BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17794_g1_i1 len=936 path=[97:0-47 2055:48-61 159:62-85 1188:86-935]

Length=936
                                                                      Score     E

ref|XP_009624857.1|  PREDICTED: glutathione S-transferase U10-like      302   9e-99   
ref|XP_009768455.1|  PREDICTED: glutathione S-transferase U10-like      301   4e-98   
ref|XP_004236471.2|  PREDICTED: glutathione S-transferase U10-like      291   8e-95   
emb|CDP20458.1|  unnamed protein product                                260   2e-82   
ref|XP_006476607.1|  PREDICTED: glutathione S-transferase U9-like       256   1e-80   
ref|XP_010663865.1|  PREDICTED: glutathione S-transferase U9-like       253   3e-79   
ref|XP_006439597.1|  hypothetical protein CICLE_v10024585mg             252   5e-79   
gb|KDO76130.1|  hypothetical protein CISIN_1g026934mg                   250   1e-78   
emb|CBI15230.3|  unnamed protein product                                252   1e-76   
ref|XP_009369406.1|  PREDICTED: glutathione S-transferase U9-like       244   7e-76   
ref|XP_008356679.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    243   8e-76   
ref|XP_002269118.1|  PREDICTED: glutathione S-transferase U9            243   8e-76   Vitis vinifera
emb|CDP20460.1|  unnamed protein product                                243   2e-75   
ref|XP_010663365.1|  PREDICTED: glutathione S-transferase U9-like       242   5e-75   
ref|XP_009771520.1|  PREDICTED: glutathione S-transferase U10-like      241   9e-75   
ref|XP_007037326.1|  Glutathione S-transferase tau 9                    241   1e-74   
ref|XP_009771522.1|  PREDICTED: glutathione S-transferase U9-like       240   2e-74   
ref|XP_010029766.1|  PREDICTED: glutathione S-transferase U9-like       240   2e-74   
ref|XP_009616913.1|  PREDICTED: glutathione S-transferase U9-like       240   2e-74   
emb|CDP21575.1|  unnamed protein product                                239   2e-74   
ref|XP_002511574.1|  glutathione s-transferase, putative                239   3e-74   Ricinus communis
ref|XP_008239955.1|  PREDICTED: glutathione S-transferase U10-like      239   5e-74   
ref|XP_006476608.1|  PREDICTED: glutathione S-transferase U10-like      238   8e-74   
ref|XP_004236032.2|  PREDICTED: glutathione S-transferase U10-like      238   2e-73   
ref|XP_007208953.1|  hypothetical protein PRUPE_ppb016836mg             237   3e-73   
emb|CDP21994.1|  unnamed protein product                                236   4e-73   
ref|XP_010678536.1|  PREDICTED: glutathione S-transferase U10-like      234   3e-72   
ref|XP_010678533.1|  PREDICTED: glutathione S-transferase U9-like       233   1e-71   
ref|XP_008239953.1|  PREDICTED: glutathione S-transferase U9-like       233   1e-71   
ref|XP_010029753.1|  PREDICTED: glutathione S-transferase U10-like      232   3e-71   
ref|XP_009785599.1|  PREDICTED: glutathione S-transferase U9            231   3e-71   
ref|XP_008239952.1|  PREDICTED: glutathione S-transferase U9            231   5e-71   
ref|XP_007208914.1|  hypothetical protein PRUPE_ppa027220mg             231   5e-71   
ref|XP_007208887.1|  hypothetical protein PRUPE_ppa026659mg             230   2e-70   
ref|XP_010029777.1|  PREDICTED: glutathione S-transferase U9-like       229   3e-70   
ref|XP_004299367.1|  PREDICTED: glutathione S-transferase U9-like       228   1e-69   
ref|XP_010029742.1|  PREDICTED: glutathione S-transferase U10-like      228   1e-69   
ref|XP_008239956.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    225   1e-68   
emb|CDP20459.1|  unnamed protein product                                222   2e-67   
ref|XP_004299368.1|  PREDICTED: glutathione S-transferase U9-like       221   6e-67   
ref|XP_010031646.1|  PREDICTED: glutathione S-transferase U9-like       220   1e-66   
gb|KGN63992.1|  hypothetical protein Csa_1G033120                       219   2e-66   
ref|XP_009616912.1|  PREDICTED: glutathione S-transferase U9-like       218   7e-66   
ref|XP_004169466.1|  PREDICTED: glutathione S-transferase U9-like       218   8e-66   
ref|XP_010533411.1|  PREDICTED: glutathione S-transferase U10           218   1e-65   
gb|KGN63994.1|  hypothetical protein Csa_1G033140                       217   2e-65   
ref|XP_004299373.1|  PREDICTED: glutathione S-transferase U10-lik...    214   1e-64   
gb|ADB11380.1|  putative tau class glutathione transferase GSTU57       214   2e-64   Populus trichocarpa [western balsam poplar]
ref|XP_006384749.1|  glutathione S-transferase GST 12 family protein    214   3e-64   
ref|XP_004137407.1|  PREDICTED: glutathione S-transferase U9-like       214   4e-64   
gb|KFK41899.1|  hypothetical protein AALP_AA2G186700                    212   1e-63   
ref|XP_004299365.1|  PREDICTED: glutathione S-transferase U9-like       212   2e-63   
ref|XP_007138188.1|  hypothetical protein PHAVU_009G187800g             211   2e-63   
emb|CAJ13709.1|  glutathione S-transferase 12                           211   2e-63   Capsicum chinense [bonnet pepper]
ref|NP_001238708.1|  glutathione S-transferase GST 12                   211   4e-63   
gb|ACU13389.1|  unknown                                                 211   4e-63   Glycine max [soybeans]
ref|XP_007210650.1|  hypothetical protein PRUPE_ppa019399mg             211   5e-63   
ref|XP_008239964.1|  PREDICTED: glutathione S-transferase U10-like      211   5e-63   
ref|XP_004157468.1|  PREDICTED: glutathione S-transferase U9-like       210   1e-62   
ref|XP_009369409.1|  PREDICTED: glutathione S-transferase U9-like       209   2e-62   
gb|ADK32333.2|  glutathione S-transferase                               208   5e-62   
ref|XP_007037331.1|  Glutathione S-transferase tau 9, putative          207   2e-61   
ref|XP_010471550.1|  PREDICTED: glutathione S-transferase U10-like      206   2e-61   
ref|XP_009757243.1|  PREDICTED: glutathione S-transferase U9-like       206   3e-61   
ref|XP_010428448.1|  PREDICTED: glutathione S-transferase U10 iso...    206   4e-61   
ref|XP_010416313.1|  PREDICTED: glutathione S-transferase U10-like      205   6e-61   
ref|XP_004151688.1|  PREDICTED: glutathione S-transferase U9-like       205   1e-60   
ref|XP_009128052.1|  PREDICTED: glutathione S-transferase U10-like      203   3e-60   
emb|CDY59707.1|  BnaCnng35440D                                          202   7e-60   
ref|XP_007211046.1|  hypothetical protein PRUPE_ppa019082mg             202   8e-60   
ref|XP_004299372.1|  PREDICTED: glutathione S-transferase U10-like      202   1e-59   
ref|XP_009151370.1|  PREDICTED: glutathione S-transferase U9            202   1e-59   
ref|XP_008239963.1|  PREDICTED: glutathione S-transferase U10-like      201   2e-59   
ref|XP_004499459.1|  PREDICTED: glutathione S-transferase U9-like       201   2e-59   
ref|XP_003613754.1|  Glutathione S-transferase                          201   2e-59   
ref|XP_004137582.1|  PREDICTED: glutathione S-transferase U9-like       201   3e-59   
emb|CDX73101.1|  BnaC06g35490D                                          201   4e-59   
gb|AFK43288.1|  unknown                                                 201   5e-59   
ref|XP_004301155.1|  PREDICTED: glutathione S-transferase U9-like       201   5e-59   
ref|XP_010258434.1|  PREDICTED: glutathione S-transferase U9            200   6e-59   
emb|CDX73100.1|  BnaC06g35480D                                          200   7e-59   
ref|XP_010530568.1|  PREDICTED: glutathione S-transferase U9            199   1e-58   
ref|XP_004169465.1|  PREDICTED: glutathione S-transferase U9-like       199   2e-58   
ref|XP_007046107.1|  Glutathione S-transferase TAU 10                   199   2e-58   
ref|XP_006392082.1|  hypothetical protein EUTSA_v10023672mg             199   2e-58   
ref|NP_851249.1|  glutathione S-transferase tau 9                       199   2e-58   Arabidopsis thaliana [mouse-ear cress]
emb|CDY00291.1|  BnaA06g21920D                                          198   4e-58   
ref|XP_006301340.1|  hypothetical protein CARUB_v10021750mg             197   7e-58   
emb|CDX86895.1|  BnaC03g51650D                                          197   9e-58   
gb|KFK27974.1|  hypothetical protein AALP_AA8G455700                    197   1e-57   
ref|XP_006827226.1|  hypothetical protein AMTR_s00010p00260360          196   1e-57   
gb|KGN63993.1|  hypothetical protein Csa_1G033130                       196   2e-57   
ref|NP_177598.1|  glutathione S-transferase TAU 10                      196   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KCW83817.1|  hypothetical protein EUGRSUZ_B00691                     194   2e-56   
ref|XP_002866495.1|  glutathione S-transferase tau 9                    193   2e-56   
ref|XP_010045583.1|  PREDICTED: glutathione S-transferase U9-like       192   3e-56   
ref|XP_004299371.1|  PREDICTED: glutathione S-transferase U10-like      192   4e-56   
ref|XP_002888985.1|  hypothetical protein ARALYDRAFT_476598             192   5e-56   
emb|CBI31960.3|  unnamed protein product                                193   6e-56   
ref|XP_002275338.2|  PREDICTED: glutathione S-transferase U10-like      191   1e-55   Vitis vinifera
ref|XP_007045286.1|  Glutathione S-transferase tau 9, putative          191   2e-55   
emb|CAN70457.1|  hypothetical protein VITISV_006270                     191   2e-55   Vitis vinifera
ref|XP_009106127.1|  PREDICTED: glutathione S-transferase U10-lik...    191   3e-55   
ref|XP_002270090.1|  PREDICTED: glutathione S-transferase U10           191   3e-55   Vitis vinifera
ref|XP_010044742.1|  PREDICTED: glutathione S-transferase U10-like      189   6e-55   
emb|CAN75202.1|  hypothetical protein VITISV_010665                     189   7e-55   Vitis vinifera
ref|XP_002270113.2|  PREDICTED: glutathione S-transferase U10-like      189   1e-54   Vitis vinifera
emb|CBI31961.3|  unnamed protein product                                191   1e-54   
ref|XP_009106126.1|  PREDICTED: glutathione S-transferase U10-lik...    189   1e-54   
ref|XP_010938837.1|  PREDICTED: glutathione transferase GST 23-like     187   7e-54   
ref|XP_006424951.1|  hypothetical protein CICLE_v10030408mg             186   1e-53   
gb|KDO66688.1|  hypothetical protein CISIN_1g038634mg                   186   1e-53   
ref|XP_006488417.1|  PREDICTED: glutathione S-transferase U7-like       186   2e-53   
ref|XP_008374930.1|  PREDICTED: glutathione S-transferase U10-like      185   3e-53   
ref|XP_010678535.1|  PREDICTED: glutathione S-transferase U10-like      184   6e-53   
ref|XP_006484732.1|  PREDICTED: probable glutathione S-transferas...    182   5e-52   
gb|KDO66687.1|  hypothetical protein CISIN_1g041211mg                   182   6e-52   
ref|XP_010678534.1|  PREDICTED: glutathione S-transferase U10-like      181   9e-52   
ref|XP_010044745.1|  PREDICTED: glutathione S-transferase U10-like      181   1e-51   
gb|ACC86120.1|  glutathione S-transferase                               180   1e-51   Knorringia sibirica
ref|XP_007037333.1|  Glutathione S-transferase TAU 10, putative         181   2e-51   
ref|XP_002268774.2|  PREDICTED: probable glutathione S-transferase      181   2e-51   Vitis vinifera
dbj|BAJ90384.1|  predicted protein                                      180   3e-51   
ref|XP_007016281.1|  Glutathione S-transferase tau 7, putative          181   5e-51   
ref|XP_010271919.1|  PREDICTED: glutathione transferase GST 23-like     179   6e-51   
ref|XP_006437359.1|  hypothetical protein CICLE_v10032702mg             179   7e-51   
ref|XP_002266900.1|  PREDICTED: probable glutathione S-transferase      179   1e-50   Vitis vinifera
gb|EYU28750.1|  hypothetical protein MIMGU_mgv1a019211mg                178   2e-50   
emb|CBI26437.3|  unnamed protein product                                178   2e-50   
ref|XP_008446345.1|  PREDICTED: glutathione S-transferase U10-like      177   3e-50   
ref|XP_002266994.1|  PREDICTED: probable glutathione S-transferase      177   8e-50   Vitis vinifera
ref|XP_010086555.1|  Glutathione S-transferase U10                      176   8e-50   
ref|XP_010666893.1|  PREDICTED: glutathione S-transferase U9-like       176   9e-50   
emb|CAN73419.1|  hypothetical protein VITISV_027346                     176   1e-49   Vitis vinifera
emb|CAN62219.1|  hypothetical protein VITISV_042912                     176   1e-49   Vitis vinifera
gb|AAG41204.1|  glutathione transferase                                 176   1e-49   Suaeda maritima
ref|XP_002520472.1|  glutathione s-transferase, putative                176   1e-49   Ricinus communis
ref|XP_010678527.1|  PREDICTED: glutathione S-transferase U9-like       177   1e-49   
gb|KDP38795.1|  hypothetical protein JCGZ_05131                         176   2e-49   
ref|XP_010279540.1|  PREDICTED: probable glutathione S-transferas...    175   2e-49   
ref|XP_009382786.1|  PREDICTED: glutathione S-transferase U10-like      176   2e-49   
ref|XP_008221732.1|  PREDICTED: glutathione S-transferase U10-like      175   2e-49   
ref|XP_010678529.1|  PREDICTED: glutathione S-transferase U9-like       175   2e-49   
emb|CBI26438.3|  unnamed protein product                                175   2e-49   
ref|XP_006424949.1|  hypothetical protein CICLE_v10029241mg             174   4e-49   
ref|XP_010938161.1|  PREDICTED: glutathione S-transferase U8-like       174   5e-49   
ref|XP_006488416.1|  PREDICTED: glutathione S-transferase U7-like       174   5e-49   
ref|XP_010279541.1|  PREDICTED: probable glutathione S-transferas...    174   5e-49   
gb|KDO66686.1|  hypothetical protein CISIN_1g041800mg                   174   7e-49   
ref|XP_010678531.1|  PREDICTED: glutathione S-transferase U9-like       174   8e-49   
ref|XP_002281843.2|  PREDICTED: glutathione S-transferase U7            174   1e-48   Vitis vinifera
ref|XP_003591644.1|  hypothetical protein MTR_1g090150                  173   1e-48   
emb|CAN73676.1|  hypothetical protein VITISV_001111                     172   2e-48   Vitis vinifera
ref|XP_009602104.1|  PREDICTED: glutathione S-transferase U10-like      173   2e-48   
ref|XP_010279542.1|  PREDICTED: probable glutathione S-transferas...    173   2e-48   
ref|XP_002520474.1|  glutathione s-transferase, putative                172   2e-48   Ricinus communis
ref|XP_010937141.1|  PREDICTED: glutathione S-transferase U10-like      172   2e-48   
ref|XP_008802611.1|  PREDICTED: glutathione S-transferase U10-like      172   3e-48   
ref|XP_010922854.1|  PREDICTED: probable glutathione S-transferase      171   5e-48   
ref|XP_011006430.1|  PREDICTED: glutathione S-transferase U9            171   5e-48   
ref|XP_010521899.1|  PREDICTED: glutathione S-transferase U7-like       171   9e-48   
gb|EYU26623.1|  hypothetical protein MIMGU_mgv1a013321mg                171   1e-47   
ref|XP_006852815.1|  hypothetical protein AMTR_s00033p00172170          171   1e-47   
ref|XP_010923032.1|  PREDICTED: probable glutathione S-transferase      171   1e-47   
gb|AFF18816.1|  glutathione transferase                                 171   1e-47   
gb|EMS56906.1|  putative glutathione S-transferase                      171   1e-47   
ref|XP_006852814.1|  hypothetical protein AMTR_s00033p00172070          171   2e-47   
ref|XP_006354571.1|  PREDICTED: glutathione transferase GST 23-li...    170   2e-47   
ref|XP_002283736.1|  PREDICTED: probable glutathione S-transferase      170   2e-47   Vitis vinifera
ref|XP_008793319.1|  PREDICTED: probable glutathione S-transferase      170   2e-47   
ref|XP_004229525.1|  PREDICTED: glutathione transferase GST 23-like     169   3e-47   
emb|CAN73675.1|  hypothetical protein VITISV_001110                     169   3e-47   Vitis vinifera
ref|XP_003606407.1|  Glutathione S-transferase 103-1A                   169   3e-47   
ref|XP_010938159.1|  PREDICTED: glutathione transferase GST 23-like     169   3e-47   
ref|XP_007225529.1|  hypothetical protein PRUPE_ppa025728mg             169   7e-47   
ref|XP_006354574.1|  PREDICTED: glutathione transferase GST 23-like     168   8e-47   
gb|EYU26621.1|  hypothetical protein MIMGU_mgv1a013264mg                168   8e-47   
ref|XP_006437357.1|  hypothetical protein CICLE_v10032696mg             168   9e-47   
ref|XP_004229524.1|  PREDICTED: glutathione transferase GST 23-like     168   1e-46   
ref|XP_010666894.1|  PREDICTED: glutathione S-transferase U10-like      168   1e-46   
ref|XP_006827227.1|  hypothetical protein AMTR_s00010p00260410          168   1e-46   
ref|XP_010663654.1|  PREDICTED: probable glutathione S-transferase      167   1e-46   
gb|AFK43038.1|  unknown                                                 167   2e-46   
ref|XP_006409999.1|  hypothetical protein EUTSA_v10017210mg             167   2e-46   
ref|XP_007016280.1|  Glutathione S-transferase tau 7, putative          167   2e-46   
ref|XP_008781341.1|  PREDICTED: glutathione transferase GST 23-like     167   2e-46   
gb|KDP34500.1|  hypothetical protein JCGZ_11050                         167   2e-46   
ref|XP_004490102.1|  PREDICTED: LOW QUALITY PROTEIN: glutathione ...    167   3e-46   
gb|KDP42500.1|  hypothetical protein JCGZ_00297                         167   3e-46   
emb|CDP06552.1|  unnamed protein product                                167   3e-46   
ref|XP_004505976.1|  PREDICTED: probable glutathione S-transferas...    167   4e-46   
ref|XP_007036677.1|  Tau class glutathione transferase GSTU26           166   4e-46   
ref|XP_006437360.1|  hypothetical protein CICLE_v10032686mg             166   6e-46   
ref|XP_006484731.1|  PREDICTED: probable glutathione S-transferas...    166   8e-46   
ref|XP_011004953.1|  PREDICTED: probable glutathione S-transferase      165   1e-45   
gb|KDO46806.1|  hypothetical protein CISIN_1g027333mg                   165   1e-45   
ref|XP_010278876.1|  PREDICTED: probable glutathione S-transferase      165   1e-45   
gb|ADB11327.1|  tau class glutathione transferase GSTU45                165   1e-45   Populus trichocarpa [western balsam poplar]
emb|CBI16040.3|  unnamed protein product                                169   2e-45   
gb|EMT08874.1|  hypothetical protein F775_30884                         165   2e-45   
gb|ADE76765.1|  unknown                                                 165   2e-45   
ref|XP_002264117.1|  PREDICTED: probable glutathione S-transferase      165   2e-45   Vitis vinifera
ref|XP_011000057.1|  PREDICTED: probable glutathione S-transferase      164   3e-45   
ref|XP_006644548.1|  PREDICTED: probable glutathione S-transferas...    165   3e-45   
ref|XP_002465034.1|  hypothetical protein SORBIDRAFT_01g030930          165   3e-45   Sorghum bicolor [broomcorn]
ref|XP_008793317.1|  PREDICTED: probable glutathione S-transferase      164   3e-45   
gb|AFK47124.1|  unknown                                                 164   3e-45   
ref|XP_008793318.1|  PREDICTED: glutathione transferase GST 23-like     164   3e-45   
ref|XP_008781207.1|  PREDICTED: probable glutathione S-transferase      164   3e-45   
ref|XP_002532525.1|  glutathione s-transferase, putative                164   3e-45   Ricinus communis
ref|XP_009593034.1|  PREDICTED: glutathione transferase GST 23-like     164   3e-45   
ref|XP_002277759.2|  PREDICTED: probable glutathione S-transferase      164   4e-45   Vitis vinifera
emb|CAN72240.1|  hypothetical protein VITISV_010777                     164   5e-45   Vitis vinifera
gb|KDP42181.1|  hypothetical protein JCGZ_02911                         164   5e-45   
ref|NP_001065124.1|  Os10g0528400                                       164   6e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010276441.1|  PREDICTED: glutathione S-transferase U7-like       164   7e-45   
ref|XP_010650966.1|  PREDICTED: glutathione S-transferase U8            163   9e-45   
pdb|2VO4|A  Chain A, Glutathione Transferase From Glycine Max           162   1e-44   
ref|XP_004978487.1|  PREDICTED: glutathione transferase GST 23-like     163   1e-44   
ref|XP_006354570.1|  PREDICTED: glutathione transferase GST 23-li...    163   1e-44   
ref|XP_002281694.2|  PREDICTED: uncharacterized protein LOC100246830    168   1e-44   Vitis vinifera
ref|NP_001237713.1|  2,4-D inducible glutathione S-transferase          162   1e-44   
gb|EYU26622.1|  hypothetical protein MIMGU_mgv1a013365mg                162   1e-44   
ref|XP_009778650.1|  PREDICTED: glutathione transferase GST 23-like     162   1e-44   
gb|AAQ02687.1|  tau class GST protein 3                                 162   2e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_010646030.1|  PREDICTED: probable glutathione S-transferase      162   2e-44   
ref|XP_010279423.1|  PREDICTED: probable glutathione S-transferase      162   2e-44   
ref|XP_002319750.2|  hypothetical protein POPTR_0013s06950g             162   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_010521903.1|  PREDICTED: glutathione S-transferase U1-like       162   2e-44   
ref|XP_004488707.1|  PREDICTED: probable glutathione S-transferas...    162   2e-44   
ref|XP_002465037.1|  hypothetical protein SORBIDRAFT_01g031040          162   2e-44   Sorghum bicolor [broomcorn]
ref|XP_009790678.1|  PREDICTED: glutathione transferase GST 23-like     162   3e-44   
dbj|BAJ94042.1|  predicted protein                                      162   3e-44   
ref|XP_010103479.1|  putative glutathione S-transferase                 162   3e-44   
ref|NP_001104998.1|  glutathione transferase41                          163   3e-44   Zea mays [maize]
ref|XP_010939722.1|  PREDICTED: glutathione transferase GST 23-like     162   3e-44   
ref|XP_002441097.1|  hypothetical protein SORBIDRAFT_09g020350          163   3e-44   Sorghum bicolor [broomcorn]
ref|XP_007134772.1|  hypothetical protein PHAVU_010G074600g             161   3e-44   
ref|XP_002264055.2|  PREDICTED: probable glutathione S-transferas...    161   3e-44   Vitis vinifera
ref|XP_010674216.1|  PREDICTED: glutathione S-transferase U8-like       161   3e-44   
ref|XP_007223941.1|  hypothetical protein PRUPE_ppa011108mg             161   3e-44   
ref|XP_006354565.1|  PREDICTED: glutathione transferase GST 23-li...    161   4e-44   
ref|XP_002520473.1|  glutathione s-transferase, putative                162   4e-44   Ricinus communis
ref|XP_010693951.1|  PREDICTED: glutathione S-transferase U7-like       161   4e-44   
gb|AFS51729.1|  tau class glutathione S-transferase                     161   4e-44   
ref|NP_001234088.1|  uncharacterized protein LOC543815                  161   5e-44   
ref|XP_010060069.1|  PREDICTED: glutathione transferase GST 23-like     161   5e-44   
ref|XP_002280532.1|  PREDICTED: probable glutathione S-transferase      161   5e-44   Vitis vinifera
ref|XP_010037769.1|  PREDICTED: probable glutathione S-transferase      161   5e-44   
ref|XP_004983859.1|  PREDICTED: probable glutathione S-transferas...    161   5e-44   
ref|XP_010661155.1|  PREDICTED: probable glutathione S-transferas...    161   6e-44   
emb|CAN83043.1|  hypothetical protein VITISV_027913                     160   6e-44   Vitis vinifera
gb|AAK98536.1|AF402795_1  putative glutathione S-transferase OsGSTU8    161   6e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010103478.1|  putative glutathione S-transferase                 161   6e-44   
emb|CDP21862.1|  unnamed protein product                                161   6e-44   
ref|NP_001235279.1|  uncharacterized protein LOC100527381               160   7e-44   
ref|XP_008219369.1|  PREDICTED: glutathione transferase GST 23-like     160   7e-44   
ref|XP_003580393.2|  PREDICTED: probable glutathione S-transferas...    162   7e-44   
ref|XP_002467617.1|  hypothetical protein SORBIDRAFT_01g030980          161   7e-44   Sorghum bicolor [broomcorn]
ref|XP_010521898.1|  PREDICTED: glutathione S-transferase U7-like       160   8e-44   
ref|XP_004983860.1|  PREDICTED: probable glutathione S-transferas...    161   8e-44   
gb|AFW78007.1|  glutathione S-transferase GST 41                        162   8e-44   
ref|XP_004969618.1|  PREDICTED: probable glutathione S-transferas...    161   8e-44   
ref|XP_010921338.1|  PREDICTED: glutathione transferase GST 23-like     160   8e-44   
ref|NP_001065129.2|  Os10g0529700                                       161   8e-44   Oryza sativa Japonica Group [Japonica rice]
gb|KHG11258.1|  putative glutathione S-transferase                      160   9e-44   
gb|ACG38910.1|  glutathione S-transferase GSTU6                         162   9e-44   Zea mays [maize]
ref|XP_002280676.1|  PREDICTED: probable glutathione S-transferase      160   1e-43   Vitis vinifera
emb|CAN73674.1|  hypothetical protein VITISV_001109                     164   1e-43   Vitis vinifera
ref|XP_008810352.1|  PREDICTED: glutathione transferase GST 23-like     161   1e-43   
ref|XP_010521901.1|  PREDICTED: glutathione S-transferase U1-like       160   1e-43   
ref|XP_010938160.1|  PREDICTED: glutathione transferase GST 23-like     160   1e-43   
ref|XP_006483268.1|  PREDICTED: glutathione S-transferase U17-lik...    160   1e-43   
gb|ACG38008.1|  glutathione S-transferase GSTU6                         160   1e-43   Zea mays [maize]
ref|XP_008360297.1|  PREDICTED: probable glutathione S-transferase      160   1e-43   
ref|NP_001238721.1|  glutathione S-transferase GST 13                   160   1e-43   
ref|XP_009354819.1|  PREDICTED: probable glutathione S-transferas...    160   1e-43   
gb|AGC13120.1|  tau class glutathione S-transferase                     160   1e-43   
ref|XP_007226313.1|  hypothetical protein PRUPE_ppa021702mg             160   1e-43   
gb|ADD71974.1|  glutathione S-transferase                               160   1e-43   
emb|CBI16039.3|  unnamed protein product                                162   1e-43   
gb|ABK27093.1|  unknown                                                 160   1e-43   
ref|XP_002264437.1|  PREDICTED: probable glutathione S-transferase      160   1e-43   
ref|NP_001065134.1|  Os10g0530200                                       160   2e-43   
gb|AGC13122.1|  tau class glutathione S-transferase                     160   2e-43   
ref|XP_006480912.1|  PREDICTED: glutathione S-transferase U8-like       159   2e-43   
ref|XP_004299207.1|  PREDICTED: glutathione transferase GST 23-like     160   2e-43   
ref|XP_010037777.1|  PREDICTED: probable glutathione S-transferase      160   2e-43   
ref|XP_002262767.1|  PREDICTED: probable glutathione S-transferase      159   2e-43   
gb|KDP42499.1|  hypothetical protein JCGZ_00296                         159   2e-43   
ref|XP_002277724.2|  PREDICTED: glutathione transferase GST 23          159   2e-43   
ref|XP_010678532.1|  PREDICTED: glutathione S-transferase U9-like       159   3e-43   
ref|XP_009343225.1|  PREDICTED: probable glutathione S-transferas...    159   3e-43   
ref|XP_008390704.1|  PREDICTED: probable glutathione S-transferase      159   3e-43   
gb|AAC32118.1|  probable glutathione S-transferase                      159   3e-43   
ref|XP_011041493.1|  PREDICTED: probable glutathione S-transferas...    159   3e-43   
ref|XP_006576598.1|  PREDICTED: probable glutathione S-transferas...    159   3e-43   
ref|XP_004969619.1|  PREDICTED: probable glutathione S-transferas...    159   3e-43   
ref|XP_008240197.1|  PREDICTED: probable glutathione S-transferase      159   3e-43   
ref|XP_002518186.1|  glutathione s-transferase, putative                159   3e-43   
ref|XP_008224069.1|  PREDICTED: glutathione transferase GST 23-like     159   4e-43   
ref|XP_010087165.1|  putative glutathione S-transferase                 159   4e-43   
ref|XP_008390701.1|  PREDICTED: probable glutathione S-transferase      159   4e-43   
gb|KHN47446.1|  Putative glutathione S-transferase                      159   4e-43   
ref|XP_010037776.1|  PREDICTED: probable glutathione S-transferase      159   4e-43   
gb|ADB11367.1|  putative tau class glutathione transferase GSTU41       159   4e-43   
ref|XP_002520478.1|  glutathione s-transferase, putative                159   4e-43   
ref|XP_006429233.1|  hypothetical protein CICLE_v10012710mg             159   4e-43   
ref|XP_002275657.2|  PREDICTED: probable glutathione S-transferase      158   4e-43   
ref|XP_006294944.1|  hypothetical protein CARUB_v10023998mg             159   4e-43   
ref|XP_007221843.1|  hypothetical protein PRUPE_ppa024247mg             158   5e-43   
gb|AAO69664.1|  glutathione S-transferase                               159   5e-43   
gb|AHA46515.1|  tau class glutathione S-transferase                     159   5e-43   
emb|CAA04391.1|  glutathione transferase                                158   5e-43   
ref|XP_008383009.1|  PREDICTED: probable glutathione S-transferase      158   5e-43   
ref|XP_008390702.1|  PREDICTED: probable glutathione S-transferase      158   5e-43   
ref|XP_002264054.1|  PREDICTED: glutathione transferase GST 23          158   6e-43   
ref|XP_006661982.1|  PREDICTED: probable glutathione S-transferas...    159   6e-43   
ref|XP_002458348.1|  hypothetical protein SORBIDRAFT_03g031780          159   6e-43   
gb|AEF79856.1|  glutathione-S-transferase tau 1                         158   6e-43   
emb|CAN78656.1|  hypothetical protein VITISV_006850                     158   6e-43   
ref|XP_002978626.1|  hypothetical protein SELMODRAFT_108617             158   6e-43   
ref|NP_001043939.2|  Os01g0692100                                       159   7e-43   
ref|XP_010062724.1|  PREDICTED: probable glutathione S-transferase      160   7e-43   
tpg|DAA58020.1|  TPA: glutathione S-transferase GSTU6                   159   7e-43   
ref|XP_002265110.1|  PREDICTED: probable glutathione S-transferase      158   7e-43   
ref|XP_010919190.1|  PREDICTED: glutathione S-transferase U17-lik...    158   7e-43   
ref|XP_009759844.1|  PREDICTED: probable glutathione S-transferas...    158   7e-43   
ref|XP_010042776.1|  PREDICTED: glutathione S-transferase U8-like       158   7e-43   
ref|XP_010243636.1|  PREDICTED: probable glutathione S-transferase      158   8e-43   
ref|XP_008360298.1|  PREDICTED: probable glutathione S-transferase      158   8e-43   
gb|AFK48261.1|  unknown                                                 158   9e-43   
gb|AGV54744.1|  glutathione transferase                                 158   9e-43   
ref|NP_001130938.1|  uncharacterized protein LOC100192043               158   9e-43   
ref|XP_009378879.1|  PREDICTED: probable glutathione S-transferase      157   9e-43   
ref|XP_010942640.1|  PREDICTED: glutathione transferase GST 23-like     158   1e-42   
ref|XP_004147912.1|  PREDICTED: probable glutathione S-transferas...    157   1e-42   
gb|AAC32139.1|  probable glutathione S-transferase                      158   1e-42   
gb|ADB11358.1|  tau class glutathione transferase GSTU26                157   1e-42   
gb|KHG11257.1|  Glutathione transferase GST 23                          157   1e-42   
ref|XP_004962089.1|  PREDICTED: glutathione transferase GST 23-like     159   1e-42   
gb|EAY79300.1|  hypothetical protein OsI_34426                          158   1e-42   
ref|XP_007140454.1|  hypothetical protein PHAVU_008G113600g             157   1e-42   
ref|NP_001238691.1|  glutathione S-transferase                          157   1e-42   
ref|XP_002523996.1|  glutathione s-transferase, putative                157   1e-42   
ref|XP_007026863.1|  Tau class glutathione transferase GSTU45           157   1e-42   
gb|EAY75448.1|  hypothetical protein OsI_03349                          158   1e-42   
ref|XP_008780084.1|  PREDICTED: glutathione S-transferase U17-like      157   1e-42   
ref|NP_001065133.1|  Os10g0530000                                       157   1e-42   
ref|XP_009616058.1|  PREDICTED: probable glutathione S-transferase      157   1e-42   
gb|AFK37918.1|  unknown                                                 157   1e-42   
emb|CAN60691.1|  hypothetical protein VITISV_044168                     157   1e-42   
ref|XP_008372264.1|  PREDICTED: probable glutathione S-transferase      157   1e-42   
gb|ABL84692.1|  glutathione S-transferase                               157   2e-42   
sp|P49332.1|GSTXC_TOBAC  RecName: Full=Probable glutathione S-tra...    157   2e-42   
gb|KCW83605.1|  hypothetical protein EUGRSUZ_B00500                     155   2e-42   
ref|XP_011077664.1|  PREDICTED: probable glutathione S-transferase      158   2e-42   
gb|AGC13134.1|  tau class glutathione S-transferase                     157   2e-42   
ref|XP_006433894.1|  hypothetical protein CICLE_v10002406mg             157   2e-42   
ref|XP_007218360.1|  hypothetical protein PRUPE_ppa011115mg             157   2e-42   
ref|XP_006662534.1|  PREDICTED: probable glutathione S-transferas...    157   2e-42   
ref|XP_008351205.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    157   2e-42   
ref|NP_001237841.1|  uncharacterized protein LOC100306119               157   2e-42   
ref|XP_006378305.1|  hypothetical protein POPTR_0010s07210g             157   2e-42   
ref|XP_006572808.1|  PREDICTED: uncharacterized protein LOC100306...    157   2e-42   
gb|ACN60408.1|  glutathione S-transferase                               157   2e-42   
ref|XP_002465038.1|  hypothetical protein SORBIDRAFT_01g031050          157   2e-42   
ref|XP_002520476.1|  glutathione s-transferase, putative                157   2e-42   
gb|KGN54330.1|  hypothetical protein Csa_4G304760                       156   2e-42   
ref|XP_010428964.1|  PREDICTED: glutathione S-transferase U19-like      156   2e-42   
ref|XP_009782169.1|  PREDICTED: glutathione S-transferase U10-like      156   2e-42   
dbj|BAJ95534.1|  predicted protein                                      157   3e-42   
ref|XP_010907529.1|  PREDICTED: glutathione transferase GST 23-like     158   3e-42   
ref|XP_003634747.1|  PREDICTED: probable glutathione S-transferas...    156   3e-42   
gb|KHN01151.1|  Glutathione S-transferase U18                           157   3e-42   
ref|XP_008224067.1|  PREDICTED: glutathione transferase GST 23-like     156   3e-42   
ref|NP_001147207.1|  glutathione S-transferase GSTU6                    157   3e-42   
ref|XP_002520166.1|  glutathione s-transferase, putative                157   3e-42   
ref|XP_006849223.1|  hypothetical protein AMTR_s00027p00230090          156   3e-42   
gb|AFK35485.1|  unknown                                                 156   3e-42   
ref|XP_003634751.1|  PREDICTED: probable glutathione S-transferase      156   3e-42   
ref|XP_008780071.1|  PREDICTED: glutathione S-transferase U18-like      157   3e-42   
ref|XP_002467615.1|  hypothetical protein SORBIDRAFT_01g030950          157   3e-42   
gb|EEC67342.1|  hypothetical protein OsI_34397                          157   3e-42   
ref|XP_003634749.1|  PREDICTED: probable glutathione S-transferas...    156   3e-42   
ref|XP_008438425.1|  PREDICTED: probable glutathione S-transferase      156   3e-42   
ref|XP_007149246.1|  hypothetical protein PHAVU_005G054000g             156   4e-42   
ref|XP_010678530.1|  PREDICTED: glutathione S-transferase U9-like       156   4e-42   
ref|XP_010037773.1|  PREDICTED: glutathione S-transferase U8-like       156   4e-42   
ref|XP_004157054.1|  PREDICTED: probable glutathione S-transferas...    156   4e-42   
ref|XP_002263395.1|  PREDICTED: probable glutathione S-transferase      156   4e-42   
gb|ABW81189.1|  glutathione-S-transferase                               156   4e-42   
ref|XP_008777531.1|  PREDICTED: glutathione S-transferase U18-like      156   4e-42   
ref|XP_007220010.1|  hypothetical protein PRUPE_ppb024827mg             156   4e-42   
ref|XP_002520480.1|  glutathione s-transferase, putative                156   4e-42   
ref|NP_001235768.1|  uncharacterized protein LOC100500281               156   4e-42   
gb|KDP24710.1|  hypothetical protein JCGZ_25701                         156   4e-42   
ref|XP_008784133.1|  PREDICTED: glutathione S-transferase U10-like      156   4e-42   
ref|XP_002518184.1|  glutathione s-transferase, putative                156   4e-42   
ref|XP_010023538.1|  PREDICTED: probable glutathione S-transferase      156   4e-42   
ref|XP_008812228.1|  PREDICTED: glutathione transferase GST 23-like     156   5e-42   
ref|NP_001238675.1|  glutathione S-transferase GST 8                    156   5e-42   
ref|XP_004247806.1|  PREDICTED: glutathione transferase GST 23-like     156   5e-42   
ref|XP_007149237.1|  hypothetical protein PHAVU_005G053200g             155   5e-42   
dbj|BAK00368.1|  predicted protein                                      156   5e-42   
ref|XP_003529119.1|  PREDICTED: probable glutathione S-transferas...    156   5e-42   
gb|KDO81087.1|  hypothetical protein CISIN_1g027498mg                   155   5e-42   
gb|ACG44169.1|  glutathione S-transferase GSTU6                         156   5e-42   
ref|XP_002264825.1|  PREDICTED: probable glutathione S-transferas...    155   6e-42   
ref|XP_006302801.1|  hypothetical protein CARUB_v10020928mg             155   6e-42   
gb|ADB11328.1|  tau class glutathione transferase GSTU46                155   6e-42   
gb|ACU24385.1|  unknown                                                 155   6e-42   
gb|KHN05121.1|  Putative glutathione S-transferase                      156   6e-42   
gb|EMS62793.1|  putative glutathione S-transferase GSTU6                156   6e-42   
gb|KHG28543.1|  Glutathione S-transferase U8 -like protein              155   6e-42   
ref|XP_010037768.1|  PREDICTED: probable glutathione S-transferase      155   6e-42   
emb|CAN66702.1|  hypothetical protein VITISV_005451                     155   6e-42   
ref|XP_006298410.1|  hypothetical protein CARUB_v10014479mg             156   6e-42   
ref|XP_004147931.1|  PREDICTED: probable glutathione S-transferas...    155   6e-42   
emb|CDP19810.1|  unnamed protein product                                155   6e-42   
gb|ABR16175.1|  unknown                                                 156   6e-42   
gb|AAA87183.1|  auxin-induced protein                                   155   6e-42   
ref|NP_565178.1|  glutathione S-transferase TAU 19                      155   6e-42   
ref|XP_002520475.1|  glutathione s-transferase, putative                155   6e-42   
ref|XP_010067033.1|  PREDICTED: probable glutathione S-transferase      155   6e-42   
ref|XP_008360299.1|  PREDICTED: probable glutathione S-transferase      155   6e-42   
ref|XP_002467600.1|  hypothetical protein SORBIDRAFT_01g030800          155   7e-42   
ref|XP_004302690.1|  PREDICTED: probable glutathione S-transferas...    155   7e-42   
gb|KHN27766.1|  Glutathione S-transferase 3                             155   7e-42   
ref|XP_006483269.1|  PREDICTED: glutathione S-transferase U17-like      155   7e-42   
ref|XP_004166786.1|  PREDICTED: probable glutathione S-transferas...    155   7e-42   
ref|XP_009335026.1|  PREDICTED: probable glutathione S-transferas...    155   7e-42   
ref|XP_002321502.2|  hypothetical protein POPTR_0015s04200g             155   7e-42   
gb|ABA95696.2|  Glutathione S-transferase, C-terminal domain cont...    155   7e-42   
ref|XP_004133937.1|  PREDICTED: probable glutathione S-transferas...    155   7e-42   
ref|XP_006438550.1|  hypothetical protein CICLE_v10032680mg             155   8e-42   
dbj|BAA78580.1|  Dcarg-1                                                155   8e-42   
gb|AAF64450.1|AF239928_1  glutathione S-transferase                     155   8e-42   
ref|XP_002884725.1|  predicted protein                                  155   8e-42   
ref|NP_187538.1|  glutathione S-transferase TAU 8                       155   8e-42   
gb|AFK49005.1|  unknown                                                 155   8e-42   
ref|XP_006378300.1|  hypothetical protein POPTR_0010s07150g             155   8e-42   
ref|XP_004983853.1|  PREDICTED: probable glutathione S-transferas...    155   8e-42   
ref|XP_002862399.1|  glutathione-s-transferase                          155   8e-42   
gb|KEH38386.1|  glutathione S-transferase, amino-terminal domain ...    155   8e-42   
emb|CAN72033.1|  hypothetical protein VITISV_032560                     152   8e-42   
ref|XP_003634746.1|  PREDICTED: probable glutathione S-transferase      155   8e-42   
ref|XP_010023536.1|  PREDICTED: glutathione transferase GST 23-like     155   9e-42   
ref|XP_009335024.1|  PREDICTED: probable glutathione S-transferas...    155   9e-42   
gb|ACJ85907.1|  unknown                                                 155   9e-42   
gb|ABW74586.1|  glutathione-S-transferase                               155   9e-42   
gb|AHI54570.1|  glutathione S-transferase                               155   9e-42   
ref|XP_011000484.1|  PREDICTED: probable glutathione S-transferase      155   1e-41   
ref|XP_002518188.1|  glutathione s-transferase, putative                155   1e-41   
gb|ABK26947.1|  unknown                                                 155   1e-41   
ref|XP_002524047.1|  glutathione s-transferase, putative                155   1e-41   
gb|ABW81037.1|  glutathione-s-transferase 7                             155   1e-41   
ref|XP_007034540.1|  Glutathione S-transferase tau 7                    155   1e-41   
gb|AFK42157.1|  unknown                                                 155   1e-41   
ref|XP_010472049.1|  PREDICTED: glutathione S-transferase U23           155   1e-41   
gb|KEH38380.1|  glutathione S-transferase, amino-terminal domain ...    155   1e-41   
gb|KHN05118.1|  Putative glutathione S-transferase                      155   1e-41   
gb|EAZ16758.1|  hypothetical protein OsJ_32234                          155   1e-41   
gb|EAY79287.1|  hypothetical protein OsI_34413                          155   1e-41   
ref|NP_180503.1|  glutathione S-transferase tau 7                       155   1e-41   
ref|XP_010685658.1|  PREDICTED: glutathione S-transferase U7-like       155   1e-41   
gb|AFF18812.1|  glutathione transferase                                 154   1e-41   
gb|KFK42224.1|  hypothetical protein AALP_AA2G227300                    154   1e-41   
ref|XP_008657742.1|  PREDICTED: probable glutathione S-transferas...    155   1e-41   
ref|XP_010023537.1|  PREDICTED: probable glutathione S-transferase      155   1e-41   
ref|XP_010060811.1|  PREDICTED: probable glutathione S-transferas...    154   1e-41   
ref|XP_010919189.1|  PREDICTED: glutathione S-transferase U17-lik...    155   2e-41   
gb|AGC13124.1|  tau class glutathione S-transferase                     155   2e-41   
ref|NP_001065125.1|  Os10g0528900                                       155   2e-41   
gb|AFK43265.1|  unknown                                                 154   2e-41   
ref|XP_006364366.1|  PREDICTED: probable glutathione S-transferas...    154   2e-41   
ref|XP_002315605.2|  hypothetical protein POPTR_0010s07150g             155   2e-41   
gb|AAM64593.1|  glutathione transferase, putative                       154   2e-41   
gb|ABE86679.1|  Intracellular chloride channel                          154   2e-41   
gb|AHA46512.1|  tau class glutathione S-transferase                     155   2e-41   
ref|XP_004246383.1|  PREDICTED: probable glutathione S-transferase      154   2e-41   
ref|XP_002521517.1|  glutathione s-transferase, putative                155   2e-41   
ref|XP_010469949.1|  PREDICTED: glutathione S-transferase U1            154   2e-41   
ref|XP_004151689.1|  PREDICTED: glutathione S-transferase U9-like       150   2e-41   
ref|XP_007149247.1|  hypothetical protein PHAVU_005G054100g             154   2e-41   
ref|XP_004983852.1|  PREDICTED: probable glutathione S-transferas...    154   2e-41   
ref|XP_011041492.1|  PREDICTED: probable glutathione S-transferas...    155   2e-41   
ref|XP_010472053.1|  PREDICTED: glutathione S-transferase U19-like      154   2e-41   
ref|XP_007034532.1|  Glutathione S-transferase tau 7                    154   2e-41   
gb|ADB11374.1|  tau class glutathione transferase GSTU50                154   2e-41   
ref|XP_002532823.1|  glutathione s-transferase, putative                154   2e-41   
ref|NP_001065126.1|  Os10g0529300                                       155   2e-41   
gb|AAK98535.1|AF402794_1  putative glutathione S-transferase OsGSTU7    155   2e-41   
ref|XP_010939723.1|  PREDICTED: glutathione transferase GST 23-like     154   2e-41   
ref|XP_010023535.1|  PREDICTED: probable glutathione S-transferase      154   2e-41   
gb|AAG34850.1|AF244707_1  glutathione S-transferase GST 42              154   2e-41   
ref|XP_002970547.1|  hypothetical protein SELMODRAFT_93858              154   2e-41   
ref|XP_002467608.1|  hypothetical protein SORBIDRAFT_01g030880          154   2e-41   
ref|XP_010234937.1|  PREDICTED: probable glutathione S-transferas...    154   2e-41   
ref|XP_009354820.1|  PREDICTED: probable glutathione S-transferase      154   2e-41   



