   AIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRN-  1080
              + G   S+ EM K N    WGN+ + + + LP L     S+PL F+ +AH+IIKRKR+ 
Sbjct  320   RVKGNL-SLEEMRKGNT---WGNRISNIEIPLPNLEDDYLSNPLEFIMRAHKIIKRKRSG  375

Query  1081  SASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYF  1260
             +  ++L   L QA+    G +  AR +    KN S  I+NMIGP E++SLANHP KG YF
Sbjct  376   TLGLFLMDGLFQAIRTVGGIQAAARTLGRRWKNCSFAITNMIGPSEQVSLANHPIKGFYF  435

Query  1261  IIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS*FTL  1437
             +  GI  S+ V+++SY+  LRI L++E  FID +K   CV ++F+ I++A++  S F++
Sbjct  436   VPTGINLSVTVSVLSYMDDLRIGLALENGFIDHQKLMTCVENSFQMIFQASMAMSEFSV  494



>gb|KEH23372.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=386

 Score =   363 bits (931),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/374 (49%), Positives = 253/374 (68%), Gaps = 10/374 (3%)
 Frame = +1

Query  301   DDCLSDYLSKMAMEAFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSC  480
             D   +DY+SKMAME  P  RPLW++H+ KYPT+NAAG ++FK HH++GDGY+LMG ILS 
Sbjct  7     DKHFADYISKMAMEDLPRTRPLWQVHVIKYPTSNAAGTLVFKFHHAIGDGYNLMGVILSS  66

Query  481   LQRADNPALPLTFPSRQRSTAAPRSKASNKISGF-FKAMPRFLFGAFNTVYDFGWSVFKS  657
             LQRAD+P+L L+FPS +    +PR K+   IS F    M ++L   F +V +FGWS+ KS
Sbjct  67    LQRADDPSLRLSFPSLK----SPRPKS---ISRFIMNKMSQYLSMPFTSVSEFGWSLLKS  119

Query  658   TLVEDDRTPVRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLY  837
             TLVEDD+TP+RSG + VEFR    + ++FS D IK+IK  L VTINDV+TGII YG RLY
Sbjct  120   TLVEDDKTPIRSGVEAVEFRRTKLSNVTFSKDHIKEIKSNLGVTINDVITGIIFYGIRLY  179

Query  838   MKQCEEESSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPA  1017
             M+  +  S     TALV+ NTR I   Y+ V +M+K   +  WGN  T+  VS+P L   
Sbjct  180   MQNIDYRSRAFSSTALVIANTRHIKD-YQIVQDMLK-TEKGAWGNHITYYHVSVPKLQDI  237

Query  1018  NASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGIS  1197
               S+PL+FVRKAH  IKR +NS +  L   LL+   K  G E  A++IHGT + SS+ IS
Sbjct  238   PISNPLQFVRKAHTSIKRNKNSFANPLITKLLRMKNKLEGPEALAKHIHGTMRKSSLLIS  297

Query  1198  NMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCC  1377
             N+ GP+E+M+ ANHP  G +F ++GIPQSL +T++SY+G LR+  + E++FID +K    
Sbjct  298   NVAGPIEQMAWANHPIGGFFFTLSGIPQSLVITVMSYMGMLRVTTTTEEEFIDEQKLTWY  357

Query  1378  VHHAFEGIYEAALG  1419
             ++ AF+ I   ++ 
Sbjct  358   LNKAFDIIRHESIA  371



>ref|XP_004173488.1| PREDICTED: O-acyltransferase WSD1-like, partial [Cucumis sativus]
Length=369

 Score =   362 bits (930),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/377 (48%), Positives = 259/377 (69%), Gaps = 11/377 (3%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             E  + E  SP+AQ LN+S LS++++ VLE EIPI   ++ +I   KD F+P+N  FSSI 
Sbjct  4     EDEFLEPMSPTAQCLNTSSLSISVIAVLEFEIPID--EAKIICYAKD-FIPLNSLFSSIT  60

Query  193   VSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWE  372
             V++ ING +KWK+VEV   E + V   P+   IE  D   ++Y++K++++    N+PLWE
Sbjct  61    VND-INGERKWKKVEVKVEEQIVVATPPSDLSIELNDAFFNEYITKLSVQELDQNKPLWE  119

Query  373   IHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPR  552
             IH+   PT+ AA N+I K HHSLGDGYS+MG +LS ++RADNP+LPLTFP   +      
Sbjct  120   IHILNCPTSTAAANLILKFHHSLGDGYSVMGLLLSTMKRADNPSLPLTFPFNGKMI---N  176

Query  553   SKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATT  732
             SK   +IS     +  FL  + N+V DFG S+ KS+++ED+ TP+RSG DGVEF+P    
Sbjct  177   SKKLGQISS---GVSHFLLSSINSVLDFGLSLIKSSVLEDELTPIRSGGDGVEFKPTEIW  233

Query  733   TMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIG  912
             T++FSL QIKQIK KL+VT+NDVV G++  G RLYM++   +S+K+  TALVL NTR   
Sbjct  234   TITFSLHQIKQIKSKLRVTVNDVVAGMLFLGIRLYMEETHPDSTKSNSTALVLLNTRMF-  292

Query  913   GGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASV  1092
             G YK + +M+ PN+  PWGN+F FL + +P LT  N S+PL+FV+ A ++IKRKR+S++V
Sbjct  293   GTYKCMEDMLNPNSNTPWGNRFGFLHIDIPKLTDFNLSNPLQFVQAAQKLIKRKRDSSAV  352

Query  1093  YLTGWLLQALMKTRGSE  1143
             +L   L++ + K RGSE
Sbjct  353   FLVDKLMEIIHKFRGSE  369



>emb|CDP14803.1| unnamed protein product [Coffea canephora]
Length=308

 Score =   357 bits (917),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/275 (61%), Positives = 208/275 (76%), Gaps = 9/275 (3%)
 Frame = +1

Query  202   GINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHL  381
             G +G KKWKRVEVN +EHV  P +P G   ++YDDC+S+YLSK+ ME FPP RPLWEIH+
Sbjct  41    GEDGQKKWKRVEVNVNEHVNFPKFPQGMSPDYYDDCVSNYLSKLGMEDFPPERPLWEIHV  100

Query  382   FKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKA  561
               YPTTNAA N++FKLHH+LGDGYSL+GA+LSCL+R+DNP+LPLTFPS Q  T     K 
Sbjct  101   MNYPTTNAASNIVFKLHHALGDGYSLVGALLSCLKRSDNPSLPLTFPSGQSKT-----KF  155

Query  562   SNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMS  741
              N  + F   +P  L  AFNT+Y FG+ V K  L+ DD TP+ S D+GV FRP+  TTM 
Sbjct  156   KNASTTF---LPDVLSRAFNTIYYFGYGVLKGFLLRDDHTPIPSDDEGVLFRPLTMTTME  212

Query  742   FSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGY  921
             FSLDQ KQIK KL+VTINDV+ GII++GTR+YM++   ESS+A CTA+VL NTR    GY
Sbjct  213   FSLDQFKQIKAKLQVTINDVIMGIIMFGTRIYMREMNHESSEANCTAVVLLNTR-YAAGY  271

Query  922   KSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANAS  1026
             KSV+EMIKPNAEMPWGN+F FLP+ +P LT   +S
Sbjct  272   KSVSEMIKPNAEMPWGNRFAFLPLPIPKLTATESS  306



>gb|KDP24113.1| hypothetical protein JCGZ_25770 [Jatropha curcas]
Length=272

 Score =   350 bits (898),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 165/261 (63%), Positives = 208/261 (80%), Gaps = 1/261 (0%)
 Frame = +1

Query  631   DFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTG  810
             DFGWS+ KS+LVED ++P+RSGDDGV+F+PI+ +T++FSLD+IKQIK +L VTINDV+TG
Sbjct  3     DFGWSLLKSSLVEDVKSPIRSGDDGVQFKPISLSTVTFSLDRIKQIKARLGVTINDVITG  62

Query  811   IIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLP  990
             II YG RLYM +  +  S A  TALVL NTRAIGG YKSV EM+KPNAE  WGN+F FL 
Sbjct  63    IIFYGIRLYMVEVNDRFSNAHSTALVLLNTRAIGG-YKSVKEMVKPNAESAWGNRFGFLH  121

Query  991   VSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGT  1170
             VS+P LT +  S+PL+FV  A++IIKRKR+S +V LTG LL AL K RG E TA+YIH T
Sbjct  122   VSMPELTKSAISNPLQFVENANQIIKRKRSSLAVDLTGRLLDALRKLRGPETTAKYIHST  181

Query  1171  SKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDF  1350
              KNSSM ISN+IGP+E M+LANHP KG+YF++ G+PQSL +TMVSY G LR+A+  EK F
Sbjct  182   LKNSSMTISNVIGPVESMALANHPVKGLYFMVVGVPQSLTITMVSYTGQLRVAVGAEKGF  241

Query  1351  IDAEKFKCCVHHAFEGIYEAA  1413
             ID +KF  C+ +AFE I+++A
Sbjct  242   IDTQKFNSCIENAFEMIFKSA  262



>ref|XP_006447284.1| hypothetical protein CICLE_v10015554mg [Citrus clementina]
 gb|ESR60524.1| hypothetical protein CICLE_v10015554mg [Citrus clementina]
Length=388

 Score =   345 bits (884),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 176/319 (55%), Positives = 226/319 (71%), Gaps = 10/319 (3%)
 Frame = +1

Query  34   ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
             SP+AQ+L+SS LSL IL +LE E  +   DSL++ L+KDVF+ I+PRFSS+MV +  NG
Sbjct  25   VSPTAQYLSSSTLSLCILAILEFEQVLD--DSLLMQLVKDVFLSISPRFSSVMVRDE-NG  81

Query  214  GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
             K+WKRVEV    HVK P  P+G   E YD  L DY+S++ M+  P ++PLWEIHL + P
Sbjct  82   AKQWKRVEVKLINHVKFPFCPSGLSPESYDKYLGDYISEIGMQQLPQSQPLWEIHLIRSP  141

Query  394  TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
            T++AA  +IFKLHHSLGDG+SLMGA+LSCLQRAD+P+LPLT P    S   P SKA ++ 
Sbjct  142  TSHAACTLIFKLHHSLGDGFSLMGALLSCLQRADDPSLPLTLP----SVFLP-SKAKDES  196

Query  574  SG-FFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSL  750
            +G  F  + +      +TV DF W+  K T  EDD+TP+RSGDDGVEFRP+   TM+FSL
Sbjct  197  NGSIFTRVLKIFSTVSDTVLDFCWNFVKITTAEDDQTPIRSGDDGVEFRPVRVATMTFSL  256

Query  751  DQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSV  930
            D +KQIK K+  TINDVVTGII  GTRLYM++   +SS A  TAL+L NTR +   Y+SV
Sbjct  257  DHVKQIKTKVDATINDVVTGIIFLGTRLYMQELRHDSSNAISTALILLNTR-VFRSYESV  315

Query  931  TEMIKPNAEMPWGNQFTFL  987
             +M+K +A  PWGN F FL
Sbjct  316  KDMLKHDANAPWGNYFAFL  334



>ref|XP_010672070.1| PREDICTED: O-acyltransferase WSD1-like [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score =   344 bits (882),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 185/474 (39%), Positives = 280/474 (59%), Gaps = 15/474 (3%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP++++  + V +L +L + E EIPI +S   + +   DVF+   PRFS I + +  
Sbjct  18    EPTSPTSEYFLTEVATLYVLCIFELEIPIDSSS--IYAFFNDVFLESYPRFSCIPIEDKQ  75

Query  208   NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
                  WK+VEVN  +H+K   +P     E Y D   DY+SK+A    P ++PLWE+H F 
Sbjct  76    RRRNVWKKVEVNVEDHIKFSKFPEHLSPENYSDHFDDYMSKIATSQLPKDKPLWEVHTFN  135

Query  388   YPT-TNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
             YPT  N A  +I K HH++GDG SLMG + SC +R D+P LPLTFPS  R++++   +  
Sbjct  136   YPTKNNVAATLIVKFHHAVGDGTSLMGVVFSCFKRVDDPTLPLTFPSTTRTSSSKGHQLH  195

Query  565   NKISGFFKAM---PRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIA-TT  732
             +  +   K +   P+FL      +YDFG ++ +  LVEDDRTP+RSG   +     A   
Sbjct  196   DFKATLMKVINIVPKFLCSMLYNIYDFGQTL-RVLLVEDDRTPIRSGITNMALPYSAKIC  254

Query  733   TMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEE--ESSKARCTALVLFNTRA  906
             +++ SL  +++IK  LKVT+NDVV GII + TRLY++  ++    + AR TA +  N R+
Sbjct  255   SVTLSLTDVRRIKSLLKVTVNDVVIGIISFATRLYIQDADQGGRLNNARLTASMAVNMRS  314

Query  907   IGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRK-RNS  1083
             I   + S  EM K N    WGN+F+ + + LP L   +  +PL FV   ++I+ RK RN 
Sbjct  315   IKR-FASPEEMRKENT---WGNKFSIIEMPLPTLGKDDIRNPLNFVINTNKILNRKKRNV  370

Query  1084  ASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFI  1263
              ++YLT   L A+    G +   R    + KNS++ I+NMIGP++ +S+ NHP KG YF+
Sbjct  371   GAIYLTALTLDAIRIFGGFKAATRTFEKSWKNSTVAITNMIGPVDHISVGNHPIKGFYFV  430

Query  1264  IAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALGSS  1425
               G+  SL V+++SY+ +LR+ L VE  FID ++   CV  A++ I +AA  S+
Sbjct  431   PTGLNLSLTVSVLSYMENLRLGLVVENGFIDHQRLVTCVETAYQKILQAANASA  484



>emb|CDP20976.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/254 (62%), Positives = 198/254 (78%), Gaps = 5/254 (2%)
 Frame = +1

Query  28   EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
            +  SP+ Q+ NSSVLS+ I+GVLE EIPIQ  DSL + L++DVF+PINPRFSSIMV +  
Sbjct  10   QPVSPTGQYFNSSVLSICIIGVLEFEIPIQEDDSLTVKLVQDVFLPINPRFSSIMVQDE-  68

Query  208  NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
             G K WK+VEV   +H++VPN+P GK IEFYD+C +DYL+K+AME  P ++PLWEIH+ K
Sbjct  69   KGVKYWKKVEVKPKDHIRVPNFPEGKSIEFYDECFNDYLTKLAMETLPQSQPLWEIHIIK  128

Query  388  YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
            YPT NAAGNV+FKLHH+LGDGYS+MGA+LSCLQRAD+P+LP+TFP+ + +        S 
Sbjct  129  YPTKNAAGNVVFKLHHALGDGYSIMGALLSCLQRADDPSLPITFPAFRTNPQV----ISI  184

Query  568  KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
            + S   K +PR L G  NT+ DF W V KST++EDDRTP+RSGDDGVEFRPI+ TT SFS
Sbjct  185  EDSSICKKVPRILSGIGNTISDFVWGVLKSTVLEDDRTPIRSGDDGVEFRPISITTFSFS  244

Query  748  LDQIKQIKDKLKVT  789
            +DQIKQIK  L+V 
Sbjct  245  MDQIKQIKVNLEVV  258



>ref|XP_010242035.1| PREDICTED: O-acyltransferase WSD1-like [Nelumbo nucifera]
Length=472

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 179/462 (39%), Positives = 276/462 (60%), Gaps = 20/462 (4%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGG  216
             SP +Q ++S    LTI+ V   ++P   S +  + LLK +    +PR  S++V++   G 
Sbjct  23    SPLSQIMHS----LTIIVVAGFDVPFDKSQT--VELLKAMHTTSDPRLFSVIVTDR-KGV  75

Query  217   KKWKRV-EVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
              +WK+V +V + +H+ V ++P G  +E YD    DYL+K+++  F  N P WE+H   YP
Sbjct  76    HRWKKVTQVAYEDHIFVASFPEGLSMEDYDKHFKDYLTKVSVTPFSDNLPPWEVHAIMYP  135

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T+N AG+++FK  H+LGDGYS +G+I++  +R D+P+LP+TFPS         SKA  K 
Sbjct  136   TSNGAGSLVFKFSHALGDGYSSLGSIMTLCRREDDPSLPITFPSST-------SKAGRK-  187

Query  574   SGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLD  753
             + + ++    +    NTV D   S  + T + DD+TP+RSG   V  +P+  + +SFSLD
Sbjct  188   NSWSRSASVLISWFINTVRDSAVSTLQGTFLRDDKTPIRSGTPPVGLQPMEISPVSFSLD  247

Query  754   QIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVT  933
              IK+I+ KL  T+NDVV GI+ Y  +LY+++ +  SS AR TAL+  N R + G Y+ + 
Sbjct  248   CIKRIRSKLGATVNDVVIGILSYAIQLYIQRMDFISSGARVTALIPLNMRMLNG-YQDIG  306

Query  934   EMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLL  1113
             +M+K N    WGN+F  L +SLP+ +     DPL F+  +   I++K+NSA+V+ +  LL
Sbjct  307   DMLKANL---WGNRFGLLSISLPSFSDEEKVDPLHFITSSRDNIRKKKNSAAVHFSSGLL  363

Query  1114  QALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCV  1293
               L    G +  A +I  + +N+S  IS ++GP  ++SL NHP K  YF + G PQ +  
Sbjct  364   TMLNNVLGPKALAGFIKSSFRNTSTTISTVVGPTHKISLENHPVKRCYFTVVGAPQDVVF  423

Query  1294  TMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALG  1419
             T+ SY+  L I  + EK FID+     CV  AFE IY+AA G
Sbjct  424   TIASYMEELCIVATAEKSFIDSNVLISCVKKAFEDIYQAACG  465



>gb|KEH30690.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=323

 Score =   315 bits (808),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 226/331 (68%), Gaps = 12/331 (4%)
 Frame = +1

Query  220   KWKRVEVNHSEHVKVPNYP--AGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
             +W+RVEV   EH+K+P +P         YD+ LSDY++ +     P ++PLWEIHL KYP
Sbjct  2     RWQRVEVKLEEHIKIPKFPETTNSSSILYDNYLSDYVTSILTSRTPQDKPLWEIHLIKYP  61

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKI  573
             T+NA G +IFKLHH+LGDGYSLMGA+LSCLQRAD+P+LPL+FPSR      P+  +    
Sbjct  62    TSNAKGTLIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSR------PQLNSKYAK  115

Query  574   SGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLD  753
              G FK +   +   F+++ DFG S+ K+ ++EDD+TP+RSG +G E +P   + +S SLD
Sbjct  116   KGLFKKLCLDISSFFSSISDFGSSLIKTRMIEDDKTPIRSGYEGTESQPFTLSNISLSLD  175

Query  754   QIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVT  933
             QIK+IK KL VTINDV++G+I YG RLYM++  E++ K+  TA+V+ NTR I  GY+S+ 
Sbjct  176   QIKEIKSKLGVTINDVLSGVIFYGIRLYMEEMNEKTKKSNSTAVVMLNTRNI-EGYQSLK  234

Query  934   EMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLL  1113
             EM KP ++  WGNQ +FL + +P L+    SDPL FV KA ++IKRKR S  VYL G LL
Sbjct  235   EMQKPESKSLWGNQISFLQIPIPKLS---QSDPLEFVWKARKLIKRKRRSFGVYLIGLLL  291

Query  1114  QALMKTRGSEVTARYIHGTSKNSSMGISNMI  1206
                MK +GSEV     + +SKN  + + ++I
Sbjct  292   NLEMKLKGSEVCHTLFNHSSKNLMLYLFSLI  322



>ref|XP_008244954.1| PREDICTED: O-acyltransferase WSD1-like, partial [Prunus mume]
Length=253

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 190/262 (73%), Gaps = 9/262 (3%)
 Frame = +1

Query  1    VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
            +E  E G  E  SP+ Q+ NSS+LS+ IL VLE E+PI  +DS  +SLL+DVF+PINPRF
Sbjct  1    MEFREEGEGEPVSPTGQYFNSSILSVAILAVLEFEVPI--NDSQTLSLLQDVFLPINPRF  58

Query  181  SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
            SSIMV +  +  K+WKRVEV   +HV VP +P+    E YD+   DY+S +A E  P NR
Sbjct  59   SSIMVRDNPDQKKQWKRVEVKLEDHVHVPIFPSKMSQESYDEYFDDYISNIAAEKLPQNR  118

Query  361  PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
            PLWEIH+ KYPT++AAG +IFKLHH+LGDGYSLMGA+LSCLQ A NP++PLTFPS + S+
Sbjct  119  PLWEIHILKYPTSHAAGTLIFKLHHALGDGYSLMGALLSCLQTAQNPSVPLTFPSLKSSS  178

Query  541  AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
                +  +  +S FF ++       F TV DF WS+ KS  VEDDRTP+RSG+DGVEFRP
Sbjct  179  GPKTTHMTKTVSQFFSSV-------FQTVSDFSWSILKSNFVEDDRTPIRSGEDGVEFRP  231

Query  721  IATTTMSFSLDQIKQIKDKLKV  786
            I  +T++FS+D+IK IK+KL V
Sbjct  232  ITLSTLTFSIDEIKLIKNKLGV  253



>ref|XP_008455535.1| PREDICTED: uncharacterized protein LOC103495687 [Cucumis melo]
Length=321

 Score =   308 bits (788),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 211/317 (67%), Gaps = 7/317 (2%)
 Frame = +1

Query  460   MGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFG  639
             M  +LSCL+RAD+P+LPLTFPSRQRS   P++K        F A  RF     N V +FG
Sbjct  1     MNTLLSCLKRADDPSLPLTFPSRQRS-KQPKNKLDFCRLSHFPA--RFFSSVSNFVLNFG  57

Query  640   WSVFKSTLVEDDRTPVRSGDDGVEF-RPIATTTMSFSLDQIKQIKDKLKVTINDVVTGII  816
             WS+ K+T VEDD TP++  +D ++  +PIA +TM+FSLDQIKQIK+KL  ++NDV+TGII
Sbjct  58    WSIMKNTFVEDDPTPIKPQEDSMQLVKPIAISTMTFSLDQIKQIKNKLNASVNDVLTGII  117

Query  817   IYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVS  996
               G RLYM++   ESS+A  +AL+L NTR     YKSV EM+K +++ PWGN+  FLPV 
Sbjct  118   FLGVRLYMQEHNPESSEANSSALILLNTRK-AKAYKSVKEMVKKDSDAPWGNKIAFLPVP  176

Query  997   LPAL--TPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGT  1170
             +P L  +P  +S PL FV K    I  +R+  SV+L   + + L    G E+ A+     
Sbjct  177   IPKLIDSPVVSSTPLEFVEKVKEKITLQRSPLSVFLAAKVFEILKNVTGPEIGAKLFKRK  236

Query  1171  SKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDF  1350
              KNSS+ ISN+IGP+E+M+L N P KG+YF + G+PQSL +T+VSY+G LRI    EK F
Sbjct  237   LKNSSIMISNLIGPVEKMALVNRPVKGLYFTVPGMPQSLMITIVSYMGDLRIVFGGEKCF  296

Query  1351  IDAEKFKCCVHHAFEGI  1401
             I+ +K K C+  AF+ I
Sbjct  297   INQQKLKVCIEDAFQRI  313



>gb|KDP24070.1| hypothetical protein JCGZ_25727 [Jatropha curcas]
Length=293

 Score =   305 bits (782),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 191/264 (72%), Gaps = 1/264 (0%)
 Frame = +1

Query  616   FNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTIN  795
              NT+ DF  S+   + VEDD++P+RSG  GVEF P++  TMSFSLDQIKQI+ KL VTIN
Sbjct  20    LNTLSDFCSSIMIGSFVEDDKSPIRSGHSGVEFLPVSLVTMSFSLDQIKQIRTKLGVTIN  79

Query  796   DVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQ  975
             DV++G I  GTR+YM+   + S KAR T+LVL NTR  GG YKSV EM KPNAE+PWGN 
Sbjct  80    DVISGTIFLGTRMYMEAISKGSGKARTTSLVLLNTRMFGG-YKSVQEMTKPNAELPWGNH  138

Query  976   FTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTAR  1155
             F FL VS+P L+ +   DPL+FV KA +II+RKR S +VYLT   LQ + K RG E  ++
Sbjct  139   FAFLSVSIPKLSGSEPKDPLQFVWKARKIIQRKRASFAVYLTAKYLQLVNKFRGPEAVSK  198

Query  1156  YIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALS  1335
             Y+H T KN+S+GI+N++GP E+M+LANHP  G YF++   PQSL   +VSY+G LR+A  
Sbjct  199   YLHNTLKNTSIGITNVMGPGEQMALANHPINGFYFVVTNSPQSLMTGVVSYMGKLRVAAL  258

Query  1336  VEKDFIDAEKFKCCVHHAFEGIYE  1407
             VEKDFID +K+   V +AF+ I +
Sbjct  259   VEKDFIDPQKYTLYVENAFQMILK  282



>ref|XP_004293155.1| PREDICTED: O-acyltransferase WSD1-like [Fragaria vesca subsp. 
vesca]
Length=258

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 192/264 (73%), Gaps = 13/264 (5%)
 Frame = +1

Query  10   MEHGYE----EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPR  177
            ME G E    E  SP +QF+NSSVLSL+IL VLE ++PI   D   ISLLK+VF+PINPR
Sbjct  1    MEFGEEGLLQEPVSPGSQFINSSVLSLSILAVLEFQVPID--DLQTISLLKNVFLPINPR  58

Query  178  FSSIMVSEGIN-GGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPP  354
            FSSIMV EG++   K+WKRV V   +HV+ P +PAG  +E YD C ++Y++++A E FP 
Sbjct  59   FSSIMV-EGVDKQNKQWKRVTVKLEDHVRAPIFPAGMSLESYDTCFNEYMTQIASETFPQ  117

Query  355  NRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQR  534
            ++PLWE+HLF+YPT++AAG +IFK+HH+LGDGYSLMGA+LS LQ A NP+LPLTFPS + 
Sbjct  118  SKPLWELHLFQYPTSHAAGQIIFKIHHALGDGYSLMGALLSRLQNAQNPSLPLTFPSLKG  177

Query  535  STAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEF  714
            +     S+     S  F+ +P+     FN+ +DF W + KST VEDDRTP+RSG DGVEF
Sbjct  178  ANNEATSR-----SRVFEFVPKIFSAVFNSAWDFSWGILKSTWVEDDRTPIRSGVDGVEF  232

Query  715  RPIATTTMSFSLDQIKQIKDKLKV  786
            RP++ +T+  S+++IK +K  L V
Sbjct  233  RPLSVSTLILSIEEIKLVKSNLGV  256



>gb|KDP24069.1| hypothetical protein JCGZ_25726 [Jatropha curcas]
Length=262

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 180/254 (71%), Gaps = 1/254 (0%)
 Frame = +1

Query  658   TLVEDDRTPVRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLY  837
             + VEDD++P+RSG  GVE  P++  TMSFSLDQIKQI+ KL VTI DV+TG I  G R+Y
Sbjct  4     SFVEDDKSPIRSGHSGVECLPVSLVTMSFSLDQIKQIRTKLGVTIKDVITGTIFLGNRMY  63

Query  838   MKQCEEESSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPA  1017
             M+   + S +AR T+LVL NTR   G YKSV EM KPNAE PWGN  TFL V +P L+  
Sbjct  64    MEAMSKGSGQARTTSLVLLNTRMFEG-YKSVQEMTKPNAEFPWGNHITFLSVPIPKLSGT  122

Query  1018  NASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGIS  1197
             +  DPL+FV KA +II+RKR S +VYLT   LQ + K RG E  ++Y+  T KNSSMGI+
Sbjct  123   DPKDPLQFVWKARQIIQRKRASFAVYLTAKYLQLVNKFRGPEALSKYLRNTLKNSSMGIT  182

Query  1198  NMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCC  1377
             N++GP+E+M+LANHP  G YF++   P SL   +VSY+G LR+A  VEKDFID +K+   
Sbjct  183   NLMGPVEQMALANHPINGFYFVVTNSPHSLGTGVVSYMGKLRVAALVEKDFIDPQKYTLH  242

Query  1378  VHHAFEGIYEAALG  1419
             V +AFE I +AA G
Sbjct  243   VENAFEMILKAACG  256



>gb|ADE77834.1| unknown [Picea sitchensis]
Length=501

 Score =   289 bits (739),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 169/494 (34%), Positives = 271/494 (55%), Gaps = 36/494 (7%)
 Frame = +1

Query  4     EMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFS  183
             EM E G  +  +P +Q + SS+LSL++  V E E  I        S++ D  +P NP FS
Sbjct  15    EMKEQG--QPVNPISQAICSSLLSLSVNVVFEFEEAITDISRCTKSIV-DAALPRNPLFS  71

Query  184   SIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRP  363
              IM  E   G  +W++  VN ++H  +  +P G+  E YD C+ DY+SK+A+  F  +RP
Sbjct  72    CIM-KEDDQGVLRWEKTAVNINDHTFIAEFPPGQ--ESYDACVDDYISKLALAPFDHSRP  128

Query  364   LWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTA  543
             L E H   Y T  A   ++F+ HH+LGDG S M  +    +R DNP LP TFP+ + S  
Sbjct  129   LCEFHFLNYKTNKAKATMVFRFHHALGDGISFMSTLFCIARRVDNPDLPPTFPTAKPSIQ  188

Query  544   APRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKST-LVEDDRTPVRSGDDGVEFRP  720
             +  S  +  ++ F + +   +   + T+ D   S+ + T  + D + P+R G  GV+  P
Sbjct  189   SSHS-GNTLLTKFIQRLWYMMLVLWYTLVDVISSLLRMTGWIGDSQMPIR-GPPGVKTMP  246

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYM-----------------KQC  849
             +A ++ +F L+ +KQIK+ +  T+NDV+TGII YG + Y+                 K+ 
Sbjct  247   VALSSATFLLEDLKQIKNSVGGTVNDVITGIIFYGMQRYLQIRFSAITEHGLQDAYEKRF  306

Query  850   E-------EESSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPAL  1008
             E       ++  K++ TAL L N R +  G +S+ EM+KP A+ PWGN F FLPV +P L
Sbjct  307   EMPEDAVIKQMEKSKLTALCLINMRGL-AGLQSIDEMVKPKAQAPWGNHFGFLPVRVPML  365

Query  1009  TPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSM  1188
                   +P++FVR+    I R + S    + G ++  L   +G +  +RY++ T  NS+ 
Sbjct  366   --GKLENPIQFVRRTKSKIDRHKISLGTSINGKIMAYLGWLKGPQAVSRYLYNTLANSTF  423

Query  1189  GISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKF  1368
             G+SN+IGP E++++  +P K   F ++G PQSL +++VSY G + + +  +K ++DA   
Sbjct  424   GMSNLIGPTEKVAIDGNPIKSFSFFVSGAPQSLELSIVSYTGVVVVQVYAQKAYVDANML  483

Query  1369  KCCVHHAFEGIYEA  1410
               C   A E I +A
Sbjct  484   CKCFIEACEEIKKA  497



>gb|KCW57203.1| hypothetical protein EUGRSUZ_H00018 [Eucalyptus grandis]
Length=345

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 163/363 (45%), Positives = 223/363 (61%), Gaps = 25/363 (7%)
 Frame = +1

Query  85    LGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGGKKWKRVEVNHSEHVKV  264
             +G+ ESEIPI   DS    L++DVF+PINPRF SIMV            V+V +  HV  
Sbjct  1     MGISESEIPID--DSQATLLIRDVFLPINPRFYSIMV-----------EVKVENQLHVPS  47

Query  265   PNYPAG--KPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHS  438
              + P G   P E  D  L  Y+S++A + FP  +PLWEIH  K PT+   G +IFKL H+
Sbjct  48    FSSPKGLSSPSE-NDSFLKSYISQIAKQPFPQGQPLWEIHTIKGPTSEVQGTLIFKLRHA  106

Query  439   LGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASNKISGFFKAMPRFLFGAF  618
             LGDGYSL+GA+LSCLQRAD+P+L +TFPS  + ++A      ++   F + +        
Sbjct  107   LGDGYSLVGALLSCLQRADDPSLLVTFPSANKLSSA---NNDDRTLDFRRWLADVFLPLV  163

Query  619   NTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTIND  798
             NTV +F   V KST  +DD  P+R G +   FRP + +T+SFSLD IK+IK +L+VTIN+
Sbjct  164   NTVRNFDGRVLKSTCFKDDLPPIRCGLES--FRPFSLSTISFSLDCIKEIKSRLRVTINN  221

Query  799   VVTGIIIYGTRLYMKQCEEE-SSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQ  975
             ++ G+I   TRLYM++     +     TALVL N R +   YKSV +M++PN+E  WGN 
Sbjct  222   IIMGVIFLATRLYMQRGSPNLNLSTNSTALVLLNMRNL-RDYKSVRDMVRPNSESLWGNN  280

Query  976   FTFLPVSLPALTPANA--SDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVT  1149
             F FL V +P + P+++  S PL+FV KAH  IK KR+S  V LTG LL+   K R  +V 
Sbjct  281   FAFLHVPIPKVKPSDSEFSIPLKFVHKAHEAIKGKRSSFGVVLTGKLLKMTKKCRNPKVC  340

Query  1150  ARY  1158
              R+
Sbjct  341   TRH  343



>gb|ADE76190.1| unknown [Picea sitchensis]
Length=504

 Score =   283 bits (723),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 166/496 (33%), Positives = 261/496 (53%), Gaps = 34/496 (7%)
 Frame = +1

Query  4     EMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFS  183
             EM   G  +  +P +Q ++SS+LSL +  V E E  I    S    ++ D  +P NP  S
Sbjct  15    EMEGQGQGQPVNPISQAMSSSLLSLCVNVVFEFEEAI-TDISRCTKVITDAALPRNPLLS  73

Query  184   SIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRP  363
              IM  + + G  +W++  VN   H  +  +P G+  + YD C+ +Y+SK+A      +RP
Sbjct  74    CIMKEDDL-GVLRWQKTTVNTKNHTFIVEFPIGQ--DSYDACVDEYISKLAHRPLDHSRP  130

Query  364   LWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTA  543
             LWE+H   Y T  A   ++F+ HH+LGDG S M  +    +R DNP LP TFP+ + S  
Sbjct  131   LWELHFLNYKTNKAKATMVFRFHHALGDGISFMSTLFCVARRVDNPDLPPTFPTAKTSIQ  190

Query  544   APRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKST-LVEDDRTPVRSGDDGVEFRP  720
             +  S  S  ++ FF+ +   +   + T+ D   S  + T  + D + P+R G  GV+  P
Sbjct  191   SSHS-GSTLLARFFQRLWYMMLVLWYTLVDVISSSLRMTGWIGDSQMPIR-GHPGVKNMP  248

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK-------------------  843
             +A ++ +F L+ IKQIK+ +  T+ND +TGII +G + Y++                   
Sbjct  249   VALSSATFLLEDIKQIKNSVGGTVNDAITGIIFHGIQRYLQIRLSADAEHSLRDAYEKRF  308

Query  844   QCEEES-----SKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPAL  1008
             +  EE+        R TAL L N R + G  +++ EM KP AE PWGN F   PV +P L
Sbjct  309   EMPEEAVIKQMKNLRLTALCLINMRGLAG-VQNIDEMFKPKAEAPWGNHFGIFPVRVPIL  367

Query  1009  TPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSM  1188
                    PL FVR+A   + R + S   ++   ++  L   +G +  +RY++ T  NS++
Sbjct  368   --GMLESPLEFVRRAKSKMDRHKISLGAFVDAKIMTYLGWLKGPQAVSRYLYSTIANSTI  425

Query  1189  GISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKF  1368
              ISNMIGPME +++  +P K   F ++G PQSL + +VSY G + + +  +K ++DA   
Sbjct  426   AISNMIGPMEMVAIDGNPIKSFSFFVSGAPQSLDLFIVSYTGVVVLQVYAQKAYVDANML  485

Query  1369  KCCVHHAFEGIYEAAL  1416
               C   A E I +A L
Sbjct  486   SKCFMEACEEIKKATL  501



>gb|EYU28203.1| hypothetical protein MIMGU_mgv1a013012mg [Erythranthe guttata]
Length=233

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 168/235 (71%), Gaps = 15/235 (6%)
 Frame = +1

Query  10   MEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSI  189
            ME+   E  SP+ Q+  SSV+S++I+ +LE E PI  S   + +LLK VF+PINPRFSS+
Sbjct  1    MENEILEPVSPTGQYFTSSVMSVSIIAILELEFPIDQSR--LDTLLKTVFLPINPRFSSL  58

Query  190  MVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLW  369
            MV +  NG K WK+VEV+  EH+K+PN+P GK  EFY+DCLS YLSK+++E FP N+ LW
Sbjct  59   MVKDK-NGKKHWKKVEVDIQEHIKIPNFPHGKSPEFYEDCLSGYLSKISLEQFPENKALW  117

Query  370  EIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAP  549
            E H+  YPT NAA N++FKLHHSLGDGYSLMGA+LSCLQRADNP LPLTFP   +     
Sbjct  118  EFHIINYPTKNAAQNLVFKLHHSLGDGYSLMGALLSCLQRADNPQLPLTFPLLNQKIQTN  177

Query  550  RSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEF  714
             +K +             L  AF++V DFGWSV KS ++EDD+TP+RSGDDGV+ 
Sbjct  178  DNKNN------------ILSMAFDSVCDFGWSVLKSIVLEDDKTPIRSGDDGVQL  220



>ref|XP_004136847.1| PREDICTED: O-acyltransferase WSD1-like [Cucumis sativus]
Length=265

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/261 (52%), Positives = 183/261 (70%), Gaps = 14/261 (5%)
 Frame = +1

Query  34   ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
             SP+AQ  NSS LS++++ VLE EIPI   D + I       +P+NP FSSIMV + ING
Sbjct  16   VSPTAQCFNSSALSISVIAVLEFEIPI---DEVQIMCYAKDLIPLNPLFSSIMVDD-ING  71

Query  214  GKKWKRVEVNHSEHVKVPNYPAGKPIE---FYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
             +KWK+VEVN  EH+ VP +P+   +     YD   + Y++ +  +    N+PLWEIH+ 
Sbjct  72   ERKWKKVEVNLEEHILVPTFPSNLSVVDDINYDAYFNKYITNLGAQELAKNKPLWEIHII  131

Query  385  KYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
            KYPT+NAA N+I K HHSLGDGYS+MG ++S ++RADNP+LPLTFPSR+ ++    +K  
Sbjct  132  KYPTSNAAANLILKFHHSLGDGYSVMGLLISSMKRADNPSLPLTFPSRKINSDDHNNKNL  191

Query  565  NKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSF  744
              +  +   +P F+    N+V DFGWS+ KS+++EDD TP+RSG DGVEFRP+A  T+SF
Sbjct  192  RHVLNY---VPSFM----NSVLDFGWSIIKSSVLEDDLTPIRSGGDGVEFRPVAICTISF  244

Query  745  SLDQIKQIKDKLKVTINDVVT  807
            SL QIKQIK KL+VTINDV+T
Sbjct  245  SLHQIKQIKSKLRVTINDVIT  265



>ref|XP_008345468.1| PREDICTED: O-acyltransferase WSD1-like [Malus domestica]
Length=253

 Score =   269 bits (688),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 136/262 (52%), Positives = 184/262 (70%), Gaps = 16/262 (6%)
 Frame = +1

Query  1    VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
            +E+ E G E   SP+  + N+SVLS++IL VLE EIPI   DS  +SLL++VF+PINPRF
Sbjct  1    MEIWEEGLE-PVSPTGHYFNNSVLSISILAVLEYEIPID--DSQFLSLLENVFLPINPRF  57

Query  181  SSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNR  360
            SSIM+ +  NG K+WKRVEV   +HVK P +P+    E YD+   DYLS +A + FP ++
Sbjct  58   SSIMIEK--NGKKQWKRVEVKLEDHVKTPIFPSNLSNESYDEYFXDYLSNVATKRFPQDK  115

Query  361  PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRST  540
            PLWEIH+ KYP  NAA NV+FKLHH+LGDGYSLMGA+LSCLQRADNP+LPLTFPSR+ S 
Sbjct  116  PLWEIHVIKYPNXNAAXNVVFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPSRKPS-  174

Query  541  AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
               + K  N ++  F ++        NT+ D  W + KS   EDD +P++S ++ +EF P
Sbjct  175  ---KPKNENVMTKTFSSL-------LNTISDIWWGISKSITGEDDLSPIKSSNNELEFTP  224

Query  721  IATTTMSFSLDQIKQIKDKLKV  786
            I  +T++ SLD I+ IK++L+V
Sbjct  225  IIVSTVTISLDHIRLIKNRLEV  246



>ref|XP_008368651.1| PREDICTED: uncharacterized protein LOC103432247 isoform X2 [Malus 
domestica]
Length=351

 Score =   267 bits (683),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 181/261 (69%), Gaps = 17/261 (7%)
 Frame = +1

Query  10   MEHGYE--EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFS  183
            ME G E  +  SP+  + NSSVLS++ILGVLE EIPI   DS  +SLL++VF+PIN RFS
Sbjct  1    MEIGGEGLDPVSPTGHYFNSSVLSISILGVLEFEIPID--DSQTLSLLENVFLPINSRFS  58

Query  184  SIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRP  363
            SI +    NG K+WK+VEV   +HVK P +P+    E YD    DY+S +A   FP ++P
Sbjct  59   SIXIEN--NGKKQWKKVEVKLEDHVKSPIFPSNLSNESYDKYFDDYISNIATTRFPEDKP  116

Query  364  LWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTA  543
            LWEIH+ KYP +NAAGNVIFKLHH+LGDGYSLMGA++SCL+RADNP+LPLTFPSR  S  
Sbjct  117  LWEIHVIKYPNSNAAGNVIFKLHHALGDGYSLMGALISCLRRADNPSLPLTFPSRLPS--  174

Query  544  APRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPI  723
              + K+ N ++  F  +        NT+ D  W + KS + EDDR+P++S ++G+EF PI
Sbjct  175  --KPKSENVMTTTFSCL-------LNTISDSWWGISKSIMGEDDRSPIKSXNNGLEFAPI  225

Query  724  ATTTMSFSLDQIKQIKDKLKV  786
              +TM+ SLD I+ IK +L V
Sbjct  226  TVSTMTISLDLIRLIKSRLGV  246


 Score =   109 bits (272),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +1

Query  1111  LQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLC  1290
             L  L+K+R     +RYI  T KNSSM I+NMIGP+E+MSLANHP KG+YF++ G PQ L 
Sbjct  236   LIRLIKSRLGVAASRYIRSTIKNSSMVITNMIGPLEQMSLANHPIKGLYFLVVGTPQDLD  295

Query  1291  VTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             +++ SY+G +++A +++K  ID +K K C+ +A + I+ A+
Sbjct  296   ISIXSYMGKVKLAFTMKKGIIDPQKLKLCMENALDMIFNAS  336



>gb|KEH30694.1| DNA repair and recombination RAD26-like protein, putative [Medicago 
truncatula]
Length=834

 Score =   276 bits (706),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/254 (52%), Positives = 180/254 (71%), Gaps = 9/254 (4%)
 Frame = +1

Query  28   EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
            E  SPS Q+ N+  L   + G LE EIPI   DS  + L++ +F+PINPRFSSI+V +  
Sbjct  9    EPVSPSGQYFNTPPLCSYVFGFLELEIPI--DDSQAMYLIQHLFLPINPRFSSIIVRDK-  65

Query  208  NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
            +G  KWK+VEVN  +H KVP +P  + IEFYD    DY+SK+ +E  P ++PLWEIH+ K
Sbjct  66   DGNMKWKKVEVNPKDHFKVPVFPKNESIEFYDQDFDDYVSKILIERTPKDKPLWEIHVIK  125

Query  388  YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
            YPT+NAA  +IFKLHH+LGDGYSLMGA+LSCL RAD+P+LPL+FP+R+ S      +   
Sbjct  126  YPTSNAAYTIIFKLHHALGDGYSLMGALLSCLHRADDPSLPLSFPNRKSSQLLTPKR---  182

Query  568  KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
               GFFK  P  +F  FN++ DFGWS+ KS+++EDD++P+ +G++G EF P A + +SFS
Sbjct  183  ---GFFKWFPSTIFSLFNSISDFGWSILKSSIIEDDKSPIWNGEEGSEFLPCALSNLSFS  239

Query  748  LDQIKQIKDKLKVT  789
            LD+I  IK KL V+
Sbjct  240  LDEIITIKSKLGVS  253



>gb|KGN43651.1| hypothetical protein Csa_7G051310 [Cucumis sativus]
Length=265

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 177/255 (69%), Gaps = 14/255 (5%)
 Frame = +1

Query  34   ASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGING  213
             SP+AQ  NSS LS++++ VLE EIPI   D + I       +P+NP FSSIMV + ING
Sbjct  16   VSPTAQCFNSSALSISVIAVLEFEIPI---DEVQIMCYAKDLIPLNPLFSSIMVDD-ING  71

Query  214  GKKWKRVEVNHSEHVKVPNYPAGKPIE---FYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
             +KWK+VEVN  EH+ VP +P+   +     YD   + Y++ +  +    N+PLWEIH+ 
Sbjct  72   ERKWKKVEVNLEEHILVPTFPSNLSVVDDINYDAYFNKYITNLGAQELAKNKPLWEIHII  131

Query  385  KYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
            KYPT+NAA N+I K HHSLGDGYS+MG ++S ++RADNP+LPLTFPSR+ ++    +K  
Sbjct  132  KYPTSNAAANLILKFHHSLGDGYSVMGLLISSMKRADNPSLPLTFPSRKINSDDHNNKNL  191

Query  565  NKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSF  744
              +  +   +P F+    N+V DFGWS+ KS+++EDD TP+RSG DGVEFRP+A  T+SF
Sbjct  192  RHVLNY---VPSFM----NSVLDFGWSIIKSSVLEDDLTPIRSGGDGVEFRPVAICTISF  244

Query  745  SLDQIKQIKDKLKVT  789
            SL QIKQIK KL+V+
Sbjct  245  SLHQIKQIKSKLRVS  259



>gb|KDO38197.1| hypothetical protein CISIN_1g044955mg [Citrus sinensis]
Length=244

 Score =   258 bits (660),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 163/226 (72%), Gaps = 1/226 (0%)
 Frame = +1

Query  736   MSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGG  915
             M+F L QIKQIKD L  T+NDV+TG I  G RLYM+   +ES+    TA+VL NTR    
Sbjct  1     MTFPLHQIKQIKDNLGATLNDVITGTIFLGIRLYMQAVNQESTNLHSTAVVLLNTRMFKS  60

Query  916   GYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVY  1095
                S+ EM+KP+++ PWGN F FL +S+P LT A   +PL+F++KA  II+ KR+S   Y
Sbjct  61    -ISSIKEMVKPDSKAPWGNHFAFLHISVPQLTNAEVQNPLKFIQKAQEIIQSKRSSFGAY  119

Query  1096  LTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGI  1275
             LT  LL+ + K RG E  A++IHG+  NSS+ I+NM+GP+E+M+LANHP KG+YF++AG 
Sbjct  120   LTAKLLETVKKLRGHETAAKFIHGSLNNSSLAITNMMGPVEKMALANHPIKGLYFMVAGS  179

Query  1276  PQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             PQSL VT+V+Y+G+LR++L  E+ FID+ K K C+ +AFE I +AA
Sbjct  180   PQSLVVTIVTYMGNLRVSLGAEEGFIDSPKLKSCIENAFEMILDAA  225



>gb|KCW57201.1| hypothetical protein EUGRSUZ_H00016 [Eucalyptus grandis]
Length=272

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/274 (50%), Positives = 187/274 (68%), Gaps = 19/274 (7%)
 Frame = +1

Query  28   EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
            E  SP+ Q+ NS V+S+++LG+LESEIPI   DS   +L+KDVF+PINPRFSSIMV  G 
Sbjct  11   EPVSPTGQYFNSKVMSVSVLGILESEIPID--DSQATALIKDVFLPINPRFSSIMVI-GK  67

Query  208  NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFY---DDCLSDYLSKMAMEAFPPNRPLWEIH  378
             G +KWK+VEV    HV VP++ + K        D  L  Y+S++A + FP  +PLWE+H
Sbjct  68   KGARKWKKVEVEVENHVHVPSFSSPKGSSSPSENDSFLKSYISQIAKQPFPQGQPLWEVH  127

Query  379  LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
            + K PT+ A G VIFKLHH+LGDGYSL+GA+LSCLQRAD+P+LP+TFPS  + ++A    
Sbjct  128  IIKCPTSEAQGTVIFKLHHALGDGYSLVGALLSCLQRADDPSLPVTFPSVNKFSSANNDD  187

Query  559  ASNKISGFFKAMPRFLFGAF----NTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIA  726
             +         +P+ + G F    NTV DFG SV KST  +DD +P+R G +   FRP +
Sbjct  188  RN-------IGLPKVVSGCFLPLVNTVRDFGGSVLKSTCFKDDLSPIRCGLES--FRPFS  238

Query  727  TTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGT  828
             + +SFSLD+IK+IK +L+VTINDV+ G+I   T
Sbjct  239  LSAISFSLDRIKEIKSRLRVTINDVIMGVIFLAT  272



>gb|AES89677.2| DNA repair and recombination RAD26-like protein, putative [Medicago 
truncatula]
Length=1158

 Score =   277 bits (708),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/254 (52%), Positives = 180/254 (71%), Gaps = 9/254 (4%)
 Frame = +1

Query  28   EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
            E  SPS Q+ N+  L   + G LE EIPI   DS  + L++ +F+PINPRFSSI+V +  
Sbjct  9    EPVSPSGQYFNTPPLCSYVFGFLELEIPI--DDSQAMYLIQHLFLPINPRFSSIIVRDK-  65

Query  208  NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
            +G  KWK+VEVN  +H KVP +P  + IEFYD    DY+SK+ +E  P ++PLWEIH+ K
Sbjct  66   DGNMKWKKVEVNPKDHFKVPVFPKNESIEFYDQDFDDYVSKILIERTPKDKPLWEIHVIK  125

Query  388  YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
            YPT+NAA  +IFKLHH+LGDGYSLMGA+LSCL RAD+P+LPL+FP+R+ S      +   
Sbjct  126  YPTSNAAYTIIFKLHHALGDGYSLMGALLSCLHRADDPSLPLSFPNRKSSQLLTPKR---  182

Query  568  KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
               GFFK  P  +F  FN++ DFGWS+ KS+++EDD++P+ +G++G EF P A + +SFS
Sbjct  183  ---GFFKWFPSTIFSLFNSISDFGWSILKSSIIEDDKSPIWNGEEGSEFLPCALSNLSFS  239

Query  748  LDQIKQIKDKLKVT  789
            LD+I  IK KL V+
Sbjct  240  LDEIITIKSKLGVS  253



>ref|XP_003607480.1| Chromodomain-helicase-DNA-binding protein [Medicago truncatula]
Length=1283

 Score =   277 bits (709),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 184/266 (69%), Gaps = 9/266 (3%)
 Frame = +1

Query  28   EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
            E  SPS Q+ N+  L   + G LE EIPI   DS  + L++ +F+PINPRFSSI+V +  
Sbjct  9    EPVSPSGQYFNTPPLCSYVFGFLELEIPI--DDSQAMYLIQHLFLPINPRFSSIIVRDK-  65

Query  208  NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
            +G  KWK+VEVN  +H KVP +P  + IEFYD    DY+SK+ +E  P ++PLWEIH+ K
Sbjct  66   DGNMKWKKVEVNPKDHFKVPVFPKNESIEFYDQDFDDYVSKILIERTPKDKPLWEIHVIK  125

Query  388  YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
            YPT+NAA  +IFKLHH+LGDGYSLMGA+LSCL RAD+P+LPL+FP+R+ S      +   
Sbjct  126  YPTSNAAYTIIFKLHHALGDGYSLMGALLSCLHRADDPSLPLSFPNRKSSQLLTPKR---  182

Query  568  KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
               GFFK  P  +F  FN++ DFGWS+ KS+++EDD++P+ +G++G EF P A + +SFS
Sbjct  183  ---GFFKWFPSTIFSLFNSISDFGWSILKSSIIEDDKSPIWNGEEGSEFLPCALSNLSFS  239

Query  748  LDQIKQIKDKLKVTINDVVTGIIIYG  825
            LD+I  IK KL V  +  V  + + G
Sbjct  240  LDEIITIKSKLGVVTHLNVEKLGVRG  265



>ref|XP_011012031.1| PREDICTED: O-acyltransferase WSD1-like, partial [Populus euphratica]
Length=281

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/274 (50%), Positives = 168/274 (61%), Gaps = 34/274 (12%)
 Frame = +1

Query  28   EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFS--------  183
            E  SP+ Q+ NSS L++++LGV E+E+PI   DS  IS L DVF+PINPRFS        
Sbjct  11   EPVSPTGQYCNSSALNVSVLGVFETEVPID--DSKTISFLTDVFLPINPRFSPSQYYMSA  68

Query  184  ------------------SIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDC  309
                               I V +  NG K+WK+VEV   +HV VP +PA    +FYD  
Sbjct  69   SKSKLFIMLPGSPHLCQVKIQVIDE-NGEKRWKKVEVKLKDHVYVPIFPAEMSPQFYDKY  127

Query  310  LSDYLSKMAMEAFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQR  489
            + DY SK+ +   P ++PLWEIH  KYPT+N AG VIFK+HHS+GDGYSLMGA+LSCLQR
Sbjct  128  VEDYFSKLLLSQLPQSQPLWEIHFIKYPTSNEAGTVIFKIHHSIGDGYSLMGALLSCLQR  187

Query  490  ADNPALPLTFPSRQRSTAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVE  669
            ADNP+LPLT PS       PR   S      FK +P+ L   F  V  F  S+ KS+LVE
Sbjct  188  ADNPSLPLTLPS-----VEPRVDTSGDHDTIFKTVPKILSLMFYIVSGFSRSLIKSSLVE  242

Query  670  DDRTPVRSGDDGVEFRPIATTTMSFSLDQIKQIK  771
            DD +P+RSGD  +EF PI  T M FS  QIKQIK
Sbjct  243  DDLSPIRSGDIRIEFHPITLTLMIFSRGQIKQIK  276



>ref|XP_002517895.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44413.1| conserved hypothetical protein [Ricinus communis]
Length=316

 Score =   253 bits (647),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 134/256 (52%), Positives = 172/256 (67%), Gaps = 14/256 (5%)
 Frame = +1

Query  28   EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
            E  SP  Q+L+SS++SLTI+ VLE E+PI   DS  +SLL+DVF+PINPRFSSIM    +
Sbjct  17   EPVSPMGQYLSSSIVSLTIVAVLELEVPID--DSQAMSLLEDVFLPINPRFSSIMNECNL  74

Query  208  NGGKKWKR------VEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLW  369
              G + +R      VEV    HVKVP +P G      DD L DYLSK+ ME  P ++PLW
Sbjct  75   ASGYEQQRRKALEEVEVKLENHVKVPFFPTGMSSNSNDDYLDDYLSKIPMEELPKHQPLW  134

Query  370  EIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAP  549
            E+H+ KY TT AA NVIFKLHHSLGDG++LMGA+LSCLQRADNP++PL+FPS Q  T   
Sbjct  135  EVHIVKYQTTIAACNVIFKLHHSLGDGFTLMGALLSCLQRADNPSIPLSFPSAQLHTQT-  193

Query  550  RSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
            +   +N I      + + L    N + DF     +S L++DD++P++SG  GVEF P++ 
Sbjct  194  QGNTNNNIGR--NIVTKILSSVCNILSDF---CLRSGLIKDDKSPIKSGHPGVEFLPVSI  248

Query  730  TTMSFSLDQIKQIKDK  777
             TMSFSLD IKQIK K
Sbjct  249  VTMSFSLDYIKQIKTK  264



>ref|XP_006593082.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=259

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/254 (50%), Positives = 163/254 (64%), Gaps = 14/254 (6%)
 Frame = +1

Query  25   EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
            +E  SP   + NSSV+   + G LE  +PI   DS  I LL+DVF+PINPRFSSIMV + 
Sbjct  9    QEPVSPHGHYFNSSVICSYVFGFLEMAVPID--DSQTIPLLEDVFLPINPRFSSIMVRDQ  66

Query  205  INGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
              G  +WKRV+VN  EHVKVP +P     E Y+    DY++++  E  P N+PLWEIHL 
Sbjct  67   A-GKMRWKRVQVNPEEHVKVPRFPECNSAELYEQYFDDYVTRILNERTPQNKPLWEIHLI  125

Query  385  KYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
            KYPT++AAG +IFK HHSLGDGYSLMGA+LSCLQR D+P+LPLTFPS  +       K  
Sbjct  126  KYPTSSAAGTIIFKFHHSLGDGYSLMGALLSCLQRTDDPSLPLTFPSNSQHAKKNMFKLH  185

Query  565  NKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSF  744
            + IS  F +M            DFG S+ K+ ++EDD+TP+RSG +G + +    + +S 
Sbjct  186  SVISSLFSSM-----------LDFGSSIIKTRMIEDDKTPIRSGYEGTKPKYFTLSNISL  234

Query  745  SLDQIKQIKDKLKV  786
            SLD IK IK  L V
Sbjct  235  SLDHIKAIKSNLGV  248



>gb|KHN35224.1| O-acyltransferase WSD1 [Glycine soja]
Length=360

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 163/255 (64%), Gaps = 14/255 (5%)
 Frame = +1

Query  25   EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
            +E  SP   + NSSV+   + G LE  +PI   DS  I LL+DVF+PINPRFSSIMV + 
Sbjct  9    QEPVSPHGHYFNSSVICSYVFGFLEMAVPID--DSQTIPLLEDVFLPINPRFSSIMVRDQ  66

Query  205  INGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
              G  +WKRV+VN  EHVKVP +P     E Y+    DY++++  E  P N+PLWEIHL 
Sbjct  67   A-GKMRWKRVQVNPEEHVKVPRFPECNSAELYEQYFDDYVTRILNERTPQNKPLWEIHLI  125

Query  385  KYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
            KYPT++AAG +IFK HHSLGDGYSLMGA+LSCLQR D+P+LPLTFPS  +       K  
Sbjct  126  KYPTSSAAGTIIFKFHHSLGDGYSLMGALLSCLQRTDDPSLPLTFPSNSQHAKKNMFKLH  185

Query  565  NKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSF  744
            + IS  F +M            DFG S+ K+ ++EDD+TP+RSG +G + +    + +S 
Sbjct  186  SVISSLFSSM-----------LDFGSSIIKTRMIEDDKTPIRSGYEGTKPKYFTLSNISL  234

Query  745  SLDQIKQIKDKLKVT  789
            SLD IK IK  L V 
Sbjct  235  SLDHIKAIKSNLGVV  249


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 66/98 (67%), Gaps = 0/98 (0%)
 Frame = +1