>ref|XP_009624857.1| PREDICTED: glutathione S-transferase U10-like [Nicotiana tomentosiformis]
Length=232

 Score =   302 bits (774),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 182/226 (81%), Gaps = 1/226 (0%)
 Frame = -3

Query  844  HHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLH  665
               ++V LHGMW+S+YAKKVELALKIKGI F+YVEEDL NKS  LL+ N ++KKVP+LLH
Sbjct  2    EDENKVTLHGMWISSYAKKVELALKIKGITFDYVEEDLSNKSSLLLKYNSVYKKVPVLLH  61

Query  664  NGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARG  485
             GRP+ ES+VI+EYIDETW N +PR LPED Y++A VRFWA Y  Q+SDTMKKAFISA+ 
Sbjct  62   RGRPVSESLVILEYIDETWKN-QPRFLPEDPYERATVRFWATYCLQISDTMKKAFISAQE  120

Query  484  QNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
             +K+ AF EFF  L+++E+  + F P ER  I A+++GLLDI +V +LG +KA  EVL M
Sbjct  121  VDKDRAFDEFFEKLQVMEEGMKDFFPGERSNICAETMGLLDIIIVGSLGTYKAAAEVLRM  180

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            KI+D +++PFI+SWV +LLELPLV++TLPPH+K VSRLE IKQ+GF
Sbjct  181  KILDPQRNPFIYSWVNTLLELPLVKQTLPPHDKVVSRLEFIKQNGF  226



>ref|XP_009768455.1| PREDICTED: glutathione S-transferase U10-like [Nicotiana sylvestris]
Length=246

 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 183/226 (81%), Gaps = 1/226 (0%)
 Frame = -3

Query  844  HHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLH  665
               ++V LHGMW+S+YAK VELALKIKGI F+YVEEDL NKS  LL+ NP++KKVP+LLH
Sbjct  16   EDENKVTLHGMWISSYAKTVELALKIKGIAFDYVEEDLSNKSSLLLKYNPVYKKVPVLLH  75

Query  664  NGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARG  485
             GRP+ ES+VI+EYIDETW N +PR LP+D Y++A+VRFWA Y  Q+SDTMKKAFISA+ 
Sbjct  76   RGRPVSESLVILEYIDETWKN-QPRFLPDDPYERARVRFWAIYCRQISDTMKKAFISAQE  134

Query  484  QNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
             +++ AF EFF  L+++E+  +   P ER    +++LGLLDI +V +LG +KA EEVLGM
Sbjct  135  VDEDRAFDEFFEKLQVMEEGMKDIFPGERSNNCSENLGLLDIIIVGSLGTYKAAEEVLGM  194

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            K++D E++PFI+SWV +LLELPLV++TLPPH+K VSRLE IKQ+GF
Sbjct  195  KVLDPERNPFIYSWVNTLLELPLVKQTLPPHDKVVSRLEFIKQNGF  240



>ref|XP_004236471.2| PREDICTED: glutathione S-transferase U10-like [Solanum lycopersicum]
Length=221

 Score =   291 bits (746),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 175/216 (81%), Gaps = 1/216 (0%)
 Frame = -3

Query  814  MWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESIV  635
            MW+STYAKKVELALKIKGI F+YVEEDL NKS  LL+ NPIHKKVP+LLH G+P+ ES+V
Sbjct  1    MWISTYAKKVELALKIKGIAFDYVEEDLSNKSSLLLKYNPIHKKVPLLLHRGKPLSESLV  60

Query  634  IVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNAAFSEF  455
            I+EYIDETWNNL+P +LPED Y++A VR WA Y  Q+SDTMKKAFISAR   +  AF E 
Sbjct  61   ILEYIDETWNNLQPLLLPEDPYERATVRLWASYCLQISDTMKKAFISAR-DVEGGAFDEL  119

Query  454  FVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEKHPF  275
            F  L+++E+  + F P  R KI A++LGLLDI +V +L  +KA EEV+G KI+D EK+PF
Sbjct  120  FEILKVMEEGMKDFFPGGRSKICAENLGLLDIIIVCSLATYKAAEEVVGTKILDPEKNPF  179

Query  274  IFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            ++SWV +LLELPLV+ETLPPH+K VSRL+ IK++GF
Sbjct  180  VYSWVTTLLELPLVKETLPPHDKLVSRLDFIKKNGF  215



>emb|CDP20458.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 168/230 (73%), Gaps = 4/230 (2%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE     D VILHGMW STY K+VELALKIKGIPFEYVEEDL NKS  LL+ NP+ +KV
Sbjct  1    MGE----EDTVILHGMWASTYVKRVELALKIKGIPFEYVEEDLSNKSALLLKYNPVQRKV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+L+HNG+PI ES+VI+EYIDETW +   ++LP+D Y++A+VRFWA YI QL ++M K F
Sbjct  57   PVLVHNGKPICESLVILEYIDETWPSHGLQLLPKDPYERARVRFWAAYIQQLLESMAKLF  116

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVE  320
                 + +  A  E +    ILE+  R F P E P +  + LG+LDI +V+TLG  +A E
Sbjct  117  NPDHKEAQEKALEEMYEKQRILEEGMREFFPEESPNVHPEKLGILDIMIVSTLGAFRAQE  176

Query  319  EVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHG  170
            E LG+K +D EK+P +FSWVE+L++LP+V+E +PP EK VS L+ IKQ+G
Sbjct  177  EALGVKTLDPEKNPLLFSWVEALIQLPVVKEIIPPFEKLVSLLQFIKQNG  226



>ref|XP_006476607.1| PREDICTED: glutathione S-transferase U9-like [Citrus sinensis]
Length=230

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 163/224 (73%), Gaps = 1/224 (0%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
             + V LHGMW STY+K+VELALK+KGIP+EY+EEDLRNKSP LLQ NP++KKVP+L+HNG
Sbjct  4    ENEVKLHGMWASTYSKRVELALKVKGIPYEYIEEDLRNKSPLLLQYNPVYKKVPVLVHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            +PI ES +I+EYIDETW N  PR+LP+D YQ+A++RFWA +I Q         IS+ G+ 
Sbjct  64   KPIAESYIILEYIDETWQN-GPRLLPQDPYQRAQIRFWASFIQQQLFGSFYKLISSNGEE  122

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A  E F  + +LEK  +   P   P++   + G+LDI + AT G +KA EEV G+K+
Sbjct  123  QEKAVEEVFEKMNVLEKGMKELLPEGVPEVDGNNSGVLDILVTATFGPYKAHEEVFGLKV  182

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            +D EK+P +FSWV+ L E+PLV+  LPPH+K V+ L+ +KQ+G 
Sbjct  183  LDPEKYPLLFSWVQKLNEIPLVKGVLPPHDKLVALLQFMKQNGL  226



>ref|XP_010663865.1| PREDICTED: glutathione S-transferase U9-like [Vitis vinifera]
Length=231

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 169/224 (75%), Gaps = 3/224 (1%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            +++ LHGMW ST+ K+VELALKIKGIP+EY+EEDL NKS  +L+ NP+HKKVP+L+HNG+
Sbjct  5    NQIKLHGMWGSTFTKRVELALKIKGIPYEYIEEDLSNKSQLVLKYNPVHKKVPVLVHNGK  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            PI+ES++I+EYIDETW N  PR+LP+D Y++AKVRFWA + H QL + M +  I++ G+ 
Sbjct  65   PIIESLIILEYIDETWKN-APRLLPDDPYERAKVRFWASFFHQQLFEDMGRV-ITSDGEA  122

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A  + F  L +LE+  + F P   P I+ +++GLLDI + A  G +KA EEVLGMK+
Sbjct  123  QEKATKDLFEKLTVLEEGMKDFFPGGTPSINGENMGLLDILMCALFGPYKAHEEVLGMKM  182

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            ID E++P +FSWV ++ E+P+V+E+ PPHEK V  ++ I+QH  
Sbjct  183  IDPERNPLLFSWVMAITEIPVVQESTPPHEKLVGLVQFIRQHAL  226



>ref|XP_006439597.1| hypothetical protein CICLE_v10024585mg, partial [Citrus clementina]
 gb|ESR52837.1| hypothetical protein CICLE_v10024585mg, partial [Citrus clementina]
Length=231

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 161/222 (73%), Gaps = 1/222 (0%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
             + V LHGMW STY+K+VELAL++KGIP+EY+EEDLRNKSP LLQ N ++KKVP+L+HNG
Sbjct  5    ENEVKLHGMWASTYSKRVELALRVKGIPYEYIEEDLRNKSPLLLQYNSVYKKVPVLVHNG  64

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            +PI ES +I+EYIDETW N  PR+LP+D YQ+A++RFWA +I Q         IS+ G+ 
Sbjct  65   KPITESYIILEYIDETWQN-GPRLLPQDPYQRAQIRFWASFIQQQLFGSFYKLISSNGEE  123

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A  E F  + +LEK  +   P   P++   + G+LDI + AT G +KA EEV G+K+
Sbjct  124  QEKAVEEVFEKMNVLEKGMKELLPEGVPEVDGNNFGVLDILVTATFGPYKAHEEVFGLKV  183

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQH  173
            +D EK+P +FSWV+ L E+PLV+  LPPH+K V+ L+ IKQ+
Sbjct  184  LDPEKYPLLFSWVQKLNEIPLVKGVLPPHDKLVALLQFIKQN  225



>gb|KDO76130.1| hypothetical protein CISIN_1g026934mg [Citrus sinensis]
Length=230

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 161/222 (73%), Gaps = 1/222 (0%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
             + V LHGMW STY+K+VELAL++KGIP+EY+EEDLRNKSP LLQ N ++KKVP+L+HNG
Sbjct  4    ENEVKLHGMWASTYSKRVELALRVKGIPYEYIEEDLRNKSPLLLQYNSVYKKVPVLVHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            +PI ES +I+EYIDETW N  PR+LP+D YQ+A++RFWA +I Q         IS+ G+ 
Sbjct  64   KPITESYIILEYIDETWQN-GPRLLPQDPYQRAQIRFWASFIQQQLFGSFYKLISSNGEE  122

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A  E F  + +LEK  +   P   P++   + G+LDI + AT G +KA EEV G+K+
Sbjct  123  QEKAVEEVFEKMNVLEKGMKELLPEGVPEVDGNNSGVLDILVTATFGPYKAHEEVFGLKV  182

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQH  173
            +D EK+P +FSWV+ L E+PLV+  LPPH+K V+ L+ IKQ+
Sbjct  183  LDPEKYPLLFSWVQKLNEIPLVKGVLPPHDKLVALLQFIKQN  224



>emb|CBI15230.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 169/224 (75%), Gaps = 3/224 (1%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            +++ LHGMW ST+ K+VELALKIKGIP+EY+EEDL NKS  +L+ NP+HKKVP+L+HNG+
Sbjct  207  NQIKLHGMWGSTFTKRVELALKIKGIPYEYIEEDLSNKSQLVLKYNPVHKKVPVLVHNGK  266

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            PI+ES++I+EYIDETW N  PR+LP+D Y++AKVRFWA + H QL + M +  I++ G+ 
Sbjct  267  PIIESLIILEYIDETWKN-APRLLPDDPYERAKVRFWASFFHQQLFEDMGRV-ITSDGEA  324

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A  + F  L +LE+  + F P   P I+ +++GLLDI + A  G +KA EEVLGMK+
Sbjct  325  QEKATKDLFEKLTVLEEGMKDFFPGGTPSINGENMGLLDILMCALFGPYKAHEEVLGMKM  384

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            ID E++P +FSWV ++ E+P+V+E+ PPHEK V  ++ I+QH  
Sbjct  385  IDPERNPLLFSWVMAITEIPVVQESTPPHEKLVGLVQFIRQHAL  428


 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 137/196 (70%), Gaps = 7/196 (4%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE     ++V L+GMW S + K+VE+ALKIKGIP+EYVEEDLRNKS  LLQ NP+HKKV
Sbjct  1    MGEE----NKVTLYGMWASPFVKRVEIALKIKGIPYEYVEEDLRNKSQLLLQYNPVHKKV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKA  503
            P+L+HNG+PI ES+VI+EYI+ETW N  P++LPED Y++AKVRFWA +I  Q  D+M  A
Sbjct  57   PVLVHNGKPITESLVILEYIEETWKN-GPKLLPEDPYERAKVRFWASFIQQQFVDSMVSA  115

Query  502  FISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAV  323
              S+ G+    A  E F  + + E+  + F P   P    +++G LDI L +  G HKA 
Sbjct  116  AKSS-GEAHEKAMKEAFEKMTVFEEGMKDFFPSGTPHFEDENIGFLDIVLCSLFGPHKAQ  174

Query  322  EEVLGMKIIDEEKHPF  275
            EE LG+KIID E+HP 
Sbjct  175  EEALGLKIIDPERHPL  190



>ref|XP_009369406.1| PREDICTED: glutathione S-transferase U9-like [Pyrus x bretschneideri]
Length=230

 Score =   244 bits (622),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 162/220 (74%), Gaps = 1/220 (0%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V LHGMW +T++K+VELAL++KG+P+EY+EEDL NKS QLL+ NP+HKKVP+L+HNG+
Sbjct  5    NGVKLHGMWATTHSKRVELALRLKGVPYEYIEEDLSNKSQQLLEYNPVHKKVPVLVHNGK  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PIVES VI+EY+DETWNN  P+ILPED Y++AKVRFWA YI Q         ++++G+ +
Sbjct  65   PIVESYVILEYVDETWNN-APKILPEDPYERAKVRFWASYIQQQLFEGMSQVVTSQGEAQ  123

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              +  E F  L + E+  + +     P  + ++LGLLDI +VAT G +KA E+VLG K++
Sbjct  124  EKSLEEVFARLGVFEEGMKEYLRGGDPFTNGENLGLLDILMVATFGPYKAHEQVLGFKML  183

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            D +++P +FSWV ++ E PLV+E  PPH+K V  L+ IKQ
Sbjct  184  DPDRNPLLFSWVAAMKEHPLVKELDPPHDKLVRLLQFIKQ  223



>ref|XP_008356679.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase U9-like 
[Malus domestica]
Length=230

 Score =   243 bits (621),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 164/221 (74%), Gaps = 3/221 (1%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V LHGMW  TY+K+VELAL++KG+ +EY+EEDL NKS QLL+ NP+HKKVP+L+HNG+
Sbjct  5    NGVXLHGMWGXTYSKRVELALRLKGVTYEYIEEDLSNKSQQLLEYNPVHKKVPVLVHNGK  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQN  479
            PIVES VI+EYIDETWNN  P+ILPED Y++AKVRFWA YI  QL + M +  ++++G+ 
Sbjct  65   PIVESYVILEYIDETWNN-APKILPEDPYERAKVRFWASYIQQQLFEGMSRV-VTSQGEA  122

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A  E F +L + E+  + +     P  + ++LGLLDI +VAT G +KA E+VLG K+
Sbjct  123  QEKALEEVFASLGVFEEGMKEYLHGGDPFTNGENLGLLDILMVATFGPYKAHEQVLGFKM  182

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            +D +++P +FSWV +  E PLV+E  PPH+K V  L+ IKQ
Sbjct  183  LDPDRNPLLFSWVAATNEHPLVKELDPPHDKLVQLLQFIKQ  223



>ref|XP_002269118.1| PREDICTED: glutathione S-transferase U9 [Vitis vinifera]
Length=227

 Score =   243 bits (621),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/231 (52%), Positives = 165/231 (71%), Gaps = 7/231 (3%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE     ++V L+GMW S + K+VE+ALKIKGIP+EYVEEDLRNKS  LLQ NP+HKKV
Sbjct  1    MGEE----NKVTLYGMWASPFVKRVEIALKIKGIPYEYVEEDLRNKSQLLLQYNPVHKKV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKA  503
            P+L+HNG+PI ES+VI+EYI+ETW N  P++LPED Y++AKVRFWA +I  Q  D+M  A
Sbjct  57   PVLVHNGKPITESLVILEYIEETWKN-GPKLLPEDPYERAKVRFWASFIQQQFVDSMVSA  115

Query  502  FISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAV  323
              S+ G+    A  E F  + + E+  + F P   P    +++G LDI L +  G HKA 
Sbjct  116  AKSS-GEAHEKAMKEAFEKMTVFEEGMKDFFPSGTPHFEDENIGFLDIVLCSLFGPHKAQ  174

Query  322  EEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHG  170
            EE LG+KIID E+HP ++SWV +L E+P V+E+LPPH+K V+ ++ ++++ 
Sbjct  175  EEALGLKIIDPERHPLVYSWVTALNEVPAVKESLPPHDKMVALIQFLRRNA  225



>emb|CDP20460.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 167/233 (72%), Gaps = 8/233 (3%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE      +V++HG W S + K+VELALKIKGIPFEYVEE+LRNKSP LL+ NP+HKKV
Sbjct  1    MGEE----SKVVVHGTWASAFTKRVELALKIKGIPFEYVEENLRNKSPLLLKYNPVHKKV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+L+HNG+PI ES++I+EYIDETW +   ++LP++ YQ+AK RFWA YI QL D++ K F
Sbjct  57   PVLVHNGKPICESVIILEYIDETWPS-GTKLLPQEPYQRAKFRFWAAYIEQLLDSVAKLF  115

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPK--ISAQSLGLLDIALVATLGMHKA  326
             + +   +  A  E    L ILE   + F  +E+    + A+ LG+LDI +V  L   KA
Sbjct  116  NTEKAA-QGKALEEVHEKLRILEDGVKEFYFVEKSPDHVHAEKLGMLDIMMVGHLVAFKA  174

Query  325  VEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
             EEVLG+KIID EK+PFI SW+++L++LP+V+ETLPPH+  V  L+ +KQ G 
Sbjct  175  QEEVLGVKIIDPEKNPFIASWIQALIQLPMVKETLPPHDNMVGLLQFVKQTGI  227



>ref|XP_010663365.1| PREDICTED: glutathione S-transferase U9-like [Vitis vinifera]
Length=236

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 165/235 (70%), Gaps = 11/235 (5%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE     ++V L+GMW S + ++VE+ LKIKGIP+EYVEEDLRNKS  LLQ NP+HKKV
Sbjct  1    MGEE----NKVTLYGMWASPFVRRVEITLKIKGIPYEYVEEDLRNKSQLLLQYNPVHKKV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ-----LSDT  515
            P+L+HNG+PI ES+VI+EYI+ETW N  P+ILPED Y++AKVRFWA +I Q     L D+
Sbjct  57   PVLVHNGKPIAESLVILEYIEETWKN-GPKILPEDPYERAKVRFWASFIQQQARQSLFDS  115

Query  514  MKKAFISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGM  335
            +  A  S+ G+    A  E F  L + E+  + F P   P    +++G LDI L +  G 
Sbjct  116  LVSAAKSS-GEAHEKAMKEVFEKLTVFEEGMKDFFPSGTPHFEDENIGFLDIVLCSLFGH  174

Query  334  HKAVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHG  170
            HKA EE LG+KIID E+HP ++SWV +L E+P V+E+LPPH+K V+ ++ ++++ 
Sbjct  175  HKAQEEALGLKIIDPERHPLVYSWVTALNEVPAVKESLPPHDKMVALIQFLRRNA  229



>ref|XP_009771520.1| PREDICTED: glutathione S-transferase U10-like [Nicotiana sylvestris]
Length=228

 Score =   241 bits (614),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 161/231 (70%), Gaps = 8/231 (3%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE     ++V LHGMW+S Y  +V+LALK+KGIPFEYVEEDL NKS  LL+ NPIHKKV
Sbjct  1    MGE----ENKVTLHGMWISPYVNRVQLALKVKGIPFEYVEEDLSNKSTLLLKYNPIHKKV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+L+HNG+P+ ES VI+EYIDETW N + R+ PED Y++++VRFWA YI Q+++ M K  
Sbjct  57   PILVHNGKPVSESFVILEYIDETWKN-KSRLFPEDPYERSRVRFWASYIQQVTECMLKVL  115

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVE  320
               +G+ ++ A  EF   L +LE   +         I  +++GLLDI +V TLG +K  E
Sbjct  116  ---KGEGQDEALEEFLEKLNVLEDGIKNSSLGIDTNILGRNMGLLDIMIVVTLGGYKVQE  172

Query  319  EVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            ++ G+KI+D +K P + SWV SL+ELP+V+E  PPH+K VS L  +K  GF
Sbjct  173  QMFGVKILDPDKTPLLCSWVTSLIELPIVKEYAPPHDKVVSFLHFLKDVGF  223



>ref|XP_007037326.1| Glutathione S-transferase tau 9 [Theobroma cacao]
 gb|EOY21827.1| Glutathione S-transferase tau 9 [Theobroma cacao]
Length=230

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 167/232 (72%), Gaps = 7/232 (3%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE     ++VILHG+W S ++K+VELALK+ GIP EYVEEDL+NKSPQLL+ NP+HKK+
Sbjct  1    MGE----ENKVILHGVWASPFSKRVELALKLTGIPLEYVEEDLQNKSPQLLRCNPVHKKI  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKA  503
            P+ +HNG+PI ES+VI+EYIDETW N  PR+LP+D Y++AKVRFW  ++  QL DTM   
Sbjct  57   PVRVHNGKPIAESLVILEYIDETWKN-SPRLLPKDPYKRAKVRFWTSFVQQQLFDTM-FT  114

Query  502  FISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAV  323
                 G+ +  A  E    L++LE+  +   P   P I +Q++GLLDI +++ LG HK  
Sbjct  115  VTKTEGEAQRKAVKEVSEKLQVLEEGIKELFPNGNPCIDSQNIGLLDIVILSLLGPHKVQ  174

Query  322  EEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            EEVLG+KIID EK P IF+W+ ++ +L +V+E+ PPH+K V+ L+ ++++  
Sbjct  175  EEVLGIKIIDPEKTPLIFAWLTAINQLTVVKESTPPHDKLVALLKFLRENSL  226



>ref|XP_009771522.1| PREDICTED: glutathione S-transferase U9-like [Nicotiana sylvestris]
Length=226

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 163/231 (71%), Gaps = 10/231 (4%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE     ++VILHGMW S Y K+VELALK+KGIPFEY+EEDL NKS  LL+ NPIHKKV
Sbjct  1    MGE----ENKVILHGMWASPYVKRVELALKVKGIPFEYIEEDLSNKSILLLKYNPIHKKV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+L+HNG+P+ ES VI+EYIDETW N  PR+LPED Y++++VRFWA YI Q+++ M K F
Sbjct  57   PVLVHNGKPVSESFVIIEYIDETWKN-EPRLLPEDPYERSRVRFWASYIQQVTECMLKVF  115

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVE  320
               +G+ K  A  EF+  L +LE   +         I  +++GLLDI ++ TLG +K  E
Sbjct  116  ---KGEEK--ALEEFYEKLNVLEDGIKNSSLGINTNIEGRNMGLLDIMIIITLGAYKVQE  170

Query  319  EVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            +V G+KI+D +K P + S + SL+ELP+V+E  PPH+K VS L  +K+  F
Sbjct  171  QVFGVKILDPDKTPLLCSGLSSLIELPIVKEITPPHDKVVSFLHFLKEMVF  221



>ref|XP_010029766.1| PREDICTED: glutathione S-transferase U9-like [Eucalyptus grandis]
 gb|KCW83603.1| hypothetical protein EUGRSUZ_B00498 [Eucalyptus grandis]
Length=229

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 158/219 (72%), Gaps = 3/219 (1%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            RV+LHG+W+S Y+K+VELALK+KGI +E+VEEDL NKS  LL+ NP+HKKVP+L+HNG+P
Sbjct  4    RVVLHGVWVSPYSKRVELALKVKGIEYEFVEEDLTNKSEALLRYNPVHKKVPVLVHNGKP  63

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQNK  476
            I ES+VI+EYIDETW    PR+LP+D Y++AKVRFWA ++H QLS+ M  + I   G  +
Sbjct  64   IAESLVIIEYIDETWKE-GPRLLPQDPYERAKVRFWAGFLHQQLSEAM-ASVIKTDGGTQ  121

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  E    L +LE+      P   P I+   +GLLDI + + LG HKA EEVLG+K +
Sbjct  122  ERAVKEVHEKLRVLEEGINGSYPGGSPFINGDGMGLLDIVVCSILGAHKAQEEVLGIKFL  181

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIK  179
            D EK+P + SWV++L+ELPLV+E +PPHEK V   +  +
Sbjct  182  DPEKYPTVTSWVKALIELPLVKEAMPPHEKLVGVFKFFR  220



>ref|XP_009616913.1| PREDICTED: glutathione S-transferase U9-like [Nicotiana tomentosiformis]
Length=226

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 163/231 (71%), Gaps = 10/231 (4%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE ++    V LHGMW S Y K+VELALK+KGIPFEY+EEDL  KSP LL+ NPIH+KV
Sbjct  1    MGEENN----VTLHGMWASPYVKRVELALKVKGIPFEYIEEDLSKKSPLLLKYNPIHQKV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+L+HNG+P+ ES VI+EYIDETWNN  PR+ P+D Y++++VRFWA YI Q+++ M K F
Sbjct  57   PVLVHNGKPVSESFVILEYIDETWNN-EPRLFPKDPYERSRVRFWASYIQQVTECMLKVF  115

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVE  320
               +G+ K  A  EF+  L +LE   +         I  +++GLLDI ++ TLG +K  E
Sbjct  116  ---KGEEK--ALEEFYEKLSVLENGIKNSSLEITTNIEGRNMGLLDIMIIITLGAYKVQE  170

Query  319  EVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            +V G+KI+D EK P ++SW+ SL+ELP+V+E  PP++K +S L  +K   F
Sbjct  171  QVFGVKILDAEKTPLLYSWLTSLIELPIVKEITPPYDKVLSFLHFLKDIVF  221



>emb|CDP21575.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 164/225 (73%), Gaps = 4/225 (2%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++V+LHGMW S Y K+VELALKIKGIPFEYVEE+LRNKSPQLL+ NP+HKKVP+L+HNG+
Sbjct  6    NKVVLHGMWASPYVKRVELALKIKGIPFEYVEENLRNKSPQLLKYNPVHKKVPVLVHNGK  65

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES+VI+EY+DE W+   P++LP++ YQ+A  RFWA YI QL +++ K F +A  +  
Sbjct  66   PVCESLVILEYLDEVWST-GPQLLPKEPYQRANFRFWAAYIQQLLESIFKLF-NADKEAH  123

Query  475  NAAFSEFFVNLEILEKETRVF-CPMERPK-ISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
                 E    L  LE   + F  P   P  ISA++LG+LD+ LV+ LG  +A EE   +K
Sbjct  124  EKPLQEVHEKLRNLEDGVKEFYFPEGSPNHISAENLGILDVMLVSVLGPFRAKEEAFSVK  183

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            I+D  K+P +FSW+++L+ELPLV+E +PPH+K V  L+ +KQ GF
Sbjct  184  ILDPGKNPLLFSWIQALIELPLVKEVVPPHDKMVGVLQFLKQSGF  228



>ref|XP_002511574.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF52176.1| glutathione s-transferase, putative [Ricinus communis]
Length=231

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 160/229 (70%), Gaps = 7/229 (3%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE     ++V LHG W S + K+VELALK+KGI F YVEEDLRNKS  LL  NP+HKKV
Sbjct  1    MGE----ENKVTLHGTWGSPFTKRVELALKLKGITFNYVEEDLRNKSQLLLHYNPVHKKV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ-LSDTMKKA  503
            P+L+HNGRPI ES VI+EYIDETW +  P++LPED Y +AKVRFWA YI Q L DTM   
Sbjct  57   PVLVHNGRPIAESFVIIEYIDETWKS-GPKLLPEDPYGRAKVRFWANYIQQKLFDTM-FL  114

Query  502  FISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAV  323
             I+  G+ ++ A  E   NL++LE   + F     P I+++++GL+DI + +    HKA 
Sbjct  115  VITTNGEAQDKAGKEVMENLKVLENGMKDFLQDGIPTINSENVGLVDIIMCSLFSPHKAQ  174

Query  322  EEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            EEVLG+KIID +K P IFSW+ S+ ELP V+E  PPHEK V  L+ ++Q
Sbjct  175  EEVLGVKIIDPDKTPLIFSWITSINELPAVKEITPPHEKLVELLQFLRQ  223



>ref|XP_008239955.1| PREDICTED: glutathione S-transferase U10-like [Prunus mume]
Length=232

 Score =   239 bits (610),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 161/228 (71%), Gaps = 4/228 (2%)
 Frame = -3

Query  844  HHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLH  665
               ++V LHG+W+S Y+K+VELALK KGIPFE+VEEDL NKSP LL+ NP+HKKVP+L+H
Sbjct  2    EEENKVTLHGLWISPYSKRVELALKTKGIPFEFVEEDLMNKSPLLLKYNPVHKKVPVLVH  61

Query  664  NGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISAR  488
            NG+PIVES+VI+EYIDETW    PR+LPED Y++A+VRFWA ++  Q+ +++K AF S  
Sbjct  62   NGKPIVESLVILEYIDETWKT-GPRLLPEDPYKRARVRFWASFVDQQVFESLKLAFTS-D  119

Query  487  GQNKNAAFSEFFVNLEILEKETRVFCPMERPKIS-AQSLGLLDIALVATLGMHKAVEEVL  311
            G+ +  A  E    L+  E+  + F P     I   ++LGLLDI L +  G HK  EEV+
Sbjct  120  GEVQEKAIKELLEKLKTFEEGMKEFFPDGIASIERTKNLGLLDIVLYSGFGAHKVPEEVI  179

Query  310  GMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            G KIID EK P IFSW+ +L ELPLV+E  PPHEK V+ L+  + +  
Sbjct  180  GTKIIDLEKTPLIFSWLTALNELPLVKELTPPHEKLVAVLQFFRNNAL  227



>ref|XP_006476608.1| PREDICTED: glutathione S-transferase U10-like [Citrus sinensis]
Length=232

 Score =   238 bits (608),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 159/221 (72%), Gaps = 4/221 (2%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
             ++V LHG W+STY+K+VELAL++KGIP++Y+EEDL NKSP L Q NP+HKK+P+L+HNG
Sbjct  4    QNKVKLHGTWISTYSKRVELALRVKGIPYDYLEEDLSNKSPLLFQYNPVHKKIPVLVHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            +PI ES +I+EYIDETW N  PR LPED YQ+A++RFWA +I Q+ + M KAF+++ G+ 
Sbjct  64   KPIPESSIILEYIDETWKNA-PRFLPEDPYQRAQIRFWAGFIQQVFEAMGKAFMTS-GEA  121

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVL--GM  305
            +  A  E    + +LE+  +     E PKI  Q+ GLLDI + A L  HKA EEVL  G+
Sbjct  122  QEKAIEETHEKINVLEEGMKGLFSEEAPKIDGQNFGLLDIMVCAVLSTHKASEEVLGNGV  181

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELI  182
            KI+  E+HPF+ SWVE L + P+V+E  PP++K +  L  I
Sbjct  182  KILHPERHPFLSSWVEKLNKHPVVKENTPPYDKIIGFLHFI  222



>ref|XP_004236032.2| PREDICTED: glutathione S-transferase U10-like [Solanum lycopersicum]
Length=235

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/231 (53%), Positives = 162/231 (70%), Gaps = 12/231 (5%)
 Frame = -3

Query  868  SKKMGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIH  689
            S KMGE     ++V LHGMW+S Y K+VELALK+KGIPFEY+EEDL NKSP +L+ NPIH
Sbjct  9    SGKMGE----ENKVTLHGMWLSPYVKRVELALKVKGIPFEYIEEDLSNKSPLILKYNPIH  64

Query  688  KKVPMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMK  509
            KKVP+L+HNG+P+ ES VIVEYIDETW N  P++LPED Y+++KV FWA YI Q+ ++M 
Sbjct  65   KKVPILVHNGKPVNESFVIVEYIDETWKN-GPQLLPEDPYERSKVHFWAAYIQQVMESML  123

Query  508  KAFISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHK  329
              F +   +++  A +EF     +LE   + F P     I  +++GL+DI +V   GM K
Sbjct  124  NIFTA---EDQKQACNEFHQKFRLLEDGMKNFFPT----IENRNIGLIDIWIVVAFGMCK  176

Query  328  AVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            A EE  G+  +D EK P I S V SLLELPL+RET+P H+KAVS L  +K+
Sbjct  177  AQEEAFGVNFLDPEKVPLIHSRVNSLLELPLLRETVPDHDKAVSFLRALKE  227



>ref|XP_007208953.1| hypothetical protein PRUPE_ppb016836mg [Prunus persica]
 gb|EMJ10152.1| hypothetical protein PRUPE_ppb016836mg [Prunus persica]
Length=232

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 159/224 (71%), Gaps = 4/224 (2%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            ++ LHG+W+S Y+K+VELALK KGIPFE+VEEDL NKSP LL+ NP+HKKVP+L+HNG+P
Sbjct  6    KLTLHGLWISPYSKRVELALKTKGIPFEFVEEDLMNKSPLLLKYNPVHKKVPVLVHNGKP  65

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQNK  476
            IVES++I+EYIDETW    PR+LPED Y++A+VRFWA ++  Q+ +++K AF S  G+ +
Sbjct  66   IVESLIILEYIDETWKT-GPRLLPEDPYKRARVRFWASFVDQQVFESLKLAFTS-DGEVQ  123

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKIS-AQSLGLLDIALVATLGMHKAVEEVLGMKI  299
              A  E    L+  E   + F P     I   ++LGLLDI L +  G HK  EEVLG KI
Sbjct  124  EKAIKELLEKLKTFEVGMKEFFPDGIASIERTKNLGLLDIVLYSGFGAHKVQEEVLGTKI  183

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            ID EK P IFSW+ +L ELPLV+E  PPHEK V+ L+  + +  
Sbjct  184  IDPEKTPLIFSWLTALNELPLVKELTPPHEKLVAVLQFFRNNAL  227



>emb|CDP21994.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 165/235 (70%), Gaps = 10/235 (4%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE      +V+LHGMW S + K+VELA+KIKGIPFEYVEE+L NKSP +L+ NP+HKKV
Sbjct  1    MGEE----SKVVLHGMWSSPFVKRVELAMKIKGIPFEYVEEELSNKSPLILKYNPVHKKV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+L+HNG+P+ ES++I+EYIDETW +  P++LP+D YQ+AKVRFWA YI QL  +M + F
Sbjct  57   PILVHNGKPVCESLLILEYIDETWPS-GPQLLPKDPYQRAKVRFWAAYIQQLLTSMARLF  115

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVF----CPMERPKISAQSLGLLDIALVATLGMH  332
               + + +  A  E    L  LE   + F      +    + A+ LG+LDI + ATLG  
Sbjct  116  NDGK-EAQGKALEEVHEKLRNLEDGVKEFYFPEGSISPDHVLAEKLGILDIMMSATLGPF  174

Query  331  KAVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            KA EE   +KI+D EK+P IFSWV++L++LP+V++T PPH+K +  L+ +KQ GF
Sbjct  175  KAHEEAFNVKILDPEKNPLIFSWVQALIQLPVVKQTAPPHDKYLGLLQFLKQSGF  229



>ref|XP_010678536.1| PREDICTED: glutathione S-transferase U10-like [Beta vulgaris 
subsp. vulgaris]
Length=227

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 158/219 (72%), Gaps = 2/219 (1%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++V +HGMW STY+K+VELALK+KGI +EYVEEDL NKS  LL+ N  HKKVP+L+HNG+
Sbjct  6    NQVNVHGMWASTYSKRVELALKLKGIHYEYVEEDLGNKSEALLKYNSAHKKVPVLVHNGK  65

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            P+ ES+VI+EYIDE W N  PR+LPE+ YQ+A VRFWA ++H QL+ ++ K F    G+ 
Sbjct  66   PLAESLVILEYIDEAWPNHFPRLLPEEPYQRAMVRFWASFLHNQLAQSLLKLF-QCNGEA  124

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            ++ A  E    + ++E     F P +   I   SLGLLDI L++  G +KA EEV+G KI
Sbjct  125  QDKALDELHEKMTLMEHRMTDFIPKDVSCIDKASLGLLDIQLISLFGAYKAREEVIGKKI  184

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELI  182
            +D EKHP IFSWV SL+ LP+V+E++P H+K V+ +++ 
Sbjct  185  LDPEKHPLIFSWVTSLMNLPVVQESIPDHKKLVALIQMF  223



>ref|XP_010678533.1| PREDICTED: glutathione S-transferase U9-like [Beta vulgaris subsp. 
vulgaris]
Length=224

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 155/218 (71%), Gaps = 2/218 (1%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
            +++ V LHGMW S Y+K+VE ALK+KGIP+EYVEEDL NKS  L++ NPIHKKVP+ +HN
Sbjct  4    NNNNVRLHGMWASVYSKRVEYALKLKGIPYEYVEEDLMNKSQALVEHNPIHKKVPVFVHN  63

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARG  485
            G+ + ES+VI+EYIDE W    PR+LPED Y++A VRFWA ++ +QL  + KK F  + G
Sbjct  64   GKSLAESLVILEYIDEAWPTHTPRLLPEDPYERAMVRFWANFLTYQLPPSAKKVFFCS-G  122

Query  484  QNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
            + ++ A  E    + ++E E     P +   I+A+ LG+LDI LV     H+A EEVLG 
Sbjct  123  EAQDEALQELHEKMTLMEDEMIDLIPKDESSITAEGLGILDIQLVTLFAAHEAQEEVLGK  182

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
            KI+D+EKHP I+SWV +L  LP++++++PPH+  V+ L
Sbjct  183  KIVDQEKHPLIYSWVNALKNLPVIKDSIPPHDTLVAAL  220



>ref|XP_008239953.1| PREDICTED: glutathione S-transferase U9-like [Prunus mume]
Length=230

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 156/219 (71%), Gaps = 1/219 (0%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++V LHGMW STY+ +VE+AL++KGIP+EY+EEDL NKS  LL+ NP+HKKVP+L+HNG+
Sbjct  5    NKVKLHGMWASTYSLRVEIALRLKGIPYEYIEEDLSNKSQLLLKYNPVHKKVPVLVHNGK  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
             I ES +I+EYIDETWN+  PRILPED Y++AKVRFWA YI Q         +++RG+ +
Sbjct  65   SIAESYIILEYIDETWNS-DPRILPEDPYERAKVRFWASYIQQQLFEGLSRVVTSRGEAQ  123

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  E F  L++ E   + +        + +SLGL+DI +V T G +KA EEVLG K++
Sbjct  124  EKALEEVFERLKVFEGGMKEYLQEGASFTNGESLGLVDILMVVTFGPYKAHEEVLGFKML  183

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIK  179
            D E++P +FSWV ++ E P+V+E  PPH+K V  L+ IK
Sbjct  184  DPERNPLLFSWVAAMKEHPVVKEVDPPHDKLVELLQFIK  222



>ref|XP_010029753.1| PREDICTED: glutathione S-transferase U10-like [Eucalyptus grandis]
 gb|KCW83602.1| hypothetical protein EUGRSUZ_B00497 [Eucalyptus grandis]
Length=235

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 156/218 (72%), Gaps = 1/218 (0%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            RV+LHGMW+S Y+K+VELALK+KGI +E+VEEDL NKS  LL+ +P+HKKVP+L+HNG+P
Sbjct  10   RVVLHGMWVSPYSKRVELALKVKGIEYEFVEEDLTNKSEALLRYSPVHKKVPVLVHNGKP  69

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            I ES+VI+EYIDETW    PR+LP+D Y++AKVRFWA ++HQ       + +   G+ + 
Sbjct  70   IAESLVIIEYIDETWKE-GPRLLPQDPYERAKVRFWAGFLHQQLFEAMGSVLRTDGEAQE  128

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             A  E    L++LE+  +   P   P  +  ++GLLD+ + + LG HK  EEVLG+K +D
Sbjct  129  RAVKEMHEKLKVLEEGIKGSYPGGSPFFNGDNMGLLDVVVCSILGNHKVREEVLGVKFLD  188

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIK  179
             +K+P + SWV++L ELPLV+E +PPHEK V+   L +
Sbjct  189  PDKYPTVTSWVKALTELPLVKEAMPPHEKLVAIYRLFR  226



>ref|XP_009785599.1| PREDICTED: glutathione S-transferase U9 [Nicotiana sylvestris]
Length=223

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/228 (53%), Positives = 159/228 (70%), Gaps = 13/228 (6%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE     ++V LHGMW+S Y K+VELALK+KGIPFEYVEEDL NKSP LL+ NP+HKKV
Sbjct  1    MGE----ENKVTLHGMWLSPYVKRVELALKVKGIPFEYVEEDLSNKSPLLLKYNPVHKKV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+L+HN +PI ES+VI+EYIDETW N   R+LPED Y++++VRFWA YI  + + M   F
Sbjct  57   PVLVHNEKPINESLVILEYIDETWKNGH-RLLPEDPYERSQVRFWAVYIQHVMECMLNIF  115

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVE  320
             +A  Q K  A  EF+  L +LE   +   P     + ++++GLLDI +V   G  KA E
Sbjct  116  -TAEDQEK--ACEEFYQKLGVLEDGMKNMFP-----VKSRNIGLLDILIVVAFGACKAQE  167

Query  319  EVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            EV G+K +D +  P I SW+ SLLELP+V+E++PPH+K VS L   K+
Sbjct  168  EVFGLKFLDPKNTPLITSWLNSLLELPVVKESVPPHDKVVSFLRFFKE  215



>ref|XP_008239952.1| PREDICTED: glutathione S-transferase U9 [Prunus mume]
Length=232

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 154/228 (68%), Gaps = 10/228 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++VILHG W+S Y K+VELALK KGIPFE V+EDL NKSP LL+ NP+HKKVP+L+HNG+
Sbjct  5    NKVILHGSWLSLYTKRVELALKTKGIPFESVDEDLNNKSPLLLKYNPVHKKVPVLVHNGK  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PIVES++I+EYIDE W    P +LPED Y++A+VRFWA ++HQ          ++ G+ +
Sbjct  65   PIVESLIILEYIDEIWKT-GPGLLPEDPYERARVRFWASFVHQQVFESLSLACTSDGEVQ  123

Query  475  NAAFSEFFVNLEILEKETRVF-----CPMERPKISAQSLGLLDIALVATLGMHKAVEEVL  311
              A  E    L+  E+  + F       +ER K    +LGLLDI L +  G HK  EEVL
Sbjct  124  EKAIKELLEKLKTFEEGMKEFFSDGIASIERSK----TLGLLDIVLCSVFGPHKVQEEVL  179

Query  310  GMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            G+KI+D EK P IFSWV +L ELPLV+E  PPHEK ++ L+  + +  
Sbjct  180  GIKIVDPEKTPLIFSWVTALTELPLVKELTPPHEKLLALLQFFRNNAL  227



>ref|XP_007208914.1| hypothetical protein PRUPE_ppa027220mg [Prunus persica]
 gb|EMJ10113.1| hypothetical protein PRUPE_ppa027220mg [Prunus persica]
Length=230

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 154/219 (70%), Gaps = 1/219 (0%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++V LHGMW STY+ +VE+AL++KGIP+EY+EEDL NKS  LL+ NP+HKKVP+L+HNG+
Sbjct  5    NKVKLHGMWASTYSLRVEIALRLKGIPYEYIEEDLSNKSQLLLKYNPVHKKVPVLVHNGK  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
             I ES +I+EYIDETWN+  PRILPED Y +AKVRFWA YI Q         +++RG+ +
Sbjct  65   SIAESYIILEYIDETWNS-DPRILPEDPYGRAKVRFWASYIQQQLFEGLSRVVTSRGEAQ  123

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  E F  L++ E   + +        + +SLGLLDI +V T G +KA EEVLG K++
Sbjct  124  EKALEEVFERLKVFEGGMKEYLQGGASFTNGESLGLLDILMVVTFGPYKAHEEVLGFKML  183

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIK  179
            D E++P +FSWV ++ E P+V+E  PPH K V  L+ I+
Sbjct  184  DPERNPLLFSWVAAMKEHPVVKEVDPPHGKLVELLQFIR  222



>ref|XP_007208887.1| hypothetical protein PRUPE_ppa026659mg [Prunus persica]
 gb|EMJ10086.1| hypothetical protein PRUPE_ppa026659mg [Prunus persica]
Length=234

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 159/220 (72%), Gaps = 1/220 (0%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + VI+HG W S Y+K+VELALK+KGIP+EYVEEDL+NK+P+LL+ NP++KKVP+L+HNG+
Sbjct  7    ESVIVHGFWASPYSKRVELALKLKGIPYEYVEEDLKNKTPELLKYNPVYKKVPVLVHNGK  66

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+VI++YI++TW N  P +LPED Y++A+VRFW  ++HQ    +        G+ +
Sbjct  67   PIAESLVILQYIEDTWKN-GPHLLPEDPYKRAQVRFWVDFVHQKFSGIMMTAAKTEGETQ  125

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A +E +  L++LE+  + F P   P   A++L LL++   + L + KA EE+LG+K+I
Sbjct  126  EKALNEVYELLKVLEEGIKSFYPDGIPTFEAENLSLLEVVASSILCLFKAPEEILGIKVI  185

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            D E  P +FSWVE+L EL LV+ET+P HEK V+ L  ++Q
Sbjct  186  DPEITPLLFSWVEALRELSLVQETIPSHEKIVALLGTLRQ  225



>ref|XP_010029777.1| PREDICTED: glutathione S-transferase U9-like [Eucalyptus grandis]
 gb|KCW83604.1| hypothetical protein EUGRSUZ_B00499 [Eucalyptus grandis]
Length=229

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 153/218 (70%), Gaps = 1/218 (0%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +V+LHGMW S Y+++VELALK+KGI +E+VEEDL +KS  LL+ NP+HKKVP+L+HNG+P
Sbjct  4    KVVLHGMWASPYSRRVELALKVKGIEYEFVEEDLTSKSEALLRYNPVHKKVPVLVHNGKP  63