Query  1123  MKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMV  1302
             +K+    V ++  + T  N S+ ISNM GPME+M+LANHP  G+YF ++G PQ++ V ++
Sbjct  242   IKSNLGVVASKTFYNTLGNCSVLISNMFGPMEQMALANHPVSGVYFAMSGGPQNVNVEIM  301

Query  1303  SYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             SYVG LRI     K FID +KFK C+  AF+ I++ A+
Sbjct  302   SYVGELRITSKTLKGFIDEQKFKFCIEKAFDEIFKDAM  339



>emb|CDP21807.1| unnamed protein product, partial [Coffea canephora]
Length=242

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 155/212 (73%), Gaps = 1/212 (0%)
 Frame = +1

Query  787   TINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPW  966
             +INDV+ G+I  G RLYM+   +E + A  TALVL NTR I G YKS+ EM++PN E  W
Sbjct  21    SINDVICGVIFLGARLYMQAMNQEKTNASSTALVLLNTRNIAG-YKSIEEMVEPNTESTW  79

Query  967   GNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEV  1146
             GNQF FL VS+P  T  ++S+PL FV KA + IK KR+SA+VYLTG LL+ L + RG E 
Sbjct  80    GNQFGFLHVSVPRFTKKDSSNPLNFVFKAQKTIKSKRDSAAVYLTGQLLETLRRHRGPEG  139

Query  1147  TARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRI  1326
             TA+Y+ GT KNSSM ISN+ GP+++++LANHPAKG+YF++ G+PQSL +TM+SY+  LR+
Sbjct  140   TAKYVRGTLKNSSMTISNISGPVDQLALANHPAKGMYFMVVGVPQSLTITMISYMRELRV  199

Query  1327  ALSVEKDFIDAEKFKCCVHHAFEGIYEAALGS  1422
             A+  EK  I  +KF+ C+  AF  +++AA  S
Sbjct  200   AVGTEKGLIHPQKFQSCIEDAFNIMFKAAAES  231



>ref|XP_003607473.1| O-acyltransferase WSD1, partial [Medicago truncatula]
Length=251

 Score =   240 bits (613),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 127/251 (51%), Positives = 171/251 (68%), Gaps = 11/251 (4%)
 Frame = +1

Query  25   EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
            +E  SP  Q+ NSSV+   + G LE  IPI   DS  + LLKDVF+PINPRFSSIMV + 
Sbjct  9    QEPVSPHGQYFNSSVICSYVFGFLELAIPI--DDSQTMPLLKDVFLPINPRFSSIMVRDK  66

Query  205  INGGKKWKRVEVNHSEHVKVPNYP--AGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIH  378
             +G  +W+RVEV   EH+K+P +P         YD+ LSDY++ +     P ++PLWEIH
Sbjct  67   -DGKMRWQRVEVKLEEHIKIPKFPETTNSSSILYDNYLSDYVTSILTSRTPQDKPLWEIH  125

Query  379  LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
            L KYPT+NA G +IFKLHH+LGDGYSLMGA+LSCLQRAD+P+LPL+FPSR      P+  
Sbjct  126  LIKYPTSNAKGTLIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSR------PQLN  179

Query  559  ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
            +     G FK +   +   F+++ DFG S+ K+ ++EDD+TP+RSG +G E +P   + +
Sbjct  180  SKYAKKGLFKKLCLDISSFFSSISDFGSSLIKTRMIEDDKTPIRSGYEGTESQPFTLSNI  239

Query  739  SFSLDQIKQIK  771
            S SLDQIK+IK
Sbjct  240  SLSLDQIKEIK  250



>gb|KDO38023.1| hypothetical protein CISIN_1g047091mg [Citrus sinensis]
Length=229

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 150/209 (72%), Gaps = 1/209 (0%)
 Frame = +1

Query  787   TINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPW  966
             T+NDV+TG I  GTRLYM+   +ES+    TA+VL NTR +     SV EM+KP+++ PW
Sbjct  3     TLNDVITGTIFLGTRLYMQAVNQESTNLHSTAVVLLNTRMLKS-ISSVKEMVKPDSKAPW  61

Query  967   GNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEV  1146
             GN F FL VS+P LT A   +PL+F+RKA  II+ KR+S   YLT  LL+ + K RG E 
Sbjct  62    GNHFAFLHVSVPQLTNAEIQNPLKFIRKAQEIIQSKRSSFGAYLTAKLLETVKKFRGHET  121

Query  1147  TARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRI  1326
              A++IHG+  NSS+ I+NM+GP+E+M+LANH  KG+YF++ G PQSL VT+VSY+G+LR+
Sbjct  122   AAKFIHGSLNNSSIAITNMMGPVEKMTLANHAIKGLYFMVVGSPQSLVVTIVSYMGNLRV  181

Query  1327  ALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             +L  E+ FID+ K K C+ +AFE +  AA
Sbjct  182   SLGAEEGFIDSPKLKSCIENAFEMMLNAA  210



>ref|XP_008362450.1| PREDICTED: O-acyltransferase WSD1-like [Malus domestica]
Length=238

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 159/226 (70%), Gaps = 3/226 (1%)
 Frame = +1

Query  736   MSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGG  915
             M+ SLD I+ IK +L VTINDV+TG++  G RLYM++  + S +A  T+LVL NTR I  
Sbjct  1     MTISLDLIRLIKSRLGVTINDVLTGVVFLGARLYMQEMNKSSREAHSTSLVLLNTR-IMA  59

Query  916   GYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVY  1095
              Y S+ EMIKP+++ PWGN+FTFL V +P LT    S+ L FV KA +II +KRNS ++Y
Sbjct  60    NYTSIEEMIKPDSKSPWGNRFTFLQVPIPKLTEF--SNVLDFVWKAQKIINQKRNSFTIY  117

Query  1096  LTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGI  1275
                 LL+ L K  G E  +RYI  T KNSSM I+NMIGP+E+MSLANHP KG+YF++ G 
Sbjct  118   FISXLLEMLNKFGGHEAASRYIRSTIKNSSMVITNMIGPLEQMSLANHPIKGLYFLVVGT  177

Query  1276  PQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             PQ L +++ SY+G +++A +++K  ID +K K C+ +A + I+ A+
Sbjct  178   PQDLDISIXSYMGKVKLAFTMKKGIIDPQKLKLCMENALDMIFNAS  223



>ref|XP_007198862.1| hypothetical protein PRUPE_ppa018325mg, partial [Prunus persica]
 gb|EMJ00061.1| hypothetical protein PRUPE_ppa018325mg, partial [Prunus persica]
Length=238

 Score =   227 bits (579),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 133/280 (48%), Positives = 172/280 (61%), Gaps = 48/280 (17%)
 Frame = +1

Query  10   MEHGYE--EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFS  183
            ME+G    E  S + Q LNSSVLS++IL VLE EIPI  S +L  S L+DVF  I+PRFS
Sbjct  1    MEYGVHGNEPVSSTGQCLNSSVLSMSILCVLEFEIPINESKNL--SFLQDVFPHISPRFS  58

Query  184  SIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRP  363
            SIMV   +NG K+ KRVEV   +HV VP +P+G   + YDD   DY+S + +E +P ++P
Sbjct  59   SIMVD--VNGEKQCKRVEVKLRDHVHVPIFPSGLSPKSYDDHFHDYISNIILEQYPKDKP  116

Query  364  LWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTA  543
            LWE+H+ KYPT++AAGN+IFKLHH+LGDGYS M A+LSCLQRADNP LPLT         
Sbjct  117  LWEVHIIKYPTSSAAGNLIFKLHHALGDGYSFMSALLSCLQRADNP-LPLT---------  166

Query  544  APRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPI  723
                      S F    P    G +N+++            +DD TP+RSG+ GVEF P+
Sbjct  167  ----------SSF---TPGIATGCWNSLF------------QDDLTPIRSGNYGVEFLPM  201

Query  724  ATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK  843
              ++++FSLD+IK IK KL         GII      Y K
Sbjct  202  TASSITFSLDEIKLIKTKLN-------AGIIFTNIHCYKK  234



>ref|XP_003607477.1| O-acyltransferase WSD1 [Medicago truncatula]
Length=481

 Score =   228 bits (581),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 134/325 (41%), Positives = 196/325 (60%), Gaps = 25/325 (8%)
 Frame = +1

Query  25   EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
            +E  SP  Q+ NSSV+   + G LE  IP    +SL I LLKDVF+PINPRFSSIMV + 
Sbjct  9    QEPVSPHGQYFNSSVMCSYVFGFLELAIPFD--NSLAIPLLKDVFIPINPRFSSIMVKD-  65

Query  205  INGGKKWKRVEVNHSEHVKVPNYPA---GKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
            + G  +W++VEV   EH+K+P +P        E YD  +S+Y++ +     P N+PLWEI
Sbjct  66   VEGKMRWQKVEVKPEEHLKIPIFPETINSSSCELYDKYVSNYVTSILNGRTPQNKPLWEI  125

Query  376  HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRS  555
            H+  YPTTNAA  +IFKL+H+LGDGYSLM A+LSCLQRAD+P+LPL+FPS++    +  +
Sbjct  126  HIINYPTTNAACTIIFKLNHALGDGYSLMSALLSCLQRADDPSLPLSFPSQRPQLNSKYA  185

Query  556  KASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTT  735
            K +      F+ +   +   F+++ DFG S+ K+ +++DD+TP+RSG +G E +P   + 
Sbjct  186  KIN-----LFEKLCFVISSFFSSISDFGSSILKTRMIKDDKTPIRSGYEGAESQPFILSN  240

Query  736  MSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALV-LFNTRAIG  912
            ++ SLDQIK +K KL V  N            L + +C   ++K R   L   F   ++ 
Sbjct  241  ITLSLDQIKGVKTKLGVLSNQ---------NFLSISECHYLTTKDRWVWLPDPFVGYSVR  291

Query  913  GGYKSVTE----MIKPNAEMPWGNQ  975
            G Y  +T     +  P + + W NQ
Sbjct  292  GSYHMLTSRDVPLRDPASSLIWHNQ  316



>gb|EPS63572.1| hypothetical protein M569_11213 [Genlisea aurea]
Length=198

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 132/177 (75%), Gaps = 4/177 (2%)
 Frame = +1

Query  31   AASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGIN  210
            A SPS ++L SS L LTILGVLE + PI  S +L+  L+  VF+PINPRFSSIMV++   
Sbjct  15   AVSPSGEYLKSSKLDLTILGVLEFQNPIDDSPTLL--LIDRVFLPINPRFSSIMVADE-T  71

Query  211  GGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKY  390
            G KKWKRV VN  +HVKVP +PA    E+YD C  +YL+ +A E  P +RPLWEIH+ KY
Sbjct  72   GAKKWKRVRVNLQDHVKVPVFPADMRAEYYDGCFREYLTSIAAEPLPQDRPLWEIHVVKY  131

Query  391  PTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKA  561
            PT  AAGN++FK+HHSLGDGYSLMGA+LSCLQR D+P +PLTFPSR +STA     A
Sbjct  132  PTKVAAGNLVFKIHHSLGDGYSLMGALLSCLQRLDDPLMPLTFPSR-KSTAVTHDGA  187



>gb|KCW57200.1| hypothetical protein EUGRSUZ_H00015 [Eucalyptus grandis]
Length=284

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 172/277 (62%), Gaps = 17/277 (6%)
 Frame = +1

Query  28   EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
            E  SP  Q+ NS V+S++ILG+LESEIPI  S +   SL+KDVF+PINPRFSSIMV    
Sbjct  11   EPVSPLGQYFNSKVMSVSILGILESEIPIDGSQAK--SLIKDVFLPINPRFSSIMVMGKK  68

Query  208  NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFY---DDCLSDYLSKMAMEAFPPNRPLWEIH  378
             G K  K        HV VP++ + K        D  L  Y++++AM+ F   +PLWEIH
Sbjct  69   GGKKWKKVEVKV-ENHVHVPSFSSPKGSSSSSENDSFLKSYIAEVAMQPFQLGQPLWEIH  127

Query  379  LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
            +   P + A G VIFKLHH+LGDGYSL+GA+LSCLQRAD+P+LP+TFPS    ++A  +K
Sbjct  128  IINCPASEAQGTVIFKLHHALGDGYSLVGALLSCLQRADDPSLPVTFPSVNNFSSA--NK  185

Query  559  ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
               KI    K + R      NT+ DFG SV KST VEDD +P+R   +   FRP + +T+
Sbjct  186  DDGKIV-LRKVVSRCFLPLVNTIRDFGRSVLKSTCVEDDLSPIRCRSES--FRPFSLSTI  242

Query  739  SFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQC  849
            +FSL  IK+IK +L+V  N      II  T L +  C
Sbjct  243  TFSLHHIKEIKSRLRVVTN------IILKTILSLASC  273



>ref|XP_010025798.1| PREDICTED: uncharacterized protein LOC104416056 [Eucalyptus grandis]
Length=366

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 149/219 (68%), Gaps = 4/219 (2%)
 Frame = +1

Query  772   DKLKVTINDVVTGIIIYGTRLYMKQCEEESS-KARCTALVLFNTRAIGGGYKSVTEMIKP  948
             +K   T+NDVVTGII   TRLYM++    S+     TALVL NTR +   YKSV EMI+P
Sbjct  147   EKRTWTVNDVVTGIIFLATRLYMQRVSPNSNGSTNSTALVLLNTRNLRD-YKSVGEMIQP  205

Query  949   NAEMPWGNQFTFLPVSLPALTPANA--SDPLRFVRKAHRIIKRKRNSASVYLTGWLLQAL  1122
             N++ PWGN F FL V +P + P N+  SDP +FVRK H +IKRKR+S  V LTG LL+ +
Sbjct  206   NSKSPWGNYFAFLHVPIPKVKPGNSQFSDPSKFVRKTHEVIKRKRSSFGVVLTGMLLEMM  265

Query  1123  MKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMV  1302
              K R  E  AR+I+ T+ NSSM ISN++GPME++SLANHP KG+YF I G P+SL VTM+
Sbjct  266   KKCRNPEAVARHIYRTTTNSSMVISNVMGPMEKLSLANHPIKGMYFTIVGTPESLQVTMI  325

Query  1303  SYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAALG  1419
             SY  +LR+ +  E+ FID+E +   +H A + I   A G
Sbjct  326   SYAENLRLVVRAEQGFIDSELYTRSLHDALDMILHDACG  364



>ref|XP_007203282.1| hypothetical protein PRUPE_ppa025603mg, partial [Prunus persica]
 gb|EMJ04481.1| hypothetical protein PRUPE_ppa025603mg, partial [Prunus persica]
Length=205

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 138/211 (65%), Gaps = 13/211 (6%)
 Frame = +1

Query  208  NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
            NG K+WKRVEV   +HV  P +P+G  +E YD    DY+SK+  E FP  +PLWEIH+  
Sbjct  4    NGKKQWKRVEVKLEDHVYTPPFPSGLSLESYDKYFDDYISKLLTERFPQGKPLWEIHIIN  63

Query  388  YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKASN  567
            YPT+NAA NVIFKLHH+LGDGYSLMGA++S +QRADNP+LPLT PSR+RS +   +  + 
Sbjct  64   YPTSNAAANVIFKLHHALGDGYSLMGALISSMQRADNPSLPLTLPSRKRSESKRENFVTK  123

Query  568  KISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFS  747
              SGF            NT+ D      K T+  D  TP+RSG+D +EFRP   +TM+FS
Sbjct  124  TFSGF-----------CNTISDLWLGTLK-TMNGDVVTPIRSGNDAIEFRPATVSTMTFS  171

Query  748  LDQIKQIKDKLKVTINDVVTGIIIYGTRLYM  840
            LDQIK IKDKL V  + V + +I Y   L +
Sbjct  172  LDQIKSIKDKLGV-WSRVNSALIFYCRSLRL  201



>gb|EPS67964.1| hypothetical protein M569_06810, partial [Genlisea aurea]
Length=207

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 146/213 (69%), Gaps = 9/213 (4%)
 Frame = +1

Query  787   TINDVVTGIIIYGTRLYMKQCEEESSKAR---CTALVLFNTRAIGGGYKSVTEMIKPNAE  957
             +INDVV G++  G RLYMK   ++  K R    TALVL NTR I G YKSV+EM+  +  
Sbjct  1     SINDVVCGVVFLGIRLYMKSKNQDVDKKRGTKSTALVLLNTRNING-YKSVSEMVDKDPA  59

Query  958   MPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRG  1137
               WGNQF FL VS+P  TP +  +PL +V KA ++++R RNSA+V LTG LL+ L K RG
Sbjct  60    ASWGNQFAFLHVSVP--TPPDPENPLSYVMKARKLVRRTRNSAAVILTGKLLERLRKLRG  117

Query  1138  SEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGS  1317
              EVTA+YIH T KN+S+ ISNM+GP E M+L +HP  G YF++ G   +L +T+VSY   
Sbjct  118   PEVTAKYIHSTLKNTSLTISNMVGPSEAMALNSHPVSGFYFMVVG---NLTITVVSYADH  174

Query  1318  LRIALSVEKDFIDAEKFKCCVHHAFEGIYEAAL  1416
             +R+A+  E   IDA KFK C+ +AF+ I+++AL
Sbjct  175   VRMAVGTENGLIDAPKFKACLQNAFDSIHKSAL  207



>ref|XP_010911763.1| PREDICTED: O-acyltransferase WSD1-like, partial [Elaeis guineensis]
Length=190

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 139/196 (71%), Gaps = 11/196 (6%)
 Frame = +1

Query  199  EGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIH  378
            E  +G ++WKRV+V   +HV VP +P G  +E YD  + DYLS++A+E  P ++PLW++H
Sbjct  2    EDEHGVQQWKRVKVKLEDHVNVPTFPPG--LESYDQFVQDYLSEIAVEKLPQSQPLWDLH  59

Query  379  LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
            + KYPT+ A G ++FKLHH+LGDG+SLMGA+ SCLQRAD+P+LPLTFP+        R K
Sbjct  60   IIKYPTSTAEGTMVFKLHHALGDGFSLMGALFSCLQRADDPSLPLTFPTS-------REK  112

Query  559  ASNK-ISGFFK-AMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATT  732
            A  K + G  +  +PRFL    NTV D GWS++KS L EDD TP+RSG   VEFRPI  +
Sbjct  113  AMKKSLWGSIRWKVPRFLSMCANTVQDVGWSLWKSNLAEDDVTPLRSGAPAVEFRPITIS  172

Query  733  TMSFSLDQIKQIKDKL  780
             + FSLD I++IKDK+
Sbjct  173  CIEFSLDDIRKIKDKV  188



>gb|KGN43654.1| hypothetical protein Csa_7G051340 [Cucumis sativus]
Length=283

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 130/319 (41%), Positives = 178/319 (56%), Gaps = 47/319 (15%)
 Frame = +1

Query  25   EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSI---MV  195
            ++  SP A++L+S +LSL+IL +LE ++PI   D  +   L+ +F+PINPRF      M 
Sbjct  7    QQPPSPIAEYLSSPMLSLSILAILEFQVPIHTLD--LTFNLRSLFLPINPRFPPYWLQMR  64

Query  196  SEGING-GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWE  372
             E  +G GK         S      NY     IE Y     +YL+K++ME F P++PLWE
Sbjct  65   KERRSGKGKHRSGRTCERSNLSTWFNY-----IESYKAYCDEYLTKISMEEFRPDKPLWE  119

Query  373  IHLFKYPTT-NAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAP  549
             HLFKYPT+   AG ++ K+HHSLGDGYSLMG +LSCL  A +    LTF S        
Sbjct  120  AHLFKYPTSPTVAGTMVLKVHHSLGDGYSLMGVVLSCLHTASD----LTFLSLFLPDVND  175

Query  550  RSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
             S+                            SV K     D++T +RSG +G++F P+ T
Sbjct  176  DSRT---------------------------SVLKGI---DEKTSIRSGREGLQFMPMNT  205

Query  730  TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKARCTALVLFNTRAI  909
             T+SFSL+ IK+IK KL VT+NDV+TGI   G RLYM++ E+ S +   TAL + NTR I
Sbjct  206  FTVSFSLNYIKKIKTKLDVTVNDVITGITFMGLRLYMEEMEKNSGEVAATALTIVNTRVI  265

Query  910  GGGYKSVTEMIKPNAEMPW  966
             G Y+  TEM KP ++  W
Sbjct  266  -GTYRPATEMAKPESKGLW  283



>ref|XP_006293222.1| hypothetical protein CARUB_v10019546mg [Capsella rubella]
 gb|EOA26120.1| hypothetical protein CARUB_v10019546mg [Capsella rubella]
Length=522

 Score =   206 bits (524),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 140/472 (30%), Positives = 236/472 (50%), Gaps = 28/472 (6%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             E   ++  SP+A+  ++   +  I+ V+  +  I     ++I   K  F+  +PRFSSIM
Sbjct  13    EKEDDQPLSPAARLFHAPEFNCNIVSVIGLKSKIDPD--VIIRGSKQTFIR-HPRFSSIM  69

Query  193   VSEGING-GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLW  369
             VSEG NG  ++W R  V   +HV +P     + IE  D  L DY+S +       +RPLW
Sbjct  70    VSEGDNGQNQRWVRTNVVVEDHVIIPEIKP-QNIENADAFLEDYVSDLMKIPLDTSRPLW  128

Query  370   EIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAP  549
             E+HL    T++A    + K+HHS+GDG S+M  +L+C+++  NP    + P ++RS++ P
Sbjct  129   ELHLLDLKTSDAENVAVLKIHHSVGDGMSIMSLVLACMRKTSNPDELPSLPYQKRSSSGP  188

Query  550   R-----SKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEF  714
                   S++ +++    K +   +    NTV D    +  +  V+D  TP++      + 
Sbjct  189   ALLPTGSRSDSRLLWLVKLLWTAVILGLNTVCDALEFLVTTLFVKDTDTPIKGDLRSKKS  248

Query  715   RPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYM-KQCEEESSKA-------  870
               +     + S D IK IK+ + +T+NDVV G+   G   Y+ ++  EE++K        
Sbjct  249   TQLRLVHRTVSFDDIKLIKNAMDMTVNDVVLGVTEAGLSRYLERRYGEENTKMKQKHLPK  308

Query  871   --RCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFL--PVSLPALTPANASDPLR  1038
               R  + +L N R    G + + +M+   ++  WGN F ++  P S+     A   DPL 
Sbjct  309   RIRLRSALLVNLRPT-TGIQDLADMMAKGSKCRWGNWFGYVVFPFSI-----ALRDDPLE  362

Query  1039  FVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPME  1218
              + +AH+ I RK+NS    LT    + ++K+ G++V A  I+    N++M  SNM+GP+E
Sbjct  363   HLERAHKTINRKKNSFGAMLTYIFCRIIVKSLGTKVAATIINRFVSNTTMTFSNMVGPVE  422

Query  1219  RMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKC  1374
              +S   HP         G P +L +   SY+  + I L V+   I      C
Sbjct  423   EVSFYGHPITYFASSAYGHPHALTIHCQSYMNKMTITLIVDPTVISDPHRLC  474



>gb|KCW57198.1| hypothetical protein EUGRSUZ_H00013 [Eucalyptus grandis]
Length=198

 Score =   196 bits (499),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 128/183 (70%), Gaps = 3/183 (2%)
 Frame = +1

Query  877   TALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANA--SDPLRFVRK  1050
             TALVL NTR +   YKSV EMI+PN++ PWGN F FL V +P + P N+  SDP +FVRK
Sbjct  15    TALVLLNTRNLRD-YKSVGEMIQPNSKSPWGNYFAFLHVPIPKVKPGNSQFSDPSKFVRK  73

Query  1051  AHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSL  1230
              H +IKRKR+S  V LTG LL+ + K R  E  AR+I+ T+ NSSM ISN++GPME++SL
Sbjct  74    THEVIKRKRSSFGVVLTGMLLEMMKKCRNPEAVARHIYRTTTNSSMVISNVMGPMEKLSL  133

Query  1231  ANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEA  1410
             ANHP KG+YF I G P+SL VTM+SY  +LR+ +  E+ FID+E +   +H A + I   
Sbjct  134   ANHPIKGMYFTIVGTPESLQVTMISYAENLRLVVRAEQGFIDSELYTRSLHDALDMILHD  193

Query  1411  ALG  1419
             A G
Sbjct  194   ACG  196



>emb|CBI23136.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   203 bits (516),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 136/465 (29%), Positives = 240/465 (52%), Gaps = 43/465 (9%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP+A+   +   +  I+ ++  +      +S VI    +  +  +PRFSS+MV++ 
Sbjct  14    EEPLSPAARLFQTRQFNCCIIAIIGCK---TVFNSHVIKAGLEHTLIKHPRFSSLMVADK  70

Query  205   INGGKKWKRVEVNHSEHVKVPNYP--AGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIH  378
             + G  +W R +VN  +H+ +PN     G P +F    +  Y+S M       ++PLW+IH
Sbjct  71    MGGEMRWIRTKVNVEDHIIIPNVDPNMGSPDQF----IESYISNMTKTYLDDSKPLWDIH  126

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQR-ADNPALPLTFPSRQRSTAAPRS  555
             L    T+ A    IF++HHS+GDG S+M  +L+C ++ +D  ALP T P+++      R 
Sbjct  127   LLNVKTSEAESTAIFRIHHSIGDGMSIMSLVLACTRKTSDLNALP-TIPTKK------RQ  179

Query  556   KASNKISGFFKAMPRFLFGAF----NTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPI  723
             ++SN  SG F  +  +++       NT+ D    +  S  + D RTP++ G  GVE  P 
Sbjct  180   RSSN--SGRFIRLVSYIWFVLQVICNTLVDVVMFIATSAFLRDTRTPLK-GAPGVELSPK  236

Query  724   ATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQ------CEEESSKA-----  870
                  + SLD IK +K+ + +TINDV+ G+   G   Y+ +       EE+++K      
Sbjct  237   WFVHKTISLDDIKLVKNAMDMTINDVILGVTQAGLSRYLNRQYGEGNAEEDAAKQKRNNL  296

Query  871   ----RCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLR  1038
                 R  A ++FN R      +++ +M++  ++  WGN   ++  +L  +T A   DPL 
Sbjct  297   PRKLRFRAALIFNIRP-SMAIEALADMMERKSKTKWGN---YIGYALLPITIALRDDPLD  352

Query  1039  FVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPME  1218
             +VR+A   + RK+ S     T    + ++   G++V A   +    N++M  SN++GP++
Sbjct  353   YVREAKATVDRKKRSLEAKCTFLSAKYIVNLLGAKVAAAISYKVFSNTTMSFSNVVGPVD  412

Query  1219  RMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
              +S   HP   +   + G P +L V   SY+  + I+L+V++D +
Sbjct  413   EISFYGHPMAYLAPSVYGHPHALTVHFQSYMNMMTISLAVDRDAV  457



>ref|XP_008353775.1| PREDICTED: uncharacterized protein LOC103417361 [Malus domestica]
Length=209

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 137/201 (68%), Gaps = 3/201 (1%)
 Frame = +1

Query  811   IIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLP  990
             ++  G+RLYM++  + S +A  TALVL +TR I G Y S+ EM+KP+++ PWGN F FL 
Sbjct  1     MVFLGSRLYMQEMNQSSREAHSTALVLLSTR-IMGNYTSIEEMVKPDSKSPWGNHFAFLQ  59

Query  991   VSLPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGT  1170
             V +P LT    S+ L FV +A + IK KRNS ++Y T  LL+ L    G E  +RYI  T
Sbjct  60    VPIPKLT--EFSNALDFVWEAQKFIKMKRNSLAIYFTSGLLKMLNMFEGHEAASRYIRRT  117

Query  1171  SKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDF  1350
              KNSSM  +NMIGP+E+MSLAN P KG+YF++ G PQ L ++++SY+G +R+ L+++K  
Sbjct  118   LKNSSMAFTNMIGPVEQMSLANQPIKGLYFMLVGSPQDLDISVLSYMGEVRLTLTMKKGT  177

Query  1351  IDAEKFKCCVHHAFEGIYEAA  1413
             ID +K K C+ +A + I+ A+
Sbjct  178   IDPQKLKLCMENAHDMIFNAS  198



>ref|XP_007219046.1| hypothetical protein PRUPE_ppa004668mg [Prunus persica]
 gb|EMJ20245.1| hypothetical protein PRUPE_ppa004668mg [Prunus persica]
Length=497

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 148/476 (31%), Positives = 241/476 (51%), Gaps = 30/476 (6%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGG  216
             SP+++  +S   +  I+ V+  +  I     +V + LK+     +PRFSS +  +   G 
Sbjct  26    SPASRLFHSPQFNCYIVIVIGFQTEINPD--VVKAGLKETLYH-HPRFSSKLNKDSKGGK  82

Query  217   KKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYPT  396
             K+W RV VN  +HV VPN  +   I+  D  + DY+S +       ++PLWE+HL    T
Sbjct  83    KRWIRVSVNEEDHVFVPNLDSN--IDHPDQFVEDYISNLTTAPLDLSKPLWEVHLLNVKT  140

Query  397   TNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRSKASNKI  573
             + A    +F+LHHS+GDG SLM  +L+C ++  +P ALP T P++ R   A  S  S+  
Sbjct  141   SYAEAVAVFRLHHSMGDGASLMSLLLACTRKTSDPDALP-TVPTKTR---ADSSSNSSWF  196

Query  574   SGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSLD  753
               F  A+   L   +NT+ D    +     ++D +TP++ G  GVE         + SLD
Sbjct  197   CWFIFAIWSGLTLIWNTLVDMMLFIATLVFLQDTKTPIK-GAPGVELTAKRFVHRTVSLD  255

Query  754   QIKQIKDKLKVTINDVVTGIIIYG-----TRLYMKQCEEESSKA---------RCTALVL  891
              IKQ+K+ + +TINDVV G+   G      R Y +  ++E SK          R  A VL
Sbjct  256   HIKQVKNAMGMTINDVVFGVTQAGLSQYLIRRYGQNEKDEGSKQKRSNLPKNIRLRANVL  315

Query  892   FNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKR  1071
              N R    G +++ +M+   ++  WGN+F ++   L   T A    PL +VR+A  +I R
Sbjct  316   SNLRPT-VGIQALADMMARKSKARWGNRFGYI---LIPFTIALRDGPLDYVRQAKAVIDR  371

Query  1072  KRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKG  1251
             K++S   + T  +   L+K  G++      H    +S++  SN++GP+E +S   HP   
Sbjct  372   KKHSLEAFCTYLIANVLIKIIGAKAAGAIAHRVISHSTLSFSNLVGPLEEISFYGHPITF  431

Query  1252  IYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI-DAEKFKCCVHHAFEGIYEAAL  1416
             +   + G P +L +   SYV  + I L+++ D I D  K    +  + + I +A L
Sbjct  432   MAPYVYGHPHALHMHFQSYVDKMTICLTIDPDVIPDPNKLLDDLEESLKLICDAVL  487



>ref|XP_010662973.1| PREDICTED: O-acyltransferase WSD1 [Vitis vinifera]
Length=493

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 136/468 (29%), Positives = 240/468 (51%), Gaps = 46/468 (10%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP+A+   +   +  I+ ++  +      +S VI    +  +  +PRFSS+MV++ 
Sbjct  14    EEPLSPAARLFQTRQFNCCIIAIIGCK---TVFNSHVIKAGLEHTLIKHPRFSSLMVADK  70

Query  205   INGGKKWKRVEVNHSEHVKVPNYP--AGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIH  378
             + G  +W R +VN  +H+ +PN     G P +F    +  Y+S M       ++PLW+IH
Sbjct  71    MGGEMRWIRTKVNVEDHIIIPNVDPNMGSPDQF----IESYISNMTKTYLDDSKPLWDIH  126

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQR-ADNPALPLTFPSRQRSTAAPRS  555
             L    T+ A    IF++HHS+GDG S+M  +L+C ++ +D  ALP T P+++      R 
Sbjct  127   LLNVKTSEAESTAIFRIHHSIGDGMSIMSLVLACTRKTSDLNALP-TIPTKK------RQ  179

Query  556   KASNKISGFFKAMPRFLFGAF----NTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPI  723
             ++SN  SG F  +  +++       NT+ D    +  S  + D RTP++ G  GVE  P 
Sbjct  180   RSSN--SGRFIRLVSYIWFVLQVICNTLVDVVMFIATSAFLRDTRTPLK-GAPGVELSPK  236

Query  724   ATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQ---------CEEESSKA--  870
                  + SLD IK +K+ + +TINDV+ G+   G   Y+ +          EE+++K   
Sbjct  237   WFVHKTISLDDIKLVKNAMDMTINDVILGVTQAGLSRYLNRQYGRTGEGNAEEDAAKQKR  296

Query  871   -------RCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASD  1029
                    R  A ++FN R      +++ +M++  ++  WGN   ++  +L  +T A   D
Sbjct  297   NNLPRKLRFRAALIFNIRP-SMAIEALADMMERKSKTKWGN---YIGYALLPITIALRDD  352

Query  1030  PLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIG  1209
             PL +VR+A   + RK+ S     T    + ++   G++V A   +    N++M  SN++G
Sbjct  353   PLDYVREAKATVDRKKRSLEAKCTFLSAKYIVNLLGAKVAAAISYKVFSNTTMSFSNVVG  412

Query  1210  PMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             P++ +S   HP   +   + G P +L V   SY+  + I+L+V++D +
Sbjct  413   PVDEISFYGHPMAYLAPSVYGHPHALTVHFQSYMNMMTISLAVDRDAV  460



>ref|XP_007219258.1| hypothetical protein PRUPE_ppa018127mg [Prunus persica]
 gb|EMJ20457.1| hypothetical protein PRUPE_ppa018127mg [Prunus persica]
Length=522

 Score =   201 bits (511),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 145/484 (30%), Positives = 240/484 (50%), Gaps = 51/484 (11%)
 Frame = +1

Query  4     EMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEI---PIQASDSLVISLLKDVFVPINP  174
             EMM +  EE  SP+A+  +    +L I+ ++  +    P     +L  +LL+      +P
Sbjct  42    EMM-NVEEEPLSPAARLFHEPNFNLHIVAIMGCKTRIYPEVCKANLPHTLLR------HP  94

Query  175   RFSSIMVSEGINGGK-KWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFP  351
             RFSS++V +  N GK KW R EV+  +H+ +P+      +E  D  + DY+  ++     
Sbjct  95    RFSSLLVVDEKNEGKMKWVRTEVDLDKHIIIPDLDPN--MESPDQFVEDYIYNLSKTTID  152

Query  352   PNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSR  528
              ++PLW++HL    T+ A G  IF++HHSLGDG SLM  +L+C ++  NP ALP T P +
Sbjct  153   KSKPLWDLHLLNLKTSEAEGTGIFRVHHSLGDGTSLMSLLLACTRQISNPEALP-TIPVK  211

Query  529   QRSTAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTL--------VEDDRTP  684
             ++     R         F +     +FGA+  V  F W+ F            +ED +TP
Sbjct  212   KKKNDDKRV--------FNRGFWWCIFGAW-WVLKFFWNTFADVFMFMLTALCLEDTKTP  262

Query  685   VRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQ------  846
             ++ G  G EF P      + SLD +K IK+ + +TINDV  G+   G   Y+ +      
Sbjct  263   LK-GPPGSEFNPRRFVYRTLSLDDMKLIKNAMNLTINDVALGVTQAGLSRYLNRRYGDNE  321

Query  847   -----CEEESS---KARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLP  1002
                   E++++   K R  + +L N R    G +++ +M++ N E  WGN   +  V LP
Sbjct  322   NKDSGAEKKNNLPEKIRLRSTLLINIRP-AAGIQALADMMEKNTEAKWGNWIGY--VLLP  378

Query  1003  ALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNS  1182
               T A   DPL ++R+A   I RK++S     T  + + ++K  G +  +   H    ++
Sbjct  379   -FTIALRDDPLDYIREAKTTIDRKKHSLEAIYTFSIAELVLKFFGIKRASALSHRIISHT  437

Query  1183  SMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAE  1362
             +M  SN++GP+E +    HP   +     G P +L +   SY+  + I LSV+++ I   
Sbjct  438   TMCFSNLVGPLEEIGFYGHPMAFLAPSSYGQPHALVINFQSYINKMTIVLSVDEETIPDP  497

Query  1363  KFKC  1374
                C
Sbjct  498   HLLC  501



>ref|XP_004309135.1| PREDICTED: O-acyltransferase WSD1-like [Fragaria vesca subsp. 
vesca]
Length=502

 Score =   201 bits (510),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 136/441 (31%), Positives = 226/441 (51%), Gaps = 36/441 (8%)
 Frame = +1

Query  160   VPINPRFSSIMVSE-GINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMA  336
             +P++PRFSSIMV +  + G K+W +V VN  +HV VPN  +   +E  D  + DY+S + 
Sbjct  61    LPMHPRFSSIMVKDRNLCGKKRWIQVSVNMEDHVIVPNMDSD--MEDADKFVRDYISHLT  118

Query  337   MEAFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPL  513
                   ++PLWE+H+    T++A   V+ ++HHS+GDG SLM  +L+C ++  +P ALP 
Sbjct  119   TSPLDLSKPLWEVHIVNVKTSDAEAVVVIRIHHSMGDGASLMSLLLACTRKTSDPDALP-  177

Query  514   TFPSRQRSTAAPRSKASNKISGFFKAMPRF-----LFGAFNTVYDFGWSVFKSTLVEDDR  678
             + P++++   +    +S+ +S F+  +        L G  NT  D    V     ++D +
Sbjct  178   SVPNQRKHQGS----SSSDLSVFWWLLLAIWSAVTLIG--NTFVDLVLFVATILFLKDTK  231

Query  679   TPVRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYM--KQCE  852
             TP++ G  GVE         + SLD IKQ+K+ + +TINDVV G+   G   Y+  K  E
Sbjct  232   TPIK-GPPGVELTAKRFLHRTVSLDHIKQVKNAMNMTINDVVLGVTQAGLSQYLNYKYGE  290

Query  853   EESSKA------------RCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVS  996
              E  +             R  A +L N R+   G + + +M+   ++  WGN+  ++   
Sbjct  291   NEKDEGAKKKGNNLPKSIRLRANILVNLRS-AAGIQDLADMMAKKSKTKWGNRIGYV---  346

Query  997   LPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSK  1176
             L     A   DPL +VR A   + RK++S   + T      L K  G++      H    
Sbjct  347   LVPFIIALQDDPLDYVRGAKSHLDRKKHSLEAFCTYLCANVLTKLIGAKGAGAVAHRVLC  406

Query  1177  NSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI-  1353
             NS++  +N+IGP+E +S   HP   I   + G P +L +   SYV  + I+L+V+ + I 
Sbjct  407   NSTLAFTNLIGPLEEISYYGHPVTYIAPNVYGHPHALHIHFQSYVDKMTISLAVDPNVIP  466

Query  1354  DAEKFKCCVHHAFEGIYEAAL  1416
             D EK    +  + + I++A +
Sbjct  467   DPEKLLDDLEESLQLIHDAVV  487



>ref|XP_008233155.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=523

 Score =   201 bits (510),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 145/483 (30%), Positives = 239/483 (49%), Gaps = 49/483 (10%)
 Frame = +1

Query  4     EMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEI---PIQASDSLVISLLKDVFVPINP  174
             EMM +  EE  SP+A+  +    +L I+ ++  +    P     +L  +LL+      +P
Sbjct  43    EMM-NVEEEPLSPAARLFHEPNFNLHIVAIMGGKTRIYPDVFKANLPHTLLR------HP  95

Query  175   RFSSIMVSEGINGGK-KWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFP  351
             RFSS++V +  NGGK KW R EV+  +H+ +P+       E  D  + DY+  ++     
Sbjct  96    RFSSLLVVDEKNGGKMKWVRTEVDLDKHIIIPDLDPN--TESPDQFVEDYIYNLSKTTID  153

Query  352   PNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSR  528
              ++PLW++HL    T+ A G  IF++HHSLGDG SLM  +L+C ++  NP ALP T P  
Sbjct  154   KSKPLWDLHLLNLKTSEAEGTGIFRVHHSLGDGTSLMSLLLACTRQISNPEALP-TIPVN  212

Query  529   QRSTAAPRSKASNKISGFFKAMPRFLFGA-------FNTVYDFGWSVFKSTLVEDDRTPV  687
             ++     R         F +     +FGA       +NT  D    +  +  +ED +TP+
Sbjct  213   KKKDDDKRV--------FNRGFWWCIFGAWWVLKLFWNTFVDVFMFMLTALCLEDTKTPL  264

Query  688   RSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQ-------  846
             + G  G EF P      + SLD +K IK+ + +TINDV  G+   G   Y+ +       
Sbjct  265   K-GPPGSEFNPRRFVYQTLSLDDMKLIKNAMNLTINDVALGVTQAGLSRYLNRRYGDDEN  323

Query  847   ----CEEESS---KARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPA  1005
                  E++++   K R  + +L N R    G +++ +M++ N E  WGN   +  V LP 
Sbjct  324   KDSGAEKKNNLPEKIRLRSTLLINIRP-AAGIQALADMMEKNTEAKWGNWIGY--VLLP-  379

Query  1006  LTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSS  1185
              T A   DPL ++R+A   I RK++S     T  + + ++K  G +  +   H    +++
Sbjct  380   FTIALRDDPLDYIREAKTTIDRKKHSLEAIYTFSIAELVLKLFGIKRASALSHRVISHTT  439

Query  1186  MGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEK  1365
             M  SN++GP+E +    HP   +     G P +L +   SY+  + I LSV+++ I    
Sbjct  440   MCFSNLVGPLEEIGFYGHPMAFLAPSSYGQPHALMINFQSYINKMTIVLSVDEETIPDPH  499

Query  1366  FKC  1374
               C
Sbjct  500   LLC  502



>gb|KGN43652.1| hypothetical protein Csa_7G051320 [Cucumis sativus]
Length=175

 Score =   190 bits (483),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 120/167 (72%), Gaps = 0/167 (0%)
 Frame = +1

Query  913   GGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSASV  1092
             G YKSV +M+KPN+  PWGN+   L + +P LT    S+P++F++ A ++IKRKR S + 
Sbjct  3     GNYKSVEDMLKPNSNAPWGNRLALLLIDIPKLTDYELSNPIQFIKAAQKLIKRKRYSYAT  62

Query  1093  YLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAG  1272
             +L   L++ + K +G EV A+Y++   +NSS+ ISNMIGP E+M+L  HPAKG+YFI+ G
Sbjct  63    FLLDKLMEMVHKLKGPEVAAKYMYKMVRNSSLSISNMIGPKEKMALLGHPAKGVYFILFG  122

Query  1273  IPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEGIYEAA  1413
             IPQSL +TMVSY+ +LRIA   EK+FID EK   C+  AFE +Y+AA
Sbjct  123   IPQSLIITMVSYMENLRIAFGSEKEFIDQEKLTSCMKTAFEHMYKAA  169



>ref|XP_010503567.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=520

 Score =   200 bits (509),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 137/470 (29%), Positives = 236/470 (50%), Gaps = 26/470 (6%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             E   E+  SP+A+  ++   +  I+ V+   I  +    +++   K  F+  +PRFSS +
Sbjct  13    EKEDEQPLSPAARLFHAPEFNCNIISVIG--IKSKMDPDVIMRGFKQTFIR-HPRFSSKL  69

Query  193   VSEGING--GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPL  366
             VSE       ++W R +V   EHV VP     + IE  D  L DY+S +       +RPL
Sbjct  70    VSERWRQWTNQRWVRTDVVVEEHVIVPEIKP-QNIENTDAFLEDYVSDLMKIPLDTSRPL  128

Query  367   WEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTA-  543
             WE+H+    T++A    +FK+HHS+GDG S+M  +L+C+++  NP    + P ++RS++ 
Sbjct  129   WELHILDLKTSDAENVAVFKIHHSVGDGMSIMSLVLACMRKTSNPDELPSLPYQKRSSSL  188

Query  544   -APRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
                 +++ +++    K +   +    NTV D    +  +  V+D  TP++      +   
Sbjct  189   LTTATRSDSRLLWLVKLLWTAVILGLNTVCDVLEFLVTTLFVKDTETPIKGDFRSKKSEQ  248

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQ--CEEESSKA--------  870
             +     + SLD IK IK+ + +TIN VV G+       Y+++   E+E+ +         
Sbjct  249   LRLVHRTVSLDDIKLIKNAMNMTINGVVLGVTQASLSRYLERRYGEDETKRKPKNLLKRI  308

Query  871   RCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFL--PVSLPALTPANASDPLRFV  1044
             R  + +L N R    G + + +M++  ++  WGN+F +L  P S+     A  +DPL  +
Sbjct  309   RLRSALLVNLRP-TTGIQDLADMMEKGSKCWWGNRFGYLVFPFSI-----ALRNDPLEHL  362

Query  1045  RKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERM  1224
             + AH+ I RK+NS    LT    + ++K+ G EV A  I+    N++M  SNM+GP+E +
Sbjct  363   KTAHKTINRKKNSFGAMLTYVFCRIIVKSLGIEVAATIINRLMSNTTMTFSNMVGPVEEV  422

Query  1225  SLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKC  1374
             S   HP   I     G P +L +   SY+  + I L V+   I   +  C
Sbjct  423   SFYGHPITCIASSAYGHPHALTIHCQSYMNKMTITLLVDPTVISDPQRLC  472



>ref|XP_010672319.1| PREDICTED: O-acyltransferase WSD1-like [Beta vulgaris subsp. 
vulgaris]
Length=283

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/258 (40%), Positives = 153/258 (59%), Gaps = 8/258 (3%)
 Frame = +1

Query  28   EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
            E ASP++ +L S V +L +L + E EIPI +S   +      VF+  +PRFS I + +  
Sbjct  18   EPASPTSAYLLSEVATLYVLCIFELEIPIDSS--FIYGFFNGVFLESHPRFSCIPIEDKQ  75

Query  208  NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
               K WK+VEVN  +H+K   +P     E Y D   DY+SK+A    P ++PLWE+H F 
Sbjct  76   KRRKVWKKVEVNVEDHIKFSKFPEYLSPENYGDHFDDYISKIATSQLPKDKPLWEVHTFN  135

Query  388  YPT-TNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSKAS  564
            YPT  N A  +I K HH++GDG SLMG + SC +R D+P LPLTFPS  R++++   +  
Sbjct  136  YPTKNNVAATLIVKFHHAVGDGTSLMGVVFSCFKRVDDPTLPLTFPSTTRTSSSKGHQLH  195

Query  565  NKISGFFKAM---PRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIA-TT  732
            +  +   K +   P+FL    +++YDFG ++ +  LVEDD TP+RSG+  +     A   
Sbjct  196  DFKATLMKVINIVPKFLCSMLSSIYDFGQTL-RVVLVEDDLTPIRSGNTNMAIPCSAKVC  254

Query  733  TMSFSLDQIKQIKDKLKV  786
            +++ SL  +K+IK  L+V
Sbjct  255  SVTLSLADVKRIKSILQV  272



>ref|XP_006404166.1| hypothetical protein EUTSA_v10011067mg [Eutrema salsugineum]
 gb|ESQ45619.1| hypothetical protein EUTSA_v10011067mg [Eutrema salsugineum]
Length=509

 Score =   199 bits (507),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 140/481 (29%), Positives = 238/481 (49%), Gaps = 33/481 (7%)
 Frame = +1

Query  1     VEMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRF  180
             VE  E   E+  SP+A+  ++   +  I+ V+  +  I+  +  +I  +K   +  +PRF
Sbjct  18    VEKKEEEDEQPLSPAARLFHAPEFNCYIISVIGLKNKIKPDE--IIQGIKQTLIK-HPRF  74

Query  181   SSIMVSEGING--GKKWKRVEVNHSEHVKVPNYPAGKPIEFY--DDCLSDYLSKMAMEAF  348
             SS +V+ G N    +KW R  V   +HV +P +   + IE    D  L  Y+S +     
Sbjct  75    SSKLVNSGSNNRQEQKWVRTNVVAEDHVIIPKFET-QDIENANADAFLESYVSDLTTTPL  133

Query  349   PPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSR  528
               ++PLWE+HL    T++A    I K+HHS+GDG SLM  +L+C ++  NP    + P +
Sbjct  134   NTSKPLWEVHLLDLKTSDAENVAILKIHHSVGDGMSLMSLVLACTRKTSNPDEFPSLPYQ  193

Query  529   QRSTAA-----PRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRS  693
              +S++      P S   +++     A+   +    NTV D    +  +  ++D  TP++ 
Sbjct  194   NQSSSGSSRLMPGSVGDSRLLWLLMALWSAIMVVLNTVCDALEFIATTLFLKDTSTPIKG  253

Query  694   GDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQ---------  846
                  + + +     + S D IK IK+ +K+T+NDV+ G+   G   Y+K+         
Sbjct  254   DFRLRKCKRMCLVHRTVSFDDIKLIKNAMKMTVNDVILGVSQAGLSQYLKRRYGEKKKKT  313

Query  847   -CEEES--SKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFL--PVSLPALT  1011
               +EES   + R  A VL N R   G  + + +M+   ++  WGN   ++  PVS+    
Sbjct  314   VDQEESIPKEIRLRAAVLVNIRPTTG-IQDLADMMTKGSKCRWGNWIGYIVFPVSI----  368

Query  1012  PANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMG  1191
              A  +DPL  +R+A  II RK+NS    LT  + + ++K+ G +  A  +H    N++M 
Sbjct  369   -ALHNDPLDHIRRAKSIIDRKKNSLEAALTFIVGKMIIKSLGVQRAANILHRALSNTTMT  427

Query  1192  ISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFK  1371
              SN++GPME +S   HP   +   + G P +L +   SY+  + I+LSV+   I      
Sbjct  428   FSNLVGPMEEISFYGHPVTYMAPSVYGHPHALTMHFQSYMNKMTISLSVDPTVISDPHRL  487

Query  1372  C  1374
             C
Sbjct  488   C  488



>ref|NP_001043877.1| Os01g0681000 [Oryza sativa Japonica Group]
 dbj|BAD73756.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF05791.1| Os01g0681000 [Oryza sativa Japonica Group]
 dbj|BAG94326.1| unnamed protein product [Oryza sativa Japonica Group]
Length=531

 Score =   199 bits (507),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 135/437 (31%), Positives = 223/437 (51%), Gaps = 29/437 (7%)
 Frame = +1

Query  169   NPRFSSIMVSEGINGGKK--WKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAME  342
             +PRF SI V + ++   K  W R +VN  +H+ VP+          +  + DY+S ++  
Sbjct  91    HPRFCSIQVLDELDKSAKPMWVRTKVNLDDHIIVPDLGPTDTSADPEKAVEDYVSSLSTP  150

Query  343   AFPPNR--PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADN----PA  504
             + P +R  PLWE+H+  +PT  AA  V  ++HHSLGDG SL+  +++C +RAD+    PA
Sbjct  151   SMPMDRSRPLWELHVLGFPTAEAAATVALRMHHSLGDGVSLLSLLIACTRRADDPDAIPA  210

Query  505   LPLTFPSRQRSTA-----APRSKASNKISGFFKAMPRFLFGAFNTVYD-FGWSVFKSTLV  666
             LP +   R+R         PR   +            +L  A++TV D   +++  ++L+
Sbjct  211   LPSSAAGRRRREGPLHALPPRPPLAAGALALAAWALSYLVLAWHTVVDVVCFTLTAASLM  270

Query  667   EDDRTPVRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYG-TRLYMK  843
              D RT V  GD+G EFRP      + SLD +K IK+ +  T+NDV+ G+     +R Y +
Sbjct  271   GDART-VLKGDEGAEFRPRRFVNRTISLDDVKNIKNAVGCTVNDVLVGLSSAALSRYYFR  329

Query  844   QCEEESSKA--RCTALVLFNTRAIGGGYKSVTEMIK--PNAEMPWGNQFTF--LPVSLPA  1005
             +  E   K   +    ++ N R   G ++ + +M++   N  + WGN+F +  LP  L  
Sbjct  330   RTGESEGKKNIKVRTALMVNLRPTPGLHE-LAKMMESGKNNGVKWGNRFGYMILPFHL--  386

Query  1006  LTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSS  1185
                A   DPL +VRKA ++ +RK++S     T W    ++K  G +  A   +G   N++
Sbjct  387   ---AKHDDPLEYVRKATKVTRRKKSSMEAIFTYWSADMVVKLFGIKAAASLCYGMFSNTT  443

Query  1186  MGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSV-EKDFIDAE  1362
             +  SN+ GP E++    +P   I     G P +L +   SY+ ++++AL+V E  F DA 
Sbjct  444   LSFSNLAGPSEQILFCGNPIVYISPTSYGHPHALTMHWQSYMNTIKLALAVDETQFPDAH  503

Query  1363  KFKCCVHHAFEGIYEAA  1413
             +       +   I EAA
Sbjct  504   ELLDDFTESMRLIREAA  520



>ref|XP_008234742.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
 ref|XP_008234744.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=520

 Score =   199 bits (506),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 151/477 (32%), Positives = 243/477 (51%), Gaps = 31/477 (6%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGG  216
             SP+++  +S   +  I+ V+  +  I     +V + LK+     +PRFSS + ++ I GG
Sbjct  48    SPASRLFHSPQFNCYIVIVMGCQTGINPD--VVKAGLKETLYH-HPRFSSKLENKDIKGG  104

Query  217   KK-WKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
             KK W RV VN  +HV VPN  +   I+  D  + DY+S +       ++PLWE+HL    
Sbjct  105   KKRWIRVSVNEEDHVFVPNLDSN--IDHPDQFVEDYISNLTTAPLDLSKPLWEVHLLNVK  162

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRSKASNK  570
             T+ A    +F+LHHS+GDG SLM  +L+C ++  +P ALP T P+R R   A  S  S+ 
Sbjct  163   TSYAKAVAVFRLHHSMGDGASLMSLLLACTRKTSDPDALP-TVPTRTR---ADSSSNSSW  218

Query  571   ISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSL  750
                F  A+   +   +NT+ D    +     ++D +TP++ G  GVE         + SL
Sbjct  219   FWWFILAIWSGITLMWNTLVDMMLFITTLVFLQDTKTPIK-GAPGVELTAKRFVHRTVSL  277

Query  751   DQIKQIKDKLKVTINDVVTGIIIYG-----TRLYMKQCEEESSKA---------RCTALV  888
             D IKQ+K+ + +TINDVV G+   G      R Y +  ++E SK          R  A V
Sbjct  278   DHIKQVKNAMGMTINDVVFGVTQAGLSQYLNRRYGQNEKDEGSKQKRSNLPKNIRLRANV  337

Query  889   LFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIK  1068
             L N R    G +++ +M+   ++  WGN+F ++   L   T A    PL +VR+A  +I 
Sbjct  338   LANLRPT-VGIQALADMMAKKSKARWGNRFGYI---LIPFTIALQDGPLDYVRQAKVVID  393

Query  1069  RKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAK  1248
             RK++S     T  +   L+K  G++      H    +S++  SN++GP+E +S   HP  
Sbjct  394   RKKHSLEALCTYVIANVLIKIIGAKAAGAIAHRVISHSTLSFSNLVGPLEEISFYGHPIN  453

Query  1249  GIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI-DAEKFKCCVHHAFEGIYEAAL  1416
              +   + G P +L +   SYV  + I L+++ D I D  K    +  + + I +A L
Sbjct  454   FMAPYVYGHPHALHMHFQSYVDKMTICLTIDPDVIPDPNKLLDDLEESLKLICDAVL  510



>ref|XP_010515263.1| PREDICTED: O-acyltransferase WSD1 [Camelina sativa]
Length=523

 Score =   199 bits (505),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 138/467 (30%), Positives = 231/467 (49%), Gaps = 25/467 (5%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             E+  SP+A+  +S   +  I+ V+   I  +    +++   K  F+  +PRFSS +VS+G
Sbjct  17    EQPLSPAARLFHSPEFNCNIISVIG--IKSKMDPDVIMRGFKQTFIR-HPRFSSKLVSDG  73

Query  205   ING-GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHL  381
              NG  ++W R  V   +HV VP     + IE  D  L DY+S +       +RPLWE+H+
Sbjct  74    DNGLNQRWVRTNVVVEDHVIVPEIKP-QNIENTDAFLEDYVSDLMKIPLDTSRPLWELHI  132

Query  382   FKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQR------STA  543
                 T++A    +FK+HHS+GDG S+M  +L+C+++  NP    + P ++R      S  
Sbjct  133   LDLKTSDAENVAVFKIHHSVGDGMSIMSLVLACMRKTSNPDELPSLPYQKRSSSSGSSLL  192

Query  544   APRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPI  723
                S+  +++    K +   +    NT  D    +     V+D  TP++      + + +
Sbjct  193   TTGSRGDSRLLWLVKLLWMAVILGLNTFCDALDFLLTMLFVKDTETPIKGDFRSSKSKQL  252

Query  724   ATTTMSFSLDQIKQIKDKLKVTINDVVTGIII----------YGTRLYMKQCEEESSKAR  873
                  + SLD IK IK+ + +TINDVV G+            YG +   ++ +    + R
Sbjct  253   RLVHRTVSLDDIKLIKNAMDMTINDVVLGVTQASFSRYLERRYGEKETKRKPKNLLKRIR  312

Query  874   CTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKA  1053
               + +L N R    G + + +M++  ++  WGN+F +  V  P  + A  +DPL  +R A
Sbjct  313   LRSALLVNLRP-TTGIQDLADMMETGSKCWWGNRFGY--VVFP-FSIALRNDPLEHLRIA  368

Query  1054  HRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLA  1233
             H+ I RK+NS    LT    + ++K+ G EV A  I+    N++M  SNM+GP+E +S  
Sbjct  369   HKTINRKKNSFGAMLTYVFCRIIVKSLGIEVAATIINRLMSNTTMTFSNMVGPVEEVSFY  428

Query  1234  NHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKC  1374
              HP   I     G P +L +   SY+  + I L V+   I+     C
Sbjct  429   GHPITYIASSAYGHPHALTLHCQSYMNKMTITLLVDPTVINDPHRLC  475



>ref|XP_008227241.1| PREDICTED: uncharacterized protein LOC103326781 [Prunus mume]
Length=382

 Score =   194 bits (494),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 130/192 (68%), Gaps = 4/192 (2%)
 Frame = +1

Query  838   MKQCEEESSKARCTALVLFNTRAIGGGYKSVTEMIK-PNAEMPWGNQFTFLPVSLPALTP  1014
             M++  ++SS   CTALVL  TR I G Y S  EMI+  NA M  GNQF FL + +P  T 
Sbjct  1     MQEVTQKSSNEHCTALVLLRTRNIEG-YTSTKEMIEHNNANMSRGNQFAFLHLPVPKST-  58

Query  1015  ANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGI  1194
                S+PL FV +A ++IK+KRNSA+ YLT WLL  L K RG E  ARYIHGT KNSSM I
Sbjct  59    -ETSNPLDFVWEAQKMIKKKRNSATSYLTSWLLDVLKKFRGPEGAARYIHGTLKNSSMTI  117