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            I ES+VI+EYIDETW    PR+LP+D +++AKVRFWA ++ Q         I   G+ + 
Sbjct  64   IAESLVIIEYIDETWTE-GPRLLPQDPFERAKVRFWAGFLQQQLFEAMFPVIKTDGEAQE  122

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             A  E    L++LE+  +   P   P ++  S+GLLDI + + LG HK  EEVLG+K +D
Sbjct  123  RAVKEVHEKLKVLEEGIKGSYPEGSPFVNGDSVGLLDIVVCSILGSHKVQEEVLGIKFLD  182

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIK  179
             EK+P + SWV +L ELPLV+E  PPHEK V  L+ ++
Sbjct  183  PEKYPRVTSWVTALTELPLVKEAAPPHEKMVGLLQFLR  220



>ref|XP_004299367.1| PREDICTED: glutathione S-transferase U9-like [Fragaria vesca 
subsp. vesca]
Length=232

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 149/222 (67%), Gaps = 2/222 (1%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V LHG W S ++K VELALK KGIPFE+VEEDLRNKSP LL+ NP+HKKVP+L+HNG+PI
Sbjct  7    VSLHGTWASPFSKCVELALKTKGIPFEFVEEDLRNKSPSLLKYNPVHKKVPVLVHNGKPI  66

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
             ES+VI+EYIDETW    P++L ED Y++A+VRFWA Y+ Q           + G+ +  
Sbjct  67   AESLVILEYIDETWKT-GPKLLLEDPYKRAQVRFWAGYLQQHLFVTMSLVCKSDGEVQEK  125

Query  469  AFSEFFVNLEILEKETRVFCPMERPKI-SAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
            A  E F  L+  E+  +   P   P I  + +LGLLDI L +  G HK  EEVLG+  ID
Sbjct  126  AIKELFEKLKTFEEGIKDLFPDGAPSIDCSNNLGLLDIVLCSQFGPHKVQEEVLGITTID  185

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
             EK+P +F+W++SL ELPLV+E  PPHEK V+ L   + +  
Sbjct  186  PEKNPLLFTWLKSLNELPLVKELTPPHEKLVAVLHFFRNYAL  227



>ref|XP_010029742.1| PREDICTED: glutathione S-transferase U10-like [Eucalyptus grandis]
 gb|KCW83601.1| hypothetical protein EUGRSUZ_B00496 [Eucalyptus grandis]
Length=232

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 148/219 (68%), Gaps = 1/219 (0%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            +RV+LHG W S Y K+VELALK+KGI +E+VEEDL +KS  LL+  P+HKKVP+L+HNG+
Sbjct  6    NRVVLHGTWASLYGKRVELALKVKGIEYEFVEEDLTDKSEALLRYYPVHKKVPVLVHNGK  65

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+VI+EYIDETW    PR+LP+D Y++AKVRFWA ++HQ       + I   G  +
Sbjct  66   PIAESLVIIEYIDETWKE-GPRLLPQDPYERAKVRFWAGFLHQQLFEAMASVIKTDGGAQ  124

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  E    L +LE+      P   P  +   +GLLDI + + LG HK  EEVLG+  +
Sbjct  125  ERAVKEVHEKLRVLEEGINGSYPRGSPFTNGDGMGLLDIVVCSILGAHKVQEEVLGVNFL  184

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIK  179
            D EK+P + SWV++L+ELPLV+E +PPHEK V   +  +
Sbjct  185  DPEKYPTVTSWVKALIELPLVKEEMPPHEKLVGVFQFFR  223



>ref|XP_008239956.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase U9-like 
[Prunus mume]
Length=234

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 157/220 (71%), Gaps = 1/220 (0%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + VI+HG W S Y+K+VELALK+KGIP+EYVEEDL+NK+P+LL+ NP+ KKVP+L+HNG+
Sbjct  7    ESVIVHGFWASPYSKRVELALKLKGIPYEYVEEDLKNKTPELLKYNPVSKKVPVLVHNGK  66

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+VI+EYI++TW N  P +LPED Y++A+VRF   ++HQ    +    +   G+ +
Sbjct  67   PIAESLVILEYIEDTWKN-GPHLLPEDPYKRAQVRFXVDFVHQKFSGIMMTAVKTEGETQ  125

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A +E +  L++LE+  + F P   P   A++L LL++   + L   KA EE+LG+K+I
Sbjct  126  EKALNEVYELLKVLEEGIKSFYPDGIPTFEAENLSLLEVVASSILCPFKAPEEILGIKVI  185

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            D E  P +FSWVE+L EL LV+ET+P HEK V+ L  ++Q
Sbjct  186  DPEITPLLFSWVEALSELSLVQETIPSHEKIVALLGTLRQ  225



>emb|CDP20459.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 159/228 (70%), Gaps = 6/228 (3%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE     ++VI+ G W S + K+VELALK KGI FEYVEEDL NKS  LL+ NP+HKKV
Sbjct  1    MGE----ENKVIVLGNWSSPFVKRVELALKTKGIRFEYVEEDLSNKSALLLKYNPVHKKV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+L+HNG+P+ ES+VI+EYIDETW N  P +LP+D Y++A+VRFW  YIHQL D+M K +
Sbjct  57   PVLVHNGKPVCESLVILEYIDETWQN-GPHLLPKDPYERARVRFWVAYIHQLLDSMAKLY  115

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVE  320
               + + +  A  E    L +LE   +   P   P + A+ L +LDI ++AT+G  K  E
Sbjct  116  TPDK-EAQEKALKEVHEKLRVLEDGMKENFPGGSPDVRAKKLEILDIMMIATVGSFKTHE  174

Query  319  EVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            E LG++I+  E++P  FSWV++L ELP+V+E+ PP+EK ++ L+ +K+
Sbjct  175  EALGVQILHPERNPLTFSWVQALNELPVVKESNPPYEKLIALLQSLKE  222



>ref|XP_004299368.1| PREDICTED: glutathione S-transferase U9-like [Fragaria vesca 
subsp. vesca]
Length=245

 Score =   221 bits (563),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 154/216 (71%), Gaps = 3/216 (1%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D VI+HGMW S ++K+VELALK+KGIP+EYVEED + K+P+LL+ NP+HKK+P+L+HNG+
Sbjct  17   DSVIVHGMWASPFSKRVELALKVKGIPYEYVEEDFKKKTPELLKYNPVHKKIPVLVHNGK  76

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            PI ES+VI+EYI+E + +  P++LP D Y+K++VRFW  ++H + SD M    I  +G+ 
Sbjct  77   PIAESLVILEYIEEAFKDC-PQLLPSDPYEKSQVRFWVDFVHTKFSDIM-MTVIKTKGEE  134

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A  + +  L++L++  ++F P   P   A+ LGLLDI   + L   +A EEVLG+KI
Sbjct  135  QEKALCQVYELLKVLDEGIKIFFPDGNPSFEAKHLGLLDIVASSVLCPFRASEEVLGIKI  194

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
            ID EK P + +W+ +L ELP V ETLP H K VS L
Sbjct  195  IDPEKTPLLNAWITALSELPQVLETLPAHGKLVSIL  230



>ref|XP_010031646.1| PREDICTED: glutathione S-transferase U9-like [Eucalyptus grandis]
Length=229

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 148/218 (68%), Gaps = 1/218 (0%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +V+LHGMW S Y+ +VELALK+KGI +E+VEEDL NKS  LL+ NP+HKKVP+L+H+G+P
Sbjct  4    KVVLHGMWASPYSNRVELALKVKGIEYEFVEEDLTNKSEALLRYNPVHKKVPVLVHDGKP  63

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            I ES+VI+EYIDETW +  PR+LP+D Y++AKVRFWA +  Q         +   G+ + 
Sbjct  64   IAESLVIIEYIDETWTD-GPRLLPQDPYERAKVRFWAGFCQQQLFEAIITVVKTDGEAQE  122

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             A  E    L++LE+      P     ++  S+GLLDI + + LG HK  EEVLG+K +D
Sbjct  123  RAGKEVHEKLKVLEEGIEGNYPEGSLFVNGDSVGLLDIVVHSILGAHKVHEEVLGVKFLD  182

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIK  179
             EK+P + SWV +L E PLV+E  PPHEK V  L+  +
Sbjct  183  PEKYPRVTSWVTALTEFPLVKEAAPPHEKMVGFLQFFR  220



>gb|KGN63992.1| hypothetical protein Csa_1G033120 [Cucumis sativus]
Length=234

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 151/222 (68%), Gaps = 1/222 (0%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
             +RV+L+GMW S YAK+V+LALKIKGIPF+YVEEDL+NKSP LL+ NP++KKVP+L+HNG
Sbjct  4    QNRVVLYGMWASPYAKRVQLALKIKGIPFQYVEEDLQNKSPDLLKFNPVYKKVPVLVHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            RPI ES +I+EYI+E WNN  P +LP+D Y++A+VRFWA Y+ +         I   G+ 
Sbjct  64   RPICESALILEYIEEVWNNNGPSLLPQDPYKRAQVRFWADYVQKQVFEGLFLLIKTEGEA  123

Query  478  KNAAFSEFFVNLEILEKET-RVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
            +  A  +    L++LE++  +         ++   LG LDI ++  LGM+K  EE  G+K
Sbjct  124  QEKAVEDVKEKLKVLEEQGLKNLLAEGSTFVNGDELGYLDIVMLTLLGMYKVHEEFFGVK  183

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            I++EEK P +FSW+  L+E P  +E+ PP EK +  L  ++Q
Sbjct  184  IVEEEKIPVVFSWLNRLIEHPFAKESAPPKEKVLGFLHFLRQ  225



>ref|XP_009616912.1| PREDICTED: glutathione S-transferase U9-like [Nicotiana tomentosiformis]
Length=223

 Score =   218 bits (554),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 148/223 (66%), Gaps = 9/223 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++VILHG W S + K+VELALKIKGIP+EYVEEDL NKSPQLL+ NP+ KKVP+L+HNG+
Sbjct  5    NKVILHGTWGSLFVKRVELALKIKGIPYEYVEEDLSNKSPQLLKYNPVLKKVPVLVHNGK  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES+VI+EYIDETW    PRILPED Y++A VRFWA YI Q           + G+ +
Sbjct  65   PVSESLVILEYIDETWKT-GPRILPEDPYERAIVRFWANYIDQHLIASTAKLWKSSGEEQ  123

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  E    + I+E+          P+I    LG+L I LV T G HKA EEVLG+KI+
Sbjct  124  EKAQEEVLEKIRIVEEGN--------PEIHGNELGILQILLVTTFGSHKAYEEVLGVKIL  175

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
              E  P ++S V SL EL LV++   PH+  VS+L++ +Q+  
Sbjct  176  VPENTPLLYSCVTSLNELTLVKQICSPHDMLVSKLKIYRQNAL  218



>ref|XP_004169466.1| PREDICTED: glutathione S-transferase U9-like [Cucumis sativus]
Length=234

 Score =   218 bits (555),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 151/222 (68%), Gaps = 1/222 (0%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
             +RV+L+GMW S YAK+V+LALKIKGIPF+YVEEDL+NKSP LL+ NP++KKVP+L+HNG
Sbjct  4    QNRVVLYGMWASPYAKRVQLALKIKGIPFQYVEEDLQNKSPDLLKFNPVYKKVPVLVHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            RPI ES +I+EYI+E WNN  P +LP+D Y++A+VRFWA Y+ +         +   G+ 
Sbjct  64   RPICESALILEYIEEVWNNNGPSLLPQDPYKRAQVRFWADYVQKQVFEGFFLLMKTEGEA  123

Query  478  KNAAFSEFFVNLEILEKET-RVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
            +  A  +    L++LE++  +         ++   LG LDI ++  LGM+K  EE  G+K
Sbjct  124  QEKAVEDVKEKLKVLEEQGLKNLLAEGSTFVNGDELGYLDIVMLTLLGMYKVHEEFFGVK  183

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            I++EEK P +FSW+  L+E P  +E+ PP EK +  L  ++Q
Sbjct  184  IVEEEKIPVVFSWLNRLIEHPFAKESAPPKEKVLGFLHFLRQ  225



>ref|XP_010533411.1| PREDICTED: glutathione S-transferase U10 [Tarenaya hassleriana]
Length=235

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 149/222 (67%), Gaps = 3/222 (1%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            DRVILHGMW STY++ VE+ALK+KGIP+EY+EEDL+ KS  LLQ NP+HKKVP+L+HNG+
Sbjct  5    DRVILHGMWASTYSRWVEIALKLKGIPYEYIEEDLQTKSQSLLQLNPVHKKVPVLVHNGK  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+VI+EYIDETW N  PR+LP+D Y +A+VRFW  YI Q         +S  G+ +
Sbjct  65   PIAESLVILEYIDETWKN-SPRLLPDDPYGRAQVRFWVSYITQQLFESTGKVMSREGEAQ  123

Query  475  NAAFSEFFVNLEILEKETRVFCPMER--PKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
              A  E    + +LE+  +    M++   ++      L+DI LV+TLG+H+A  E LG++
Sbjct  124  AEAVKETRGRIRVLEEGLKTHFSMDQDSSEVGGNDSALVDIILVSTLGVHEAYSEALGVE  183

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            IID  + P  FS VE + ELP  +E  PPH+  V R+   +Q
Sbjct  184  IIDPVETPVTFSRVERVRELPEFKEVAPPHDMFVKRMRNYRQ  225



>gb|KGN63994.1| hypothetical protein Csa_1G033140 [Cucumis sativus]
Length=234

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 150/223 (67%), Gaps = 1/223 (0%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              +RV+L+GMW S YAK+V+LALKIKGIPF+YVEEDL+NKSP LL+ NP++KKVP+L+HN
Sbjct  3    EQNRVVLYGMWASPYAKRVQLALKIKGIPFQYVEEDLQNKSPDLLKFNPVYKKVPVLVHN  62

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            GRPI ES +I+EYI+E WNN  P +LP+D Y+++++RFWA Y+ +         I   G+
Sbjct  63   GRPICESALILEYIEEVWNNNGPSLLPQDPYKRSQIRFWADYLQKQVFEGLFLLIKTEGE  122

Query  481  NKNAAFSEFFVNLEILEKET-RVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
             +  A  +    L++LE++  +         ++   LG LDI ++  LG +K  EE  GM
Sbjct  123  AQEKAIEDVKEKLKVLEEQGLKNLLAEGSTFVNGDELGYLDIGMLTILGRYKIYEEFFGM  182

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            KI++EE+ P +FSW+  L+E P+ +E  PP EK +  L  I+Q
Sbjct  183  KIMEEEEIPIVFSWLNRLIEHPIAKEVTPPKEKVLGFLHFIRQ  225



>ref|XP_004299373.1| PREDICTED: glutathione S-transferase U10-like isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004299374.1| PREDICTED: glutathione S-transferase U10-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=233

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 160/236 (68%), Gaps = 9/236 (4%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              ++VIL+G W S Y K+VEL LK+KGIP+EYVEEDLRNKSP LL+ NPIHKKVP+L+HN
Sbjct  3    EQNKVILYGTWTSPYVKRVELVLKVKGIPYEYVEEDLRNKSPMLLKLNPIHKKVPVLVHN  62

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            G+ I ES+VI+EYIDETW    PR+LP+D Y+++++RFWA Y+ Q+S+ M    +   G+
Sbjct  63   GKAITESLVIIEYIDETWKT-GPRLLPQDPYKRSQIRFWASYVQQVSEPM-VMVLKTIGE  120

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKIS--AQSLGLLDIALVATL-GMHKAVEEVL  311
             +  A  E    +++LE   +   P   P +   ++++ LLD+ ++A L G ++  EEV 
Sbjct  121  AQEKAIKEVSEKVKVLEAGLKGLFPDGIPSVDEYSKNVTLLDLVILADLGGGYEVQEEVF  180

Query  310  GMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGFI**WNSAT  143
            G+KIID EK P I S + +L+ELP V+E+  P EK V+ L+  +++      NSA+
Sbjct  181  GVKIIDSEKTPLIVSCITALIELPAVKESQMPREKVVAFLKFFRENAL----NSAS  232



>gb|ADB11380.1| putative tau class glutathione transferase GSTU57 [Populus trichocarpa]
Length=230

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 145/226 (64%), Gaps = 1/226 (0%)
 Frame = -3

Query  844  HHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLH  665
                +V L+GMW STY K+VE+AL+ KGI  EY+EEDL NKS  LLQ +P+H +VP+L+H
Sbjct  2    EEEQKVKLYGMWASTYVKRVEVALRAKGIACEYIEEDLSNKSQALLQYDPVHNEVPVLVH  61

Query  664  NGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARG  485
            NG+PI ES +I+EYIDETW    PR+LP+D YQ+AKVRFWA +I Q         I+  G
Sbjct  62   NGKPITESSIILEYIDETWKQ-APRLLPDDPYQRAKVRFWASFIQQQLFEGVSQVITRGG  120

Query  484  QNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
            + +  A  E    + I E+E +   P     I  Q+LGLLDI + A    +KA EEV G+
Sbjct  121  EAQEKAIGELLEKMNIFEEEMKKLLPNGVSVIEVQNLGLLDILVGAVFSPYKAQEEVAGV  180

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            +I+D EK+P I SWV +  +L  V+E LPPH+K V  L+ +++   
Sbjct  181  QILDPEKNPLILSWVTAWNQLTTVQELLPPHDKIVGLLQFVRKTAL  226



>ref|XP_006384749.1| glutathione S-transferase GST 12 family protein [Populus trichocarpa]
 gb|ERP62546.1| glutathione S-transferase GST 12 family protein [Populus trichocarpa]
Length=230

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 145/219 (66%), Gaps = 1/219 (0%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +V L+GMW STY K+VE+AL+ KGI  EY+EEDL NKS  LLQ +P+H +VP+L+HNG+P
Sbjct  6    KVKLYGMWASTYVKRVEVALRAKGIACEYIEEDLSNKSQALLQYDPVHNEVPVLVHNGKP  65

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            I ES +I+EYIDETW    PR+LP+D YQ+AKVRFWA +I Q         I+  G+ + 
Sbjct  66   ITESSIILEYIDETWKQ-APRLLPDDPYQRAKVRFWASFIQQQLFEGVSQVITRGGEAQE  124

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             A  E    + I E+E +   P     I  Q+LGLLDI + A    +KA EEV G++I+D
Sbjct  125  KAIGELLEKMNIFEEEMKKLLPNGVSVIEVQNLGLLDILVGAVFSPYKAQEEVAGVQILD  184

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
             EK+P I SWV +  +L  V+E LPPH+K V  L+ +++
Sbjct  185  PEKNPLILSWVTAWNQLTTVQELLPPHDKIVGLLQFVRK  223



>ref|XP_004137407.1| PREDICTED: glutathione S-transferase U9-like [Cucumis sativus]
Length=234

 Score =   214 bits (544),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 148/222 (67%), Gaps = 1/222 (0%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
             +RV+L+GMW S YAK+V+LALKIKGIPF+YVEEDL NKSP LL+ NP++KKVP+L+HNG
Sbjct  4    QNRVVLYGMWASPYAKRVQLALKIKGIPFQYVEEDLPNKSPDLLKFNPVYKKVPVLVHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            R I ES +I+EYI+E WNN  P +LP+D Y++A+VRFWA Y+ +         +   G+ 
Sbjct  64   RSICESALILEYIEEVWNNNGPSLLPQDPYKRAQVRFWADYVQKQVFEGFFLLMKTEGEA  123

Query  478  KNAAFSEFFVNLEILEKET-RVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
            +  A  +    L++LE++  +         ++   LG LDI +   LGM+K  EE  G+K
Sbjct  124  QEKAVEDVKEKLKVLEEQGLKNLLAEGSTFVNGDELGYLDIVMFTVLGMYKVHEEFFGVK  183

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            I++EEK P +FSW+  L+E P  +E+ PP EK +  L  ++Q
Sbjct  184  IVEEEKIPVVFSWLNRLIEHPFAKESAPPKEKVLGFLHFLRQ  225



>gb|KFK41899.1| hypothetical protein AALP_AA2G186700 [Arabis alpina]
Length=232

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 150/219 (68%), Gaps = 2/219 (1%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +VILHGMW S+YAK+VE+ALK+KGIP+EYVEEDL+NK+  L Q NP+HKK+P+L+H+G+P
Sbjct  7    KVILHGMWASSYAKRVEIALKLKGIPYEYVEEDLQNKTESLTQLNPVHKKIPVLVHDGKP  66

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            + ES+VI+EYIDETW N  PR+LPED Y++A+VRFWA YI+Q    +    +S  G+   
Sbjct  67   VAESLVILEYIDETWQN-SPRLLPEDPYERAQVRFWASYINQQVFEVMGRVVSQEGEALA  125

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
                E     ++LE   +   P +  +     +GLL+I + AT G HK   EV+G+KIID
Sbjct  126  KTAEEAQERFKVLEDGLKKHFPNKMTR-EDDDVGLLEIIITATFGNHKVYHEVIGVKIID  184

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
                P +++W+E L ELP+++E   P ++ V+ L+  +Q
Sbjct  185  PVNTPALYNWIECLRELPVMKEVEIPRDRLVNSLQCYRQ  223



>ref|XP_004299365.1| PREDICTED: glutathione S-transferase U9-like [Fragaria vesca 
subsp. vesca]
Length=235

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 149/219 (68%), Gaps = 3/219 (1%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V LH MW STY+K+VELALK+KGIP+EY+EED  NKS  LL+ NP+HKKVP+L+H+G+PI
Sbjct  7    VKLHEMWASTYSKRVELALKLKGIPYEYMEEDFTNKSQLLLKYNPVHKKVPVLVHDGKPI  66

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFIS-ARGQNK  476
             ES +I+EYIDETW    P++ PED Y++AK RFWA +I  QL ++  +  IS  +G+  
Sbjct  67   AESYIILEYIDETWKT-GPKLFPEDPYERAKFRFWASFIQQQLFESFSRVVISQGQGEAL  125

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  + F  L + E+  + +        + ++LGLLDI +V T   HK  EEV G+K +
Sbjct  126  EQAVKDVFERLGVFEEGMKEYLAGGASFTNGENLGLLDILMVVTFSPHKVHEEVFGIKTM  185

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIK  179
            D +++P +FSW+ +L E PLV++  PPH+K V  L++ K
Sbjct  186  DPDRYPLLFSWITALNEHPLVKQISPPHDKLVELLQIYK  224



>ref|XP_007138188.1| hypothetical protein PHAVU_009G187800g [Phaseolus vulgaris]
 gb|AEX38000.1| glutathione transferase [Phaseolus vulgaris]
 gb|ESW10182.1| hypothetical protein PHAVU_009G187800g [Phaseolus vulgaris]
Length=231

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 146/224 (65%), Gaps = 2/224 (1%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
             ++VILHGMW S YAK+VELAL  KGIP+EYVEEDLRNKS  LL+ NP+HKKVP+L+HNG
Sbjct  4    QEKVILHGMWASPYAKRVELALNFKGIPYEYVEEDLRNKSELLLKYNPVHKKVPVLVHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            + I ES+VI+EYI+ETW +  P +LP D+Y++A+ RFW+ +I      +    +   G+ 
Sbjct  64   KAIAESMVILEYIEETWKD-APNLLPTDSYRRAQARFWSSFIQDQLIEVSFLVLKTDGEA  122

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A  + +  L +LE   + +   ER      + G+L+I   A  G +KA EEVLGMK 
Sbjct  123  QQKAVDQVYEKLNVLEDGMKTYLA-ERNARGESNFGILEIVFCALFGSYKAHEEVLGMKF  181

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            I  EK P +FSW+ ++ E+ +V++  PPHEK V  L L +Q   
Sbjct  182  IVPEKFPVLFSWLMAIAEVEVVKKATPPHEKTVEILHLFRQSAL  225



>emb|CAJ13709.1| glutathione S-transferase 12 [Capsicum chinense]
Length=225

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 148/220 (67%), Gaps = 7/220 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++VILH  + S YA +VELALKIKGI FEYV+EDL NKSP+LL+ NP+HKKVP+L+HNG+
Sbjct  5    NKVILHKTYASRYAMRVELALKIKGIQFEYVDEDLSNKSPELLKYNPVHKKVPLLVHNGK  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES++I+EYIDETW    P ILP+D Y++A+VRFWA +I Q      +   S  G+ +
Sbjct  65   PVSESLIILEYIDETWKT-GPLILPQDPYERARVRFWANFIDQHLIPSTRKVWSTTGEEQ  123

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  E    L ILE+E      ++ P     +LGLL I LV   G +K  EEVLGMKI+
Sbjct  124  EKAKEEIMEKLRILEEE------LKTPNHENDNLGLLQILLVTLFGSYKVYEEVLGMKIL  177

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
              E  P ++S V SL +LPLV+E  PPH+K V+ + + +Q
Sbjct  178  VPENTPLLYSCVTSLNKLPLVKEVCPPHDKMVALVNVYRQ  217



>ref|NP_001238708.1| glutathione S-transferase GST 12 [Glycine max]
 gb|AAG34802.1|AF243367_1 glutathione S-transferase GST 12 [Glycine max]
 gb|KHN30836.1| Glutathione S-transferase U9 [Glycine soja]
Length=235

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 147/224 (66%), Gaps = 7/224 (3%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
             D+VILHGMW S YAK+VELAL  KGIP+EYVEEDLRNKS  LL+ NP+HKKVP+L+HNG
Sbjct  4    QDKVILHGMWASPYAKRVELALNFKGIPYEYVEEDLRNKSDLLLKYNPVHKKVPVLVHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISAR--G  485
            + I ES+VI+EYIDETW +  P++LP D+Y++A+ RFW  +I      M+  F+  +  G
Sbjct  64   KAIAESMVILEYIDETWKD-GPKLLPSDSYKRAQARFWCHFIQ--DQLMESTFLVVKTDG  120

Query  484  QNKNAAFSEFFVNLEILEKETRVFCPMERPKISA--QSLGLLDIALVATLGMHKAVEEVL  311
            + +  A    +  L++LE   + +       IS    + G+LDI   A  G +KA EEV+
Sbjct  121  EAQQKAIDHVYEKLKVLEDGMKTYLGEGNAIISGVENNFGILDIVFCALYGAYKAHEEVI  180

Query  310  GMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIK  179
            G+K I  EK P +FSW+ ++ E+  V+   PPHEK V  L+L +
Sbjct  181  GLKFIVPEKFPVLFSWLMAIAEVEAVKIATPPHEKTVGILQLFR  224



>gb|ACU13389.1| unknown [Glycine max]
Length=235

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 147/224 (66%), Gaps = 7/224 (3%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
             D+VILHGMW S YAK+VELAL  KGIP+EYVEEDLRNKS  LL+ NP+HKKVP+L+HNG
Sbjct  4    QDKVILHGMWASPYAKRVELALNFKGIPYEYVEEDLRNKSDLLLKYNPVHKKVPVLVHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISAR--G  485
            + I ES+VI+EYIDETW +  P++LP D+Y++A+ RFW  +I      M+  F+  +  G
Sbjct  64   KAIAESMVILEYIDETWKD-GPKLLPSDSYKRAQARFWCHFIQ--DQLMESTFLVVKTDG  120

Query  484  QNKNAAFSEFFVNLEILEKETRVFCPMERPKISA--QSLGLLDIALVATLGMHKAVEEVL  311
            + +  A    +  L++LE   + +       IS    + G+LDI   A  G +KA EEV+
Sbjct  121  EAQQKAIDHVYEKLKVLEDGMKTYLGEGNAIISGVENNFGILDIVFCALYGAYKAHEEVI  180

Query  310  GMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIK  179
            G+K I  EK P +FSW+ ++ E+  V+   PPHEK V  L+L +
Sbjct  181  GLKFIVPEKFPVLFSWLMAIAEVEAVKIATPPHEKTVGILQLFR  224



>ref|XP_007210650.1| hypothetical protein PRUPE_ppa019399mg [Prunus persica]
 gb|EMJ11849.1| hypothetical protein PRUPE_ppa019399mg [Prunus persica]
Length=231

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 155/226 (69%), Gaps = 3/226 (1%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              ++V L+GMW S Y K+VELAL++KGIP+EYVEEDLRNKS  LL+ NPIH+KVP+L+HN
Sbjct  3    EENKVTLYGMWSSPYVKRVELALRLKGIPYEYVEEDLRNKSQLLLKLNPIHQKVPVLVHN  62

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            G+ IVES+VI+EYIDETW    P++LPED Y++++VRFWA Y+ Q+ ++M  + +   GQ
Sbjct  63   GKTIVESLVILEYIDETWKT-GPQLLPEDPYKRSQVRFWASYLQQVFESM-VSVLKTSGQ  120

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERP-KISAQSLGLLDIALVATLGMHKAVEEVLGM  305
             +  A  E    L++LE+  + F P   P     +++GLL++ + +  G ++A EE LG+
Sbjct  121  AQEKAIKEVTEKLKLLEEGLKGFFPNGFPNSFDIENVGLLEVVICSHFGANEAQEEALGV  180

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            K+I  EK P I+S + +L E+P V+    PHEK V+ L+  ++   
Sbjct  181  KVITPEKTPLIYSSITALTEIPAVKAASIPHEKVVAFLKFFREKAL  226



>ref|XP_008239964.1| PREDICTED: glutathione S-transferase U10-like [Prunus mume]
Length=231

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 156/226 (69%), Gaps = 3/226 (1%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              ++V L+GMW S Y K+VELAL++KGIP+EYVEEDLRNKS  LL+ NPIH+KVP+L+HN
Sbjct  3    EENKVTLYGMWSSPYVKRVELALRLKGIPYEYVEEDLRNKSQLLLKLNPIHQKVPVLVHN  62

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            G+ IVES+VI+EYIDETW    P++LPED Y++++VRFWA Y+ Q+ ++M  + +   G+
Sbjct  63   GKAIVESLVILEYIDETWKT-GPQLLPEDPYKRSQVRFWASYLQQVFESM-VSVLKTSGE  120

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERP-KISAQSLGLLDIALVATLGMHKAVEEVLGM  305
             +  A  E    L++LE+  + F P   P     +++GLL++ + +  G ++A+EE LG+
Sbjct  121  AQEKAIKEVTEKLKLLEEGLKGFFPNGFPNSFDIENVGLLEVVICSHFGANEALEEALGV  180

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            K+I  EK P I+S + +L E+P V+    PHEK V+ L+  ++   
Sbjct  181  KVITPEKTPLIYSSITALTEIPAVKAASIPHEKVVTFLKFFREKAL  226



>ref|XP_004157468.1| PREDICTED: glutathione S-transferase U9-like [Cucumis sativus]
 gb|KGN63996.1| Glutathione s-transferase [Cucumis sativus]
Length=234

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 153/225 (68%), Gaps = 3/225 (1%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              ++V+L+G+W S + K+VELALKIK IPFEYVEED  NKSP+LL+ NP++KKVP+L+HN
Sbjct  3    EENKVVLYGLWASPFVKRVELALKIKAIPFEYVEEDFLNKSPELLKFNPVYKKVPVLVHN  62

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARG  485
            GRPI ES +I EYI+E WNN  P +LP+D Y+++++RFWA ++ +QL D +  A +   G
Sbjct  63   GRPICESAIIFEYIEEVWNNNGPPLLPQDPYKRSQIRFWADFVQNQLFDGLLLA-MKTEG  121