Query  1195  SNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKC  1374
             SNMIGP+E+M+L + P  G+YF++ G PQ L VT +SY+G LR+A   EK FID++K K 
Sbjct  118   SNMIGPVEKMALDSQPVGGLYFMVVGPPQCLTVTALSYMGKLRVAFGAEKGFIDSQKLKA  177

Query  1375  CVHHAFEGIYEA  1410
              + +AF  I EA
Sbjct  178   SMQNAFGVILEA  189



>ref|XP_002440221.1| hypothetical protein SORBIDRAFT_09g027970 [Sorghum bicolor]
 gb|EES18651.1| hypothetical protein SORBIDRAFT_09g027970 [Sorghum bicolor]
Length=554

 Score =   198 bits (503),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 130/419 (31%), Positives = 207/419 (49%), Gaps = 25/419 (6%)
 Frame = +1

Query  169   NPRFSSIMVSEG---INGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAM  339
             +PRFSSI V +     N   +W R  VN  +HV VP           D  + DYLS ++ 
Sbjct  110   HPRFSSIQVKDDDARKNAKPRWVRTTVNLDDHVIVPYLDPAATSTKPDQAVEDYLSWLST  169

Query  340   EAFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPA-LPLT  516
                  +RPLWE H+  +PT+ A   V  ++HHSLGDG SL+  +++C + A +PA LP  
Sbjct  170   APMDHSRPLWEFHVLNFPTSEATATVAIRMHHSLGDGVSLLSLLIACTRSAADPARLPEL  229

Query  517   FPSRQRS---TAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPV  687
              P+ +R+    A PR   S     F   +  ++  A++T+ D    V  +  + D RTP 
Sbjct  230   PPAPRRAGPVYARPRPPLSAGFVAFALWLWSYVVLAWHTLVDVVCFVATAWFLSDPRTPF  289

Query  688   RSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYG-TRLYMKQCE----  852
              +  +GVEFR       + SLD +K +K+ +K T+NDV+ G+   G +R Y ++      
Sbjct  290   MAASEGVEFRRKRFVHRTLSLDDVKFVKNAMKCTVNDVLIGVTNAGLSRYYFRKTSGSNN  349

Query  853   --EESSKARCTALVLFNTRAIGGGYKSVTEMI--KPNAEMPWGN--QFTFLPVSLPALTP  1014
               ++S   R  + +L N R    G  ++TEM+    N    WGN   +  LP  +     
Sbjct  350   EGKKSQNIRVRSALLVNIRR-APGLHALTEMMASSKNNGAKWGNLIGYMILPFHI-----  403

Query  1015  ANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGI  1194
             A   DPL ++R+  R  +RK+ S     T W    ++K  G +  A   +G   N+++  
Sbjct  404   AMHDDPLEYIRQGKRTAERKKASLEAVFTYWSGNLIVKLFGMKAAAALCYGMFTNTTLSF  463

Query  1195  SNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEK-DFIDAEKF  1368
             S+M+GP E++    HP   I   + G P +L V   SY  S+++ L+V+   F D+ + 
Sbjct  464   SSMVGPAEKVEFYGHPIVYIAPSVYGHPHALTVHYQSYTNSIKLVLAVDDAQFPDSHQL  522



>ref|XP_010426423.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=523

 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 137/473 (29%), Positives = 235/473 (50%), Gaps = 29/473 (6%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             E   E+  SP+A+  ++   +  I+ V+ S+  I     ++I   +  F+  +PRFSS +
Sbjct  13    EKEDEQPLSPAARLFHAPEFNCNIISVIGSKSKIDPD--VIIRGFQQTFIR-HPRFSSKL  69

Query  193   VSEGING-GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLW  369
             VS+G NG  ++W R  V   +HV VP     + IE  D  L DY+S +       ++PLW
Sbjct  70    VSDGDNGQNQRWVRTNVVVEDHVIVPEIKP-QNIENTDAFLEDYVSDLMKIPLDTSKPLW  128

Query  370   EIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQR-----  534
             E+H+    T++A    +FK+HHS+GDG S+M  +L+C+++  NP    + P ++R     
Sbjct  129   EVHILDLKTSDAENVAVFKVHHSVGDGMSMMSLVLACMRKTSNPDELPSLPYQKRSSSSG  188

Query  535   -STAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVE  711
              S     S+  +++    K +   +    NT  D    +     V+D  TP++      +
Sbjct  189   SSLLTTGSRGDSRLLWLVKLLWMAVILGLNTFCDSLDILLTMLFVKDTETPIKGDFRSSK  248

Query  712   FRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQ--CEEESSKA-----  870
              + +     + SLD IK IK+ + +T+NDVV G+       Y+++   E+E+ +      
Sbjct  249   SKQLRLVHRTVSLDDIKLIKNAMDMTVNDVVLGVTQASLSRYLERRYGEKETKRKPKNLL  308

Query  871   ---RCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFL--PVSLPALTPANASDPL  1035
                R  + +L N R    G + + +M++  ++  WGN+F ++  P S+     A  +DPL
Sbjct  309   KRIRLRSALLVNLRPT-TGIQDLADMMEKGSKCWWGNRFGYVVFPFSI-----ALRNDPL  362

Query  1036  RFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPM  1215
               ++ AH+ I RK+NS    LT    + ++K+ G EV A  I+    N++M  SNM+GP+
Sbjct  363   EHLKTAHKTINRKKNSFGAMLTYVFCRIIVKSLGIEVAATIINRLMSNTTMTFSNMVGPV  422

Query  1216  ERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKC  1374
             E +S   HP   I     G P +L +   SY+  + I L V+   I      C
Sbjct  423   EEVSFYGHPITYIASSAYGHPHALTIHCQSYMNKMTITLLVDPTVISDPHQLC  475



>ref|XP_008246217.1| PREDICTED: uncharacterized protein LOC103344399, partial [Prunus 
mume]
Length=154

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 118/158 (75%), Gaps = 5/158 (3%)
 Frame = +1

Query  811   IIIYGTRLYMKQCEEESSKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLP  990
             +I +GTRLYM++ ++ SS A CTA+VL NTR I G Y  + EMIKPN++MPWGN+FTFL 
Sbjct  1     MIFFGTRLYMQEIDQSSSTADCTAMVLLNTR-IMGDYMPIEEMIKPNSKMPWGNRFTFLQ  59

Query  991   VSLPALTP-ANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHG  1167
             V +P LT  +NA D   F+R  H++IK+KRNS +VY T  LL+ + K    E ++RYIH 
Sbjct  60    VPIPKLTELSNADD---FIRNTHKMIKKKRNSLAVYFTSRLLEIVNKFGSHEASSRYIHR  116

Query  1168  TSKNSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQ  1281
             T KNSSM ISNMIGP+E+MSLANHP KG YF++ G+PQ
Sbjct  117   TLKNSSMVISNMIGPVEQMSLANHPIKGFYFLVPGLPQ  154



>ref|XP_004961273.1| PREDICTED: O-acyltransferase WSD1-like [Setaria italica]
Length=558

 Score =   198 bits (503),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 129/419 (31%), Positives = 211/419 (50%), Gaps = 25/419 (6%)
 Frame = +1

Query  169   NPRFSSIMVSEGI---NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAM  339
             +PRFSS+ V + +   N   +W R  VN  +H+  P+          D  + DYLS ++ 
Sbjct  128   HPRFSSVQVKDDVKNKNAKPRWVRTTVNLDDHIIFPHLDPAATSANPDQAVEDYLSSLST  187

Query  340   EAFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPA-LPLT  516
                  +RPLWE+H+  +PT+ AA  V  ++HHSLGDG SL+  +++C + A +PA LP  
Sbjct  188   APMDHSRPLWELHVLDFPTSEAASAVAVRMHHSLGDGISLLSLLIACTRSAADPARLPEL  247

Query  517   FPSRQRS---TAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPV  687
              P+ +R+    A PR   S  ++     +  +   A++T+ D    V  S  + D RTP 
Sbjct  248   PPAPRRAGPVHARPRPPLSAGLAALALWVWSYAVLAWHTLVDVACFVATSWFLRDPRTPF  307

Query  688   RSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYG-TRLYMKQCEE---  855
              +  +GVEFR       + SLD +K +K  +K T+NDV+ G+   G +R Y ++  +   
Sbjct  308   AAASEGVEFRRKRFVHRTLSLDDVKFVKTAMKCTVNDVLIGVTSAGLSRYYFRKTSDTNE  367

Query  856   --ESSKARCT-ALVLFNTRAIGGGYKSVTEMIK--PNAEMPWGN--QFTFLPVSLPALTP  1014
               +S K  C  + +L N R    G  ++ EM+    N    WGN   +  LP  +     
Sbjct  368   RKKSQKNICVRSALLVNIRKT-PGLHALAEMMDSSKNNGAKWGNLIGYVILPFHI-----  421

Query  1015  ANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGI  1194
             A   DPL ++R+  R  +RK+ S     T W    ++K  G +  A   +G   N++M  
Sbjct  422   AMHDDPLEYIRQGKRTAERKKTSLEAVFTYWSGNLIVKLFGMKAAAALCYGMFTNTTMSF  481

Query  1195  SNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEK-DFIDAEKF  1368
             S+M+GP E++    HP + I   + G P +L V   SY+ S+++ L+V+   F D+ + 
Sbjct  482   SSMVGPAEKVEFYGHPIQYIAPSVYGHPHALTVHYQSYMNSIKLVLAVDDAQFPDSHQL  540



>ref|XP_010095758.1| O-acyltransferase WSD1 [Morus notabilis]
 gb|EXB62178.1| O-acyltransferase WSD1 [Morus notabilis]
Length=508

 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 139/483 (29%), Positives = 231/483 (48%), Gaps = 54/483 (11%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQ---ASDSLVISLLKDVFVPINPRFS  183
             E   EE  SP+ +  +    ++ ++ ++ S+  IQ   A  +   +LLK      +PRFS
Sbjct  31    EGELEEPVSPAGRMFHEPNFNVHVIAIMGSKYKIQPDVAKANAPKTLLK------HPRFS  84

Query  184   SIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRP  363
             S++V +   G  KW R EV+  +HV VP+      IE  D  + DY+  +   +   ++P
Sbjct  85    SLLVVDD-EGKMKWVRTEVDLDKHVIVPDIDIPN-IESPDKFVEDYIYNLTKTSLDKSKP  142

Query  364   LWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRST  540
             LWEIH+    T++A G  IF++HHSLGDG SLM  +L+C ++  NP ALP          
Sbjct  143   LWEIHILNLKTSDAEGVGIFRIHHSLGDGTSLMSLLLACTRQVANPDALP----------  192

Query  541   AAPRSKASNKISGFFKAMPRFLFGA-------FNTVYDFGWSVFKSTLVEDDRTPVRSGD  699
               P+ K  ++  GF ++  +  FG        +NT+ D    +  S  ++D  TP+ +  
Sbjct  193   TLPKHKKKDEKGGFIRSFSQCFFGVWWLLGLFWNTMVDVFMFMATSLFLKDTATPITAPP  252

Query  700   DGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESS-----  864
             D V   P      + SLD +K +K+ + +TINDV  GI   G   Y+ +   E +     
Sbjct  253   DSVR-NPRRIVHKTVSLDDMKLVKNAMNMTINDVAVGITQAGLSKYLNRRYGEKNNNDKG  311

Query  865   ----------KARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQ--FTFLPVSLPAL  1008
                         R  +++L N R    G + + +M++ NAE  WGN   +  LP  +   
Sbjct  312   ATESKNNLPKNIRLRSVLLINIRP-SAGIQELADMMEKNAEAKWGNWVGYILLPFDI---  367

Query  1009  TPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSM  1188
                   DPL ++R+A   I RK++S  V  T  +   L++  G +  +   H    N++ 
Sbjct  368   --GLRDDPLEYIRRAKNTIDRKKHSLEVLATSAIANLLLRVLGIKRASAQSHRIFSNTTF  425

Query  1189  GISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKF  1368
               SN+ GP+E + +  H  + +     G P +L +   SYV  + I LSV+ + +  + +
Sbjct  426   VFSNLTGPLEEIGIYGHELEYLAPTSYGQPHALMINFQSYVNRMTIVLSVD-ERVYPDPY  484

Query  1369  KCC  1377
             K C
Sbjct  485   KLC  487



>ref|XP_004979823.1| PREDICTED: O-acyltransferase WSD1-like [Setaria italica]
Length=508

 Score =   196 bits (499),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 143/484 (30%), Positives = 245/484 (51%), Gaps = 47/484 (10%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQ---ASDSLVISLLKDVFVPINPRFSSIMV  195
             +E  SP+AQF +     L I+ V+    PI    A   L ++L++      +PRF SI V
Sbjct  32    DEPLSPTAQFYSD----LCIVAVVGLAAPIDIELARAGLEVTLVR------HPRFCSIHV  81

Query  196   SEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
             ++G     +W R  VN  +H+ VP+          D  L DY+S ++      +RPLWE+
Sbjct  82    TDGPE--HRWVRTPVNLDDHIIVPDLDPAAIAADPDKVLEDYVSSLSTLPMDKSRPLWEL  139

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALP-----LTFPSRQRS  537
             H+  +PT+ AA   +F+++H+LGDG SL+  +L+C + A +P ALP     +  P+R++ 
Sbjct  140   HILDFPTSEAASAAVFRINHALGDGTSLISLLLACTRSAADPKALPVMPSAMPPPARRKG  199

Query  538   T-----AAPRSKASNKISGFFKAMPRFLFGAFNTVYD-FGWSVFKSTLVEDDRTPVRSGD  699
                   A+P    S     F   +   +  A++T+ D   ++     LV D RT V +G 
Sbjct  200   RRRVYGASPTPARSAGAMAFVAWVLSCVLLAWHTIVDVVSFAALALDLVRDPRT-VFTGV  258

Query  700   DGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYG-TRLYMKQCEEESSKARC  876
              GVEFR     +   SLD +K +K+ L  T+NDV+ G+     +R Y ++  ++++K   
Sbjct  259   KGVEFRRKRFVSRGLSLDDVKHVKNVLGCTVNDVLVGVTSAALSRYYFRKSGDDATKKDV  318

Query  877   T--ALVLFNTRAIGGGYKSVTEMIKP--NAEMPWGNQF--TFLPVSLPALTPANASDPLR  1038
                +L++ N R+   G + + +M++   N ++ WGN      LP  +     A   DPL 
Sbjct  319   CLRSLLMVNVRST-PGIQELAQMMESSKNNDVKWGNPVGQIILPFYI-----AMYDDPLE  372

Query  1039  FVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPME  1218
             +VRKA +++ RK++S  V +T  + +   +  G++V+    H    N+++  SN+IGP+E
Sbjct  373   YVRKAKKVVDRKKHSLEVIVTHGIGKKGSELFGTKVSGAIFHRMISNTTVPFSNIIGPVE  432

Query  1219  RMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEG  1398
              +    H    I   + G P +L +   SY  ++R+ L+V     D  +F  C HH  + 
Sbjct  433   PVEFYGHRVVYIAPSVYGHPSALTILWQSYADTIRVVLAV-----DDSQFPDC-HHLLDD  486

Query  1399  IYEA  1410
               E+
Sbjct  487   FAES  490



>ref|XP_010266526.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Nelumbo nucifera]
Length=506

 Score =   196 bits (497),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 142/463 (31%), Positives = 230/463 (50%), Gaps = 38/463 (8%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMV-SE  201
             E+  SP+A+       +  I+ ++  +  I   D  VI    +  +  +PRFSSI V SE
Sbjct  37    EQPLSPAARIFREPNFNCYIIAIMGCKTKI---DPDVIKAGLETTLLKHPRFSSIQVASE  93

Query  202   GINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHL  381
             G +G   W R +V+   HV VP       +E  D  L DY+S +   A   ++PLWE+HL
Sbjct  94    GKSGEMNWVRTKVDLDNHVIVPELDPN--MESLDQFLEDYVSDLTRTAIDMSKPLWELHL  151

Query  382   FKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQR-ADNPALPLTFPSRQRSTAAPRSK  558
                 T+ A    +F++HHSLGDG SL+  +L+C ++ +D  ALP T P ++R+       
Sbjct  152   LNVKTSEAEAVGVFRIHHSLGDGMSLISLLLACTRKSSDGGALP-TIPVQKRA-------  203

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFK----STLVEDDRTPVRSGDDGVEFRPIA  726
             A+     +F  +   +    + +++    +FK    S  ++D  TP++ G  GV F    
Sbjct  204   ATGTSGSWFLWVLSSVLAVLHLLWNSTVDIFKFLATSVFIKDTDTPLKGG-RGVGFTRKR  262

Query  727   TTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK------QCEEESSKA------  870
                 + SLD IK +K++LK+TINDVV G+   G   Y+       + +EE+++       
Sbjct  263   FVHRTVSLDDIKLVKNELKMTINDVVLGVTQGGLSRYLNRRYGESKMDEEATRKRNNLPK  322

Query  871   --RCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFV  1044
               R  A +L N R    G +++ +M+   +E  WGN   +  V LP    A   DPL +V
Sbjct  323   HIRLRAALLVNIRP-STGIQALADMMDNKSEAKWGNWLGY--VLLP-FKIALHDDPLDYV  378

Query  1045  RKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERM  1224
             R+A   I RK+ S     T      ++K+ G +  A   H    N++M  SN++GP+E +
Sbjct  379   REAKATIDRKKISLESMFTFVCATIIVKSIGQKAAALLCHRILSNTTMSYSNVVGPVEEI  438

Query  1225  SLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             S   HP   +   + G P +L +   SY+  + I L+V++D I
Sbjct  439   SFCGHPIVYLAPSVYGHPHALTIHFQSYMDKMTIVLAVDQDVI  481



>ref|XP_009760691.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana sylvestris]
Length=505

 Score =   196 bits (497),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 130/468 (28%), Positives = 227/468 (49%), Gaps = 33/468 (7%)
 Frame = +1

Query  10    MEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQAS---DSLVISLLKDVFVPINPRF  180
             ME   EE  SPSA+  +    ++ ++ ++ S+  I      + LV +LLK      +PRF
Sbjct  22    MEAAEEEPLSPSARLFHEPNFNVHVIAIMGSKSRINPQVIKEKLVHTLLK------HPRF  75

Query  181   SSI-MVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPN  357
             SS+ +V E  NG  KW R +V+  +H+ VP     K  E  D  + +Y+  ++      +
Sbjct  76    SSLQVVDEEKNGEMKWVRTKVDLDKHIVVPQVDEQKLKESPDKFVENYIHNLSKTTLDKS  135

Query  358   RPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRS  537
             +P+W++HL    T++A    +F++HHSLGDG SL+  +L+C ++  +P    T P  ++ 
Sbjct  136   KPMWDLHLLNVKTSDAEAVGVFRIHHSLGDGTSLISLLLACTRQTAHPDKIPTIPGNKKR  195

Query  538   TAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFR  717
                     +  +  +F  +  F+   +NT+ D    +  +  ++D  TP++ G  G EF 
Sbjct  196   PNNSSEYTTKGLWQYFAKVWSFMRLFWNTIVDVLMFMATTMFLKDTSTPIK-GKPGSEFN  254

Query  718   PIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYM----------KQCEEESS-  864
             P      + SLD +K +K+ L +TINDV  G    G  +Y+          K+  E+++ 
Sbjct  255   PRRFVYRTVSLDDLKLVKNALNMTINDVALGATQAGLSVYLNRRFGVSKKDKRATEKNNN  314

Query  865   ---KARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQ--FTFLPVSLPALTPANASD  1029
                  R  + +L N R    G +++ +M+  + E+ WGN   F  LP  +         D
Sbjct  315   LPKNIRLRSTLLVNLRP-STGIQALADMMDKDTEVKWGNSIGFVLLPFKISL-----RDD  368

Query  1030  PLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIG  1209
             PL ++R+A   I RK+NS     T  + +  ++  G + ++   H    N++M  SN++G
Sbjct  369   PLDYIREAKATIDRKKNSLEAIYTFSISELALRFFGIKTSSSISHRIITNTTMCFSNLVG  428

Query  1210  PMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             P E +    HP   +     G P +L +   SY   + I LSV++  I
Sbjct  429   PQEEIGFYGHPMAYLAPSSYGQPHALMINFQSYTNKMTIVLSVDESVI  476



>emb|CBH32551.1| conserved hypothetical protein, expressed [Triticum aestivum]
 emb|CDM83948.1| unnamed protein product [Triticum aestivum]
Length=515

 Score =   196 bits (497),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 134/435 (31%), Positives = 218/435 (50%), Gaps = 24/435 (6%)
 Frame = +1

Query  169   NPRFSSIMVSEGI--NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAME  342
             +PRF S+ V + +  +   KW R  VN  +HV VP+          D  L  Y+S ++  
Sbjct  81    HPRFCSVQVVDELEEDARPKWVRTTVNLDDHVIVPDLDPTATSADPDRALEHYVSSLSTL  140

Query  343   AFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADN----PALP  510
                 +RPLWE+H+F +PT++AA  V+ ++HHS+GDG SL+   ++C +RA +    P LP
Sbjct  141   PMDHSRPLWELHVFDFPTSDAAAAVVLRVHHSVGDGVSLLSLFIACTRRAADPDALPELP  200

Query  511   LT-FPSRQRSTAAPRSKASNKISGFFKAMPRF----LFGAFNTVYDFGWSVFKSTLVEDD  675
              T  P R     A RS+ S    G    +  +    L  A++TV D       +T +  D
Sbjct  201   TTGAPRRAGPAYALRSRHSPSSWGALAVLAAWVVSLLVLAWHTVVDVLCFSATATWMLRD  260

Query  676   RTPVRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYG-TRLYMKQCE  852
                +  G +GVEFRP      + SLD +K +K+ +  T+NDV+ G+     +R Y ++  
Sbjct  261   PPTLFKGAEGVEFRPKRFVNRTLSLDDVKYVKNTMNCTVNDVLLGVTSAALSRFYFRKTG  320

Query  853   EESSKA-RCTALVLFNTRAIGGGYKSVTEMIKPNAE--MPWGNQ--FTFLPVSLPALTPA  1017
             E   K+ +  + +L N R   G +   T M+K   +    WGN+  +  LP  +      
Sbjct  321   ESGRKSIKVRSTLLVNLRKTPGLHALAT-MMKSGKDNWAEWGNRLGYMILPFHI-----V  374

Query  1018  NASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGIS  1197
             +  DPL +VRKA ++ +RK++S     T W    +MK  G +  A   +G  +N+++  S
Sbjct  375   HGDDPLEYVRKATKVARRKKSSMESIFTYWSASMIMKFFGIKAAASLCYGMMRNTTLSFS  434

Query  1198  NMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKD-FIDAEKFKC  1374
             NM GP E++    HP   I   + G P +L +   SY+  +++ L+ E++ F DA +   
Sbjct  435   NMAGPTEQVVFYGHPIVYIAPSVYGHPHALTMHYQSYMNIIKLVLATEEEQFPDAHELLD  494

Query  1375  CVHHAFEGIYEAALG  1419
                 + + I EAA G
Sbjct  495   DFAVSLKLIREAASG  509



>ref|XP_010482729.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=491

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 133/457 (29%), Positives = 219/457 (48%), Gaps = 27/457 (6%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM-VSE  201
             EE  SP ++  NS   +  I+  +   +  + +   +I  LK   V  +PRFSSI+ ++ 
Sbjct  17    EEPLSPCSRLFNSPDFNCAIIVTMGCRV--KGNTPAIIDGLKRTLVN-HPRFSSILEMNN  73

Query  202   GINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHL  381
             G  G   W R +V   +HV VP       IE  D  L DY+SK+       ++PLWEIH+
Sbjct  74    GKKGKPCWVRTKVKVEDHVIVPEI--DPKIENPDQYLEDYISKLTTIPMDLSKPLWEIHI  131

Query  382   FKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRSK  558
                 T+NA    + K+HHSLGDG SLM   L+C ++  NP ALP     ++R      S 
Sbjct  132   IHLKTSNAESIALLKIHHSLGDGMSLMSLFLACTRKTSNPEALPTVAVQKKRFGPICNSG  191

Query  559   ASNKISGFFKAM---PRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
               NKI   F  +    R LF  F  +  F  ++F   LV D  TP+ +   G EF P   
Sbjct  192   FFNKIWWLFVGLWFIIRLLFNTFVDILMFALTIF---LVRDTETPLLA-KPGSEFNPKRF  247

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK---------QCEEESSKARCTA  882
                  S D +K +K+ LK+T+NDV+ G+   G   Y+          + +E   + R  +
Sbjct  248   VHRIISFDDVKLVKNALKMTVNDVLLGVTEAGLSRYLSRRYDQEATPKLKESMRRIRLRS  307

Query  883   LVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRI  1062
              ++ N R    G +++ +M+   ++  WGN F ++   L   +    +DPL +VR+A   
Sbjct  308   AIMINLRP-NAGIEALADMMAKKSKCRWGNLFGYI---LLPFSVGLETDPLEYVRRAKST  363

Query  1063  IKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHP  1242
             I RK++S     +    + ++K  G + +   +     ++++  SN++GP E ++   HP
Sbjct  364   IDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLTFSNVVGPKEEITFHGHP  423

Query  1243  AKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
                I   + G P +L +   SY   + I+++ +   I
Sbjct  424   LSYIAPCVFGHPYALTIHFQSYANKVIISVTADPTVI  460



>ref|XP_009630816.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=505

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 130/468 (28%), Positives = 223/468 (48%), Gaps = 33/468 (7%)
 Frame = +1

Query  10    MEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQAS---DSLVISLLKDVFVPINPRF  180
             ME   EE  SPSA+  +    ++ ++ ++ S+  I      + LV +LLK      +PRF
Sbjct  22    MEAAEEELLSPSARLFHEPNFNVHVIAIMGSKSRINPQVIKEKLVHTLLK------HPRF  75

Query  181   SSI-MVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPN  357
             SS+ +V E  NG  KW R  V+  +H+ VP           D  + +Y+  ++      +
Sbjct  76    SSLQVVDEKKNGEMKWVRTMVDLDKHIVVPQVDEQNLQGSPDKFVENYIQNLSKTTLDKS  135

Query  358   RPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRS  537
             +PLW++HL    T++A    +F++HHSLGDG SL+  +L+C ++  +P    T P  ++ 
Sbjct  136   KPLWDLHLLNVKTSDAEAVAVFRIHHSLGDGTSLISLLLACTRQTAHPDKIPTIPGNKKM  195

Query  538   TAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFR  717
                     +  +  +F  +  F+   +NT+ D    +  +  ++D  TP++ G  G EF 
Sbjct  196   PINSSEYTTKGLWQYFAKVWSFMRLFWNTIVDVLMFMATTMFLKDTSTPIK-GKPGSEFN  254

Query  718   PIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSK----------  867
             P      + SLD +K +K+ L +TINDV  G+   G  +Y+ +   E  K          
Sbjct  255   PRRFVYRTVSLDDLKLVKNALNMTINDVALGVTQAGLSVYLNRRFGEGKKNKGVTEKNNN  314

Query  868   ----ARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQ--FTFLPVSLPALTPANASD  1029
                  R  + +L N R    G +++ +M++ + E  WGN   F  LP  +     A   D
Sbjct  315   LPKNIRLRSTLLVNLRP-STGIQALADMMEKDTEAKWGNWIGFVLLPFKI-----ALRDD  368

Query  1030  PLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIG  1209
             PL ++R+A   I RK+NS     T  + +  ++  G + ++   H    N++M  SN++G
Sbjct  369   PLDYIREAKATIDRKKNSLEAIYTFSISELALRFFGIKTSSSISHRIITNTTMCFSNLVG  428

Query  1210  PMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             P E +    HP   +     G P +L +   SY   + I LSV++  I
Sbjct  429   PQEEIGFYGHPMAYLAPSSYGQPHALMINFQSYTNKMTIVLSVDESMI  476



>dbj|BAJ93204.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score =   194 bits (494),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 135/440 (31%), Positives = 217/440 (49%), Gaps = 35/440 (8%)
 Frame = +1

Query  169   NPRFSSIMVSEGI--NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAME  342
             +PRF S+ V + +  +   KW R  VN  +HV VP+          D  L  Y+S ++  
Sbjct  80    HPRFCSVQVIDELEEDARPKWVRTTVNLDDHVIVPHLDPTATSADPDRALEKYVSSLSTL  139

Query  343   AFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADN----PALP  510
                 +RPLWE+H+  +PT++AA  V+ ++HHS+GDG SL+   ++C +RA +    P LP
Sbjct  140   PMDHSRPLWELHVLDFPTSDAAAAVVLRVHHSVGDGVSLLSLFIACTRRAADQGALPELP  199

Query  511   LT-----------FPSRQRSTAAPRSKASNKISGFFKA-MPRFLFGAFNTVYDFGWSVFK  654
              T            PSR R     R ++S     F  A +   L  A++T+ D       
Sbjct  200   ATGAPRRAGPVHALPSRPRH----RPRSSWGALAFLAAWVASLLVLAWHTLVDVACFAAT  255

Query  655   STLVEDDRTPVRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYG-TR  831
             +T +  D   +  G +GVEFRP      + SLD +K +K+ +  T+NDV+ G+     +R
Sbjct  256   ATAMLGDPPTLFKGAEGVEFRPKRFVNRTLSLDDVKYVKNTMSCTVNDVLLGVTSAALSR  315

Query  832   LYMKQCEEESSKA-RCTALVLFNTRAIGGGYKSVTEMI--KPNAEMPWGNQ--FTFLPVS  996
              Y ++  E S K+ +  + +L N R   G +   T M   K N    WGN+  +  LP  
Sbjct  316   FYFRKTGESSRKSIKVRSTLLVNLRKTPGLHALATMMESGKDNGA-EWGNRLGYMILPFH  374

Query  997   LPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSK  1176
             +     A   DPL +VRKA ++ +RK++S     T W    +MK  G +  A   +G  +
Sbjct  375   I-----AMHDDPLEYVRKATKVARRKKSSMESVFTYWSASVIMKIFGIKAAASLCYGMMR  429

Query  1177  NSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKD-FI  1353
             N+++  SNM GP E++    HP   I   + G P +L +   SY+  +++ L+ E++ F 
Sbjct  430   NTTLSFSNMAGPSEQVVFYGHPIVYIAPSVYGHPHALTMHYQSYMNIIKLVLATEEEQFP  489

Query  1354  DAEKFKCCVHHAFEGIYEAA  1413
             DA +       + + I EAA
Sbjct  490   DAHELLDDFAESLKLIREAA  509



>ref|XP_010266525.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Nelumbo nucifera]
Length=507

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 141/464 (30%), Positives = 230/464 (50%), Gaps = 39/464 (8%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSI--MVS  198
             E+  SP+A+       +  I+ ++  +  I   D  VI    +  +  +PRFSSI  + S
Sbjct  37    EQPLSPAARIFREPNFNCYIIAIMGCKTKI---DPDVIKAGLETTLLKHPRFSSIQQVAS  93

Query  199   EGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIH  378
             EG +G   W R +V+   HV VP       +E  D  L DY+S +   A   ++PLWE+H
Sbjct  94    EGKSGEMNWVRTKVDLDNHVIVPELDPN--MESLDQFLEDYVSDLTRTAIDMSKPLWELH  151

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQR-ADNPALPLTFPSRQRSTAAPRS  555
             L    T+ A    +F++HHSLGDG SL+  +L+C ++ +D  ALP T P ++R+      
Sbjct  152   LLNVKTSEAEAVGVFRIHHSLGDGMSLISLLLACTRKSSDGGALP-TIPVQKRA------  204

Query  556   KASNKISGFFKAMPRFLFGAFNTVYDFGWSVFK----STLVEDDRTPVRSGDDGVEFRPI  723
              A+     +F  +   +    + +++    +FK    S  ++D  TP++ G  GV F   
Sbjct  205   -ATGTSGSWFLWVLSSVLAVLHLLWNSTVDIFKFLATSVFIKDTDTPLKGG-RGVGFTRK  262

Query  724   ATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK------QCEEESSKA-----  870
                  + SLD IK +K++LK+TINDVV G+   G   Y+       + +EE+++      
Sbjct  263   RFVHRTVSLDDIKLVKNELKMTINDVVLGVTQGGLSRYLNRRYGESKMDEEATRKRNNLP  322

Query  871   ---RCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRF  1041
                R  A +L N R    G +++ +M+   +E  WGN   +  V LP    A   DPL +
Sbjct  323   KHIRLRAALLVNIRP-STGIQALADMMDNKSEAKWGNWLGY--VLLP-FKIALHDDPLDY  378

Query  1042  VRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMER  1221
             VR+A   I RK+ S     T      ++K+ G +  A   H    N++M  SN++GP+E 
Sbjct  379   VREAKATIDRKKISLESMFTFVCATIIVKSIGQKAAALLCHRILSNTTMSYSNVVGPVEE  438

Query  1222  MSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             +S   HP   +   + G P +L +   SY+  + I L+V++D I
Sbjct  439   ISFCGHPIVYLAPSVYGHPHALTIHFQSYMDKMTIVLAVDQDVI  482



>ref|XP_002877655.1| condensation domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53914.1| condensation domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   194 bits (493),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 133/473 (28%), Positives = 232/473 (49%), Gaps = 31/473 (7%)
 Frame = +1

Query  13    EHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM  192
             E   E+  SP+A+  +S   +  I+ V+   +  +    ++I   K+ F+  +PRFSS +
Sbjct  13    EKEEEQPLSPAARLFHSPEFNCNIISVIG--LKSKLDPCVIIRGFKETFIR-HPRFSSKL  69

Query  193   VSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWE  372
             V++     ++W R  V   +HV VP     + IE  D  L DY+S +       +RPLWE
Sbjct  70    VTDENGQNQRWVRTNVVVEDHVIVPEIKL-QNIENTDSFLEDYVSDLMKIPLDISRPLWE  128

Query  373   IHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQR-----S  537
             +HL    T++A    + K+HHS+GDG S+M  +L+C+++  NP    + P + R     S
Sbjct  129   LHLLDLKTSDAENVAVLKIHHSVGDGMSIMSLVLACMRKTSNPDELPSLPYQYRSSSGSS  188

Query  538   TAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFR  717
                  S++ +++    K +   +    NT+ D    +  +  V+D  TP++      + +
Sbjct  189   LLTTGSRSDSRLLWLVKVLWTAVILGLNTICDTLEFIVTTLFVKDTETPIKGDFRSTKSK  248

Query  718   PIATTTMSFSLDQIKQIKDKLKVTINDVVTGIII----------YGTRLYMKQCEEESSK  867
              +     + SLD IK IK+ + +T+NDVV G+            YG R   ++ +    +
Sbjct  249   RLRLVHRTVSLDDIKLIKNAMNMTVNDVVLGVTQASLSQYLERRYGERETKRKRKNLPKR  308

Query  868   ARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFL--PVSLPALTPANASDPLRF  1041
              R  + +L N R    G + + +M++  ++  WGN F ++  P S+     A   DPL  
Sbjct  309   IRLRSALLVNLRP-TTGIQDIADMMENGSKCRWGNWFGYIVFPFSI-----ALRDDPLEH  362

Query  1042  VRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMER  1221
             +++A +II RK+NS    LT    + ++K  G ++ A  I+    N++M  SNM+GP+E+
Sbjct  363   LKRAQKIITRKKNSFGAMLTYIFCRIIVKFLGIQLAATIINRMVSNTTMTFSNMVGPVEQ  422

Query  1222  MSLANHPAKGIYFIIAGI--PQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKC  1374
             +S   HP    YF  +G   P +L +   SY+  + I L V+   I      C
Sbjct  423   VSFYGHPIT--YFASSGYGHPHALTINCQSYMNKMTITLIVDSTVISDPHRLC  473



>ref|XP_002865972.1| hypothetical protein ARALYDRAFT_918418 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42231.1| hypothetical protein ARALYDRAFT_918418 [Arabidopsis lyrata subsp. 
lyrata]
Length=488

 Score =   193 bits (490),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 132/457 (29%), Positives = 220/457 (48%), Gaps = 27/457 (6%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM-VSE  201
             EE  SP ++  NS   +  I+  + S +  +     +I  L+   V  +PRFSSI+ ++ 
Sbjct  14    EEPLSPCSRLFNSPDFNCAIIVTMGSRV--KGDTPAIIHGLEHTLVN-HPRFSSILEMNN  70

Query  202   GINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHL  381
             G  G  +W R +V   EHV VP+      IE  D  L DY+SK+       ++PLWE+HL
Sbjct  71    GKKGKPRWVRTKVKVEEHVIVPDIDPD--IENPDQYLEDYISKLTTIPMDLSKPLWEMHL  128

Query  382   FKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRSK  558
                 T NA    I K+HHSLGDG SLM  +L+C ++  +P ALP     ++R   +  S 
Sbjct  129   LGLKTLNAESFAILKIHHSLGDGMSLMSLLLACTRKTSDPQALPTVAVQKKRFGPSCNSG  188

Query  559   ASNKISGFFKAM---PRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
               NKI   F  +    R LF  F  +  F  ++F    + D  TP+ +   G E  P   
Sbjct  189   FFNKIWWLFVGLWFIIRLLFNTFVDILMFALTIF---FLRDTETPLLA-KPGSELTPKRF  244

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK---------QCEEESSKARCTA  882
                  S D +K +K+ +K+T+NDV+ G+   G   Y+          + +E   K R  +
Sbjct  245   IHRIISFDDVKLVKNAMKMTVNDVLLGVTQAGLSRYLSRRYDQEATPKSKESMRKIRLRS  304

Query  883   LVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRI  1062
              ++ N R    G +++ +M+   ++  WGN F ++   L   +    +DPL +VR+A   
Sbjct  305   AIMINLRP-NTGIEALADMMAKKSKCRWGNLFGYI---LLPFSVGLEADPLEYVRQAKAT  360

Query  1063  IKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHP  1242
             I RK+NS     +    + ++K  G + +   +     ++++  SN++GP E ++   HP
Sbjct  361   IDRKKNSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLTFSNVVGPKEEITFHGHP  420

Query  1243  AKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
                I   + G P +L +   SY   + I+++ +   I
Sbjct  421   LNYISPCVFGHPHALTLHFQSYANKVIISVTADPTVI  457



>ref|XP_003569566.1| PREDICTED: O-acyltransferase WSD1-like [Brachypodium distachyon]
Length=519

 Score =   193 bits (491),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 137/440 (31%), Positives = 221/440 (50%), Gaps = 33/440 (8%)
 Frame = +1

Query  169   NPRFSSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPA--GKPIEFYDDCLSDYLSKMAME  342
             +PRF S+ V +      KW R  VN  +HV VP+  A    P +  D  L DY+S ++  
Sbjct  85    HPRFHSVQVLDAEGARPKWVRTTVNLDDHVVVPDLDAITATPAD-PDRALEDYVSSLSTL  143

Query  343   AFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTF  519
                 +RPLWE+H+  +PT+ AA  + F++HHS+GDG SL+   L+C +R  +P ALP   
Sbjct  144   PMDHSRPLWELHVLDFPTSEAAAALAFRVHHSVGDGVSLLSLFLACTRRTADPSALPAII  203

Query  520   PSRQRSTAA--------PRSKASNKISGFFKA-MPRFLFGAFNTVYDFGWSVFKSTLVED  672
             P+ +R+  A        PR ++   +  F  A +  FL   ++T  D   + F +T    
Sbjct  204   PAARRAGPAVYALPPQRPRLQSLGALLVFLVAWVGSFLVLVWHTAVDV--ACFVATAASA  261

Query  673   DRTP---VRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYG-TRLYM  840
              R P    R  ++GVEFRP      + SLD +K IK+ +  T+NDV+ G+     +R Y 
Sbjct  262   ARDPPTLFRGAEEGVEFRPKRFVNRTLSLDDVKHIKNAMNCTVNDVLLGVASAALSRYYF  321

Query  841   KQCEE---ESSKARCTALVLFNTRAIGGGYKSVTEMIK-PNAEMPWGNQ--FTFLPVSLP  1002
             ++  E   +S K R T LV  N R   G +   + M    ++   WGN+  +  LP  L 
Sbjct  322   RKTGENVRKSIKVRSTLLV--NLRKTPGLHTLASMMESGKDSGAKWGNRLGYMILPFHL-  378

Query  1003  ALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNS  1182
                 A   D L +VR+A ++ +RK++S    LT W    +MK  G +  A   +   +N+
Sbjct  379   ----AKHDDHLEYVREATKVARRKKSSMESVLTYWSASIIMKIFGIKAAASLCYSMMRNT  434

Query  1183  SMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI-DA  1359
             ++  S++ GP E++    HP   I   + G P +L +   SY+  +++ L+V++  + DA
Sbjct  435   TLSFSSLAGPSEQVVFCGHPIVYIAPSVYGHPHALTMHYQSYMRIIKLVLAVDETQVPDA  494

Query  1360  EKFKCCVHHAFEGIYEAALG  1419
              +       + + I EAA G
Sbjct  495   HELLDDFTESLKLIREAAPG  514



>dbj|BAJ97841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score =   193 bits (490),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 134/440 (30%), Positives = 217/440 (49%), Gaps = 35/440 (8%)
 Frame = +1

Query  169   NPRFSSIMVSEGI--NGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAME  342
             +PRF S+ V + +  +   KW R  VN  +HV VP+          D  L  Y+S ++  
Sbjct  80    HPRFCSVQVIDELEEDARPKWVRTTVNLDDHVIVPHLDPTATSADPDRALEKYVSSLSTL  139

Query  343   AFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADN----PALP  510
                 +RPLWE+H+  +PT++AA  V+ ++HHS+GDG SL+   ++C +RA +    P LP
Sbjct  140   PMDHSRPLWELHVLDFPTSDAAAAVVLRVHHSVGDGVSLLSLFIACTRRAADQGALPELP  199

Query  511   LT-----------FPSRQRSTAAPRSKASNKISGFFKA-MPRFLFGAFNTVYDFGWSVFK  654
              T            PSR R     R ++S     F  A +   L  A++T+ D       
Sbjct  200   ATGAPRRAGPVHALPSRPRH----RPRSSWGALAFLAAWVASLLVLAWHTLVDVACFAAT  255

Query  655   STLVEDDRTPVRSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYG-TR  831
             +T +  D   +  G +GVEFRP      + SLD +K +K+ +  T+NDV+ G+     +R
Sbjct  256   ATAMLGDPPTLFKGAEGVEFRPKRFVNRTLSLDDVKYVKNTMSCTVNDVLLGVTSAALSR  315

Query  832   LYMKQCEEESSKA-RCTALVLFNTRAIGGGYKSVTEMI--KPNAEMPWGNQ--FTFLPVS  996
              Y ++  E S K+ +  + +L N R   G +   T M   K N    WGN+  +  LP  
Sbjct  316   FYFRKTGESSRKSIKVRSTLLVNLRKTPGLHALATMMESGKDNGA-EWGNRLGYMILPFH  374

Query  997   LPALTPANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSK  1176
             +     A   DPL +VRKA ++ +RK++S     T W    +MK  G +  A   +G  +
Sbjct  375   I-----AMHDDPLEYVRKATKVARRKKSSMESVFTYWSASVIMKIFGIKAAASLCYGMMR  429

Query  1177  NSSMGISNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKD-FI  1353
             N+++  SN+ GP E++    HP   I   + G P +L +   SY+  +++ L+ E++ F 
Sbjct  430   NTTLSFSNVAGPSEQVVFYGHPIVYIAPSVYGHPHALTMHYQSYMNIIKLVLATEEEQFP  489

Query  1354  DAEKFKCCVHHAFEGIYEAA  1413
             DA +       + + I EAA
Sbjct  490   DAHELLDDFAESLKLIREAA  509



>ref|XP_010445768.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=491

 Score =   192 bits (489),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 132/457 (29%), Positives = 219/457 (48%), Gaps = 27/457 (6%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM-VSE  201
             EE  SP ++  NS   +  I+  +   +  + +   +I  LK   V  +PRFSSI+ ++ 
Sbjct  17    EEPLSPCSRLFNSPDFNCAIIVTMGCRV--KGNTPAIIDGLKRTLVN-HPRFSSILEMNN  73

Query  202   GINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHL  381
             G  G   W R +V   +HV VP       IE  D  L DY+SK+       ++PLWEIH+
Sbjct  74    GKKGKPCWVRTKVKVEDHVIVPEI--DPKIENPDQYLEDYISKLTTIPMDLSKPLWEIHI  131

Query  382   FKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADN-PALPLTFPSRQRSTAAPRSK  558
                 T+NA    + K+HHSLGDG SLM   L+C ++  N  ALP     ++R   +  S 
Sbjct  132   IHLKTSNAESIALLKIHHSLGDGMSLMSLFLACTRKTSNLEALPTVAVQKKRFGPSCNSG  191

Query  559   ASNKISGFFKAM---PRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
               NKI   F  +    R LF  F  +  F  ++F   LV D  TP+ +   G EF P   
Sbjct  192   FFNKIWWLFVGLWFIIRLLFNTFVDILMFALTIF---LVRDTETPLLA-KPGSEFNPKRF  247

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK---------QCEEESSKARCTA  882
                  S D +K +K+ LK+T+NDV+ G+   G   Y+          + +E   + R  +
Sbjct  248   VHRIISFDDVKLVKNALKMTVNDVLLGVTEAGLSRYLSRRYDQEATPKLKESMRRIRLRS  307

Query  883   LVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRI  1062
              ++ N R    G +++ +M+   ++  WGN F ++   L   +    +DPL +VR+A   
Sbjct  308   AIMINLRP-NAGIEALADMMAKKSKCRWGNLFGYI---LLPFSVGLETDPLEYVRRAKAT  363

Query  1063  IKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHP  1242
             I RK++S     +    + ++K  G + +   +     ++++  SN++GP E ++   HP
Sbjct  364   IDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLTFSNVVGPKEEITFHGHP  423

Query  1243  AKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
                I   + G P +L +   SY   + I+++ +   I
Sbjct  424   LSYIAPCVFGHPHALTIHFQSYANKVIISVTADPTVI  460



>ref|XP_010035244.1| PREDICTED: O-acyltransferase WSD1-like [Eucalyptus grandis]
 gb|KCW46541.1| hypothetical protein EUGRSUZ_K00371 [Eucalyptus grandis]
Length=505

 Score =   193 bits (490),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 144/466 (31%), Positives = 232/466 (50%), Gaps = 46/466 (10%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGI  207
             E  SP+A+  ++   +  IL ++  +  I     +V + L++  +  +PRFSS MV +  
Sbjct  29    EKLSPAARLFHAPRFNCYILAIMGCKTRINPG--VVKAGLEETLLK-HPRFSSKMVGDIK  85

Query  208   NGGK-KWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
               GK KW + ++N  EHV VP+      ++  D  + DY+S +       +RPLWE+HL 
Sbjct  86    RSGKMKWVQTKMNLDEHVIVPD--VDPDMDTPDRFVEDYISYLTKTPLDMSRPLWELHLL  143

Query  385   KYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRSKA  561
                T++A    IF++HHS+GDG SLM  +L+C ++  +P ALP T P ++ +     ++ 
Sbjct  144   NVKTSDAEAVAIFRIHHSMGDGASLMSLLLACTRKTADPEALP-TIPGKKSAG----TQN  198

Query  562   SNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMS  741
             S     F  A+       +NT+ DF   V     ++D  + V+ G        +A TT  
Sbjct  199   SGGFWWFILALWSMFRLIWNTIVDFSVFVATYCFLKDTESLVKGGPG------VAKTTKR  252

Query  742   F-----SLDQIKQIKDKLKVTINDVVTGIIIYGTRLYM-KQCEEESSK------------  867
             F     SLD IK IK  L +TINDVV G+   G   Y+ ++ E ES K            
Sbjct  253   FVHRTVSLDDIKLIKSALNMTINDVVLGVTQAGLSRYLNRRYEGESGKDQNSKKKKSNIP  312

Query  868   --ARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQ--FTFLPVSLPALTPANASDPL  1035
                R  A VL N R    G +++++M+  N++  WGN   +  +P S+      +  DPL
Sbjct  313   KNMRLRATVLINLRPT-AGIQALSDMMIKNSKCKWGNWIGYILIPFSI-----GSEDDPL  366

Query  1036  RFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPM  1215
              +V KA   I RK+ S    +T    + ++K  G +V +   H    N+++  SN+IGP+
Sbjct  367   EYVHKAKATIDRKKLSLEAIITFVCAELVLKLFGVKVASAIAHRFLSNTTVAFSNVIGPV  426

Query  1216  ERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             E +S   HP   +   + G P +L +   SYV  + IA++V+ D I
Sbjct  427   EEISFYGHPIAFLAPSVYGHPHALTIHFQSYVNKMTIAVAVDPDVI  472



>ref|XP_006401711.1| hypothetical protein EUTSA_v10013378mg [Eutrema salsugineum]
 gb|ESQ43164.1| hypothetical protein EUTSA_v10013378mg [Eutrema salsugineum]
Length=489

 Score =   192 bits (488),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 130/454 (29%), Positives = 220/454 (48%), Gaps = 20/454 (4%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM-VSE  201
             EE  SP ++  NS   +  I+  +  ++  + + + +I  LK   V  +PRFSSI+ + +
Sbjct  14    EEPLSPCSRLFNSPEFNCAIIVTMGCKV--KGNPAAIIDGLKHTLVN-HPRFSSILEMDK  70

Query  202   GINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHL  381
             G  G   W R +VN  EHV VP+      IE +D  L DY+SK+       ++PLWEIHL
Sbjct  71    GKKGKPSWVRTKVNVEEHVIVPDIDPDN-IENHDQYLEDYISKLTTIPMDLSKPLWEIHL  129

Query  382   FKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRSK  558
                 T+NA    + K+HHSLGDG SLM   L+C +++ +P ALP     ++R      S 
Sbjct  130   LCLKTSNAESIGLLKIHHSLGDGMSLMSLFLACTRKSSDPEALPTVAVQKKRFGPRCYSG  189

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
               NKI  FF  +   L   FNT  D          + D  TP+ +   G E  P      
Sbjct  190   FFNKIWWFFLGLWCILRLFFNTFVDVLMFALTICFLRDTETPLLA-KPGSELIPKRFVHR  248

Query  739   SFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK---------QCEEESSKARCTALVL  891
               S D +K +K+ +K+T+NDV+ G+   G   Y+          + +E   + R  + ++
Sbjct  249   IISFDDVKLVKNAMKMTVNDVLLGVTQAGLSRYLNRRYDQEATPKSKESMRRIRLRSAIM  308

Query  892   FNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKR  1071
              N R    G +++ +M+   ++  WGN F ++   L   +    +DPL +VR+A   + R
Sbjct  309   INLRP-NTGIEALADMMAKKSKCRWGNLFGYI---LLPFSVGLETDPLEYVRRAKDTVDR  364

Query  1072  KRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKG  1251
             K++S     +    + ++K  G + +   +     ++++  SN++GP E ++   HP   
Sbjct  365   KKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPKEEITFHGHPLSY  424

Query  1252  IYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             I   + G P +L +   SY   + I+++ +   I
Sbjct  425   IAPSVFGHPHALTLHFQSYENKVIISVTADPTVI  458



>gb|AGT16887.1| hypothetical protein SHCRBa_165_I15_F_280 [Saccharum hybrid cultivar 
R570]
Length=552

 Score =   193 bits (491),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 130/434 (30%), Positives = 215/434 (50%), Gaps = 25/434 (6%)
 Frame = +1

Query  169   NPRFSSIMVSEG---INGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAM  339
             +PRFSSI V++     +   +W R  VN  +HV VP           D  + DYLS ++ 
Sbjct  122   HPRFSSIQVNDDDARKSAKPRWVRTTVNLDDHVIVPYLDPSATSTKPDQAVEDYLSWLST  181

Query  340   EAFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPA-LPLT  516
                  +RPLWE H+  +PT+ A   V  ++HHSLGDG SL+  +++C + A +PA LP  
Sbjct  182   APMDHSRPLWEFHVLDFPTSEATATVAIRMHHSLGDGVSLLSLLIACTRSAADPARLPEL  241

Query  517   FPSRQRST---AAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPV  687
              P+ +R+    A PR   S  +  F   +  ++  A++T+ D    V  +  + D RTP 
Sbjct  242   PPAPRRAGPLFARPRPPLSAGLVAFVLWLWSYVVLAWHTLVDVVCFVATAWFLRDQRTPF  301

Query  688   RSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYG-TRLYMKQCEEESS  864
              +  +GVEFR       + +LD +K +K+ +K T+NDV+ G+   G ++ Y ++  + +S
Sbjct  302   MAASEGVEFRRKRFVHRTLNLDDVKFVKNAMKCTVNDVLIGVTNAGLSQYYFRKTSDTNS  361

Query  865   KA------RCTALVLFNTRAIGGGYKSVTEMIK--PNAEMPWGN--QFTFLPVSLPALTP  1014
             +       R  + +L N R    G  +++EM+    N+   WGN   +  LP  +     
Sbjct  362   ERKKSQSIRVRSALLVNIRKT-PGLHALSEMMDSGKNSGAKWGNLIGYMILPFHI-----  415

Query  1015  ANASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGI  1194
             A   DPL ++R+  R  +RK+ S     T W    ++K  G +  A   +G   N++M  
Sbjct  416   AMHDDPLEYIRQGKRTAERKKASLEAVFTYWSGNLIVKLFGMKAAAALCYGMFTNTTMSF  475

Query  1195  SNMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEK-DFIDAEKFK  1371
             S+M GP E++    HP   I   + G P +L V   SY  S+++ L+V+   F D+ +  
Sbjct  476   SSMGGPAEKVEFYGHPIVYIAPSVYGHPHALTVHYQSYTNSIKLVLAVDDAQFPDSHQLL  535

Query  1372  CCVHHAFEGIYEAA  1413
                  +   I +AA
Sbjct  536   DDFAESLRLIRQAA  549



>ref|XP_010537088.1| PREDICTED: O-acyltransferase WSD1 isoform X1 [Tarenaya hassleriana]
Length=477

 Score =   191 bits (486),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 142/481 (30%), Positives = 231/481 (48%), Gaps = 34/481 (7%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP ++  NS   + +I+  L  +   + + + +I  LK+  +  +PRFSS +    
Sbjct  5     EEPLSPGSRLFNSPEFNCSIIVTLGCKT--RGNPNAIIDGLKNTLIN-HPRFSSKLEMNR  61

Query  205   INGGK-KWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHL  381
              NGGK  W R +V   +HV VP+      +E  D  L DY+S +       ++PLWEIHL
Sbjct  62    GNGGKPTWVRTKVRVEDHVVVPDIDPD--MEEPDKFLEDYISNLTTLPMDMSKPLWEIHL  119

Query  382   FKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRSK  558
             F   T++A    + K+HHSLGDG SLM   L+C ++  NP ALP     ++R   +P   
Sbjct  120   FNLKTSDAESVGVLKIHHSLGDGMSLMSLFLACTRKTSNPEALPTIASKKKRIGPSP---  176

Query  559   ASNKISGFFKA---MPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
             + N I  FF     M R +F  F  VY F  ++F    + D  TP+ S    +   P   
Sbjct  177   SLNSIFRFFVRVWFMIRLIFNTFVDVYKFAATLF---FLRDTETPIMSKPAAMAPNPRRC  233

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYM-KQCEEESS--------KARCTA  882
                  S + +K +K+ +K+TINDV+ G+   G   Y+ ++ ++E +        + R  +
Sbjct  234   VHRIISFEDVKLVKNAMKMTINDVLLGVTQAGISRYLSRRYDQEGTPKSKKFMGRIRLHS  293

Query  883   LVLFNTRAIGGGYKSVTEMIKPNAEMPWGN--QFTFLPVSLPALTPANASDPLRFVRKAH  1056
              ++ N R    G +++ +M+   ++  WGN   +  LP S+        +DPL +VR+A 
Sbjct  294   AIMINLRP-NTGIEALADMMAKGSKCRWGNLIGYVLLPFSV-----GLENDPLEYVRRAK  347

Query  1057  RIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLAN  1236
               I RK+ S    L+  + +  +   G +     +     N++M  SN++GP E +S   
Sbjct  348   STIDRKKLSLEAVLSYAIFKFTINVLGFKAGEALVKRVFGNTTMTFSNLVGPKEEISFYG  407

Query  1237  HPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI-DAEKFKCCVHHAFEGIYEAA  1413
             HP   I     G P +L +   SY   + IA++V+   I D  +       +FE I  A 
Sbjct  408   HPISYIASSAFGHPHALSLHFQSYADKIIIAMAVDPTVIPDPHRLCDDFSESFETIKSAV  467

Query  1414  L  1416
             L
Sbjct  468   L  468



>ref|XP_010519416.1| PREDICTED: O-acyltransferase WSD1-like [Tarenaya hassleriana]
Length=500

 Score =   191 bits (486),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 134/463 (29%), Positives = 233/463 (50%), Gaps = 36/463 (8%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGIN-G  213
             SP+A+  +S   +  I+ V+  +  I     ++   LK+  +  +PRFSS +V +G    
Sbjct  22    SPAARLFHSPEFNCYIISVIGCKTKIDTD--VITQGLKETLIR-HPRFSSKLVIDGDKRQ  78

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPI-EFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKY  390
              ++W R +VN  +HV VP+  A + + E  D+ L +Y+S +       +RPLWE+H+   
Sbjct  79    NQRWVRTKVNVEDHVVVPDMVASRRMTENPDEFLENYVSNLTSTPLDVSRPLWELHVLDI  138

Query  391   PTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADN----PALPLTFPSRQRSTAAPRSK  558
              T++A    + K+HHS+GDG SLM  +L+C ++  N    P+LP+   S+ R T     +
Sbjct  139   KTSDAENVAVLKVHHSIGDGMSLMSLVLACTRKTSNPMEIPSLPVKNRSKSRLTGL---R  195

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGV-EFRPIATTT  735
             + ++      A+   +   FNT  D    V  +  ++D  TP++    G+ E +P     
Sbjct  196   SQSRFWWLVLALWSSVLLVFNTFCDAFEFVATTLFLKDTETPIKGKRGGLMEEKPRRFVH  255

Query  736   MSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYM---------KQCEEESS------KA  870
              + S D IK IK+ + +T+NDV+ GI + G   Y+         KQ  +E +      + 
Sbjct  256   RTMSFDDIKLIKNTMNMTVNDVLLGITLAGLSRYLNRKYGDTEEKQEAKERNQDNLPKRI  315

Query  871   RCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQ--FTFLPVSLPALTPANASDPLRFV  1044
             R  A VL N R    G +++ +M+   ++  WGN   +  +P S+     A   DPL  +
Sbjct  316   RLRAAVLVNLRP-DAGIQALADMMSKGSKCKWGNWIGYVVIPFSI-----ATRDDPLEHL  369

Query  1045  RKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERM  1224
             R+A   I RK++S   +LT  + + +++T G +  A  I     N++M  SNM+GP+E +
Sbjct  370   RRAKDTIDRKKHSLEAFLTFSVGKFILETFGVKAAADIIGRAVSNTTMSFSNMMGPVEEI  429