Query  484  QNKNAAFSEFFVNLEILEKET-RVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLG  308
            + +  A  E    L+++E++  +       P ++   LG LDI ++  LG +K  EE  G
Sbjct  122  EAQEKAIKEVKEKLKVIEEQGLKSLLAEGSPFVNGDELGYLDIGMLTVLGRYKIYEEFFG  181

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQH  173
            MKI++EE+ P +FSW+  L+E P+ +E  PP EK +  L ++++ 
Sbjct  182  MKIMEEEEIPIVFSWLNRLIEHPIAKEGAPPKEKVLGLLHIVRRR  226



>ref|XP_009369409.1| PREDICTED: glutathione S-transferase U9-like [Pyrus x bretschneideri]
Length=228

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 157/220 (71%), Gaps = 5/220 (2%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++V LHGMW S Y K+VELALK+KGIP+EYVEEDL+NKSP LL+ NP+H+KVP+L+HNG+
Sbjct  5    NKVTLHGMWASPYVKRVELALKLKGIPYEYVEEDLKNKSPLLLKLNPVHQKVPVLVHNGK  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+VI+EYIDETW   + R+LP+D Y++++VRF+A ++  + ++M  + +  RGQ +
Sbjct  65   PIFESLVILEYIDETW---KTRLLPQDPYKRSQVRFYAGFMQHVFESM-VSVLETRGQAQ  120

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPK-ISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
              A  E    L +LE+  + F P   PK    +++ LL++ ++A LG ++A EEVLG K+
Sbjct  121  EKAIKEVSEKLNLLEEGLKGFYPNGFPKSFDPKNVELLEVVILAHLGAYEAQEEVLGFKV  180

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIK  179
            +D +  P I+S + ++ E+P V+E   PHE+ V+ L+  +
Sbjct  181  MDLQTTPLIYSCIRAMTEIPEVKEVSNPHEQVVAFLKFFR  220



>gb|ADK32333.2| glutathione S-transferase [Ziziphus jujuba]
Length=233

 Score =   208 bits (529),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 145/208 (70%), Gaps = 0/208 (0%)
 Frame = -3

Query  823  LHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVE  644
            +HGMW S ++K+VELALK+KGIP+EYVEEDL+NK P  L  NP++KK+P+L+HNG+PI E
Sbjct  9    VHGMWASPFSKRVELALKVKGIPYEYVEEDLKNKRPYFLSINPVYKKIPVLVHNGKPIAE  68

Query  643  SIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNAAF  464
            S++I+EYI++TW N  P++LP+D Y++A+VRFW  ++H        A ++  G+ +  A 
Sbjct  69   SLIILEYIEDTWKNTGPKLLPDDFYERAQVRFWVDFLHSKFSENVMAAVTKDGETREKAL  128

Query  463  SEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEK  284
            +     ++IL++  + F P     I+ ++LGLL +   + L    + EE LG+++ID E+
Sbjct  129  NGIHEQIKILDEGLKRFYPNGTSGITHENLGLLGVVGSSVLCPFLSTEEALGIQLIDPEQ  188

Query  283  HPFIFSWVESLLELPLVRETLPPHEKAV  200
             P + SWVE+L  + LV+ETLPPH+K V
Sbjct  189  APLVHSWVETLRGISLVKETLPPHDKLV  216



>ref|XP_007037331.1| Glutathione S-transferase tau 9, putative [Theobroma cacao]
 gb|EOY21832.1| Glutathione S-transferase tau 9, putative [Theobroma cacao]
Length=233

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 159/223 (71%), Gaps = 4/223 (2%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V LHG+  + ++K+VELAL+IKGIP+E++EEDL NKS  LL+ NP++KK+P+L+HN +P+
Sbjct  7    VKLHGIGANPHSKRVELALRIKGIPYEFIEEDLSNKSQLLLKSNPVYKKIPVLVHNEKPV  66

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQNKN  473
            V+S++I+EYIDETW N  P++LP+D  ++AKVRF   +I  QL + M +  ++  G+ + 
Sbjct  67   VDSLIILEYIDETWKN-APQLLPDDPLERAKVRFRTSFIQQQLFEAMTRV-VTCDGEIQA  124

Query  472  AAFSEFFVNLEILEKETR-VFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
             A  E    +++LE+  + VF     P I   +LGLLDI + +T   +KA EE LG+KI+
Sbjct  125  KAIDEVQGKMKVLEEGMKEVFPGSGSPSIDGDNLGLLDIMICSTFSPYKAYEEALGVKIL  184

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            D E++P +F WV++L ELPLV+E  PPH+K V+ L++++++  
Sbjct  185  DPERNPLVFCWVKALNELPLVKELYPPHDKLVALLKVVRENAL  227



>ref|XP_010471550.1| PREDICTED: glutathione S-transferase U10-like [Camelina sativa]
Length=232

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 151/222 (68%), Gaps = 2/222 (1%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
               +V LHGMW+STY+K+VE+ALK+KGI +EYVEEDL+NKS  L+Q NP+HKK+P+L+HN
Sbjct  4    QRSKVTLHGMWISTYSKRVEIALKLKGILYEYVEEDLQNKSESLIQLNPVHKKIPVLVHN  63

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            G+P+ ES+VI+EYIDETW N  PR+ PED Y++A+VRFW  YI+Q    +    +   G+
Sbjct  64   GKPVAESLVILEYIDETWKN-SPRLFPEDTYERAQVRFWVSYINQQVFEVMGQVVFQEGE  122

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             +  +  E    +++LE+  +   P +  +     +GLL+I ++AT G HKA  E LG++
Sbjct  123  AQAKSVEEARKRVQVLEEGLKKHFPNKNIR-ENDDVGLLEITIIATFGAHKAYREALGVE  181

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            IID    P +++W+E L +L +++E   P +K V+ L+  +Q
Sbjct  182  IIDPVNTPTLYNWIERLQDLTVMKEVEVPRDKLVNFLQNYRQ  223



>ref|XP_009757243.1| PREDICTED: glutathione S-transferase U9-like [Nicotiana sylvestris]
Length=223

 Score =   206 bits (524),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 144/223 (65%), Gaps = 9/223 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++VILHG W S + K+VELALKIKGI +EYVEEDL NKSP LL+ NP+ KKVP+L+H+ +
Sbjct  5    NKVILHGTWGSVFVKRVELALKIKGIAYEYVEEDLSNKSPHLLKYNPVLKKVPVLVHDDK  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES+VI+EYIDETW    PRILP+D Y+KA VRFWA YI Q           + G+ +
Sbjct  65   PVSESLVILEYIDETWKT-GPRILPQDPYEKAIVRFWANYIDQHLIPSTAKLWKSTGEEQ  123

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  E    + I+E+          P I    LG+L I LV T G HKA E+VLG+KI+
Sbjct  124  EKALEEVLEKIRIVEEGI--------PVIHGNELGILQILLVTTFGSHKAYEDVLGVKIL  175

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
              E  P + S V SL ELP V+E  PP++  +S+L++ +Q+  
Sbjct  176  VPENTPLLCSCVTSLNELPPVKEICPPYDMLLSKLKIYRQNAL  218



>ref|XP_010428448.1| PREDICTED: glutathione S-transferase U10 isoform X1 [Camelina 
sativa]
 ref|XP_010428449.1| PREDICTED: glutathione S-transferase U10 isoform X2 [Camelina 
sativa]
Length=232

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 150/222 (68%), Gaps = 2/222 (1%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
               +V LHGMW+STY+KKVE+ALK+KGI +EYVEEDL+NKS  L+Q NP+HKK+P+L+HN
Sbjct  4    QRSKVTLHGMWVSTYSKKVEIALKLKGILYEYVEEDLQNKSESLIQLNPVHKKIPVLVHN  63

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            G+P+ ES+VI+EYIDETW N  PR  PED Y++A+VRFW  YI+Q    +    +   G+
Sbjct  64   GKPVAESLVILEYIDETWKN-SPRFFPEDPYERAQVRFWVSYINQQVFEVMGQVVFQEGE  122

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             +  +  E    +++LE+  +   P +  +     +GLL+I ++AT G HKA  E LG++
Sbjct  123  AQAKSVEEARKRVQVLEEGLKKHFPNKNIR-ENDDVGLLEITIIATFGAHKAYREALGVE  181

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            IID    P +++W+E L +L +++E   P +K V+ L+  +Q
Sbjct  182  IIDPVNTPTLYNWIERLQDLTVMKEVEVPRDKLVNFLQNYRQ  223



>ref|XP_010416313.1| PREDICTED: glutathione S-transferase U10-like [Camelina sativa]
Length=232

 Score =   205 bits (522),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/222 (45%), Positives = 149/222 (67%), Gaps = 2/222 (1%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
               +V LHGMW STY+K+VE+ALK+KGI +EYVEEDL+NKS  L+Q NP+HKK+P+L+HN
Sbjct  4    QRSKVTLHGMWTSTYSKRVEIALKLKGILYEYVEEDLQNKSESLIQLNPVHKKIPVLVHN  63

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            G+P+ ES+VI+EYIDETW N  PR  PED Y++A+VRFW  YI+Q    +    +   G+
Sbjct  64   GKPVAESLVILEYIDETWKN-SPRFFPEDTYERAQVRFWVSYINQQVFEVMGQVVFQEGE  122

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             +  +  E    +++LE+  +   P +  +     +GLL+I ++AT G HKA  E LG++
Sbjct  123  AQAKSVEEARKRVQVLEEGLKKHFPNKNIR-ENDDVGLLEITIIATFGAHKAYREALGVE  181

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            IID    P +++W+E L +L +++E   P +K V+ L+  +Q
Sbjct  182  IIDPVNTPTLYNWIERLQDLTVMKEVEVPRDKLVNFLQNYRQ  223



>ref|XP_004151688.1| PREDICTED: glutathione S-transferase U9-like [Cucumis sativus]
Length=235

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 152/226 (67%), Gaps = 4/226 (2%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              ++V+L+G+W S + K+VELALKIK IPFEYVEED  NKSP+LL+ NP++KKVP+L+HN
Sbjct  3    EENKVVLYGLWASPFVKRVELALKIKAIPFEYVEEDFLNKSPELLKFNPVYKKVPVLVHN  62

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARG  485
            GRPI ES +I EYI+E WNN  P +LP+D Y+++++RFWA ++ +QL D +  A +   G
Sbjct  63   GRPICESAIIFEYIEEVWNNNGPPLLPQDPYKRSQIRFWADFVQNQLFDGLLLA-MKTEG  121

Query  484  QNKNAAFSEFFVNLEILEKET-RVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLG  308
            + +  A  E    L+++E++  +       P ++   LG LDI ++  LG +K  EE  G
Sbjct  122  EAQEKAVEEVKERLKVVEEQGLKSLLAEGSPFVNGDELGYLDIGMLTVLGRYKIYEEFFG  181

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRE-TLPPHEKAVSRLELIKQH  173
            MKI++EE+ P +FSW+  L+E P+ +E   PP EK +  L + +Q 
Sbjct  182  MKIMEEEEIPIVFSWLNRLIEHPIAKELGAPPKEKILGLLHITRQR  227



>ref|XP_009128052.1| PREDICTED: glutathione S-transferase U10-like [Brassica rapa]
Length=232

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 150/219 (68%), Gaps = 2/219 (1%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +V LHGMW S+Y+K+VE+ALK+KGI +EYVEEDL NK+  L++ NP+HKKVP+L+H+G+P
Sbjct  7    KVTLHGMWASSYSKRVEIALKLKGILYEYVEEDLSNKTESLVRLNPVHKKVPLLVHDGKP  66

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            + ES VI+EYIDETWNN  PR+LPED+Y++A+VRFW  YI+Q    +    +   G+ + 
Sbjct  67   VAESQVILEYIDETWNN-SPRLLPEDSYERAQVRFWVSYINQQVIEVMGKVLFQEGEAQE  125

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             A  E     ++LE+  +   P +  +     +GLLDI +++T G HK   +V G+ +ID
Sbjct  126  KAIEEARERFKVLEEGLKKHFPNKTIR-ENDDVGLLDIIIISTFGSHKVYHDVFGVGVID  184

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            +   P +++W+ESL EL +++E   P ++ V  L++ +Q
Sbjct  185  QVNTPTLYNWIESLKELAVMKEAEVPSDRLVPFLQMYRQ  223



>emb|CDY59707.1| BnaCnng35440D [Brassica napus]
Length=232

 Score =   202 bits (515),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/220 (46%), Positives = 151/220 (69%), Gaps = 4/220 (2%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +V LHGMW STY+K+VE+ALK+KGI +EYVEEDL NK+  L+Q NP+HKKVP+L+H+G+P
Sbjct  7    KVTLHGMWASTYSKRVEIALKLKGILYEYVEEDLSNKTESLVQLNPVHKKVPLLVHDGKP  66

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQNK  476
            + ES VI+EYIDETW N  PR+LPED+Y++A+VRFW  YI+ Q+ + M+K      G+ +
Sbjct  67   VAESQVILEYIDETWKN-SPRLLPEDSYERAQVRFWVSYINEQVIEVMRKVLFQ-EGEAQ  124

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  E     ++LE+  +   P +  +     +GLLDI +++T G HK   E+ G+ II
Sbjct  125  EKAIEEARERFKVLEEGLKKHFPNKIIR-ENDDVGLLDIIIISTFGSHKDYHELFGVGII  183

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            D    P +++W+ESL EL +++E   P ++ V  L++ +Q
Sbjct  184  DPVNTPTLYNWIESLKELAVIKEAEVPSDRLVPFLQMYRQ  223



>ref|XP_007211046.1| hypothetical protein PRUPE_ppa019082mg [Prunus persica]
 gb|EMJ12245.1| hypothetical protein PRUPE_ppa019082mg [Prunus persica]
Length=231

 Score =   202 bits (514),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 153/226 (68%), Gaps = 3/226 (1%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              ++V L+GMW+S Y K+VE AL++KGIP+EYVEEDLRNKSP LL+ NP+ ++VP+L+HN
Sbjct  3    EENKVTLYGMWISPYVKRVEFALRLKGIPYEYVEEDLRNKSPSLLKLNPVRQEVPVLVHN  62

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            G+ IVES+VI+EYIDETW    P++LPED Y++++VRFWA Y+ Q+ ++M     S+ G+
Sbjct  63   GKAIVESLVILEYIDETWKT-GPQLLPEDPYKRSQVRFWASYLQQVFESMVSVLKSS-GE  120

Query  481  NKNAAFSEFFVNLEILEKETRVFCPME-RPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
             +  A  E    L +LE+  + F P         +++GLL++ + +  G ++A EE LG+
Sbjct  121  AQEKAIKEVTEKLNLLEEGLKGFFPNGFLNSFDKENVGLLEVVIFSHFGSYEAQEEALGV  180

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            K I  EK P I+S V +L E+P V+     HEK V+ L+ ++++  
Sbjct  181  KFITLEKTPLIYSSVTALTEIPAVKAERNSHEKVVAFLKFVRRNAL  226



>ref|XP_004299372.1| PREDICTED: glutathione S-transferase U10-like [Fragaria vesca 
subsp. vesca]
Length=233

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 154/228 (68%), Gaps = 5/228 (2%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              ++VIL+G W S YAK VE+ALK KG+P+EYVEEDL NKSP LL+ NPIHKKVP+L+HN
Sbjct  3    EQNKVILYGTWFSPYAKMVEVALKAKGVPYEYVEEDLWNKSPMLLKLNPIHKKVPVLVHN  62

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            G+ IVES+VI+EY+DETW    P++LPED Y++++ RFWA Y+HQ+ + + +  ++  G+
Sbjct  63   GKAIVESLVIIEYMDETWKT-GPQLLPEDPYKRSQFRFWASYMHQVFEALTEV-VTTSGE  120

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQ-SLG-LLDIALVATLGMH-KAVEEVL  311
             +  A  E F  L +LE+  +   P        + S G LL++ + +  G + + ++EV 
Sbjct  121  AQEKAIKETFEQLNLLEEGLKGLFPEGIVSSDGEFSNGKLLELVMFSCFGTYEEGLQEVF  180

Query  310  GMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            G+ +ID EK P +FS + +L+E+P ++E+  PHEK V+ L+  ++   
Sbjct  181  GIDVIDPEKTPLLFSCITALMEIPALKESCNPHEKMVAFLKFYREDAL  228



>ref|XP_009151370.1| PREDICTED: glutathione S-transferase U9 [Brassica rapa]
Length=234

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/224 (46%), Positives = 153/224 (68%), Gaps = 6/224 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++VILHG +MS Y+K+VELALK+K IP+ +V+EDL NKS  LLQ NP+HKKVP+LLH G+
Sbjct  7    NKVILHGTFMSPYSKRVELALKLKSIPYLFVQEDLHNKSQTLLQHNPVHKKVPVLLHKGK  66

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            PI ES+ I+EYIDETW N  P++LP+D Y+++KVRFWA YI   L D + K  + + G+ 
Sbjct  67   PISESLFIIEYIDETWRN-GPQLLPQDPYRRSKVRFWASYIQLHLFDVVMKV-VKSEGEE  124

Query  478  KNAAFSEFFVNLEILEKET--RVFCPME-RPKISAQSLGLLDIALVATLGMHKAVEEVLG  308
            +  A +E    L I+EKE    +F     +P ++ +++ L+DI +   L  +KA EEVLG
Sbjct  125  QEIALTEVKEKLSIIEKEGLKEIFSDTNGKPTVTDETMSLVDIVMCTLLSPYKAHEEVLG  184

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            +KI+D E  P ++ W+ ++ E  +V++  PP+E+ +  L   +Q
Sbjct  185  LKIVDPETLPGVYCWLNAINETDVVKDLSPPYEQVLEILRTFRQ  228



>ref|XP_008239963.1| PREDICTED: glutathione S-transferase U10-like [Prunus mume]
Length=231

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 153/226 (68%), Gaps = 3/226 (1%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              ++V L+GMW+S Y K+VE AL++KGIP+EYVEEDLRNKSP LL+ NP+ ++VP+L+HN
Sbjct  3    EENKVTLYGMWVSPYVKRVEFALRLKGIPYEYVEEDLRNKSPLLLKLNPVRQEVPVLVHN  62

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            G+ IVES+VI+EYIDETW    P++LPED Y++++VRFWA Y+ Q+ ++M  + +   G+
Sbjct  63   GKAIVESLVILEYIDETWKT-GPQLLPEDPYKRSQVRFWAIYLQQVFESM-VSVLKTSGE  120

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERP-KISAQSLGLLDIALVATLGMHKAVEEVLGM  305
             +  A  E    L++LE+  + F P   P     +++GLL++ + +  G ++A EE LG+
Sbjct  121  AQEKAIKEVTEKLKLLEEGLKGFFPNGFPNSFDKENVGLLEVVIFSHFGSYEAQEEALGV  180

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            K I  EK P I+S V +L E+P V+     HEK V  L+ ++ +  
Sbjct  181  KFITPEKTPLIYSSVTALTEIPAVKAEPSSHEKMVVFLKFVRGNAL  226



>ref|XP_004499459.1| PREDICTED: glutathione S-transferase U9-like [Cicer arietinum]
Length=231

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/225 (42%), Positives = 147/225 (65%), Gaps = 1/225 (0%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              ++VILHGMW S + K+VE+ALK+KGI +EYVEEDL NKS  LL+ NP++KKVP+L+HN
Sbjct  3    EQNKVILHGMWASPFVKRVEMALKLKGISYEYVEEDLANKSDSLLKYNPVYKKVPVLVHN  62

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
             + IVES+VI+EYIDETW +  P+++P D Y++A+ RFW K+I +         +   G+
Sbjct  63   EKAIVESLVILEYIDETWKD-GPKLMPNDPYKRAQARFWCKFIEEKVLENVLLVVKTDGE  121

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             +  A SE +  L +LE   + +   + P     + G+LD   ++  G +KA EEV+G+K
Sbjct  122  AQQKAISELYEKLSLLEDGMKNYFEGQNPSADKINSGVLDFVFISLFGTYKAQEEVVGVK  181

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
             I+ EK P +FSW+ +++E+ +V+E   P+++ V  L+ I+    
Sbjct  182  FIEAEKFPMLFSWLMAVVEISVVKEASLPNDRTVGLLQFIRNKAL  226



>ref|XP_003613754.1| Glutathione S-transferase [Medicago truncatula]
 gb|AES96712.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
 gb|AFK38290.1| unknown [Medicago truncatula]
Length=225

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 145/226 (64%), Gaps = 4/226 (2%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE       V+L G W S+Y  KVELALK+KGIP++YV+EDLRNKS  LL+ NP+HKKV
Sbjct  1    MGE---ETSEVVLLGNWASSYCTKVELALKVKGIPYKYVDEDLRNKSDSLLKYNPVHKKV  57

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+LLH GR I ES +I+EYIDE W++  P++LPED YQ+AKVRFWA Y  Q         
Sbjct  58   PILLHKGRSICESQIILEYIDEIWDH-SPKLLPEDPYQRAKVRFWANYFDQKIIPSSYRI  116

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVE  320
              +RG+ +  A  E    L + E+  +     +    + ++LGLLDI + AT   ++A +
Sbjct  117  FQSRGEERKKAAEEMEEILVVFEEGVKEGFNEKFHFFNGETLGLLDIVVAATSCTYEAFQ  176

Query  319  EVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELI  182
            E   +++   EK P  F WV +L E PLV+ETLPPHEK V++L+ I
Sbjct  177  EACEIEVFTPEKMPKFFIWVNNLKEHPLVKETLPPHEKLVAKLKSI  222



>ref|XP_004137582.1| PREDICTED: glutathione S-transferase U9-like [Cucumis sativus]
Length=234

 Score =   201 bits (511),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 150/223 (67%), Gaps = 3/223 (1%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++V+L+G W   + K VELALKIKGIPF YVEED  NKSP+LL+ NP++KKVP+L+HN R
Sbjct  5    NKVVLYGFWACPFVKSVELALKIKGIPFAYVEEDFLNKSPELLKFNPVYKKVPVLVHNER  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQN  479
            PI ES +I+EYI+E WNN  P +LP+D ++++++RFW  ++ +QL D++  + +   G+ 
Sbjct  65   PICESAIILEYIEEVWNNNGPSLLPQDPFKRSQIRFWVDFVKNQLYDSLLLS-MKTEGEA  123

Query  478  KNAAFSEFFVNLEILEKET-RVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
            +  A  E    L+++E++  +       P ++   LG LDI ++  LG +K  EE  GMK
Sbjct  124  QEKAVEEVKERLKVVEEQGLKSLLAEGSPFVNGDELGYLDIGMLTVLGRYKIYEEFFGMK  183

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQH  173
            I++EE+ P +FSW+  L+E P+ +E  PP EK +  L ++++ 
Sbjct  184  IMEEEEIPIVFSWLNRLIEHPIAKEGAPPKEKVLGLLHIVRRR  226



>emb|CDX73101.1| BnaC06g35490D [Brassica napus]
Length=232

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 150/219 (68%), Gaps = 2/219 (1%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +VILHGMW STY+K+VE+ALK+KGI +EYVEEDL+NK+  L+Q NP+ KK+P+L+H+G+P
Sbjct  7    KVILHGMWASTYSKRVEIALKLKGISYEYVEEDLKNKTESLIQLNPVLKKIPLLVHDGKP  66

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            + ++ VI++YIDETW N  PR  PED Y++A+VRFW  YI+Q    +    +   G+ + 
Sbjct  67   VADTQVILDYIDETWKN-SPRFYPEDPYERAQVRFWVSYINQQVFEVMGRVMLQEGEAQA  125

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             +  E     E+LE+  +   P +  +     +GLLDI ++A+ G++KAV E +G++IID
Sbjct  126  KSVEEARERFEVLEEGLKKHFPNKTIR-GNDDVGLLDIIIIASFGVYKAVHEAIGVEIID  184

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
                P +++W E L +LP+++E   PH++ V+ L+  +Q
Sbjct  185  PVNTPTLYNWTEQLQQLPVIKEVEVPHDRLVTFLQKCRQ  223



>gb|AFK43288.1| unknown [Lotus japonicus]
Length=233

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 150/225 (67%), Gaps = 6/225 (3%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +VILHGMW S YAK+VELAL++KG+P+EYVEEDL +KS  L++ +P+ KKVP+L+HNG+ 
Sbjct  6    KVILHGMWASPYAKRVELALELKGVPYEYVEEDLVDKSELLIKHDPVRKKVPVLVHNGKA  65

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQN  479
            I ES+VI+EYIDETW N  P++LP+D Y++A+VRFW+K+I +  L  T +   +   G+ 
Sbjct  66   IAESLVILEYIDETWKN-SPKLLPDDPYKRAQVRFWSKFIQEQILESTFQ--VLKTEGEA  122

Query  478  KNAAFSEFFVNLEILEKETRV-FCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
            +  A  E +  L +L    +  F     P     + G+LD+   +  G +KA EEVLG++
Sbjct  123  QRKAVDEVYEKLYVLGNGMKAFFTDGSNPGFEENNAGILDVVFCSLFGAYKAQEEVLGLQ  182

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
             I  +K P ++SW+ +++EL  V++  PPH+K V  L+  +++  
Sbjct  183  FIVPDKFPVLYSWLITIVELEAVKKVAPPHDKTVGILQHFRRYAL  227



>ref|XP_004301155.1| PREDICTED: glutathione S-transferase U9-like [Fragaria vesca 
subsp. vesca]
Length=234

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 150/221 (68%), Gaps = 3/221 (1%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            RVILHG  +S Y K+VE+ALKIKGIP+E+VEEDL+NKSP LL+ NP+HKK+P+L+HNG+P
Sbjct  6    RVILHGNRLSPYVKRVEMALKIKGIPYEFVEEDLKNKSPLLLKYNPVHKKIPVLVHNGKP  65

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            + ES+VI+EYIDE W    P++LPED Y++A+V FWA ++HQ         I    + + 
Sbjct  66   LAESLVILEYIDEAWKT-SPQLLPEDPYRRARVHFWASFLHQQLFEAIVLVIKTDEEARQ  124

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSL--GLLDIALVATLGMHKAVEEVLGMKI  299
                E F  L++LE   +       P +   ++  GLLD+ + +    ++A E+VLG+K+
Sbjct  125  KTIKEMFNKLKLLEDGVKDLFSDGIPLVVDNNINVGLLDVLMFSIFDSYEAHEQVLGIKV  184

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            ID EK P I+SW++S+ EL +V+E   PHEK ++ ++L ++
Sbjct  185  IDPEKTPVIYSWIKSINELHVVKELHIPHEKVLASVKLFRK  225



>ref|XP_010258434.1| PREDICTED: glutathione S-transferase U9 [Nelumbo nucifera]
Length=229

 Score =   200 bits (508),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 150/225 (67%), Gaps = 13/225 (6%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L+G+W S+Y  +V++ALK+KGIP+EYVEED+ NKS  LL  NP+HKKVP+L+HNGRPI
Sbjct  4    VKLYGVWASSYCNRVQMALKLKGIPYEYVEEDVSNKSRSLLNYNPVHKKVPVLVHNGRPI  63

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
             ES+VI+EY+DE W    P +LPED Y++AKVRFWA +  Q       + +   G+ +  
Sbjct  64   AESLVILEYVDEFWKK-APLLLPEDPYERAKVRFWANFYDQKLSPSINSIVKTGGEEQEK  122

Query  469  AFSEFFVNL-----EILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEE--VL  311
            A  E   N+     E+ EKE+ V      P  +  S G LDI + +++  H+AV+E  V+
Sbjct  123  AIKELLENMRVMEEELFEKESTVTA--RSPFFNGDSPGFLDIVMGSSMCNHRAVKEALVV  180

Query  310  GMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            G  +I+ +K+PF +SW+ +L E P++++TLPPH+K V   ELI++
Sbjct  181  GTDLINLDKYPFCYSWLTALEEHPIMKDTLPPHDKLV---ELIRK  222



>emb|CDX73100.1| BnaC06g35480D [Brassica napus]
Length=232

 Score =   200 bits (508),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 152/220 (69%), Gaps = 4/220 (2%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +VILHGMW STY+K+VE+ALK+KGI +EYVEEDL+NK+  L+Q NP+HKK+P+L+H+G+P
Sbjct  7    KVILHGMWASTYSKRVEIALKLKGISYEYVEEDLKNKTETLIQLNPVHKKIPLLVHDGKP  66

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ-LSDTMKKAFISARGQNK  476
            + ES VI++YIDETW +  PR  PED Y++A+VRFW  YI+Q + D M +  +  +G+  
Sbjct  67   VAESQVILDYIDETWMS-SPRFYPEDPYERAQVRFWISYINQHVFDVMARV-LYQKGEAA  124

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              +        E+LE+  +   P +  +     +GLLDI ++A+ G+HK   E +G++II
Sbjct  125  TRSVEVARERFEVLEEGLKKHFPNKIIR-GNDDVGLLDIIIIASFGVHKVFHEAIGVEII  183

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            D    P +++W+E L +LP+++E   PH++ V+ L+  +Q
Sbjct  184  DPVNTPTLYNWIEQLQQLPVIKEVEVPHDRLVTFLQKYRQ  223



>ref|XP_010530568.1| PREDICTED: glutathione S-transferase U9 [Tarenaya hassleriana]
Length=225

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 149/228 (65%), Gaps = 9/228 (4%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE     ++V LHG +MS Y+K+VELAL++K +P+E+VEEDL+NKS  LL+ NP+H+K+
Sbjct  1    MGEE----NKVRLHGTFMSPYSKRVELALRLKAVPYEFVEEDLKNKSRDLLKYNPVHEKI  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+L+HNG+PI ES VI+EYIDETW    PRILPED Y++AK+RFWA+Y+ +    +    
Sbjct  57   PVLVHNGKPICESSVIIEYIDETWKT-GPRILPEDPYRRAKIRFWARYLQEHVFEVLLKV  115

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVE  320
            I  +G  +  A  E    L+++E+E       E        +GL D+ +   L  +KA E
Sbjct  116  IKTQGDEQEKAHEELKEKLKVIEEEALEDISYE----GKPEMGLADMVMCTMLSPYKAQE  171

Query  319  EVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            EVLG KI+D E  P + SW++++ E+ +V+E  PPHEK V  +   +Q
Sbjct  172  EVLGFKIVDPEAVPGVHSWIDAINEVDVVKELSPPHEKLVQIIRAFRQ  219



>ref|XP_004169465.1| PREDICTED: glutathione S-transferase U9-like [Cucumis sativus]
Length=235

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 150/224 (67%), Gaps = 4/224 (2%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++V+L+G W   + K VELALKIKGIPF+YVEED  NKSP+LL+ NP++KKVP+L+HNGR
Sbjct  5    NKVVLYGFWACPFVKSVELALKIKGIPFDYVEEDFLNKSPELLKFNPVYKKVPVLVHNGR  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQN  479
            PI ES +I+EYI+E WNN  P + P+D ++++++RFW  ++ +QL D++  + +   G+ 
Sbjct  65   PICESAIILEYIEEVWNNNGPSLRPQDPFKRSQIRFWVDFVKNQLYDSLLLS-MKTEGEA  123