Query  1225  SLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             S   HP   +     G P +L +   SY+  + ++L+V+   I
Sbjct  430   SFYGHPITYLAPSAYGHPHALTMHFQSYMNKMTMSLTVDSTVI  472



>gb|EAY98969.1| hypothetical protein OsI_20927 [Oryza sativa Indica Group]
Length=565

 Score =   192 bits (489),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 126/418 (30%), Positives = 208/418 (50%), Gaps = 23/418 (6%)
 Frame = +1

Query  169   NPRFSSIMVSEGINGGKK--WKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAME  342
             +PRF S+ VS+  +   K  W R  VN  +H+  P           D  + DY+S ++ +
Sbjct  134   HPRFCSVQVSDEASKRAKPRWVRTTVNLDDHLIFPELDPTATSASPDQVIEDYMSTLSTQ  193

Query  343   AFPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPA-LPLTF  519
                 +RPLWE+H+  +PT+ AA  V  ++HHSLGDG SL+  +++C + A +PA LP   
Sbjct  194   PMDHSRPLWELHVLDFPTSEAAATVAVRMHHSLGDGVSLLSLLIACTRSAADPARLPALP  253

Query  520   PSRQRSTAAPRSKASNKISGFFKAMP----RFLFGAFNTVYDFGWSVFKSTLVEDDRTPV  687
             P+  R      ++    +S    A+      +L  A +T+ D    V  S  + D RTP+
Sbjct  254   PAPARRDGPVYARRRPPLSAGIVALAAWAWSYLVLALHTLVDVACFVATSLFLRDARTPL  313

Query  688   RSGDDGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYG-TRLYMKQCEEESS  864
               G +GVEFR       + SLD +K +K+ +K T+NDV+ G+     +R Y ++  + +S
Sbjct  314   -MGTEGVEFRRKRFVHCTLSLDDVKLVKNAMKCTVNDVLVGVTSAALSRYYFRKENDTNS  372

Query  865   KA-------RCTALVLFNTRAIGGGYKSVTEMIKPNAE--MPWGNQFTFLPVSLPALTPA  1017
             +        R  + +L N R   G +  + EM+  N      WGN   +  + LP    A
Sbjct  373   EKRTRRKHIRVRSALLVNIRKTPGLH-VLAEMMNSNKNNVARWGNLIGY--IVLP-FRIA  428

Query  1018  NASDPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGIS  1197
                DPL ++R+  R + RK++S     T W    ++K  G +  A   HG   N+++  S
Sbjct  429   MFHDPLEYIRQGKRTVDRKKSSLEAIFTYWSGNLIVKLFGIKTAAALCHGMLANTTLSFS  488

Query  1198  NMIGPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEK-DFIDAEKF  1368
             +M+GP E++    HP + I   + G P +L V   SY+  +++ L+V+   F DA + 
Sbjct  489   SMVGPAEKVEFYGHPIEYIAPSVYGHPHALTVHYQSYMNIIKLVLAVDDAQFPDAHQL  546



>ref|XP_004979822.1| PREDICTED: O-acyltransferase WSD1-like [Setaria italica]
Length=508

 Score =   191 bits (486),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 138/484 (29%), Positives = 236/484 (49%), Gaps = 47/484 (10%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQ---ASDSLVISLLKDVFVPINPRFSSIMV  195
             +E  SP+AQ          I+ V+    PI    A   L ++L++      +PRF SI V
Sbjct  32    DEPLSPTAQLYGD----FCIVAVVGLAAPIDIELARAGLEVTLVR------HPRFCSIHV  81

Query  196   SEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
             ++G     +W R  VN  +H+ VP+          D  L DY+S ++      +RPLWE+
Sbjct  82    TDGPE--HRWVRTPVNLDDHIIVPDLDPAAIAADPDKVLEDYVSSLSTLPMDKSRPLWEL  139

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPS----------  525
             H+  +PT+ AA   +F+++H+LGDG SL+  +L+C + A +P      PS          
Sbjct  140   HILDFPTSEAASAAVFRINHALGDGTSLISLLLACTRSATDPKTLPVMPSAMPPPARLKG  199

Query  526   -RQRSTAAPRSKASNKISGFFKAMPRFLFGAFNTVYD-FGWSVFKSTLVEDDRTPVRSGD  699
              R+   A+P    S     F   +   +  A++T+ D   ++     LV D RT V +  
Sbjct  200   RRRVYGASPPPARSAGAMAFVAWVLSCVLLAWHTIVDVVSFAALALDLVRDPRT-VFTAV  258

Query  700   DGVEFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYG-TRLYMKQCEEESSKARC  876
              GVEFR     +   SLD +K +K+ L  T+NDV+ G+     +R Y ++  ++++K   
Sbjct  259   KGVEFRRKRLVSRGLSLDDVKHVKNVLGCTVNDVLVGVTSAALSRYYFRKSGDDATKKDV  318

Query  877   T--ALVLFNTRAIGGGYKSVTEMIKPNAE--MPWGNQF--TFLPVSLPALTPANASDPLR  1038
                +L++ N R+   G + + +M++P+    + WGN      LP  +     A   DPL 
Sbjct  319   CLRSLLMVNVRST-PGIQELAQMMEPSKHNGVKWGNPVGQIILPFYI-----AMYDDPLE  372

Query  1039  FVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPME  1218
             +VRKA +++ RK++S  V +T  + +   +  G++V+    H    N+++  SNMIGP+E
Sbjct  373   YVRKAKKVVDRKKHSLEVIVTHGIGKRGTELFGTKVSGAIFHRMVSNTTVAFSNMIGPVE  432

Query  1219  RMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVHHAFEG  1398
             ++    H    I   + G   +L +   SY  ++R+ L+V     D  +F  C HH  + 
Sbjct  433   QVEFYGHRVVYIAPSVCGNTSALTIHWQSYADTIRVVLAV-----DDSQFPDC-HHLLDD  486

Query  1399  IYEA  1410
               E+
Sbjct  487   FAES  490



>emb|CDY47071.1| BnaA03g12270D [Brassica napus]
Length=490

 Score =   191 bits (485),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 135/458 (29%), Positives = 217/458 (47%), Gaps = 27/458 (6%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP ++  NS   +  I+ ++  ++  + +   +I  LK   V  +PRFSSI++ E 
Sbjct  14    EEPLSPCSRLFNSPDFNCAIIVIMGCKV--KGNPPAIIDGLKHTLVN-HPRFSSILIQEM  70

Query  205   INGGK---KWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
              NG K    W R EV   +HV VP+      IE  D  L  Y+SK+       ++PLWEI
Sbjct  71    KNGKKGKPSWVRTEVRVEDHVIVPDIDPN--IENPDQYLEHYISKLTTVPMDFSKPLWEI  128

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPR  552
             HL    T+NA    + K+HHSLGDG SLM   L+C ++  +P ALP    S QR    P 
Sbjct  129   HLLCLKTSNAESIGLLKIHHSLGDGMSLMSLFLACTRKTSDPEALPTV--SVQRKQFGPS  186

Query  553   SKAS--NKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIA  726
             S     NKI   F  +   L   FNT  D          + D  TP+ +   G E  P  
Sbjct  187   SYNGFFNKIWWLFVGLRFILRLVFNTFVDVLMFALTICFLRDTETPLLA-KPGTELVPKR  245

Query  727   TTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK---------QCEEESSKARCT  879
                   S D +K +K+ +K+T+NDV+ G+   G   Y+          + +E   K R  
Sbjct  246   FVHRIISFDDVKLVKNAMKLTVNDVLLGVTQAGLSRYLSRRYDQEATPKSKESMRKFRLR  305

Query  880   ALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHR  1059
             + ++ N R    G +++ +M+   ++  WGN F ++   L   +    +DPL +VR+A  
Sbjct  306   SAIMINLRP-NTGIEALADMMAKKSKCRWGNLFGYI---LLPFSVGLETDPLEYVRRAKV  361

Query  1060  IIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANH  1239
              + RK++S     +    + ++K  G + +   +     N+++  SN++GP E ++   H
Sbjct  362   TVDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHNTTLTFSNVVGPKEEITFHGH  421

Query  1240  PAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             P   I   + G P +L V   SY   + I+++ +   I
Sbjct  422   PLSYIAPSVFGHPHALTVHFQSYEKKVIISVTADPTVI  459



>dbj|BAB09801.1| unnamed protein product [Arabidopsis thaliana]
Length=485

 Score =   191 bits (484),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 131/458 (29%), Positives = 223/458 (49%), Gaps = 32/458 (7%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP ++  NS   +  I+  + S++  +     +I  L+   V  +PRFSSI+    
Sbjct  14    EEPLSPCSRLFNSPDFNCAIIVTMGSKV--KGDTPAIIHGLEHTLVN-HPRFSSIL----  66

Query  205   INGGKK--WKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIH  378
             +N GKK  W R +V   EHV VP+      IE  D  L DY+SK+       ++PLWE+H
Sbjct  67    MNNGKKPRWVRTKVKVEEHVIVPD--VDPDIENPDQYLEDYISKLTTIPMDLSKPLWEMH  124

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRS  555
             L    T+NA    I K+HHSLGDG SLM  +L+C ++  +P ALP     ++R   +  S
Sbjct  125   LLGVKTSNAESYAILKIHHSLGDGMSLMSLLLACTRKTSDPEALPTVAVHKKRFGPSCNS  184

Query  556   KASNKISGFFKAM---PRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIA  726
                NKI   F  +    R LF  F  +  F  ++F   ++ D  TP+ +   G E  P  
Sbjct  185   GFFNKIWWLFVGLWFILRLLFNTFVDILMFALTIF---VLRDTETPLLA-KPGSELIPKR  240

Query  727   TTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK---------QCEEESSKARCT  879
                   S D +K +K+ +K+T+NDV+ G+   G   Y+          + +E   + R  
Sbjct  241   FVHRIISFDDVKLVKNAMKMTVNDVLLGVTQAGLSRYLSRKYDQEATPKSKESMRRIRLR  300

Query  880   ALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHR  1059
             + ++ N R    G +++ +M+   ++  WGN F ++   L   +    +DPL +VR+A  
Sbjct  301   SAIMINLRP-NAGIEALADMMAKKSKCRWGNLFGYI---LLPFSVGLETDPLEYVRQAKA  356

Query  1060  IIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANH  1239
              I RK++S     +    + ++K  G + +   +     ++++  SN++GP E ++   H
Sbjct  357   TIDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPKEEITFHGH  416

Query  1240  PAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             P   I   + G P +L +   +Y   + I+++ +   I
Sbjct  417   PLNYISPCVFGHPHALTLHFQTYANKVIISVTADPTVI  454



>ref|XP_007051549.1| O-acyltransferase family protein, putative [Theobroma cacao]
 gb|EOX95706.1| O-acyltransferase family protein, putative [Theobroma cacao]
Length=510

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 142/464 (31%), Positives = 225/464 (48%), Gaps = 41/464 (9%)
 Frame = +1

Query  25    EEAASPSAQFL---NSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMV  195
             EE  SPSA+     N +V  +  LG      P     +L  +LLK      +PRFSS+ V
Sbjct  40    EEPLSPSARLFHEPNFNVYIIATLGCKTRIYPDVVKANLGHTLLK------HPRFSSLQV  93

Query  196   SEGINGGK-KWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWE  372
              +  N G+ KW R EV+   HV VP+      ++  D  L DY+  ++      ++PLW+
Sbjct  94    EDEDNKGEMKWVRTEVDLERHVVVPDLDPN--MDLPDKFLEDYIYNLSKTTIDKSQPLWD  151

Query  373   IHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAP  549
             +HL    T+ +    +F++HHSLGDG SLM  +L+C ++ ++P ALP T P R+      
Sbjct  152   LHLLNLRTSQSEAVGVFRIHHSLGDGTSLMSLLLACTRQMNDPLALP-TIPIRK------  204

Query  550   RSKASNKISGFFKAMPRF--LFGAF-NTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRP  720
             + +  N   GF++ M     +F  F N+V D    +  + L++D   P + G  GVEF P
Sbjct  205   KQERKNDRRGFWRIMFMLCSVFQVFWNSVVDVFMFMATALLLKDTENPFK-GLPGVEFTP  263

Query  721   IATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK-------------QCEEES  861
                   + SLD IK +K+ +  T+NDV  GI   G   Y+              + +   
Sbjct  264   RRIVYGTVSLDDIKLVKNAMNTTVNDVALGITQAGLSRYINRIYGGNKNDGAAIEMDNLP  323

Query  862   SKARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRF  1041
                R  + +L N R    G +++ +M++ +AE  WGN   +  V LP  T A   DPL +
Sbjct  324   KSIRLRSTLLVNIRP-SAGIQALADMMEKDAEAKWGNWIGY--VLLP-FTIAIRDDPLDY  379

Query  1042  VRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMER  1221
             VR A   I RK+ S     T  + + ++K  G +  +   H    +++M  SN++GP+E 
Sbjct  380   VRDAKATIDRKKRSLEAIYTFSIAELVLKLFGVKAASALSHRIMSHTTMCFSNLVGPLEE  439

Query  1222  MSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             +    HP   +     G P +L +   SY+  + I LSV++  I
Sbjct  440   IGFYGHPIAFLAPSSYGQPHALMINFQSYIDKMTIVLSVDEGTI  483



>gb|KDP24675.1| hypothetical protein JCGZ_26453 [Jatropha curcas]
Length=498

 Score =   191 bits (484),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 145/479 (30%), Positives = 235/479 (49%), Gaps = 40/479 (8%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP+A   ++   +  I+ V+  +IPI   D  ++ L  +  +  +PRFSS +V + 
Sbjct  14    EETLSPAALLFHAPHFNCHIIAVMGCKIPI---DPTIVKLGLEHTLIKHPRFSSKLVIK-  69

Query  205   INGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLF  384
              +   KW    VN  +HV VPN      IE  +  + DY+S +       ++PLWE+HL 
Sbjct  70    -SRKMKWTPTTVNVQDHVIVPNL--DNKIESPNQFIEDYISHLTTIPMDSSKPLWELHLL  126

Query  385   KYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRSKA  561
                ++ A    IFK+HHS+GDG SLM  +L+C ++  +P ALP T P ++R++A+  S A
Sbjct  127   NLKSSYAEAIGIFKIHHSIGDGASLMSLLLACTRKTSDPEALP-TIPMQKRASASNSSTA  185

Query  562   SNK---------ISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEF  714
             S           +   F  +   L   +NT+ D    V     ++D +TP + G+ GV+ 
Sbjct  186   SASASASASSNGLQKLFWNIFMILKLVWNTLVDLILFVSTILFLKDTKTPFK-GESGVDL  244

Query  715   RPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSK---------  867
             +P      S SLD IK +K+K+ +TINDV+ GI   G   Y+     ++ K         
Sbjct  245   KPKRFVYRSVSLDDIKLVKNKMNMTINDVILGITQAGLSRYLNHQFGKNEKDGDRKHKKI  304

Query  868   -----ARCTALVLFNTRAIGGGYKSVTEMI--KPNAEMPWGNQFTFLPVSLPALTPANAS  1026
                   R  A VL N R +  G +++ E++  +   +  WGN   ++ V     T A   
Sbjct  305   SLQKSIRLRATVLVNLRPV-VGIQTLAELMGKESKGKWGWGNSIGYIMV---PFTIALQD  360

Query  1027  DPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMI  1206
             DPL ++RKA   I RK+ S     T  + + ++ T G +V     H    N+++  SN++
Sbjct  361   DPLDYIRKAKATIDRKKLSLEAIFTFQIAKLVIMTFGHKVAGAIAHRFLSNTTLAFSNVV  420

Query  1207  GPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFIDAEKFKCCVH  1383
             GP+E +S   HP   +   + G P +L +   SY   + I ++V+ D I +   K C H
Sbjct  421   GPLEDISFYGHPIDFLAPSVYGHPHALTIHFQSYSNKMTIVIAVDPDVI-SNPHKLCDH  478



>ref|NP_200151.2| bifunctional wax ester synthase/diacylglycerol acyltransferase 
[Arabidopsis thaliana]
 dbj|BAD83884.1| FOLDED PETALS [Arabidopsis thaliana]
 gb|AED96347.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
Length=486

 Score =   190 bits (483),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 131/458 (29%), Positives = 223/458 (49%), Gaps = 31/458 (7%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP ++  NS   +  I+  + S++  +     +I  L+   V  +PRFSSI+    
Sbjct  14    EEPLSPCSRLFNSPDFNCAIIVTMGSKV--KGDTPAIIHGLEHTLVN-HPRFSSIL---E  67

Query  205   INGGKK--WKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIH  378
             +N GKK  W R +V   EHV VP+      IE  D  L DY+SK+       ++PLWE+H
Sbjct  68    MNNGKKPRWVRTKVKVEEHVIVPD--VDPDIENPDQYLEDYISKLTTIPMDLSKPLWEMH  125

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRS  555
             L    T+NA    I K+HHSLGDG SLM  +L+C ++  +P ALP     ++R   +  S
Sbjct  126   LLGVKTSNAESYAILKIHHSLGDGMSLMSLLLACTRKTSDPEALPTVAVHKKRFGPSCNS  185

Query  556   KASNKISGFFKAM---PRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIA  726
                NKI   F  +    R LF  F  +  F  ++F   ++ D  TP+ +   G E  P  
Sbjct  186   GFFNKIWWLFVGLWFILRLLFNTFVDILMFALTIF---VLRDTETPLLA-KPGSELIPKR  241

Query  727   TTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK---------QCEEESSKARCT  879
                   S D +K +K+ +K+T+NDV+ G+   G   Y+          + +E   + R  
Sbjct  242   FVHRIISFDDVKLVKNAMKMTVNDVLLGVTQAGLSRYLSRKYDQEATPKSKESMRRIRLR  301

Query  880   ALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHR  1059
             + ++ N R    G +++ +M+   ++  WGN F ++   L   +    +DPL +VR+A  
Sbjct  302   SAIMINLRP-NAGIEALADMMAKKSKCRWGNLFGYI---LLPFSVGLETDPLEYVRQAKA  357

Query  1060  IIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANH  1239
              I RK++S     +    + ++K  G + +   +     ++++  SN++GP E ++   H
Sbjct  358   TIDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPKEEITFHGH  417

Query  1240  PAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             P   I   + G P +L +   +Y   + I+++ +   I
Sbjct  418   PLNYISPCVFGHPHALTLHFQTYANKVIISVTADPTVI  455



>ref|XP_009132482.1| PREDICTED: O-acyltransferase WSD1-like [Brassica rapa]
Length=490

 Score =   190 bits (483),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 135/458 (29%), Positives = 217/458 (47%), Gaps = 27/458 (6%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP ++  NS   +  I+ ++  ++  + +   +I  LK   V  +PRFSSI++ E 
Sbjct  14    EEPLSPCSRLFNSPDFNCAIIVIMGCKV--KGNPPAIIDGLKHTLVN-HPRFSSILIQEM  70

Query  205   INGGK---KWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
              NG K    W R EV   +HV VP+      IE  D  L  Y+SK+       ++PLWEI
Sbjct  71    KNGKKGKPSWVRTEVRVEDHVIVPDIDPN--IENPDQYLEHYISKLTTVPMDFSKPLWEI  128

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPR  552
             HL    T+NA    + K+HHSLGDG SLM   L+C ++  +P ALP    S QR    P 
Sbjct  129   HLLCLKTSNAESIGLLKIHHSLGDGMSLMSLFLACTRKTSDPEALPTV--SVQRKQFGPS  186

Query  553   SKAS--NKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIA  726
             S     NKI   F  +   L   FNT  D          + D  TP+ +   G E  P  
Sbjct  187   SYNGFFNKIWWLFVGLWFILRLVFNTFVDVLMFALTICFLRDTETPLLA-KPGTELVPKR  245

Query  727   TTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK---------QCEEESSKARCT  879
                   S D +K +K+ +K+T+NDV+ G+   G   Y+          + +E   K R  
Sbjct  246   FVHRIISFDDVKLVKNAMKLTVNDVLLGVTQAGLSRYLSRRYDQEATPKSKESMRKFRLR  305

Query  880   ALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHR  1059
             + ++ N R    G +++ +M+   ++  WGN F ++   L   +    +DPL +VR+A  
Sbjct  306   SAIMINLRP-NTGIEALADMMAKKSKCRWGNLFGYI---LLPFSVGLETDPLEYVRRAKV  361

Query  1060  IIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANH  1239
              + RK++S     +    + ++K  G + +   +     N+++  SN++GP E ++   H
Sbjct  362   TVDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHNTTLTFSNVVGPKEEITFHGH  421

Query  1240  PAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             P   I   + G P +L V   SY   + I+++ +   I
Sbjct  422   PLSYIAPSVFGHPHALTVHFQSYEKKVIISVTADPTVI  459



>ref|XP_006282349.1| hypothetical protein CARUB_v10028646mg [Capsella rubella]
 gb|EOA15247.1| hypothetical protein CARUB_v10028646mg [Capsella rubella]
Length=496

 Score =   190 bits (483),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 129/450 (29%), Positives = 218/450 (48%), Gaps = 21/450 (5%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM-VSEGING  213
             SP ++  NS   +  I+  +   +  +A+   ++  LK   V  +PRFSSI+ ++ G  G
Sbjct  26    SPCSRLFNSPDFNCAIIVTMGCRV--KANPPAIVDGLKHTLVN-HPRFSSILEMNNGKKG  82

Query  214   GKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHLFKYP  393
                W R +V   +HV VP+      IE  D  L DY+SK+       ++PLWE+H+    
Sbjct  83    KPCWVRTKVRVEDHVIVPDI--DPKIENPDKYLEDYISKLTTIPMDLSKPLWEMHILNLK  140

Query  394   TTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRSKASNK  570
             T+NA    I K+HHSLGDG SLM   L+C ++  NP ALP     ++R   +  S   NK
Sbjct  141   TSNAESIAILKIHHSLGDGMSLMSLFLACTRKTSNPEALPTVAVQKKRLVPSCNSGFFNK  200

Query  571   ISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSFSL  750
             I   F  +   L   FNT  D          V D  TP+ +   G E  P        S 
Sbjct  201   IWWLFVVLWFILRLLFNTFVDILMFALTILFVRDTETPLLA-KPGSELIPKRFVHRIISF  259

Query  751   DQIKQIKDKLKVTINDVVTGIIIYG-TRLYMKQCEEESS--------KARCTALVLFNTR  903
             D +K +K+ LK+T+NDV+ G+   G TR   ++ ++E++        K R  + ++ N R
Sbjct  260   DDVKLVKNALKMTVNDVLLGVTEAGLTRYLSRRYDQEATPKSKESMRKIRLRSAIMINLR  319

Query  904   AIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNS  1083
                 G +++ +M+   ++  WGN F ++   L   +    +DPL +VR+A   + RK++S
Sbjct  320   P-NAGIEALADMMAKKSKCRWGNLFGYI---LLPFSVGQETDPLEYVRRAKATVDRKKHS  375

Query  1084  ASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFI  1263
                  +    + ++K  G + +   +     ++++  SN++GP E ++   HP   I   
Sbjct  376   LEAVFSMAFFKVILKVFGLKASVVLVRKVIHSTTLSFSNVVGPKEEITFHGHPLSYIAPC  435

Query  1264  IAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             + G P +L +   SY   + I+++ +   I
Sbjct  436   VFGHPHALTLHFQSYANKVIISVTADPTII  465



>ref|XP_004228362.1| PREDICTED: O-acyltransferase WSD1-like [Solanum lycopersicum]
Length=506

 Score =   191 bits (484),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 129/469 (28%), Positives = 221/469 (47%), Gaps = 30/469 (6%)
 Frame = +1

Query  4     EMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQAS----DSLVISLLKDVFVPIN  171
             E +    EE  SPS++  +    ++ +L +L  +  I       D L  +LLK      +
Sbjct  20    EAINESEEEPLSPSSRLFHEPNFNVHVLAILGMKTRINTEQAPRDHLANTLLK------H  73

Query  172   PRFSSIMVSEGINGGK-KWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAF  348
             PRFSS+ V +   GG+ +W R EV+  +H+ VP        E  D  + +Y+  ++    
Sbjct  74    PRFSSLQVVDEKKGGEMRWVRTEVDIDQHIIVPQIDEQNLKESPDKFVENYIHNLSKTTL  133

Query  349   PPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSR  528
               ++P+W++HL    T++A    I ++HHSLGDG SL+  +L+C ++  +PA   T P  
Sbjct  134   DKSKPMWDLHLLNIKTSDAEAVAILRIHHSLGDGTSLISLLLACTRQTADPAKVPTIPRT  193

Query  529   QRSTAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGV  708
             ++    P   ++  +  +      F+   + T+ D    +  +  ++D  TP++ G  G 
Sbjct  194   KKRLIDPSEHSTKGLHRYVTKTWSFMKLFWYTIVDVLMFMATTMFLKDTTTPIK-GRPGS  252

Query  709   EFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSK-------  867
             E  P      + SLD IK +K+ L +T+ DV  G+   G  +Y+ +   E  K       
Sbjct  253   ESNPRRVVYRTVSLDDIKVVKNALNMTVTDVALGVTQAGLSMYLNRRYGEGEKDRGKTEK  312

Query  868   -------ARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANAS  1026
                     R  + +L N R    G +++ +M++ + E  WGN   F+   L  L  A   
Sbjct  313   NNNLPKNIRLRSTILMNLRP-AVGIQALADMMEKDTEAKWGNWIGFV---LFPLKIALRD  368

Query  1027  DPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMI  1206
             DPL ++R+A   I RK+NS   + T  + +  +K  G + ++   H T  N++M  S + 
Sbjct  369   DPLDYIREAKATIDRKKNSLEAFYTFSISELALKFFGIKTSSLISHRTITNTTMCFSCLP  428

Query  1207  GPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             GP E +    HP   I     G P +L +   SYV  + I LSV++  I
Sbjct  429   GPQEEICFYGHPLAYIAPGSYGQPHALMINCQSYVNKMTIVLSVDESVI  477



>ref|XP_011092557.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Sesamum indicum]
Length=463

 Score =   189 bits (481),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 138/476 (29%), Positives = 240/476 (50%), Gaps = 27/476 (6%)
 Frame = +1

Query  4     EMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFS  183
             E ME   ++  +P+ +     +++  I   +  E P    ++    L   + +  +PRF 
Sbjct  3     EAMER--DQPLTPAGRLFLQPLMNQVINCAVVVEFPFDDVEAFKAELRSSILLQ-HPRFC  59

Query  184   SIMVSEGINGGKKWKRVEVNHSEHVKVPNYP-AGKPIEFYDDCLSDYLSKMAMEA-FPPN  357
             S+MV++   G + W++ +V+   HV V + P +       DD ++D+++ +++ +  P +
Sbjct  60    SLMVTDSF-GREHWRKTQVDVDRHVIVRHQPLSDDIHISDDDAVNDFVADLSVSSPLPTD  118

Query  358   RPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRS  537
             +PLWEIHL       A   V+F++HH+LGDG SLM  +LSC +R D+P+ P T      +
Sbjct  119   KPLWEIHLLL-----AHKTVLFRVHHALGDGISLMSMLLSCCRRVDDPSQPPTIGGVGAA  173

Query  538   TAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFR  717
             +++PR +A + +S   K +       +  +Y   +S+    L   D+T   SG DGVE  
Sbjct  174   SSSPRRRAWS-VSTLVKVV------WYTLIYILEFSL--RALCLRDKTTAVSGGDGVELW  224

Query  718   PIATTTMSFSLDQIKQIKDKL-KVTINDVVTGIIIYGTRLYM--KQCEEESSKARCTALV  888
             P    +  F LD +K +K  +   TINDV+ G+I  G   Y+  K  +      R T + 
Sbjct  225   PRRLASARFRLDDMKIVKRAVADATINDVLFGVISCGLSRYLDIKSPKAMPEGLRITGVA  284

Query  889   LFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIK  1068
             + N R    G + + ++I   +   WGN+F  L   LP    +  SDPL+FV++A  +I 
Sbjct  285   MVNLRP-QAGLQEIWKLINSKSGSRWGNKFGML--LLPVYYHSGGSDPLQFVKRAKTMID  341

Query  1069  RKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAK  1248
             +K+ S     +  +   +M   G ++ +   +    N++  ISN++GP E +S+A +P K
Sbjct  342   KKKLSLEAPFSYKVGDLVMSLFGPKLASILNYRIVCNTTFTISNVVGPREEISMAGNPVK  401

Query  1249  GIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI-DAEKFKCCVHHAFEGIYEAA  1413
              I    + +P +L + MVSY G   + + V KD I D +    C  +A   + EAA
Sbjct  402   NIRTTSSSLPHALTMHMVSYAGVADLQILVAKDIIPDPKVLADCFQNALLEMKEAA  457



>ref|XP_010442900.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=491

 Score =   190 bits (482),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 131/457 (29%), Positives = 218/457 (48%), Gaps = 27/457 (6%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM-VSE  201
             EE  SP ++  NS   +  I+  +   +  + +   +I  LK   V  +PRFSSI+ ++ 
Sbjct  17    EEPLSPCSRLFNSPDFNCAIIVTMGCRV--KGNTPAIIDGLKRTLVN-HPRFSSILEMNN  73

Query  202   GINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHL  381
             G  G   W R +V   +HV VP       IE  D  L DY+SK+       ++PLWEIH+
Sbjct  74    GKKGKPCWVRTKVKVEDHVIVPEI--DPKIENPDQYLEDYISKLTTIPMDLSKPLWEIHI  131