Query  478  KNAAFSEFFVNLEILEKET-RVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
            +  A  E    L+++E++  +       P ++   LG LDI ++  LG +K  EE  GMK
Sbjct  124  QEKAMEEVKERLKVVEEQGLKSLLAEGSPFVNGDELGYLDIGMLTILGRYKIYEEFFGMK  183

Query  301  IIDEEKHPFIFSWVESLLELPLVRE-TLPPHEKAVSRLELIKQH  173
            I++EE+ P +FSW+  L+E P+ +E   PP EK +  L + +Q 
Sbjct  184  IMEEEEIPIVFSWLNRLIEHPIAKELGAPPKEKVLGLLHITRQR  227



>ref|XP_007046107.1| Glutathione S-transferase TAU 10 [Theobroma cacao]
 gb|EOY01939.1| Glutathione S-transferase TAU 10 [Theobroma cacao]
Length=229

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 139/214 (65%), Gaps = 1/214 (0%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +V+L G W S Y K+VELALK+KGIP+EY+EEDL NKS  L   NP+HKKVP+LLH+G P
Sbjct  7    QVVLIGTWASGYCKRVELALKLKGIPYEYIEEDLENKSSLLHHSNPVHKKVPVLLHDGIP  66

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            I ES+VI+EYIDE W+N+ P++LPED YQ+AK+RFWA Y  Q           ++G+  +
Sbjct  67   IAESLVILEYIDEYWSNVAPKLLPEDPYQRAKIRFWANYHDQKIMPAIWHIALSQGKEHD  126

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             A   +   L++ E+      P + P  +  SLG LD+ +      ++A  EV+ + I D
Sbjct  127  KAIEVYHGLLKVFEEGIEKDFPAKSPFFNGDSLGFLDVIVGTVACNYQAFHEVVTV-IFD  185

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
              KHP  FSWV +L E PL++E LPPH+K V+ +
Sbjct  186  PAKHPSFFSWVTALKEHPLIKEVLPPHDKLVALM  219



>ref|XP_006392082.1| hypothetical protein EUTSA_v10023672mg [Eutrema salsugineum]
 gb|ESQ29368.1| hypothetical protein EUTSA_v10023672mg [Eutrema salsugineum]
Length=232

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 146/219 (67%), Gaps = 2/219 (1%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +V LHGMW STY+K+VE+ALK+KGIPF+YVEEDL+NKS  L+Q NP+HKK+P+L+H+G+P
Sbjct  7    KVTLHGMWASTYSKRVEIALKLKGIPFKYVEEDLKNKSDSLIQLNPVHKKIPLLVHDGKP  66

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            + ES VI+EYIDETW N  PR+LPED Y+KA+VRFW  YI Q    +    +   G+   
Sbjct  67   LAESQVILEYIDETWKN-SPRLLPEDPYEKAQVRFWVSYIIQQVYEVFGRILFQEGKALA  125

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             +  E    L +LE+  +   P +  +     +GLL+I +  + G HK   E LG++IID
Sbjct  126  KSVEEAQERLRVLEEGLKKHFPNKILR-ENDDVGLLEIIIFTSFGAHKVYHEALGVEIID  184

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
                P +++W+E L EL +++E   PH+K V+ ++  +Q
Sbjct  185  PVDTPTLYNWIERLQELTVMKECEVPHDKLVTSIQNYRQ  223



>ref|NP_851249.1| glutathione S-transferase tau 9 [Arabidopsis thaliana]
 sp|Q9FUT0.1|GSTU9_ARATH RecName: Full=Glutathione S-transferase U9; Short=AtGSTU9; AltName: 
Full=GST class-tau member 9; AltName: Full=Glutathione 
S-transferase 14 [Arabidopsis thaliana]
 gb|AAG30128.1|AF288179_1 glutathione S-transferase [Arabidopsis thaliana]
 dbj|BAD43974.1| glutathione S-transferase (GST14) [Arabidopsis thaliana]
 gb|AED97612.1| glutathione S-transferase tau 9 [Arabidopsis thaliana]
Length=240

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 155/224 (69%), Gaps = 6/224 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++VILHG + S Y+K++ELAL++K IP+++V+EDL+NKS  LL+ NP+HKK+P+L+HNG+
Sbjct  7    NKVILHGSFASPYSKRIELALRLKSIPYQFVQEDLQNKSQTLLRYNPVHKKIPVLVHNGK  66

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            PI ES+ I+EYIDETW+N  P ILPED Y+++KVRFWA YI   L D + K  + + G+ 
Sbjct  67   PISESLFIIEYIDETWSN-GPHILPEDPYRRSKVRFWANYIQLHLYDLVIKV-VKSEGEE  124

Query  478  KNAAFSEFFVNLEILEKET--RVFCPME-RPKISAQSLGLLDIALVATLGMHKAVEEVLG  308
            +  A +E    L ++EKE    +F   +  P ++ +++ L+DI +   L  +KA EEVLG
Sbjct  125  QKKALTEVKEKLSVIEKEGLKEIFSDTDGEPTVTNETMSLVDIVMCTLLSPYKAHEEVLG  184

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            +KIID E  P ++ W+ ++ E  +V++  PP+E+ +  L   +Q
Sbjct  185  LKIIDPEIVPGVYGWINAINETSVVKDLSPPYEQILEILRAFRQ  228



>emb|CDY00291.1| BnaA06g21920D [Brassica napus]
Length=234

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 152/224 (68%), Gaps = 6/224 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++VILHG +MS Y+K+VELALK+K IP+ +V+EDL NKS  LLQ NP+HKKVP+L+H G+
Sbjct  7    NKVILHGTFMSPYSKRVELALKLKSIPYLFVQEDLHNKSQTLLQYNPVHKKVPVLVHKGK  66

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            PI ES+ I+EYIDETW N  P++LP+D Y+++KVRFWA YI   L D + K  + + G+ 
Sbjct  67   PISESLFIIEYIDETWRN-GPQLLPQDPYRRSKVRFWASYIQLHLFDVVMKV-VKSEGEE  124

Query  478  KNAAFSEFFVNLEILEKET--RVFCPME-RPKISAQSLGLLDIALVATLGMHKAVEEVLG  308
            +  A +E    L I+EKE    +F     +P ++ +++ L+DI +   L  +KA  EVLG
Sbjct  125  QEIALTEVKEKLSIIEKEGLKEIFSDTNGKPTVTDETMSLVDIVMCTLLSPYKAHREVLG  184

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            +KI+D E  P ++ W+ ++ E  +V++  PP+E+ +  L   +Q
Sbjct  185  LKIVDPETLPGVYCWLNAINETDVVKDLSPPYEQVLEILRTFRQ  228



>ref|XP_006301340.1| hypothetical protein CARUB_v10021750mg [Capsella rubella]
 gb|EOA34238.1| hypothetical protein CARUB_v10021750mg [Capsella rubella]
Length=232

 Score =   197 bits (501),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 148/220 (67%), Gaps = 2/220 (1%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++V LHGMW+STY+K+VE+ALKIKGI ++YVEEDL+NKS  L+Q NP+HKK+P+L+HNG+
Sbjct  6    NKVTLHGMWISTYSKRVEIALKIKGILYQYVEEDLQNKSESLIQLNPVHKKIPVLVHNGK  65

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES+VI+EYIDETW N  P   PED Y++ +VRFW  YI+Q    +    +   G+ +
Sbjct  66   PVAESLVILEYIDETWKN-SPHFFPEDPYERGQVRFWVSYINQQVFEVMGQVVFQEGEAQ  124

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              +  E    +++LE+  +     +  +     +GLL+I ++AT G HK   E +G++II
Sbjct  125  AKSVEEARKRIKVLEEGLKKHFSNKIIR-ENDDVGLLEIIIIATFGAHKVYREAIGVEII  183

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            D    P +++W+E L +LP+++E   P +K V+ L+  +Q
Sbjct  184  DPVNTPTLYNWIECLQDLPVMKEVEVPRDKLVNFLQSYRQ  223



>emb|CDX86895.1| BnaC03g51650D [Brassica napus]
Length=234

 Score =   197 bits (501),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 152/224 (68%), Gaps = 6/224 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++VILHG ++S Y+K+VELALK+K IP+ +V+EDL NKS  LLQ NP+HKKVP+L+H G+
Sbjct  7    NKVILHGTFVSPYSKRVELALKLKSIPYLFVQEDLHNKSQALLQHNPVHKKVPVLVHKGK  66

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            PI ES+ I+EYIDETW N  P++LP+D Y+++KVRFWA YI   L D + K  +   G+ 
Sbjct  67   PISESLFIIEYIDETWRN-GPQLLPQDPYKRSKVRFWASYIQLHLFDVVMKV-VKTEGEE  124

Query  478  KNAAFSEFFVNLEILEKET--RVFCPME-RPKISAQSLGLLDIALVATLGMHKAVEEVLG  308
            +  A +E    L I+EKE    +F     +P ++ +++ L+DI +   L  +KA EEVLG
Sbjct  125  QEKALTEVKEKLSIIEKEGLKDIFSDTNGKPTLTNETMSLVDIVMCTLLSPYKAHEEVLG  184

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            +KI+D E  P + SW+ ++ E  +V++  PP+E+ +  L   +Q
Sbjct  185  LKIVDPETVPGVCSWLTAINETDVVKDLSPPYEQVLEILRAFRQ  228



>gb|KFK27974.1| hypothetical protein AALP_AA8G455700 [Arabis alpina]
Length=234

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 150/223 (67%), Gaps = 4/223 (2%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++VIL+  + S Y+K+VELALK+K IP++ V EDL+NKS  LL+ NP+HKK+P+L+HNG+
Sbjct  7    NKVILYATYASPYSKRVELALKLKSIPYQLVHEDLQNKSQDLLKYNPVHKKIPVLVHNGK  66

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES++IVEYIDETW N  P +LP+D Y++AKVRFWA YIH     +    + + G+ +
Sbjct  67   PISESLIIVEYIDETWTN-GPHLLPQDPYKRAKVRFWASYIHLHLVDVVLKVVKSEGEEQ  125

Query  475  NAAFSEFFVNLEILEKET--RVFCPME-RPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
              A +E    L I+EKE    +F   +  P ++ +++ L+DI +   L  +KA EEVLG+
Sbjct  126  EEALTEVKEKLSIIEKEGLKEIFSDTDGEPTVTNETMSLVDIVMCTLLSPYKAHEEVLGL  185

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            KIID E  P +++W+ ++ +  +V+E  PP E+ +  L   +Q
Sbjct  186  KIIDPETVPGVYAWINAINQTNVVKELSPPFEQLLEILRSFRQ  228



>ref|XP_006827226.1| hypothetical protein AMTR_s00010p00260360 [Amborella trichopoda]
 gb|ERM94463.1| hypothetical protein AMTR_s00010p00260360 [Amborella trichopoda]
Length=232

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 143/207 (69%), Gaps = 1/207 (0%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
            +  V L G+W S++  +VELALK+KGI +EY+EE+L NKSP LLQ NPIHKKVP+LLH+G
Sbjct  3    NSEVKLFGLWASSFCHRVELALKLKGISYEYIEEELNNKSPLLLQLNPIHKKVPVLLHSG  62

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            RPI ES++I+EYIDETW  L   ++PED Y++A VRFWA ++ +      +  +   G+ 
Sbjct  63   RPIAESLIILEYIDETWPELSA-LMPEDPYERALVRFWADFLDKKFLETSEEILRTEGKE  121

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A +E+  NLE+LEK  +     ++P I+ ++ G LD+ L ++ G  K +EE+ G K 
Sbjct  122  QEKAVAEYRENLEVLEKGLQRDFGTKKPFINGETPGYLDVILASSSGWMKGLEEIAGQKF  181

Query  298  IDEEKHPFIFSWVESLLELPLVRETLP  218
            I+EEK P + S++ +L +L +VRET+P
Sbjct  182  IEEEKAPLMHSFMSALCDLGVVRETIP  208



>gb|KGN63993.1| hypothetical protein Csa_1G033130 [Cucumis sativus]
Length=235

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 149/224 (67%), Gaps = 4/224 (2%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++V+L+G W   + K VELALKIKGIPF YVEED  NKSP+LL+ NP++KKVP+L+HN R
Sbjct  5    NKVVLYGFWACPFVKSVELALKIKGIPFAYVEEDFLNKSPELLKFNPVYKKVPVLVHNER  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQN  479
            PI ES +I+EYI+E WNN  P +LP+D ++++++RFW  ++ +QL D++  + +   G+ 
Sbjct  65   PICESAIILEYIEEVWNNNGPSLLPQDPFKRSQIRFWVDFVKNQLYDSLLLS-MKTEGEA  123

Query  478  KNAAFSEFFVNLEILEKET-RVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
            +  A  E    L+++E++  +       P ++   LG LDI ++  LG +K  EE  GMK
Sbjct  124  QEKAMEEVKERLKVVEEQGLKSLLAEGSPFVNGDELGYLDIGMLTILGRYKIYEEFFGMK  183

Query  301  IIDEEKHPFIFSWVESLLELPLVRE-TLPPHEKAVSRLELIKQH  173
            I++EE+ P +FSW+  L+E P+ +E   PP EK +  L + +Q 
Sbjct  184  IMEEEEIPIVFSWLNRLIEHPIAKELGAPPKEKILGLLHITRQR  227



>ref|NP_177598.1| glutathione S-transferase TAU 10 [Arabidopsis thaliana]
 sp|Q9CA57.1|GSTUA_ARATH RecName: Full=Glutathione S-transferase U10; Short=AtGSTU10; 
AltName: Full=GST class-tau member 10 [Arabidopsis thaliana]
 gb|AAG52384.1|AC011765_36 putative glutathione S-transferase; 80986-80207 [Arabidopsis 
thaliana]
 gb|AAM65598.1| putative glutathione S-transferase [Arabidopsis thaliana]
 dbj|BAC42270.1| putative glutathione S-transferase [Arabidopsis thaliana]
 gb|AAO63839.1| putative glutathione transferase [Arabidopsis thaliana]
 gb|AEE35613.1| glutathione S-transferase TAU 10 [Arabidopsis thaliana]
Length=232

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 149/219 (68%), Gaps = 2/219 (1%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +VILHG W+STY+K+VE+ALK+KG+ +EY+EEDL+NKS  L+Q NP+HKK+P+L+H+G+P
Sbjct  7    KVILHGTWISTYSKRVEIALKLKGVLYEYLEEDLQNKSESLIQLNPVHKKIPVLVHDGKP  66

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            + ES+VI+EYIDETW N  PR  PED Y++A+VRFW  YI+Q    +    +S  G+ + 
Sbjct  67   VAESLVILEYIDETWTN-SPRFFPEDPYERAQVRFWVSYINQQVFEVMGQVMSQEGEAQA  125

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             +  E     ++L++  +   P +  +     +GLL+I ++ATLG +KA  E +G+ II 
Sbjct  126  KSVEEARKRFKVLDEGLKKHFPNKNIR-RNDDVGLLEITIIATLGGYKAHREAIGVDIIG  184

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
                P +++W+E L +L +++E   PH+  V+ ++  +Q
Sbjct  185  PVNTPTLYNWIERLQDLSVIKEVEVPHDTLVTFIQKYRQ  223



>gb|KCW83817.1| hypothetical protein EUGRSUZ_B00691 [Eucalyptus grandis]
Length=258

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 133/195 (68%), Gaps = 1/195 (1%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +V+LHGMW S Y+ +VELALK+KGI +E+VEEDL NKS  LL+ NP+HKKVP+L+H+G+P
Sbjct  4    KVVLHGMWASPYSNRVELALKVKGIEYEFVEEDLTNKSEALLRYNPVHKKVPVLVHDGKP  63

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            I ES+VI+EYIDETW +  PR+LP+D Y++AKVRFWA +  Q         +   G+ + 
Sbjct  64   IAESLVIIEYIDETWTD-GPRLLPQDPYERAKVRFWAGFCQQQLFEAIITVVKTDGEAQE  122

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             A  E    L++LE+      P     ++  S+GLLDI + + LG HK  EEVLG+K +D
Sbjct  123  RAGKEVHEKLKVLEEGIEGNYPEGSLFVNGDSVGLLDIVVHSILGAHKVHEEVLGVKFLD  182

Query  292  EEKHPFIFSWVESLL  248
             EK+P + SW + LL
Sbjct  183  PEKYPRVTSWRQRLL  197



>ref|XP_002866495.1| glutathione S-transferase tau 9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42754.1| glutathione S-transferase tau 9 [Arabidopsis lyrata subsp. lyrata]
Length=234

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 154/224 (69%), Gaps = 6/224 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++VILHG + S Y+K++ELALK+K IP+++V+EDL++KS  LL+ NP+HKK+P+L+HNG+
Sbjct  7    NKVILHGSYASPYSKRIELALKLKSIPYQFVQEDLQSKSQTLLRYNPVHKKIPVLVHNGK  66

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            PI ES+ I+EYIDETW N  P +LPED Y+++KVRFWA YI   L D + K  + + G+ 
Sbjct  67   PISESLFIIEYIDETWRN-GPHLLPEDPYRRSKVRFWANYIQLHLYDVVIKV-VKSEGEE  124

Query  478  KNAAFSEFFVNLEILEKET--RVFCPME-RPKISAQSLGLLDIALVATLGMHKAVEEVLG  308
            +  A +E    L ++EKE    +F   +  P ++ +++ L+DI +   L  +KA EEVLG
Sbjct  125  QERALTEVKEKLRVIEKEGLKEIFSDTDGEPTVTNETMSLVDIVMCTLLSPYKAHEEVLG  184

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            +KIID E  P ++ W+ ++ E  +V++   P+E+ +  L + +Q
Sbjct  185  LKIIDPEIVPGVYGWINAINETRVVKDLSLPYEQVLEILRVFRQ  228



>ref|XP_010045583.1| PREDICTED: glutathione S-transferase U9-like [Eucalyptus grandis]
 gb|KCW83600.1| hypothetical protein EUGRSUZ_B00494 [Eucalyptus grandis]
Length=209

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 139/205 (68%), Gaps = 1/205 (0%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            +RV+LHG   S ++ +V+LALK+KGI +E+VEEDL NKS  LL  NP++KKVP+L+HNG+
Sbjct  6    NRVVLHGNLASLHSARVKLALKVKGIEYEFVEEDLMNKSEALLWYNPVYKKVPVLVHNGK  65

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI+ESIVI+EYIDETW    PR+LP+D Y++AKVRFW  +I Q       + I   G+ +
Sbjct  66   PIIESIVIIEYIDETWKE-GPRLLPQDPYERAKVRFWTGFIQQPLYEATASVIKTDGEAQ  124

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  +    L++LE+      P   P I+  ++GLLDI +   LG  + +E VLG+K +
Sbjct  125  ERAVEKVHEKLKVLEEGIEGKYPGGFPFINGDNMGLLDIVVFLILGHLEVLEAVLGVKFL  184

Query  295  DEEKHPFIFSWVESLLELPLVRETL  221
            D EK+P + SWV++L E P+V+E L
Sbjct  185  DSEKYPSVTSWVKALKEFPVVKEAL  209



>ref|XP_004299371.1| PREDICTED: glutathione S-transferase U10-like [Fragaria vesca 
subsp. vesca]
Length=231

 Score =   192 bits (489),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 149/224 (67%), Gaps = 3/224 (1%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
             ++V L+G+W S + K VE ALK+KGIP+EY+EEDL NKSP LL+ NPIHKKVP+L HNG
Sbjct  4    QNKVSLYGIWASPFVKTVEFALKVKGIPYEYLEEDLWNKSPLLLKFNPIHKKVPVLFHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            + I ES++I+EYIDETW    P++LPE+ Y+++++RFWA Y+HQ+   +    +   G+ 
Sbjct  64   KAIAESLLIIEYIDETWKT-DPQLLPENPYERSQIRFWASYMHQVFWAL-AVVVKTSGEA  121

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQ-SLGLLDIALVATLGMHKAVEEVLGMK  302
            +  A  E F  L +LE+  +   P      + + S  +L+  + A    ++AV EVLG+ 
Sbjct  122  QEKAIKEMFEKLILLEEGLKGLFPDGYVASADEFSKNVLEWIMFAFFSSYEAVHEVLGIN  181

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHG  170
            + D EK P +FS + +L+E+P V+E+  PHEK V+ L+ ++++ 
Sbjct  182  VTDPEKTPLLFSCITALMEIPEVKESCYPHEKMVAFLKSLREYA  225



>ref|XP_002888985.1| hypothetical protein ARALYDRAFT_476598 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65244.1| hypothetical protein ARALYDRAFT_476598 [Arabidopsis lyrata subsp. 
lyrata]
Length=232

 Score =   192 bits (489),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/219 (43%), Positives = 148/219 (68%), Gaps = 2/219 (1%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +V LHG W+S Y+K+VE+ALK+KGI +EYVEEDL+NKS  L+Q NP+HKK+P+L+H+G+P
Sbjct  7    KVTLHGTWISPYSKRVEIALKLKGILYEYVEEDLQNKSESLIQLNPVHKKIPVLVHDGKP  66

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            + ES+VI+EYIDETW N  PR  PED Y++A+VRFW  YI+Q    +    +   G+ + 
Sbjct  67   VAESLVILEYIDETWMN-SPRFFPEDPYERAQVRFWVSYINQQVFEVTGQIMFQEGEAQA  125

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             +  E    +++L++      P +  +     +GLL+I ++AT G+HKA  E +G++II 
Sbjct  126  KSVEEARKRIKVLDEGLEKHFPNKNIR-ENDDVGLLEIIIIATFGVHKAHREEIGVEIIS  184

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
                P +++W+E L +L +V+E   PH+K V+ ++  +Q
Sbjct  185  PVNTPTLYNWIERLQDLSVVKEVEVPHDKLVNLIQNYRQ  223



>emb|CBI31960.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   193 bits (490),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/245 (41%), Positives = 150/245 (61%), Gaps = 10/245 (4%)
 Frame = -3

Query  925  SLLLKYATPTSSNYYTIIASKKMGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEY  746
            S+ L   TP  +N        +  E+      V L G W S Y  ++ELALK+KGIP+EY
Sbjct  5    SISLSPNTPKQTN--------RRRESMEKQSEVKLFGTWASVYCTRIELALKLKGIPYEY  56

Query  745  VEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQ  566
            VEEDL NKS  L+  NP+HKKVP+L+HNG+ I ES+VI+EYIDE WN+  P++LP D Y+
Sbjct  57   VEEDLPNKSDLLIHHNPVHKKVPVLVHNGKAIAESLVILEYIDEHWNH-TPKLLPADPYE  115

Query  565  KAKVRFWAKYIHQLSDTMKKAFISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKIS  386
            +AKVRFWA +  Q         ++++G+ +  A  +    L++ E+      P + P ++
Sbjct  116  RAKVRFWANFYDQKFGPSIYNIMTSKGKEQEKAIEDSLEVLKVFEEGIERDFPAKSPFLN  175

Query  385  AQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
              +LG LDI + ++    KA  EV  + + D EK+P   SWV ++ E PL++ETLPPH++
Sbjct  176  GGTLGFLDIVVGSSSCNFKAFNEVFAV-VFDPEKNPAFCSWVTAMKECPLMKETLPPHDR  234

Query  205  AVSRL  191
             V+++
Sbjct  235  LVAKI  239



>ref|XP_002275338.2| PREDICTED: glutathione S-transferase U10-like [Vitis vinifera]
Length=227

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 140/216 (65%), Gaps = 2/216 (1%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
               V L G W S Y  ++ELALK+KGIP+EYVEEDL NKS  L+  NP+HKKVP+L+HNG
Sbjct  4    QSEVKLFGTWASVYCTRIELALKLKGIPYEYVEEDLPNKSDLLIHHNPVHKKVPVLVHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            + I ES+VI+EYIDE WN+  P++LP D Y++AKVRFWA +  Q         ++++G+ 
Sbjct  64   KAIAESLVILEYIDEHWNH-TPKLLPADPYERAKVRFWANFYDQKFGPSIYNIMTSKGKE  122

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A  +    L++ E+      P + P ++  +LG LDI + ++    KA  EV  + +
Sbjct  123  QEKAIEDSLEVLKVFEEGIERDFPAKSPFLNGGTLGFLDIVVGSSSCNFKAFNEVFAV-V  181

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
             D EK+P   SWV ++ E PL++ETLPPH++ V+++
Sbjct  182  FDPEKNPAFCSWVTAMKECPLMKETLPPHDRLVAKI  217



>ref|XP_007045286.1| Glutathione S-transferase tau 9, putative [Theobroma cacao]
 gb|EOY01118.1| Glutathione S-transferase tau 9, putative [Theobroma cacao]
Length=232

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 147/238 (62%), Gaps = 24/238 (10%)
 Frame = -3

Query  844  HHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLH  665
               ++V+L GMW S Y K+VELALK+KGI +EYVEED+ NKSP + + NP +K++P+L+H
Sbjct  2    EQENKVVLLGMWASPYTKRVELALKLKGISYEYVEEDMFNKSPLVFKYNPAYKRLPVLVH  61

Query  664  NGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ------------LS  521
            NG PIVES++I EYIDETW N  P+ILP D Y++A+VRFWA +IHQ              
Sbjct  62   NGNPIVESLIIYEYIDETWKN-GPQILPADPYKRAQVRFWASFIHQQQFYGYILFPFKTV  120

Query  520  DTMKKAFISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATL  341
            +TM     S  G+ +    ++    +++LE+  +             ++G LD  + +  
Sbjct  121  ETMVTVLKSG-GEAQEKDINKMLEIIKVLEEGVK----------DIYNVGYLDFLICSVF  169

Query  340  GMHKAVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
                A+E+VLG+KI+D EK P ++SWV  L +L LV+ET+  HEK V  L+++++   
Sbjct  170  SFRSAMEKVLGIKILDSEKTPLLYSWVTKLNDLALVKETIASHEKLVEVLKVVREKAL  227



>emb|CAN70457.1| hypothetical protein VITISV_006270 [Vitis vinifera]
Length=228

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 142/216 (66%), Gaps = 2/216 (1%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
               V L G W S Y  ++ELALK+KGIP+EYVE+DL NKS  L+  NP+HKKVP+L+HNG
Sbjct  4    QSEVKLFGTWASGYCTRIELALKLKGIPYEYVEZDLSNKSDLLIHHNPVHKKVPVLVHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            + I ES+VI+EYIDE WN+  P++LPED Y+KAKVRFWA +  Q          +++G+ 
Sbjct  64   KAIAESLVILEYIDEHWNH-TPKLLPEDPYEKAKVRFWANFYDQKFGPSIYNIXTSKGKE  122

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A  +    L + E+      P + P ++   LG LDI + ++   +KA+ EV+G+ +
Sbjct  123  QEKAIEDSREVLXVFEEGIERDFPAKSPFLNGGPLGFLDIVVGSSACNYKAMNEVVGV-V  181

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
            +D +K+P    W+ ++ + PL++ETLPPH++ V+++
Sbjct  182  VDPKKNPAFCYWMTAMKDCPLMKETLPPHDRLVAKM  217



>ref|XP_009106127.1| PREDICTED: glutathione S-transferase U10-like isoform X2 [Brassica 
rapa]
Length=232

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 146/219 (67%), Gaps = 2/219 (1%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +VILHGMW STY+K+VE+ALK+KGI +EYVEEDL+NK+  L+Q NP+ KK+P+L+H+G+P
Sbjct  7    KVILHGMWASTYSKRVEIALKLKGISYEYVEEDLKNKTESLIQLNPVLKKIPLLVHDGKP  66

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            + ++ VI++YIDETW N  PR   ED Y++A+VRFW  YI+Q    +    +  +G+   
Sbjct  67   VADTQVILDYIDETWKN-SPRFYHEDPYERAQVRFWVSYINQQVFDVVARVLYQKGEAAT  125

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             +         +LE+  +   P +  +     +GLLDI ++A+ G+HK   E +G++IID
Sbjct  126  RSVEVARERFRVLEEGLKKHFPNKIIR-ENDDVGLLDITIIASFGVHKVFHESIGVEIID  184

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
                P +++W+E L +LP+++E   PH++ V+ L+  +Q
Sbjct  185  PVNTPTLYNWIEQLQKLPVIKEVEVPHDRLVTFLQKYRQ  223



>ref|XP_002270090.1| PREDICTED: glutathione S-transferase U10 [Vitis vinifera]
Length=228

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 144/213 (68%), Gaps = 2/213 (1%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L G W S Y  +++LALK+KGIP+EYVEEDL NKS  L+  NP+HKKVP+L+HNG+ I
Sbjct  7    VKLFGTWSSGYCTRIKLALKLKGIPYEYVEEDLSNKSDLLIHHNPVHKKVPVLVHNGKAI  66

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
             ES+VI+EYIDE WN+  P++LPED Y+KAKVRFWA +  Q         ++++G+ +  
Sbjct  67   AESLVILEYIDEHWNHT-PKLLPEDPYEKAKVRFWANFYDQKFKPSIYNIMTSKGKEQEK  125

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDE  290
            A  +    L++ E+      P + P ++   LG LDI + ++   +KA+ EV+G+ ++D 
Sbjct  126  AIEDSREVLKVFEEGRERDFPAKSPFLNGGPLGFLDIVVGSSACNYKAMNEVVGV-VVDP  184

Query  289  EKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
            +K+P    W+ ++ + PL++ETLPPH++ V+++
Sbjct  185  KKNPAFCYWMTAMKDCPLMKETLPPHDRLVAKM  217



>ref|XP_010044742.1| PREDICTED: glutathione S-transferase U10-like [Eucalyptus grandis]
 gb|KCW86843.1| hypothetical protein EUGRSUZ_B03440 [Eucalyptus grandis]
Length=227

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 146/224 (65%), Gaps = 6/224 (3%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            M EN      V+L G + S+Y K+VELALK+KGIPF YVEEDL+NKS  LL+ NP+H+KV
Sbjct  1    MDENSE----VVLLGTFGSSYCKRVELALKLKGIPFAYVEEDLKNKSDLLLRSNPVHQKV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+LLH+GRPI ES++I+EYI+E W+N  P++LPED Y ++++RFWA +  Q         
Sbjct  57   PVLLHDGRPICESLLILEYIEEYWSNA-PKLLPEDPYTRSRIRFWADFYDQKVKLATYLV  115

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVE  320
            +  +G++++ A  +    L + E+  +   P + P  + ++L  L I + A+   ++A E
Sbjct  116  LQTKGKDQDKAREDLVELLRVFEEGIQRDFPTKSPFFNGENLSFLGIVVGASACNYQAFE  175

Query  319  EVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLE  188
            E +G KI D E++   FSWV+ L   P + E LPPH+K V++++
Sbjct  176  EAIG-KISDRERNASFFSWVDELKAHPFMSENLPPHDKLVAKMK  218



>emb|CAN75202.1| hypothetical protein VITISV_010665 [Vitis vinifera]
Length=227

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 139/216 (64%), Gaps = 2/216 (1%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
               V L G W S Y  ++ELALK+KGIP+EYVEEDL NKS  L+  NP+HKKVP+L+HNG
Sbjct  4    QSEVKLFGTWASGYCTRIELALKLKGIPYEYVEEDLPNKSDLLIHHNPVHKKVPVLVHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            + I ES+VI+EYIDE WN+  P++LP D Y++AKVRFWA +  Q         ++++G+ 
Sbjct  64   KAIAESLVILEYIDEHWNH-TPKLLPADPYERAKVRFWANFYDQKFGPSIYNIMTSKGKE  122

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A  +    L++ E+      P + P ++  +LG LDI + ++    KA  EV  + +
Sbjct  123  QEKAIEDSLEVLKVFEEGIERDFPAKSPFLNGGTLGFLDIVVGSSSCNFKAFNEVFAV-V  181

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
             D E +P   SWV ++ E PL++ETLPPH++ V+++
Sbjct  182  FDPEXNPAFCSWVTAMKECPLMKETLPPHDRLVAKI  217



>ref|XP_002270113.2| PREDICTED: glutathione S-transferase U10-like [Vitis vinifera]
Length=245

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 149/233 (64%), Gaps = 2/233 (1%)
 Frame = -3

Query  889  NYYTIIASKKMGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQL  710
            N  +  A +   E+      V L G W S Y  +++LALK+KGIP+EYVEEDL NKS  L
Sbjct  4    NTRSTTAIEGGRESMEKQSEVKLFGTWSSGYCTRIKLALKLKGIPYEYVEEDLSNKSDLL  63

Query  709  LQQNPIHKKVPMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH  530
            +  NP+HKKVP+L+HNG+ I ES+VI+EYIDE WN+  P++LPED Y++AKVRFWA +  
Sbjct  64   IHHNPVHKKVPVLVHNGKAIAESLVILEYIDEHWNHT-PKLLPEDPYERAKVRFWANFYD  122

Query  529  QLSDTMKKAFISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALV  350
            Q         ++++G+ +  A  +    L + E+      P + P ++   LG LDI + 
Sbjct  123  QKFKPSIYNIMTSKGKEQEKAIEDSREVLMVFEEGIERDFPAKSPFLNGGPLGFLDIVVG  182

Query  349  ATLGMHKAVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
            ++   +KA+ EV+G+ ++D +K+P    W+ ++ + PL++ETLPPH++ V+++
Sbjct  183  SSACNYKAMNEVVGV-VVDPKKNPAFCYWMAAMKDCPLMKETLPPHDRLVAKM  234



>emb|CBI31961.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 146/221 (66%), Gaps = 2/221 (1%)
 Frame = -3

Query  853  ENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPM  674
            E+      V L G W S Y  +++LALK+KGIP+EYVEEDL NKS  L+  NP+HKKVP+
Sbjct  84   ESMEKQSEVKLFGTWSSGYCTRIKLALKLKGIPYEYVEEDLSNKSDLLIHHNPVHKKVPV  143

Query  673  LLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFIS  494
            L+HNG+ I ES+VI+EYIDE WN+  P++LPED Y+KAKVRFWA +  Q         ++
Sbjct  144  LVHNGKAIAESLVILEYIDEHWNHT-PKLLPEDPYEKAKVRFWANFYDQKFKPSIYNIMT  202

Query  493  ARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEV  314
            ++G+ +  A  +    L++ E+      P + P ++   LG LDI + ++   +KA+ EV
Sbjct  203  SKGKEQEKAIEDSREVLKVFEEGRERDFPAKSPFLNGGPLGFLDIVVGSSACNYKAMNEV  262

Query  313  LGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
            +G+ ++D +K+P    W+ ++ + PL++ETLPPH++ V+++
Sbjct  263  VGV-VVDPKKNPAFCYWMTAMKDCPLMKETLPPHDRLVAKM  302



>ref|XP_009106126.1| PREDICTED: glutathione S-transferase U10-like isoform X1 [Brassica 
rapa]
 emb|CDX96555.1| BnaA07g31660D [Brassica napus]
Length=233

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 149/221 (67%), Gaps = 5/221 (2%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +VILHGMW STY+K+VE+ALK+KGI +EYVEEDL+NK+  L+Q NP+ KK+P+L+H+G+P
Sbjct  7    KVILHGMWASTYSKRVEIALKLKGISYEYVEEDLKNKTESLIQLNPVLKKIPLLVHDGKP  66

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH--QLSDTMKKAFISARGQN  479
            + ++ VI++YIDETW N  PR   ED Y++A+VRFW  YI+  Q+ D + +  +  +G+ 
Sbjct  67   VADTQVILDYIDETWKN-SPRFYHEDPYERAQVRFWVSYINQQQVFDVVARV-LYQKGEA  124

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
               +         +LE+  +   P +  +     +GLLDI ++A+ G+HK   E +G++I
Sbjct  125  ATRSVEVARERFRVLEEGLKKHFPNKIIR-ENDDVGLLDITIIASFGVHKVFHESIGVEI  183

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            ID    P +++W+E L +LP+++E   PH++ V+ L+  +Q
Sbjct  184  IDPVNTPTLYNWIEQLQKLPVIKEVEVPHDRLVTFLQKYRQ  224



>ref|XP_010938837.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=225

 Score =   187 bits (474),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 136/222 (61%), Gaps = 8/222 (4%)
 Frame = -3

Query  823  LHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVE  644
            L+GMW S Y  +V+LAL +KG+ +EY+EEDL NKSP LL  NP+HKKVP+LLH  RPI E
Sbjct  8    LYGMWSSFYVHRVQLALHLKGVEYEYIEEDLSNKSPALLLHNPVHKKVPVLLHGDRPIAE  67

Query  643  SIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF---ISARGQNKN  473
            S +I+EYIDE W   +P ILP D Y++A VRFW    H + +T++ +F   + + G+ + 
Sbjct  68   SSIIIEYIDEFWKA-KP-ILPADPYERAVVRFWC---HFVDNTLRPSFGVILRSSGEGQA  122

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             A   F  NL  LE E R      R     + +G+LDI +   L  + A E+VLGMKIID
Sbjct  123  TAVDNFRQNLMFLETELRDGSFKGRKFFGGERIGILDIVMGCGLYWNSACEDVLGMKIID  182

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            +E  P   SW ES  E   V+E +PP EK V  ++ + Q  F
Sbjct  183  QESFPLFTSWFESFNEAKEVKEVIPPAEKLVEYVKGVLQKMF  224



>ref|XP_006424951.1| hypothetical protein CICLE_v10030408mg, partial [Citrus clementina]
 gb|ESR38191.1| hypothetical protein CICLE_v10030408mg, partial [Citrus clementina]
Length=228

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 133/212 (63%), Gaps = 11/212 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L+G W S +++++ELALK+KG+PFEY+EEDL NKSP+LL+ NP HKK+P+L+HN +
Sbjct  9    EEVKLYGTWSSPFSRRIELALKLKGVPFEYIEEDLSNKSPELLKYNPAHKKIPVLVHNSK  68

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
            PI ES VI+EYIDE WNN  P ILP+D YQ+A  RFW K+I +  L+  MK  F  A G+
Sbjct  69   PIAESQVILEYIDEIWNN-NP-ILPQDPYQRAMARFWGKFIDEKVLATRMKANF--AEGK  124

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             +     EFF  +E LE E        +     +++G +DI  +         +EVLG+ 
Sbjct  125  ERELVTEEFFQQMEFLENELN-----GKDFFGGETIGFVDIVAIVVAIWFPLTQEVLGVD  179

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
               EEK P +F W+  + E+ +V E  PP EK
Sbjct  180  TFTEEKFPVLFKWIRKITEIDVVNECRPPREK  211



>gb|KDO66688.1| hypothetical protein CISIN_1g038634mg [Citrus sinensis]
Length=222

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 135/212 (64%), Gaps = 11/212 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L+G W S +++++ELALK+KG+PFEY+EEDL NKSP+LL+ NP+HKK+P+L+HN +
Sbjct  3    EEVKLYGTWSSPFSRRIELALKLKGVPFEYIEEDLSNKSPELLKYNPVHKKIPVLVHNSK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
            PI ES VI+EYIDE WNN  P ILP+D YQ+A  RFW K+I +  L+  MK  F  A G+
Sbjct  63   PIAESQVILEYIDEIWNN-NP-ILPQDPYQRAMARFWGKFIDEKALATRMKANF--AEGK  118

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             +     EFF  ++ LE E        +     +++G +DI  +         +EVLG++
Sbjct  119  ERELVTEEFFQQMKFLENELN-----GKDFFGGETIGFVDIVAIVVAIWFPLTQEVLGVE  173

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
               EEK P +F W+  + E+ +V E  PP EK
Sbjct  174  TFTEEKFPVLFKWIRKITEIDVVNECRPPREK  205



>ref|XP_006488417.1| PREDICTED: glutathione S-transferase U7-like [Citrus sinensis]
Length=222

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 133/212 (63%), Gaps = 11/212 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L+G W S +++++ELALK+KG+PFEY+EEDL NKSP+LL+ NP HKK+P+L+HN +
Sbjct  3    EEVKLYGTWSSPFSRRIELALKLKGVPFEYIEEDLSNKSPELLKYNPAHKKIPVLVHNSK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
            PI ES VI+EYIDE WNN  P ILP+D YQ+A  RFW K+I +  L+  MK  F  A G+
Sbjct  63   PIAESQVILEYIDEIWNN-NP-ILPQDPYQRAMARFWGKFIDEKVLATRMKANF--AEGK  118

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             +     EFF  +E LE E        +     +++G +DI  +         +EVLG+ 
Sbjct  119  ERELVTEEFFQQMEFLENELN-----GKDFFGGETIGFVDIVAIVVAIWFPLTQEVLGVD  173

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
               EEK P +F W+  + E+ +V E  PP EK
Sbjct  174  TFTEEKFPVLFKWIRKITEIDVVNECRPPREK  205



>ref|XP_008374930.1| PREDICTED: glutathione S-transferase U10-like [Malus domestica]
Length=218

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 143/213 (67%), Gaps = 4/213 (2%)
 Frame = -3

Query  814  MWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESIV  635
            MW S Y K+VELALK+ GIP+EYVE+DL+NKSP LL+ N +H+KVP+L+HNG+PIVES+V
Sbjct  1    MWASPYVKRVELALKLXGIPYEYVEKDLKNKSPSLLKLNLVHQKVPVLVHNGKPIVESLV  60

Query  634  IVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNAAFSEF  455
            I+EYIDETW   +  +LP+D Y++++V  WA ++ Q       + +   GQ +  A  E 
Sbjct  61   ILEYIDETW---KTGLLPQDPYKRSQVHLWAGFMQQQVFESMVSVLKTSGQAQEKAIKEV  117

Query  454  FVNLEILEKETRVFCPMERPK-ISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEKHP  278
                 +LE+  + F P   PK    +++GLL++ ++A L +++A EEV+G K+ID +  P
Sbjct  118  SEKXNLLEEGLKGFYPNGFPKSFDPKNVGLLEVVILAHLRVYEAREEVIGFKVIDLQITP  177

Query  277  FIFSWVESLLELPLVRETLPPHEKAVSRLELIK  179
             I+S + ++ E+P V+E   PHEK V+ L+  +
Sbjct  178  LIYSCIRAMTEIPEVKEVSNPHEKVVAFLKFFR  210



>ref|XP_010678535.1| PREDICTED: glutathione S-transferase U10-like [Beta vulgaris 
subsp. vulgaris]
Length=230

 Score =   184 bits (468),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/219 (43%), Positives = 135/219 (62%), Gaps = 3/219 (1%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V LHGMW S +A + +LALKIKGI FE++EEDL NKS  LLQ NP+HKKVP+L+HNG PI
Sbjct  7    VKLHGMWASPFAMRAKLALKIKGIDFEHIEEDLANKSELLLQYNPVHKKVPVLVHNGMPI  66

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
             ES+VI+EYIDETW +  P +LP+D Y +AK+RFWA Y   + + M K  I   G+ +  
Sbjct  67   AESLVILEYIDETWTD-PPHLLPQDPYLRAKLRFWAAYFQPVFELMSKTLI-LEGEAQKN  124

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQ-SLGLLDIALVATLGMHKAVEEVLGMKIID  293
              +E    L++ E+  +   P   P  S   + G LDI   +  G H+  ++  G  +I 
Sbjct  125  MLNELLEKLDVAEEGIKEIYPNSVPSFSEDVNPGYLDIVFYSLFGTHEVAKDFFGRVLIT  184

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
             E++P + SW+ ++ ++P V E  PP    +  L+ I+Q
Sbjct  185  PERYPLLTSWIMAMKQVPQVIEVTPPSANLLGFLQFIRQ  223



>ref|XP_006484732.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=221

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 144/213 (68%), Gaps = 9/213 (4%)
 Frame = -3

Query  811  WMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESIVI  632
            W S +A +V  ALK+KG+ F+ +EEDL NKSP LLQ NP+HKK+P+L+HNG+PI ES+VI
Sbjct  11   WSSPFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQYNPVHKKIPVLVHNGKPISESLVI  70

Query  631  VEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQNKNAAFSEF  455
            +EY+DETW      +LP+  Y +A+ RFWAK+   ++S +M   FI  +G+ +  AF + 
Sbjct  71   LEYVDETWRQY--PLLPDGPYDRARARFWAKFSDDKVSPSMWGVFIK-QGKEREEAFDQV  127

Query  454  FVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEKHPF  275
            F NL+ LE+E +      +     + +G  D+AL         +EE++G+KI++EEK P 
Sbjct  128  FENLKFLEEELK-----GKKFFGGEKIGFADLALGWIAERVCVLEEIIGVKIVEEEKFPL  182

Query  274  IFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            + +W++  +++P+++E+LPPHEK V+++  I++
Sbjct  183  VSAWMQEFVKVPIIKESLPPHEKLVTKIRGIRE  215



>gb|KDO66687.1| hypothetical protein CISIN_1g041211mg [Citrus sinensis]
Length=222

 Score =   182 bits (461),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 137/212 (65%), Gaps = 11/212 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L+G W+S +++++ELALK+KG+PFEY+EEDL NKSP+LL+ NP+HKK+P+L+HNG+
Sbjct  3    EEVKLYGTWVSPFSRRIELALKLKGVPFEYMEEDLSNKSPELLKYNPVHKKIPVLVHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
            PI ES+VI+EYIDETW N  P ILP+D YQ+A VRFWAK+I +  L+   K  F    G+
Sbjct  63   PIAESLVILEYIDETWKN-NP-ILPQDPYQRAMVRFWAKFIDEKILATGWKANF--GEGK  118

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             +  A  EF   ++ LE E        +     +++G LDI            ++ LG++
Sbjct  119  EREVAIEEFAEQMKFLENELN-----GKDFFEGETIGFLDIVANLIAFWFPVRQDALGIE  173

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
               +EK P +F W+ ++ ++ LV E  PP EK
Sbjct  174  AFTQEKFPVLFKWIANITKIDLVNECRPPREK  205



>ref|XP_010678534.1| PREDICTED: glutathione S-transferase U10-like [Beta vulgaris 
subsp. vulgaris]
Length=230

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 135/219 (62%), Gaps = 3/219 (1%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V LHGMW    A + +LALKIKGI +E++EEDL NKS  LLQ NP+HKKVP+L+H+G PI
Sbjct  7    VKLHGMWACPSAMRAKLALKIKGIDYEHIEEDLANKSELLLQYNPVHKKVPVLVHDGLPI  66

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
             ES+VI+EYIDETW N  P +LP+D Y +AK+RFWA Y   + + M+K  I   G+ +  
Sbjct  67   AESLVIIEYIDETWTN-PPHLLPQDPYLRAKLRFWAAYFQLVFEMMRKTLI-LEGEAQKN  124

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQ-SLGLLDIALVATLGMHKAVEEVLGMKIID  293
              +E    L++ E+  +   P   P  S   + G LDI   +  G H+  ++ LG  +I 
Sbjct  125  MLNELLEKLDVAEEGIKEIYPNSVPSFSEDVNPGYLDIVFYSLFGTHEVAKDFLGGVLIT  184

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
             E++P + SW+ ++ ++P V E  PP  K +  L+  +Q
Sbjct  185  PERYPLLTSWIMAMKQVPQVIEVTPPSAKLLGFLQYFRQ  223



>ref|XP_010044745.1| PREDICTED: glutathione S-transferase U10-like [Eucalyptus grandis]
 gb|KCW86844.1| hypothetical protein EUGRSUZ_B03441 [Eucalyptus grandis]
Length=218

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/224 (41%), Positives = 143/224 (64%), Gaps = 7/224 (3%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            M EN      V+L G + S+ +K+VELALK+KGIPF YVEEDL+NKS  LL+ NP+H+KV
Sbjct  1    MDENSE----VVLLGTFGSS-SKRVELALKLKGIPFAYVEEDLKNKSDLLLRSNPVHQKV  55

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+LLH+GRPI ES++I+EYI+E W+N  P++LPED Y ++++RFWA +  Q         
Sbjct  56   PVLLHDGRPICESLLILEYIEEYWSNA-PKLLPEDPYTRSRIRFWADFYDQKVKRATYLV  114

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVE  320
            +  +G++++ A  +    L + E+  +   P + P  + ++L  L I +  +   ++A E
Sbjct  115  LQTKGKDQDKAREDLVEQLRVFEEGIQRDFPSKSPFFNGENLSFLGIVVGVSACNYQAFE  174

Query  319  EVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLE  188
            E  G KI D E++   FSW + L   P + E LPPH+K V++++
Sbjct  175  EATG-KISDRERNALFFSWADELKAHPFMSENLPPHDKLVAKMK  217



>gb|ACC86120.1| glutathione S-transferase [Knorringia sibirica]
Length=215

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 133/213 (62%), Gaps = 11/213 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            DRV+L+GMW S + ++VEL LK+KGI +E+VEEDL NKS  LL  NP+HKKVP+LLHN +
Sbjct  6    DRVMLYGMWASPFVRRVELVLKVKGISYEHVEEDLTNKSQDLLLYNPVHKKVPVLLHNDK  65

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
                   I+EYI++TW +  P + P D Y++AKVRFWA +I Q      +  +  RG+  
Sbjct  66   -------IIEYIEDTWKS-SPSVFPTDPYERAKVRFWANFIDQKILEQLRTVLIKRGEED  117

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
                 E   NLE LE  T    P  +P +  +S+ LLDI +    G+ +++EE L +KI+
Sbjct  118  IKEMRE---NLEKLEANTNDIFPSGKPPVVGESMSLLDILMCTYSGVIESLEEALEVKIM  174

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVS  197
            D  K+P   +W+++   L +VRET P HEK VS
Sbjct  175  DPNKYPLTITWMKAFDSLEIVRETTPSHEKLVS  207



>ref|XP_007037333.1| Glutathione S-transferase TAU 10, putative [Theobroma cacao]
 gb|EOY21834.1| Glutathione S-transferase TAU 10, putative [Theobroma cacao]
Length=236

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 130/194 (67%), Gaps = 5/194 (3%)
 Frame = -3

Query  742  EEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQK  563
            EEDL NKS  LL+ NP+HKKVP+L+H G PI ES VI+EYIDETW  + PR+LP+D YQ+
Sbjct  39   EEDLSNKSQVLLRHNPVHKKVPVLVHKGNPIAESCVILEYIDETWK-VAPRLLPDDPYQR  97

Query  562  AKVRFWAKYIHQ-LSDTMKKAFIS-ARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKI  389
            A+VRFWA +I Q L + +     S A  Q KN    E    +++ E+  + F       I
Sbjct  98   AQVRFWASFIQQQLFEAIGWIITSNAEAQEKNTV--ELLQQMDVFEETMKEFYAEGIQGI  155

Query  388  SAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHE  209
               +LGLLDI + AT G +KA+EE  G+KI+D E+HPFI+SWV +  E+P+++E  PPHE
Sbjct  156  RNDNLGLLDILVCATFGPYKALEEAAGVKILDPERHPFIYSWVTNSNEVPVMKEATPPHE  215

Query  208  KAVSRLELIKQHGF  167
            K ++ L++++Q+  
Sbjct  216  KLLALLQIVRQNAL  229



>ref|XP_002268774.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
 emb|CBI26443.3| unnamed protein product [Vitis vinifera]
Length=236

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 144/229 (63%), Gaps = 16/229 (7%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              ++V L G W S + K+VE ALK KGI +EYVEEDL NKS  LL  NP++KKVP+LLHN
Sbjct  8    QEEQVKLLGSWYSPFVKRVEWALKFKGIEYEYVEEDLINKSSLLLTSNPVYKKVPVLLHN  67

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARG  485
            G PI +++VI+EYIDETW +  P ILP+D +++AK RFWA +I  +L+D ++ A I+ +G
Sbjct  68   GNPIAQTLVIIEYIDETWKH-NP-ILPQDPHERAKARFWADFIEVKLTDVVRTALIT-QG  124

Query  484  QNKNAAFSEFFVNLEILEKET------RVFCPMERPKISAQSLGLLDIALVATLGMHKAV  323
            + +  A  E    +E+LE E       RVF            +G +DI L    G  + +
Sbjct  125  EQQEKAVKEAKEAMEVLEGEAAKLKGERVFFG------GNNGIGYVDIVLGLMCGWVEVI  178

Query  322  EEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            EEV G K++D +K P I  WV + +ELPL++ TL P EK +   ++I+Q
Sbjct  179  EEVGGFKLLDPQKQPHIHKWVANFVELPLIKPTLLPKEKLMIHFQMIRQ  227



>dbj|BAJ90384.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 146/224 (65%), Gaps = 4/224 (2%)
 Frame = -3

Query  844  HHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLH  665
            H  ++V L GMW S Y  KV+ AL IKG+ +EY+EEDLRNKS  LL+ NP+HKKVP+LL+
Sbjct  3    HQEEKVKLFGMWASPYVLKVKWALSIKGVEYEYLEEDLRNKSDDLLEHNPVHKKVPVLLY  62

Query  664  NGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISAR  488
            +G+P+ ES VIVE++DE W++   RILP D Y++A  RFW +++H +LS  + K F +A 
Sbjct  63   HGKPVAESDVIVEFVDEAWSHRGGRILPGDPYERAMARFWVRFVHDKLSPPIWKWFTTAP  122

Query  487  GQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLG  308
            G+++ AA       L++LE+   V     +   + +S+GL+D++L A   +    EE++G
Sbjct  123  GEDQEAARGASVEQLQVLEELLAVGG---KEFFAGESVGLVDLSLGAMAYVVPMYEEIVG  179

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            ++++ EE+ P + +W+   L  P V++  PP E+ + R   +++
Sbjct  180  VRLVTEERFPSLSAWMGRFLGSPPVKDHPPPVERLIPRYRAMRE  223



>ref|XP_007016281.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
 gb|EOY33900.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
Length=261

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 144/235 (61%), Gaps = 13/235 (6%)
 Frame = -3

Query  868  SKKMGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIH  689
            + K+ +     D V L GMW S Y+++VELALK+KGIP+EYVEEDL +KS  LL+ NP+H
Sbjct  31   TSKLEQTMADEDEVKLFGMWASPYSRRVELALKLKGIPYEYVEEDLSSKSCLLLKYNPVH  90

Query  688  KKVPMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ-LSDTM  512
            +K+P+L+HNG+PI ES+VI+EYIDETW N  P ILP+D Y +A  RFWAK+I + L  T 
Sbjct  91   QKIPVLVHNGKPIAESLVILEYIDETWTN-NP-ILPQDPYDRAMARFWAKFIDEKLLMTT  148

Query  511  KKAFISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMH  332
            +KA + A G+ K  A  E    L++LE E +      +   S  S+G LDI     +   
Sbjct  149  RKASV-ASGKEKEQAIEEITEQLKLLESELQ-----GKEYFSGPSIGYLDIVASVLVFWF  202

Query  331  KAVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAV----SRLELIK  179
              ++E LG+ +  +EK P IF W+  + E+  V     P EK +    +RLE  K
Sbjct  203  GNLQEALGVDMFTKEKFPIIFGWIGKVAEIDAVEVCRIPKEKHLEYIRTRLEAFK  257



>ref|XP_010271919.1| PREDICTED: glutathione transferase GST 23-like [Nelumbo nucifera]
Length=223

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 135/220 (61%), Gaps = 7/220 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D+V L GMW S  + ++E ALKIKGI +EY++EDL NKS +LL  NP+HKKVP+L+H G+
Sbjct  4    DQVTLLGMWASPLSLRIEWALKIKGIHYEYIDEDLDNKSQRLLTCNPVHKKVPVLVHAGK  63

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+VI+EYIDETW++   RILPED Y++A  RFWAK+      T      +  GQ +
Sbjct  64   PIAESLVILEYIDETWSH--SRILPEDPYERAMARFWAKFADDKCWTTIHGVFTKTGQEQ  121

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A SE   +L+ LEK      P E       ++G LDI           +EE+ G+ ++
Sbjct  122  ENAKSEAIESLKTLEK-----IPRESKFFGGDAIGFLDIVFGWMAYWVPLLEEITGIILV  176

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
             E+  P +  W ++ L++PLV+E LPP EK +  L+  +Q
Sbjct  177  GEDSLPSLKEWFKNFLDVPLVKELLPPREKLLHHLQTFRQ  216



>ref|XP_006437359.1| hypothetical protein CICLE_v10032702mg [Citrus clementina]
 gb|ESR50599.1| hypothetical protein CICLE_v10032702mg [Citrus clementina]
Length=221

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 147/221 (67%), Gaps = 9/221 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L   W S +A +V  ALK+KG+ F+ +EEDL NKSP LLQ NP+HKK+P+L+HNG+
Sbjct  3    EEVKLLTTWSSPFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQYNPVHKKIPVLVHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQN  479
            PI ES+VI+EY+DETW    P +LP+  Y +A+ RFWAK+   ++S ++   FI  +G+ 
Sbjct  63   PISESLVILEYVDETWRQ-NP-LLPDGPYDRARARFWAKFSDDKVSPSIWGVFIK-QGKE  119

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  AF + F NL+ LE+E +      +     + +G  D+AL         +EE++G+KI
Sbjct  120  REEAFDQVFENLKFLEEELK-----GKKFFGGEKIGFADLALGWIAERVCVLEEIIGVKI  174

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            ++EEK P + +W++  +++P+++E+ PPHEK V+++  I++
Sbjct  175  VEEEKFPLVSAWMQEFVKVPIIKESCPPHEKLVTKIRGIRE  215



>ref|XP_002266900.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=236

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 137/229 (60%), Gaps = 3/229 (1%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            M       ++V L G+W+S + K+VE ALK KGI +EYVEEDL NKS  LL  NP+H+KV
Sbjct  1    MASGAMQEEQVKLLGIWVSPFVKRVEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKV  60

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+LLHNG PIVES+VI+EYIDE W   +  ILP+D +++AK RFWA +I Q      +  
Sbjct  61   PVLLHNGNPIVESLVIIEYIDENWK--QNPILPQDPHERAKARFWANFIEQKITEATRTA  118

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQS-LGLLDIALVATLGMHKAV  323
            +   G+ +     E    +E+LE E       +      ++ LG +DI L       + +
Sbjct  119  LVTEGEQQEKVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVI  178

Query  322  EEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            EEV G K++D +K P I  W+ + +E+PL++ TL P EK V   ++++Q
Sbjct  179  EEVGGFKVLDPQKQPHIHKWMANFVEVPLIKPTLLPKEKMVVYFQMVRQ  227



>gb|EYU28750.1| hypothetical protein MIMGU_mgv1a019211mg [Erythranthe guttata]
Length=225

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 133/212 (63%), Gaps = 14/212 (7%)
 Frame = -3

Query  811  WMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESIVI  632
            W S+Y  +VELALK+KGI +E +EEDLRNKS  LL+QNP+HKKVP+LLHNG  I ES++I
Sbjct  13   WFSSYCTRVELALKVKGISYECIEEDLRNKSDLLLKQNPVHKKVPVLLHNGNAISESLII  72

Query  631  VEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNAAFSEFF  452
            +EYIDE   +  P +LP D YQ+A+VRFWA Y  Q   +     +   G  ++ A  EF 
Sbjct  73   LEYIDECLKD-GPTLLPCDPYQRAQVRFWANYFDQKYMSGMIKILVTSGSERDNAMEEFC  131

Query  451  VNLEILEKE-----TRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEE  287
              L + E+      + + C       S  S+G L+I + +T   ++A  E +G+    E+
Sbjct  132  EMLRVFEEGISKHFSTLLC-------SKDSIGFLEIVVGSTGCNYRAFFEAVGVDYPFEK  184

Query  286  KHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
             H + FSW++ L E PL++ETLPPHEK V+++
Sbjct  185  NHKY-FSWIDGLRECPLMKETLPPHEKLVAKI  215



>emb|CBI26437.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 136/223 (61%), Gaps = 3/223 (1%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              ++V L G+W+S + K+VE ALK KGI +EYVEEDL NKS  LL  NP+H+KVP+LLHN
Sbjct  2    QEEQVKLLGIWVSPFVKRVEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHN  61

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            G PIVES+VI+EYIDE W   +  ILP+D +++AK RFWA +I Q      +  +   G+
Sbjct  62   GNPIVESLVIIEYIDENWK--QNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGE  119

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQS-LGLLDIALVATLGMHKAVEEVLGM  305
             +     E    +E+LE E       +      ++ LG +DI L       + +EEV G 
Sbjct  120  QQEKVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEEVGGF  179

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            K++D +K P I  W+ + +E+PL++ TL P EK V   ++++Q
Sbjct  180  KVLDPQKQPHIHKWMANFVEVPLIKPTLLPKEKMVVYFQMVRQ  222



>ref|XP_008446345.1| PREDICTED: glutathione S-transferase U10-like [Cucumis melo]
Length=229

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 137/214 (64%), Gaps = 2/214 (1%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V+L G W S+Y  ++ LALKIKGI FEY+EEDL NKS  LL+ NP+H+KVP+L+H G PI
Sbjct  8    VVLFGTWYSSYCTRIVLALKIKGIDFEYIEEDLANKSELLLKYNPVHQKVPVLVHKGNPI  67

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
             ES VI+EYI+E WN+  P+ILP+  Y++AK+RFWA++  Q         + + G+ +  
Sbjct  68   AESFVILEYIEEQWNH-HPKILPDHPYERAKLRFWAQFYDQKIILGALPILKSIGEERER  126

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDE  290
            A  E    + + E   +   P + P    +SLGLLDI +      + A+ EV+G  +ID 
Sbjct  127  AVEEQSKLIRVFEDGMKKDFPGKFPFYHGKSLGLLDIVVGPNACNYLALFEVVG-DVIDS  185

Query  289  EKHPFIFSWVESLLELPLVRETLPPHEKAVSRLE  188
            +++P  F+WV++L E PL++E LP H K V +L+
Sbjct  186  KRNPDFFTWVDALKEHPLIKEALPAHHKMVQKLK  219



>ref|XP_002266994.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=236

 Score =   177 bits (448),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 136/229 (59%), Gaps = 3/229 (1%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            M       ++V L G+W S + +++E ALK KGI +EYVEEDL NKS  LL  NP+H+KV
Sbjct  1    MASGAMQEEQVKLLGIWFSPFVRRIEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKV  60