Query  382   FKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRSK  558
                 T+NA    + K+HHSLGDG SLM   L+C ++  NP ALP     ++R   +  S 
Sbjct  132   IHLKTSNAESIALLKIHHSLGDGMSLMSLFLACTRKTSNPEALPTVAVQKKRFGPSCNSG  191

Query  559   ASNKISGFFKAM---PRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIAT  729
               NKI      +    R LF  F  +  F  ++F   LV D  TP+ +   G E  P   
Sbjct  192   FFNKIWWLCVGLWFIIRLLFNTFVDILMFALTIF---LVRDTETPLLA-KPGSELNPKRF  247

Query  730   TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK---------QCEEESSKARCTA  882
                  S D +K +K+ LK+T+NDV+ G+   G   Y+          + +E   + R  +
Sbjct  248   VHRIISFDDVKLVKNALKMTVNDVLLGVTEAGLSRYLSRRYDQEATPKLKESMRRIRLRS  307

Query  883   LVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRI  1062
              ++ N R    G +++ +M+   ++  WGN F ++   L   +    +DPL +VR+A   
Sbjct  308   AIMINLRP-NAGIEALADMMAKKSKCRWGNLFGYI---LLPFSVGLETDPLEYVRRAKAT  363

Query  1063  IKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHP  1242
             I RK++S     +    + ++K  G + +   +     ++++  SN++GP E ++   HP
Sbjct  364   IDRKKHSLEAVFSMAFFKLILKVLGLKASVILVRKVIHSTTLTFSNVVGPKEEITFHGHP  423

Query  1243  AKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
                I   + G P +L +   SY   + I+++ +   I
Sbjct  424   LSYIAPCVFGHPHALTIHFQSYANKVIISVTADPTVI  460



>gb|KHG19380.1| O-acyltransferase WSD1 [Gossypium arboreum]
Length=464

 Score =   189 bits (479),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 130/425 (31%), Positives = 223/425 (52%), Gaps = 29/425 (7%)
 Frame = +1

Query  169   NPRFSSIMVSEGINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEA-  345
             +PRF S++V +  NG + W++  ++   HV V  +   +  E  +  ++ Y++ +++ + 
Sbjct  55    HPRFCSLLVRDD-NGFEHWRKTRLDVDRHVIVVKHRVNEDEEDDEVAVNLYVADLSVSSP  113

Query  346   FPPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAIL-SCLQRADNPALPLTFP  522
                ++PLWE+HL       A  +V+F++HHSLGDG SLM  ++ SC + +D  ALP+  P
Sbjct  114   LSTDKPLWEVHLL-----TAHKHVVFRIHHSLGDGISLMSMLMASCRKVSDPDALPMMVP  168

Query  523   SR--QRSTAAPRSKASNKISGFFK-AMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRS  693
              +  ++   +P S  S  + GF K A   F+F     V +F   + +S  V D +T V S
Sbjct  169   EKTTEKKRDSPWSFGS--MWGFLKMAWLTFVF-----VLEF---LLRSLFVSDRKTAV-S  217

Query  694   GDDGVEFRPIATTTMSFSLDQIKQIKDKL-KVTINDVVTGIIIYGTRLYMKQCEEES--S  864
             G DGVE  P    T  F LD +K++K  +   TINDV+ GI+  G   Y+      +   
Sbjct  218   GGDGVELWPRKLATAKFLLDDMKEVKKAIPDTTINDVLFGIVSCGLSRYLDHRTPNALHE  277

Query  865   KARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFV  1044
               R T + + N RA   G + +++++K N+E  WGN+F    + LP     + +DPL ++
Sbjct  278   GLRMTGVAMVNLRA-KPGLQEISKLMKDNSETRWGNKFGV--ILLPVFYHKSGNDPLEYL  334

Query  1045  RKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERM  1224
             ++A  ++ RK+ S   Y +  +   ++   G +  +   +    N++  ISN+IGP+E +
Sbjct  335   KRAKVMVDRKKQSLEAYFSYRIGDLIVSLLGIKYASLINYRLLCNTTFTISNLIGPLEDI  394

Query  1225  SLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI-DAEKFKCCVHHAFEGI  1401
             +L+ +P   I    + +PQ+L + MVSY G   + + V KD I D E    C   A   +
Sbjct  395   TLSGNPISSIKVSTSSLPQALTMHMVSYAGKAEMQILVAKDIIPDPEFLAKCFEDALLEM  454

Query  1402  YEAAL  1416
               AA+
Sbjct  455   KVAAM  459



>ref|XP_011092556.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Sesamum indicum]
Length=465

 Score =   188 bits (478),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 139/479 (29%), Positives = 241/479 (50%), Gaps = 31/479 (6%)
 Frame = +1

Query  4     EMMEHGYEEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFS  183
             E ME   ++  +P+ +     +++  I   +  E P    ++    L   + +  +PRF 
Sbjct  3     EAMER--DQPLTPAGRLFLQPLMNQVINCAVVVEFPFDDVEAFKAELRSSILLQ-HPRFC  59

Query  184   SIMVSEGINGGKKWKRVEVNHSEHVKVPNYP-AGKPIEFYDDCLSDYLSKMAMEA-FPPN  357
             S+MV++   G + W++ +V+   HV V + P +       DD ++D+++ +++ +  P +
Sbjct  60    SLMVTDSF-GREHWRKTQVDVDRHVIVRHQPLSDDIHISDDDAVNDFVADLSVSSPLPTD  118

Query  358   RPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRS  537
             +PLWEIHL       A   V+F++HH+LGDG SLM  +LSC +R D+P+ P T      +
Sbjct  119   KPLWEIHLLL-----AHKTVLFRVHHALGDGISLMSMLLSCCRRVDDPSQPPTIGGVGAA  173

Query  538   TAAPRSKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFR  717
             +++PR +A + +S   K +       +  +Y   +S+    L   D+T   SG DGVE  
Sbjct  174   SSSPRRRAWS-VSTLVKVV------WYTLIYILEFSL--RALCLRDKTTAVSGGDGVELW  224

Query  718   PIATTTMSFSLDQIKQIKDKL-KVTINDVVTGIIIYGTRLYMKQCEEESSKA-----RCT  879
             P    +  F LD +K +K  +   TINDV+ G+I  G   Y+   +    KA     R T
Sbjct  225   PRRLASARFRLDDMKIVKRAVADATINDVLFGVISCGLSRYL-DIKSPKGKAMPEGLRIT  283

Query  880   ALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHR  1059
              + + N R    G + + ++I   +   WGN+F  L   LP    +  SDPL+FV++A  
Sbjct  284   GVAMVNLRP-QAGLQEIWKLINSKSGSRWGNKFGML--LLPVYYHSGGSDPLQFVKRAKT  340

Query  1060  IIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANH  1239
             +I +K+ S     +  +   +M   G ++ +   +    N++  ISN++GP E +S+A +
Sbjct  341   MIDKKKLSLEAPFSYKVGDLVMSLFGPKLASILNYRIVCNTTFTISNVVGPREEISMAGN  400

Query  1240  PAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI-DAEKFKCCVHHAFEGIYEAA  1413
             P K I    + +P +L + MVSY G   + + V KD I D +    C  +A   + EAA
Sbjct  401   PVKNIRTTSSSLPHALTMHMVSYAGVADLQILVAKDIIPDPKVLADCFQNALLEMKEAA  459



>dbj|BAC42871.1| unknown protein [Arabidopsis thaliana]
Length=486

 Score =   188 bits (478),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 130/458 (28%), Positives = 223/458 (49%), Gaps = 31/458 (7%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             EE  SP ++  NS   +  I+  + S++  +     +I  L+   V  +PRFSSI+    
Sbjct  14    EEPLSPCSRLFNSPDFNCAIIVTMGSKV--KGDTPAIIHGLEHTLVN-HPRFSSIL---E  67

Query  205   INGGKK--WKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIH  378
             +N GKK  W R +V   EHV VP+      IE  D  L DY+SK+       ++PLWE+H
Sbjct  68    MNNGKKPRWVRTKVKVEEHVIVPD--VDPDIENPDQYLEDYISKLTTIPMDLSKPLWEMH  125

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRS  555
             L    T++A    I K+HHSLGDG SLM  +L+C ++  +P ALP     ++R   +  S
Sbjct  126   LLGVKTSSAESYAILKIHHSLGDGMSLMSLLLACTRKTSDPEALPTVAVHKKRFGPSCNS  185

Query  556   KASNKISGFFKAM---PRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIA  726
                NKI   F  +    R LF  F  +  F  ++F   ++ D  TP+ +   G E  P  
Sbjct  186   GFFNKIWWLFVGLWFILRLLFNTFVDILMFALTIF---VLRDTETPLLA-KPGSELIPKR  241

Query  727   TTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK---------QCEEESSKARCT  879
                   S D +K +K+ +K+T+NDV+ G+   G   Y+          + +E   + R  
Sbjct  242   FVHRIISFDDVKLVKNAMKMTVNDVLLGVTQAGLSRYLSRKYDQEATPKSKESMRRIRLR  301

Query  880   ALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHR  1059
             + ++ N R    G +++ +M+   ++  WGN F ++   L   +    +DPL +VR+A  
Sbjct  302   SAIMINLRP-NAGIEALADMMAKKSKCRWGNLFGYI---LLPFSVGLETDPLEYVRQAKA  357

Query  1060  IIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANH  1239
              I RK++S     +    + ++K  G + +   +     ++++  SN++GP E ++   H
Sbjct  358   TIDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPKEEITFHGH  417

Query  1240  PAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             P   I   + G P +L +   +Y   + I+++ +   I
Sbjct  418   PLNYISPCVFGHPHALTLHFQTYANKVIISVTADPTVI  455



>gb|EMT14089.1| hypothetical protein F775_13804 [Aegilops tauschii]
Length=508

 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 126/407 (31%), Positives = 205/407 (50%), Gaps = 23/407 (6%)
 Frame = +1

Query  175   RFSSIMVSEGINGGK--KWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAF  348
             RF SI V++G   G   +W R  VN  +H+ VP           D  + DY++ +     
Sbjct  76    RFRSIQVTDGSKDGNNPRWARTAVNVEDHMIVPTLDPAAVEADPDRAVEDYVASVYTLPM  135

Query  349   PPNRPLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP----ALPLT  516
               +RPLWE H   YPT+ AA  V+F++HHSL DG SL+  +L+  + A +P    A+P  
Sbjct  136   DRSRPLWEFHFLDYPTSEAASTVVFRVHHSLSDGMSLITMLLASARSAADPTRLPAMPDQ  195

Query  517   FPSRQRSTAAPR---SKASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPV  687
              P+R  +  APR   S ++  ++ F   +  +L  A+NT+ D  +    +  + D  TP 
Sbjct  196   -PARTGAIYAPRHRESASAGALAAFIAWIWPYLVLAWNTMVDVSFFAATTVFLRDPCTPF  254

Query  688   RSGDDGVEFRPIAT-TTMSFSLDQIKQIKDKLKVTINDVVTGIIIYG-TRLYMKQCEEES  861
             R  +  V F P       S SLD +K +K+ +  T+NDV+ G      +R Y ++    +
Sbjct  255   RRAEGDVTFNPRRRFVHRSLSLDDVKFVKNAMSCTVNDVLVGATSAALSRYYFRKSGGSN  314

Query  862   S-KARCTALVLFNTRAIGG--GYKSVTEMIKPNAEMPWGNQ--FTFLPVSLPALTPANAS  1026
             + +    +++L NTR       Y ++ E  + N ++ WGNQ  +  LP  L     A   
Sbjct  315   TYRTWLRSVLLVNTRPTASLQTYANMIESGRSN-DVAWGNQLGYILLPFHL-----AMHD  368

Query  1027  DPLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMI  1206
             DPL +VRKA  I+ RK++S     T    + ++K  G +  A        N+++  SN++
Sbjct  369   DPLAYVRKAKMIVDRKKSSLEAIFTCKTSEVVVKMFGLKAGAFIFRRMFSNTTISFSNLV  428

Query  1207  GPMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKD  1347
             GP E++ L  HP   I   + G+PQ+L V   SY  +++I LSV+++
Sbjct  429   GPTEKIELCGHPVVFIAPSVYGVPQALIVHYQSYNNTIKIVLSVDEE  475



>ref|XP_009396534.1| PREDICTED: O-acyltransferase WSD1-like [Musa acuminata subsp. 
malaccensis]
Length=515

 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 133/464 (29%), Positives = 217/464 (47%), Gaps = 33/464 (7%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGG  216
             SP+AQ  +       I+ ++    P  A   ++ S L    V  +PRFSS+ V E   G 
Sbjct  46    SPAAQLFHQPGFDCCIVAIMGLGKP--ADVDVIRSGLAATLVR-HPRFSSVPVLEESGGA  102

Query  217   K-KWKRVEVNHSEHVKVP-----NYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIH  378
             + +W R +V    H+ +P        A  P    D  + DY++ +       +RPLW++H
Sbjct  103   EPRWVRTKVVVENHIVIPALEDQRRAAASP----DQVVEDYVASLTSAPLDRSRPLWDLH  158

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
             +  +PT+ AA   + ++HHSLGDG SLM  +L+C ++A +P    T P + R     R  
Sbjct  159   VLNFPTSEAAAVAVLRVHHSLGDGTSLMSLLLACTRKASDPHSLPTIPHQSRRPLVSRKL  218

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
              +         +  FL  A+NT+ D       S   +D  TP+ +G  GVE+ P      
Sbjct  219   HAGGAFTLLLWLWAFLILAWNTLLDVLRFTATSAFSKDTTTPL-TGPKGVEYHPKRIVHR  277

Query  739   SFSLDQIKQIKDKLKVTINDVVTGIIIYG-----TRLYMKQCEEESSKA------RCTAL  885
             + SLD IK +K+ +  T+NDV+ G+   G     +R Y +  +E   K       R  + 
Sbjct  278   TVSLDDIKDVKNAMHCTVNDVLVGVTSAGLSRYLSRRYGQNVDEHGKKTQLPSNIRLQST  337

Query  886   VLFNTRAIGGGYKSVTEMIKPNAEMPWGNQ--FTFLPVSLPALTPANASDPLRFVRKAHR  1059
             +L N R   G +     M   ++   WGN   +  LP S+         DP+ ++RK   
Sbjct  338   LLVNIRPSPGVHALAELMEGRHSGTKWGNYIGYIILPFSI-----FKYKDPMDYIRKGKE  392

Query  1060  IIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANH  1239
             I  RK+NS     T    + ++K  G +  A   H    N+++  SNMIGP+E ++  +H
Sbjct  393   IAGRKKNSLEAIFTYKSGELIVKCLGIKAGAALCHRVLSNTTLSFSNMIGPVEEVAFYDH  452

Query  1240  PAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI-DAEKF  1368
             P   +   + G PQ+L V   SY+  +++ ++V+   I DA + 
Sbjct  453   PIVYLAPSVYGHPQALTVHFQSYMNMMKMVVTVDDKVIPDAHQL  496



>ref|XP_011088231.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Sesamum indicum]
Length=465

 Score =   187 bits (476),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 129/469 (28%), Positives = 234/469 (50%), Gaps = 28/469 (6%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEG  204
             ++  +PS +     +++  I   L ++ PI      V + +++  +  +PRF S+MV + 
Sbjct  8     DQPLTPSGRLFLQPLMNQVINCALGADYPIDLD--CVKTQIQNSIMLKHPRFCSLMVRDS  65

Query  205   INGGKKWKRVEVNHSEHVKVPNYP-AGKPIEFYDDCLSDYLSKMAMEA-FPPNRPLWEIH  378
              +G + W++ +V+   H+ + ++  +  P    +D +++Y++ ++  +  P ++PLWE+H
Sbjct  66    -SGREHWRKTQVDVDRHLIIRHHSLSNDPSVSDEDAINNYMADLSFSSPLPTDKPLWELH  124

Query  379   LFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSRQRSTAAPRSK  558
             +       A   V+F++HH+LGDG SLM  +LSC ++ D+PA   T      ++  PR  
Sbjct  125   VLA-----AHNAVVFRVHHALGDGISLMSMLLSCCRKVDDPAQLPTIGGVGAASLVPRRW  179

Query  559   ASNKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTM  738
             +   +    K +   L      V    W          D+T V SG  G+E  P    T 
Sbjct  180   S---VWTLMKVVWFTLVSILEFVLRLLWL--------RDKTTVLSGGSGLELWPRQLATA  228

Query  739   SFSLDQIKQIKDKL-KVTINDVVTGIIIYGTRLYM--KQCEEESSKARCTALVLFNTRAI  909
              F LD +K +K  L   TINDV+ G+I  G   Y+  +         + T L + N R  
Sbjct  229   RFRLDDMKTVKRALADSTINDVLFGVISIGFSRYLDIRSSTAPQEGDQITGLAMVNLRP-  287

Query  910   GGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRIIKRKRNSAS  1089
               G + +++++  ++  PWGN+F    + LP      +SDPL+FVR+A  +I RK+ S  
Sbjct  288   QSGLQDLSKLMDSDSGTPWGNKFGI--ILLPVHYHRESSDPLQFVRRAKAMIHRKKLSLE  345

Query  1090  VYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPAKGIYFIIA  1269
                +  LL  +    G+++T+   +    N++  ISN++GP E+++LA HP K I    +
Sbjct  346   APFSHTLLDWITSLFGAKLTSILNYRIVCNTTFTISNIVGPREQVTLAGHPVKYIRVTSS  405

Query  1270  GIPQSLCVTMVSYVGSLRIALSVEKDFI-DAEKFKCCVHHAFEGIYEAA  1413
              +P ++ + M+SY G   + + V K+ I D +    C   A   + +AA
Sbjct  406   SLPHAITMHMLSYAGVADMQILVAKEVIPDPKVLAKCFEDALLEMKQAA  454



>ref|XP_009395725.1| PREDICTED: O-acyltransferase WSD1-like [Musa acuminata subsp. 
malaccensis]
Length=535

 Score =   187 bits (475),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 133/461 (29%), Positives = 215/461 (47%), Gaps = 32/461 (7%)
 Frame = +1

Query  37    SPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIMVSEGINGG  216
             SP  +  +       I+ ++    PI     +V S L+   V  +PRF SI V     GG
Sbjct  60    SPGGRLFHQRGFDCYIVAIMGYAKPIDVG--VVKSGLEKTLVR-HPRFCSIPVVLDETGG  116

Query  217   KK--WKRVEVNHSEHVKVPNYPAGKPIEFY-DDCLSDYLSKMAMEAFPPNRPLWEIHLFK  387
              K  W   +V   +H+ +P+    + I    D  + DY++ +       +RPLWE+H+  
Sbjct  117   TKSTWVPAKVVVDDHIVIPDLADPRRITTSPDQLVEDYIASLTCIPMDHSRPLWELHVLN  176

Query  388   YPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNPALPLTFPSR-QRSTAAPRSKAS  564
             +PT++AA   + +LHHSLGDG SLM  +L+C +++ +P    T PS   R   AP+ +  
Sbjct  177   FPTSDAAAVAVLRLHHSLGDGVSLMSLLLACTRKSSHPDSLPTVPSHYSRRPPAPK-RLH  235

Query  565   NKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATTTMSF  744
              ++      +  FL   +NT+ D       S  ++D  TP+  G  GVE RP      S 
Sbjct  236   ARVFTLLLWLWAFLILTWNTLVDVVCFTATSIFLKDTPTPL-MGSQGVEQRPKRIVHRSV  294

Query  745   SLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKA----------------RC  876
             SLD IK +K+ +  TINDV+ G+   G   Y+ + +E++S                  R 
Sbjct  295   SLDDIKDVKNAMHCTINDVLVGVTSAGLSRYLSRRQEQNSNDDDKNKNKKKKELPSNLRL  354

Query  877   TALVLFNTRAIGGGYKSVTEMIKPNAEMPWGN--QFTFLPVSLPALTPANASDPLRFVRK  1050
              + +L N R   G +     M   +    WGN   +  LP  +      N  DPL +VR+
Sbjct  355   RSTLLVNIRPAPGIHALAELMEGRDDGTKWGNLIGYIILPFEI-----FNHKDPLDYVRR  409

Query  1051  AHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSL  1230
                I  RK+NS     T    + ++K  G +  A+  H    ++++  SNM+GP+E +  
Sbjct  410   GKAIADRKKNSLEAIFTYKSAELVVKCLGIKAAAKLCHRMLTHTTLSFSNMVGPVEEIEF  469

Query  1231  ANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
               HP   +     G PQ+L +   SY+ +++I L+V+   I
Sbjct  470   FGHPLVYLAPSAYGHPQALTIHFQSYMNTMKIVLAVDDKVI  510



>emb|CDY54346.1| BnaC03g14900D [Brassica napus]
Length=489

 Score =   186 bits (471),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 132/456 (29%), Positives = 216/456 (47%), Gaps = 25/456 (5%)
 Frame = +1

Query  25    EEAASPSAQFLNSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSIM-VSE  201
             EE  SP ++  NS   +  I+ ++  ++  + +   +I  LK   V  +PRFSSI+ ++ 
Sbjct  14    EEPLSPCSRLFNSPDFNCAIIVIMGCKV--KGNPPAIIDGLKHTLVN-HPRFSSILEMNN  70

Query  202   GINGGKKWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEIHL  381
             G  G   W R EV   +HV VP+      IE  D  L DY+SK+       ++PLWEIHL
Sbjct  71    GKKGKPSWVRTEVRVEDHVIVPDIDPN--IESPDQYLEDYISKLTTVPMDFSKPLWEIHL  128

Query  382   FKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPRSK  558
                 T+NA    + K+HHSLGDG SLM   L+C ++  +P ALP    S Q+    P S 
Sbjct  129   LCLKTSNAESIGLLKIHHSLGDGMSLMSLFLACTRKTSDPEALPTV--SVQKKQFGPSSN  186

Query  559   AS--NKISGFFKAMPRFLFGAFNTVYDFGWSVFKSTLVEDDRTPVRSGDDGVEFRPIATT  732
                 NKI   F  +   L   FNT  D          + D  TP+ +     E  P    
Sbjct  187   TGFFNKIWWLFVGLWFILRLVFNTFVDVLIFALTICFLRDTETPLLA-KPRTELVPKRFV  245

Query  733   TMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMK---------QCEEESSKARCTAL  885
                 S D +K +K+ +K+T+NDV+ G+   G   Y+          + +E   K R  + 
Sbjct  246   HRIISFDDVKLVKNAMKLTVNDVLLGVTQAGLSRYLSRRYDQEATPKSKESMGKFRLRSA  305

Query  886   VLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRFVRKAHRII  1065
             ++ N R    G +++ +M+   ++  WGN F ++   L   +    +DPL +VR+A   +
Sbjct  306   IMINLRP-NTGIEALADMMAKKSKCRWGNLFGYI---LLPFSVGLETDPLEYVRQAKVTV  361

Query  1066  KRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMERMSLANHPA  1245
              RK++S     +    + ++K  G + +   +     N+++  SN++GP E ++   HP 
Sbjct  362   DRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHNTTLTFSNVVGPKEEITFHGHPL  421

Query  1246  KGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
               I   + G P +L V   SY   + I+++ +   I
Sbjct  422   SYIAPSVFGHPHALTVHFQSYEKKVIISVTADPTVI  457



>gb|KCW78187.1| hypothetical protein EUGRSUZ_D02376, partial [Eucalyptus grandis]
Length=505

 Score =   186 bits (472),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 137/468 (29%), Positives = 228/468 (49%), Gaps = 51/468 (11%)
 Frame = +1

Query  28    EAASPSAQFLNSSVLSLTILGVLESEIPIQ---ASDSLVISLLKDVFVPINPRFSSIMVS  198
             E  SPSAQ  +    ++ I+ V+  + PI       +LV +LLK      +PRFSS+ V 
Sbjct  32    EPLSPSAQMFHEPNFNVYIVAVMGCKTPIDLPVIKSNLVHTLLK------HPRFSSLQVE  85

Query  199   EGINGGK-KWKRVEVNHSEHVKVPNYPAGKPIEFYDDCLSDYLSKMAMEAFPPNRPLWEI  375
             +    GK +W    V+  +H+ VP    G  ++  +  + DY+S ++       +PLW+I
Sbjct  86    DEKEKGKFRWIPTNVDLEKHIIVPKIKPG--MDSPERFIEDYVSNLSKTTICKTQPLWDI  143

Query  376   HLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRSTAAPR  552
             H+    T++A    +F++HHSLGDG SLM  +L+C ++  +P ALP T P ++    +  
Sbjct  144   HILNVKTSDAEAVGVFRIHHSLGDGTSLMSLLLACTRKISDPEALP-TIPVKK----SKE  198

Query  553   SKASNKISGFFKAMPRFLFGAFNTVYD---FGWSVFKSTLVEDDRTPVRSGDDGVEFRPI  723
              +   +I G+   +  FL   +NT  D   FG +V     ++D  +P++ G  GVE  P 
Sbjct  199   KRDYGRIWGWLLGVCWFLVLLWNTAVDTIMFGATVL---FLKDSESPIK-GPPGVELMPR  254

Query  724   ATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSK------------  867
                  + SL+ IK +K+ L  T+NDV  G+   G   Y+     E+ K            
Sbjct  255   RFVYRTVSLEDIKMVKNALNATVNDVALGVTQAGLSQYLHLRYAETKKRHGATKIRNDLP  314

Query  868   --ARCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASDPLRF  1041
                R  + +L N R    G + +  M++ + E+ WGN+  ++   L  +T A  S+PL +
Sbjct  315   KNLRLRSTLLINLRP-SIGIQGLAAMMEKDTEVKWGNRIGYV---LVPITIALHSNPLDY  370

Query  1042  VRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIGPMER  1221
             VR+A   I RK++S     T  + +A++K  G +  +   H    +++M  SN++GP+E 
Sbjct  371   VREAKATINRKKHSLEAIFTHSIAEAVLKLFGIKAASALSHRVITHTTMCFSNLVGPLEE  430

Query  1222  MSLANHP----AKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEKDFI  1353
             +    HP    A G Y    G P  L V   SY   +   +S ++  I
Sbjct  431   IGFYGHPLAYLAPGCY----GQPHGLMVNFQSYANKMTFVVSADEGTI  474



>gb|KHG26801.1| O-acyltransferase WSD1 -like protein [Gossypium arboreum]
Length=515

 Score =   186 bits (472),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 139/465 (30%), Positives = 226/465 (49%), Gaps = 45/465 (10%)
 Frame = +1

Query  19    GYEEAASPSAQFL---NSSVLSLTILGVLESEIPIQASDSLVISLLKDVFVPINPRFSSI  189
             G EE  SPS++     N +V  + I+G      P     +L  +LL+      +PRFSS+
Sbjct  43    GEEEPLSPSSRLFHEPNFNVYVIAIMGCKTRIYPDVVKANLGHTLLR------HPRFSSL  96

Query  190   MVSEGIN-GGKKWKRVEVNHSEHVKVPNYPAG--KPIEFYDDCLSDYLSKMAMEAFPPNR  360
              V +  N GG KW R +V+  +HV VP        P +F    L DY+  ++  +   ++
Sbjct  97    QVMDERNKGGMKWVRTQVDLEKHVIVPKLDPNIYSPEKF----LEDYIYNLSKTSIDESQ  152

Query  361   PLWEIHLFKYPTTNAAGNVIFKLHHSLGDGYSLMGAILSCLQRADNP-ALPLTFPSRQRS  537
             PLW++HL    T+ +    +F++HHSLGDG SLM  +L+C ++ ++P ALP T P ++  
Sbjct  153   PLWDLHLLNLRTSESEAVGVFRIHHSLGDGTSLMSLLLACTRQMNDPLALP-TVPIKK--  209

Query  538   TAAPRSKASNKISGFFKAMPRFL--FGAF-NTVYDFGWSVFKSTLVEDDRTPVRSGDDGV  708
                 + +  N  + F++    F   F  F NTV D       +  ++D + P++ G  GV
Sbjct  210   ----KQEKKNDHTWFWRITSMFWSTFQVFLNTVVDVFMFTATTLFLKDTQNPLK-GPPGV  264

Query  709   EFRPIATTTMSFSLDQIKQIKDKLKVTINDVVTGIIIYGTRLYMKQCEEESSKA------  870
             EF P      + SLD IK +K+ +  TINDV  GI   G   Y+ +    ++KA      
Sbjct  265   EFTPRRIVYRTVSLDDIKLVKNAMNTTINDVALGITQAGLSRYINRIYGGNNKAEGAIEI  324

Query  871   -------RCTALVLFNTRAIGGGYKSVTEMIKPNAEMPWGNQFTFLPVSLPALTPANASD  1029
                    R  + +L N R    G +++ +M++ + E  WGN   +  V LP  T A   D
Sbjct  325   DNLPNKIRLRSTLLINIRP-SAGIQALADMMEKDGEAKWGNWIGY--VLLP-FTIARRDD  380

Query  1030  PLRFVRKAHRIIKRKRNSASVYLTGWLLQALMKTRGSEVTARYIHGTSKNSSMGISNMIG  1209
             PL +VR A   I RK+ S     T  + +  +K  G +  +   H    +++M  SN++G
Sbjct  381   PLDYVRDAKATIDRKKRSLEAIFTFSIAELALKLFGVKTASALSHRILSHTTMCFSNLVG  440

Query  1210  PMERMSLANHPAKGIYFIIAGIPQSLCVTMVSYVGSLRIALSVEK  1344
             P+E +    HP   +     G P +L +   SY+  + I +S ++
Sbjct  441   PLEEIGFYGHPMAFLAPSSYGQPHALMINFQSYMDKMTIVVSADE  485



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4223647644888