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+LLHNG PIVES+VI+EYIDE W   +  ILP+D +++AK RFWA +I Q      +  
Sbjct  61   PVLLHNGNPIVESLVIIEYIDENWK--QNPILPQDPHERAKARFWANFIEQKITEATRTA  118

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQS-LGLLDIALVATLGMHKAV  323
            +   G+ +     E    +E+LE E       +      ++ LG +DI L       + +
Sbjct  119  LVTEGEQQKKVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVI  178

Query  322  EEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            EEV G K++D +K P I  W+ + +E+PL++ TL P EK V   ++++Q
Sbjct  179  EEVGGFKVLDPQKQPHIHKWMANFVEVPLIKPTLLPKEKMVVCFQMVRQ  227



>ref|XP_010086555.1| Glutathione S-transferase U10 [Morus notabilis]
 gb|EXB20254.1| Glutathione S-transferase U10 [Morus notabilis]
Length=229

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 135/218 (62%), Gaps = 3/218 (1%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
            +  V++ G W ++ + +VELALK+KGIP+EYVEEDL NKS  LL  NP+HKKVP+L+H G
Sbjct  6    NSEVVVFGTWANSISGRVELALKLKGIPYEYVEEDLANKSELLLHYNPVHKKVPVLVHKG  65

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            RPI+ES+VI+EYIDE W    P+ILP++ +++AK+RFWA +  Q           ++GQ 
Sbjct  66   RPILESLVILEYIDENW-TFPPKILPQEPFERAKIRFWANFYDQKIIPAIYTIGGSKGQE  124

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQ-SLGLLDIALVATLGMHKAVEEVLGMK  302
            +  A  E    L + E+  +   P + P      ++  L I + +    + A  E + M 
Sbjct  125  REKAIEELSELLGVFEEGIQKDFPGKSPFFDDDGNVSFLGIVVNSYACSYPAFHEAVAM-  183

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLE  188
            II  EK+P   SWV SL E PL++ETLP H++ V RL+
Sbjct  184  IISSEKNPTFLSWVNSLRECPLIKETLPDHDRLVDRLK  221



>ref|XP_010666893.1| PREDICTED: glutathione S-transferase U9-like [Beta vulgaris subsp. 
vulgaris]
Length=229

 Score =   176 bits (447),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 139/220 (63%), Gaps = 3/220 (1%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V LHGMW S + ++V +ALKIKGIP+EY EEDL+NKS  LLQ NP+ K VP+L+H G+PI
Sbjct  3    VKLHGMWASPWVRRVTIALKIKGIPYEYFEEDLKNKSQLLLQYNPVKKLVPVLVHEGKPI  62

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQNKN  473
             ES++I+EYIDETW N  P++ P D Y++AKVRFWA +I+ QL + ++    S     ++
Sbjct  63   PESLIILEYIDETWKN-SPKLFPHDPYKRAKVRFWADFINLQLFEKLRDVVKSQNDYEED  121

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
                E   ++  LE   +          + +++ +LDI ++  L +   VEE + +K I 
Sbjct  122  KIIKEIQESMNKLEANVKDLYSTATHS-NRETMEILDILMITLLPIINGVEEAISVKFIH  180

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQH  173
             E  P +FSW++S  ++PLV +T P HE+ V  L  ++Q+
Sbjct  181  PENFPLVFSWMKSHDDVPLVEDTAPNHEQLVKFLRKLRQY  220



>emb|CAN73419.1| hypothetical protein VITISV_027346 [Vitis vinifera]
Length=236

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 134/229 (59%), Gaps = 3/229 (1%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            M       ++V L G+W S + +++E ALK KGI +EYVEEDL NKS  LL  NP+H KV
Sbjct  1    MASGAMQEEQVKLLGIWFSPFVRRIEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHXKV  60

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+LLHNG PIVES+VI+EYIDE W   +  ILP+D +++AK RFWA +I Q      +  
Sbjct  61   PVLLHNGNPIVESLVIIEYIDENWK--QNPILPQDPHERAKARFWANFIEQKITEATRTA  118

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQ-SLGLLDIALVATLGMHKAV  323
            +   G+ +     E    +E+LE E       +      +  LG +DI L       + +
Sbjct  119  LVTEGEQQXKVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVI  178

Query  322  EEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            EEV G K++D +K P I  W+ + +E+PL++ TL P EK V   ++++Q
Sbjct  179  EEVGGFKVLDPQKQPHIHKWMANFVEVPLIKPTLLPKEKMVVXFQMVRQ  227



>emb|CAN62219.1| hypothetical protein VITISV_042912 [Vitis vinifera]
Length=221

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 139/211 (66%), Gaps = 9/211 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D+V L G+W S + ++VE+AL++KG+ FEYVEEDL NKSP LL+ NP+HKK+P+LLHNG 
Sbjct  3    DQVQLFGVWGSFFGRRVEVALRLKGVQFEYVEEDLYNKSPSLLKYNPVHKKIPVLLHNGN  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ-LSDTMKKAFISARGQN  479
            P+ ES+VI+EYIDETW +  P I P+D Y++A+ RFWAK+I + L   ++KA  S   + 
Sbjct  63   PLAESLVILEYIDETWKH-NP-IFPKDPYERARARFWAKFIDEKLWPVVRKALGSKEEKE  120

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A  E   +LE LE E +     E+     +S G LDIA +  + +  A +E LG++ 
Sbjct  121  QREAIGETHEHLETLESELK-----EKKFFGGESRGYLDIAAMVIIWLGIA-QEALGVEF  174

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
            I +EK P +  W + L+E  + +E +PP EK
Sbjct  175  IPKEKFPRLHEWQQRLVEDAVFKECVPPREK  205



>gb|AAG41204.1| glutathione transferase [Suaeda maritima]
Length=235

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 139/221 (63%), Gaps = 4/221 (2%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L+G W S Y  +V+LALKIKGI ++Y EEDL NKS  LLQ NP++K+VP+L+HNG PI
Sbjct  7    VKLYGTWSSPYVLRVKLALKIKGIEYDYFEEDLANKSELLLQYNPVYKRVPVLVHNGLPI  66

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFI-SARGQNKN  473
             ES VI+EYIDETW +  P +LP+D Y +AK RFWA Y+ Q+++    + +  ++G++  
Sbjct  67   SESSVILEYIDETWTD-PPHLLPKDPYLRAKHRFWAAYLQQVAEMFGTSLVLKSQGKDIE  125

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSL--GLLDIALVATLGMHKAVEEVLGMKI  299
               +E++  +++ E+  R   P         ++  G LDI L + +G   A EE+ G K 
Sbjct  126  DVVNEYWNKMDVAEELIRETFPYNEIPCFKDTIKPGYLDIILYSLVGTSDASEELFGFKP  185

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
               E++P + SW ++L E+P V+E  PP +K +  L  I+Q
Sbjct  186  FIPERYPLLASWTKALSEVPEVKEVTPPKDKLIELLRTIRQ  226



>ref|XP_002520472.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41885.1| glutathione s-transferase, putative [Ricinus communis]
Length=222

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 133/210 (63%), Gaps = 7/210 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W S ++ ++ELALK+KGI +EY+EEDL NKS  LL  NP+HKK+P+L+HNG+
Sbjct  3    EEVKLLGTWASPFSHRIELALKLKGIQYEYIEEDLSNKSTLLLSTNPVHKKIPVLIHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+VI+EYI+ETW N  P ILP+D Y +A  RFWAK++ +        F  A+ + K
Sbjct  63   PIAESLVILEYIEETWPN-NP-ILPKDPYNRALARFWAKFVEEKILQTASKFRVAKEEEK  120

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
               + E    L++LE E R     ER     +S+G +DI     L   +  +EVL + +I
Sbjct  121  KQIYEELDQQLKVLENELR-----EREFSGGESIGFVDIVAFFILYWFQVRQEVLQLSLI  175

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEK  206
             +EK P +  +V+ LLE+ +V+E LPP EK
Sbjct  176  SKEKFPVLCKYVDKLLEIDMVKECLPPKEK  205



>ref|XP_010678527.1| PREDICTED: glutathione S-transferase U9-like [Beta vulgaris subsp. 
vulgaris]
Length=265

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 150/257 (58%), Gaps = 10/257 (4%)
 Frame = -3

Query  925  SLLLKYATPTSSNYYTIIAS--KKMGEN----HHHHDRVILHGMWMSTYAKKVELALKIK  764
            +L +K+   T+  YY   A+  +K GE+          V L+GMW S Y  +V+LALKIK
Sbjct  6    TLCVKHFNTTTHKYYIRPAASCEKRGEDPLKVMGEESSVKLYGMWASPYVLRVKLALKIK  65

Query  763  GIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESIVIVEYIDETWNNLRPRIL  584
            GI +EY+EEDL NKS  LL+ NP++KKVP+L+HNG PIVES +I+EYIDETWN   P +L
Sbjct  66   GIEYEYIEEDLANKSDLLLRYNPVYKKVPVLVHNGLPIVESSLIIEYIDETWNE-PPYLL  124

Query  583  PEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNAAFSEFFVNLEILEK-ETRVFCP  407
            P+D Y +A+ RFW  Y +Q+S+ + K    + G+  +    E    L+++E+   +   P
Sbjct  125  PKDPYLRARHRFWVAYFNQVSEFIFKTL--SEGKAADDLLKECLNKLDVIEELLMKEMFP  182

Query  406  MERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRE  227
               P       G LDI      G+   VEE  G+K+    K+  + SW+ ++ E+P V+E
Sbjct  183  NGAPSFQDMKPGYLDIMFYTYFGISDLVEECFGIKLFTSGKYLLLTSWINAISEVPEVKE  242

Query  226  TLPPHEKAVSRLELIKQ  176
              PP  K +  L+++ Q
Sbjct  243  LSPPKPKILQHLKVVLQ  259



>gb|KDP38795.1| hypothetical protein JCGZ_05131 [Jatropha curcas]
Length=228

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 142/219 (65%), Gaps = 8/219 (4%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L G W S +A +VE+ALK+KGIP+E++EEDL NKSP LL+ NPI+K++P+L+ N RPI
Sbjct  8    VKLLGGWFSPFAHRVEVALKLKGIPYEFLEEDLANKSPLLLKYNPIYKRIPVLVQNERPI  67

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQNKN  473
            VES +I+EYIDETW +  P +LP+D YQKA  RFWA +I  +L++ +++  I+  G+ + 
Sbjct  68   VESQLILEYIDETWKH-SPLLLPQDPYQKAMARFWANFIDDKLTEAVRRV-IATEGEAQQ  125

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
                +     E+LE+E +      +     +++G +DI L       + VEE   +KI +
Sbjct  126  KEVKQAIEAFEVLEREIK-----GKKFFGGETVGFVDIVLGWITIWLEVVEETTCVKIYN  180

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
             EK+P I  W+++ L+LP+VRET+P H+  +     I+Q
Sbjct  181  PEKYPSIHKWIQNFLQLPVVRETMPQHDMLIQYFVTIRQ  219



>ref|XP_010279540.1| PREDICTED: probable glutathione S-transferase isoform X1 [Nelumbo 
nucifera]
Length=227

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 133/212 (63%), Gaps = 10/212 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W+S ++ +VELALK+KG+ +EY++EDL NKSP LL+ NPIHKKVP+LLHNG+
Sbjct  3    EEVKLIGAWISPFSLRVELALKLKGVQYEYIDEDLSNKSPLLLKYNPIHKKVPVLLHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
            PI ES VI+EYIDETW      +LPED Y++A  RFW K+I +  +    K  +I  R Q
Sbjct  63   PIAESTVILEYIDETWKGY--HLLPEDPYERAMTRFWVKFIDEKCIEAIWKACWIEERKQ  120

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             K  A  E    L+ILE E +      R   +  ++G +DIA +        ++EV+G+ 
Sbjct  121  EK--AIEEAKETLKILENELK----KGRKFFAGDNIGFVDIAAIFIAFWVGVLQEVVGIS  174

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
            ++DEEK P +  W+E  +   +V E LPP +K
Sbjct  175  LMDEEKFPVLHKWIEEFINCDVVGENLPPRDK  206



>ref|XP_009382786.1| PREDICTED: glutathione S-transferase U10-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 141/234 (60%), Gaps = 10/234 (4%)
 Frame = -3

Query  871  ASKKMGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPI  692
            +   MGE      +V L+G W+S Y   V LALK+KG+ +EYVEEDL NKS  LLQ NP+
Sbjct  10   SDTDMGEAK----QVKLYGFWLSPYCTLVHLALKLKGVAYEYVEEDLTNKSATLLQLNPV  65

Query  691  HKKVPMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTM  512
            H+KVP+L+ +G+P+ ES VI+EYIDETW    P  LP D Y +A+VRFW  + +Q     
Sbjct  66   HQKVPVLVVDGKPVAESRVILEYIDETWAE--PSFLPSDPYSRARVRFWVDFFYQRMVPP  123

Query  511  KKAFISARGQNKNAAFSEFFVNLEILEKETRVFCPMER-PKISAQSLGLLDIALVATLGM  335
              A I ++G+    A  EF   L ILEK      P ++ P I   S GLLDI + A    
Sbjct  124  SYAIIRSQGEELEKATKEFIEVLRILEKGIMEDFPRKKGPFIHGSSPGLLDIIVGAGNPG  183

Query  334  HKAVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQH  173
             KA+EEV  +K+ +EE  P ++S+V + L L LV+ T+ P+++    LE IK+ 
Sbjct  184  TKAIEEVADVKLFNEEMTPQLYSYVHAFLSLDLVKNTVVPYDQV---LEAIKER  234



>ref|XP_008221732.1| PREDICTED: glutathione S-transferase U10-like [Prunus mume]
Length=223

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 138/219 (63%), Gaps = 2/219 (1%)
 Frame = -3

Query  844  HHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLH  665
            H    V+L G W S+++ +V++ALK+KGI +EYVEEDL NKS  LL  NP+HK+VP+L+H
Sbjct  3    HKQSEVVLFGTWSSSFSGRVKIALKLKGIQYEYVEEDLVNKSQMLLSYNPVHKQVPVLVH  62

Query  664  NGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARG  485
             G+PI ES VI+EYIDE W+   P +LP+D Y++AK+RFWAKY  +       + I ++G
Sbjct  63   RGKPIAESRVILEYIDENWSKT-PNLLPKDPYERAKIRFWAKYYDEKIIPGIYSIIRSKG  121

Query  484  QNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
            +++  A  +    +++ E+  +     + P     SL  L I + +    ++A  E +  
Sbjct  122  KDREKAIEDLSELVKVFEEGMKRDFEEDPPFFIDGSLSFLGIVVSSYACTYEAFHEAVTT  181

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLE  188
             +I  EK+P  FSWV  L   PL++ETLPPH+K V+RL+
Sbjct  182  VLI-PEKNPAFFSWVHDLKGHPLIKETLPPHDKLVARLK  219



>ref|XP_010678529.1| PREDICTED: glutathione S-transferase U9-like [Beta vulgaris subsp. 
vulgaris]
Length=231

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 131/221 (59%), Gaps = 2/221 (1%)
 Frame = -3

Query  844  HHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLH  665
               + V LHGMW S Y  + ++ALKIKGI +EY+EEDL NKS  LLQ NP++K+VP+L+H
Sbjct  2    REENSVKLHGMWASPYVLRTKIALKIKGIEYEYIEEDLSNKSDLLLQYNPVNKQVPVLVH  61

Query  664  NGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARG  485
            NG PI ES++I+EY+DE W +  P +LP+D Y +AK RFW  Y  Q+SD + +A + A G
Sbjct  62   NGLPIAESMIILEYLDEAWTD-PPYLLPKDPYLRAKHRFWVTYFQQVSDALGQALL-AGG  119

Query  484  QNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
            +      ++++  L++ E   +       P       G LDI   +  G    V+E  G+
Sbjct  120  KATEDRMNDYWKKLDVAEDLIKEIFSDGAPSFQDSKPGYLDIMFYSYFGTSDVVKECFGI  179

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELI  182
             ++   ++P + SW+ +L E+P  +E  PP +K +  L  +
Sbjct  180  DLLIAGRYPLLTSWINALSEVPEFKELTPPKDKLLQNLRAV  220



>emb|CBI26438.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 135/223 (61%), Gaps = 3/223 (1%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              ++V L G+W S + +++E ALK KGI +EYVEEDL NKS  LL  NP+H+KVP+LLHN
Sbjct  2    QEEQVKLLGIWFSPFVRRIEWALKFKGIEYEYVEEDLTNKSSLLLTSNPVHQKVPVLLHN  61

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            G PIVES+VI+EYIDE W   +  ILP+D +++AK RFWA +I Q      +  +   G+
Sbjct  62   GNPIVESLVIIEYIDENWK--QNPILPQDPHERAKARFWANFIEQKITEATRTALVTEGE  119

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQS-LGLLDIALVATLGMHKAVEEVLGM  305
             +     E    +E+LE E       +      ++ LG +DI L       + +EEV G 
Sbjct  120  QQKKVVKELKEAMEVLEGEAAAKLNDKTLFFGGKNGLGYVDIVLGWICNWVEVIEEVGGF  179

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            K++D +K P I  W+ + +E+PL++ TL P EK V   ++++Q
Sbjct  180  KVLDPQKQPHIHKWMANFVEVPLIKPTLLPKEKMVVCFQMVRQ  222



>ref|XP_006424949.1| hypothetical protein CICLE_v10029241mg [Citrus clementina]
 gb|ESR38189.1| hypothetical protein CICLE_v10029241mg [Citrus clementina]
Length=222

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 138/215 (64%), Gaps = 11/215 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L+G W+S +++++ELALK+KG+PFEY+  DL NKSP+LL+ NPIHKK+P+L+HNG+
Sbjct  3    EEVKLYGTWVSPFSRRIELALKLKGVPFEYIGVDLSNKSPELLKYNPIHKKIPVLVHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
             IVES++I+EYID+TW N  P ILP D +Q+A  RFWAK+I +  L+  MK +   A G+
Sbjct  63   SIVESLIILEYIDDTWKN-NP-ILPRDPHQRAVARFWAKFIDEKLLATGMKASL--AEGK  118

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             K     E    +++LE E        +     +++GL+DI             EVLG++
Sbjct  119  EKELLNEEILEQMKLLENELN-----GKDFFGGEAIGLVDIVATVVAFWFPVSHEVLGVE  173

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVS  197
            +I +EK P +  W+  L E+ +V ++ PP EK V+
Sbjct  174  VITQEKFPVLLKWIGKLQEIDVVSQSRPPREKHVA  208



>ref|XP_010938161.1| PREDICTED: glutathione S-transferase U8-like [Elaeis guineensis]
Length=226

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 137/218 (63%), Gaps = 10/218 (5%)
 Frame = -3

Query  823  LHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVE  644
            L G+W S ++++VELAL++KGIP++Y+EEDL NKSP LL+ NPIHKK+P+LLH G+P+VE
Sbjct  7    LFGVWGSPFSRRVELALRLKGIPYDYMEEDLSNKSPSLLKYNPIHKKIPVLLHGGKPVVE  66

Query  643  SIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISA--RGQNKNA  470
            S+VI+EYI+ETW      ILP+D Y++A  RFWA+++      M   ++S    G  +  
Sbjct  67   SLVILEYIEETWEG-NHAILPKDPYERAMARFWARFLD--DKCMPAMWMSCWTEGDAQQN  123

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDE  290
               E   NL ILE E +      +      ++GL+DIA +        ++EV G+ +++E
Sbjct  124  FMKESKENLSILEGELK-----GKKFFGGNAIGLVDIAALFIAHWAGVLQEVAGISLVNE  178

Query  289  EKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            EKHP +F W+E  +   +V E LP  E+ ++  +  K+
Sbjct  179  EKHPILFKWIEEFISSDIVVECLPARERLLAFFQAKKE  216



>ref|XP_006488416.1| PREDICTED: glutathione S-transferase U7-like [Citrus sinensis]
Length=223

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 138/215 (64%), Gaps = 11/215 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L+G W+S +++++ELALK+KG+PFEY+  DL NKSP+LL+ NPIHKK+P+L+HNG+
Sbjct  4    EEVKLYGTWVSPFSRRIELALKLKGVPFEYIGVDLSNKSPELLKYNPIHKKIPVLVHNGK  63

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
             IVES++I+EYID+TW N  P ILP D +Q+A  RFWAK+I +  L+  MK +   A G+
Sbjct  64   SIVESLIILEYIDDTWKN-NP-ILPRDPHQRAVARFWAKFIDEKLLATGMKASL--AEGK  119

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             K     E    +++LE E        +     +++GL+DI             EVLG++
Sbjct  120  EKELLNEEILEQMKLLENELN-----GKDFFGGEAIGLVDIVATVVAFWFPVSHEVLGVE  174

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVS  197
            +I +EK P +  W+  L E+ +V ++ PP EK V+
Sbjct  175  VITQEKFPVLLKWIGKLQEIDVVSQSRPPREKHVA  209



>ref|XP_010279541.1| PREDICTED: probable glutathione S-transferase isoform X2 [Nelumbo 
nucifera]
Length=227

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 133/212 (63%), Gaps = 10/212 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W+S  + +VELALK+KG+ +EY++EDL NKSP LL+ NPIHKKVP+LLHNG+
Sbjct  3    EEVKLIGAWVSPVSLRVELALKLKGVKYEYIDEDLSNKSPLLLKYNPIHKKVPVLLHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
            PI ES VI+EYIDETW     ++LPED Y++A  RFW K+I +  +    K  +I  R Q
Sbjct  63   PIAESAVILEYIDETWKGY--QLLPEDPYERAVTRFWVKFIDEKCIEAIWKACWIEERKQ  120

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             K  A  E    L+ILE E +      R   +  ++G +DIA +        ++EV+G+ 
Sbjct  121  EK--AIEEAKETLKILENELK----KGRKFFAGDNIGFVDIAAIFIAFWVGVLQEVVGIS  174

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
            ++DEEK P +  W+E  +   +V E LPP +K
Sbjct  175  LMDEEKFPVLHKWIEEFINCDVVGENLPPRDK  206



>gb|KDO66686.1| hypothetical protein CISIN_1g041800mg [Citrus sinensis]
Length=223

 Score =   174 bits (440),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 138/215 (64%), Gaps = 11/215 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L+G W+S +++++ELALK+KG+PFEY+  DL NKSP+LL+ NPIHKK+P+L+HNG+
Sbjct  4    EEVKLYGTWVSPFSRRIELALKLKGVPFEYIGVDLSNKSPELLKYNPIHKKIPVLVHNGK  63

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
             IVES++I+EYID+TW N  P ILP D +Q+A  RFWAK+I +  L+  MK +   A G+
Sbjct  64   SIVESLIILEYIDDTWKN-NP-ILPRDPHQRAVARFWAKFIDEKLLATGMKASL--AEGK  119

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             K     E    +++LE E        +     +++GL+DI             EVLG++
Sbjct  120  EKELLNEEILEQMKLLENELN-----GKDFFGGEAIGLVDIVATVVAFWFPISHEVLGVE  174

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVS  197
            +I +EK P +  W+  L E+ +V ++ PP EK V+
Sbjct  175  VITQEKFPVLLKWIGKLQEIDVVNQSRPPREKHVA  209



>ref|XP_010678531.1| PREDICTED: glutathione S-transferase U9-like [Beta vulgaris subsp. 
vulgaris]
Length=230

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 93/229 (41%), Positives = 135/229 (59%), Gaps = 8/229 (3%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE       + L+GMW S +  + +LALKIKGI +EY+EEDL NKS  LLQ NP++K+V
Sbjct  1    MGE----ESSIKLYGMWASPFVLRPKLALKIKGIEYEYIEEDLANKSELLLQYNPLYKQV  56

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+ +HNG PIVES VIVEYIDETW +  P +LP+D Y +AK RFW  Y  Q+   + K  
Sbjct  57   PVFVHNGLPIVESFVIVEYIDETWTD-PPHLLPKDPYLRAKHRFWVAYFEQVLLFLGKTL  115

Query  499  ISARGQNKNAAFSEFFVNLEILEK-ETRVFCPMERPKISAQSLGLLDIALVATLGMHKAV  323
                G+      +E+   L++ E+  T+       P      LG LDI   +   M   +
Sbjct  116  --TEGKANEEQLNEYLKKLDVAEELLTKEMFLNGAPSFQDMKLGYLDIVFYSCFDMSDVL  173

Query  322  EEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            E+  G+K++  E++P + SW+ +L E+P V+E  PP  K +  L+++ Q
Sbjct  174  EDCFGIKLLTSERYPLLTSWLNALREVPEVKELTPPKPKMLQHLQVVLQ  222



>ref|XP_002281843.2| PREDICTED: glutathione S-transferase U7 [Vitis vinifera]
Length=230

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 138/216 (64%), Gaps = 14/216 (6%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W S +++++E+ALK+KG+ FEY+EE+L NKSP LL+ NP+HKK+P+L+HNG+
Sbjct  13   EEVKLFGTWASVFSRRIEVALKLKGVQFEYIEENLSNKSPALLKYNPLHKKIPVLVHNGK  72

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFIS---ARG  485
            P+ ES+VI+EYIDETW +  P ILP D Y+KA  RFWAKY   + D +  A I    ++G
Sbjct  73   PVAESLVILEYIDETWKH-NP-ILPTDPYEKAMARFWAKY---MDDKLLPAAIKVAMSKG  127

Query  484  QNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
            + +     E    L+ LE E +     E+     +SLG +DIA   T+      +E LGM
Sbjct  128  EEQKGVIEEIQKQLKTLESELK-----EKKFFGGESLGFVDIA-ANTIVWLVVAQEALGM  181

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVS  197
            +I+ EEK P +  W + L++  + +E +PP E+ +S
Sbjct  182  EILTEEKFPVLHGWYQRLVDDAVFKECMPPREQHLS  217



>ref|XP_003591644.1| hypothetical protein MTR_1g090150 [Medicago truncatula]
 gb|ABE86689.1| Glutathione S-transferase, C-terminal; Thioredoxin-like fold 
[Medicago truncatula]
 gb|AES61895.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=226

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 136/212 (64%), Gaps = 6/212 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V + G+W S Y ++V   LK+KG+ +EY  EDL NKS  LLQ NPI+KKVP+L+HNG+
Sbjct  2    EDVKVFGLWSSPYTQRVVWTLKLKGVSYEYYGEDLANKSSLLLQYNPIYKKVPVLVHNGK  61

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES+VIVEYIDETW      +LP+DAY+++ VRFW+K+I + S  M + F+   G+ +
Sbjct  62   PMAESMVIVEYIDETWPPF--PLLPQDAYERSNVRFWSKFIEEKSMHMMEFFL-YDGERQ  118

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  E    L ++EKE+ +    E+  I   ++GL DIAL         +EE++G+K I
Sbjct  119  ERAIKETLETLRVIEKESGL---SEKMFIGGNTIGLADIALGWVAHTLPVMEEIVGVKFI  175

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAV  200
              +  P + SWV++ LE+P ++  LPPHE  V
Sbjct  176  TIDAFPHLHSWVKNFLEIPAIKNNLPPHELLV  207



>emb|CAN73676.1| hypothetical protein VITISV_001111 [Vitis vinifera]
Length=220

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 138/216 (64%), Gaps = 14/216 (6%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W S +++++E+ALK+KG+ FEY+EE+L NKSP LL+ NP+HKK+P+L+HNG+
Sbjct  3    EEVKLFGTWASVFSRRIEVALKLKGVQFEYIEENLSNKSPALLKYNPLHKKIPVLVHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFIS---ARG  485
            P+ ES+VI+EYIDETW +  P ILP D Y+KA  RFWAKY   + D +  A I    ++G
Sbjct  63   PVAESLVILEYIDETWKH-NP-ILPTDPYEKAMARFWAKY---MDDKLLPAAIXVAMSKG  117

Query  484  QNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
            + +     E    L+ LE E +     E+     +SLG +DIA   T+      +E LGM
Sbjct  118  EEQXGVIEEIQKQLKTLESELK-----EKKFFGGESLGFVDIA-ANTIVWLVVAQEALGM  171

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVS  197
            +I+ EEK P +  W + L++  + +E +PP E+ +S
Sbjct  172  EILTEEKFPVLHGWYQRLVDDAVFKECMPPREQHLS  207



>ref|XP_009602104.1| PREDICTED: glutathione S-transferase U10-like [Nicotiana tomentosiformis]
Length=229

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 138/212 (65%), Gaps = 2/212 (1%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V+L G W S+Y  +V LAL+IKGI +EY E+DL NKS +LL  NPIHKKVP+L+H G+PI
Sbjct  7    VVLLGSWFSSYCNRVRLALEIKGIQYEYTEQDLTNKSQELLNYNPIHKKVPVLVHKGKPI  66

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
            VESIVI+EYI++ W NL  ++ PE+ Y++AKVRFW  Y  Q      KA + ++G  K+ 
Sbjct  67   VESIVILEYIEDCWKNLT-KLWPEEPYERAKVRFWINYYDQKIGPSSKAVLMSKGSEKDK  125

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVL-GMKIID  293
            A  E    +++LE+ T    P   P ++ ++ G+LDI + ++    +A  E + G + ++
Sbjct  126  AIEESKEVVKVLEEGTERDFPKRSPFLNGENPGILDIVIGSSACNAEAFNEAIGGGEDLN  185

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVS  197
             +K+P +F+ V +L  LP++++ LP H   V+
Sbjct  186  LDKYPCLFALVTALKNLPIMKQYLPQHHDLVA  217



>ref|XP_010279542.1| PREDICTED: probable glutathione S-transferase isoform X3 [Nelumbo 
nucifera]
Length=227

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 130/210 (62%), Gaps = 6/210 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W+S  + +VELALK+KG+ +EY++EDL NKSP LL+ NPIHKKVP+LLHNG+
Sbjct  3    EEVKLIGAWVSPVSLRVELALKLKGVKYEYIDEDLSNKSPLLLKYNPIHKKVPVLLHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES VI+EYIDETW     ++LPED Y++A  RFW K+I +  +        +    +
Sbjct  63   PIAESAVILEYIDETWKGY--QLLPEDPYERAVTRFWVKFIDEKCNATLWRACWSEASEQ  120

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  E   NL+ILE E +      +      ++G +DIA +        ++EV+G+ ++
Sbjct  121  EKAIEEARENLKILENELK----KGKKFFGGDNIGSVDIAAIYIAFWVGVLQEVVGISLM  176

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEK  206
            DEEK P +  W+E  +   +V+E LPP +K
Sbjct  177  DEEKFPVLHKWIEEFINCDVVKENLPPRDK  206



>ref|XP_002520474.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41887.1| glutathione s-transferase, putative [Ricinus communis]
Length=222

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 135/210 (64%), Gaps = 7/210 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W S ++ ++ELALK+KGI +EY+EEDL NKSP LL  NP+HKK+P+L+HNG+
Sbjct  3    EEVKLLGAWASPFSHRIELALKLKGIQYEYIEEDLSNKSPLLLSTNPVHKKIPVLIHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+VI+EYI+ETW +  P ILP+D Y +A  RFWAK++ +        F SA+ + K
Sbjct  63   PIAESLVILEYIEETWQS-NP-ILPKDPYDRAVARFWAKFVDEKILQTASKFRSAKEEEK  120

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
               F E   +L++LE E R      R     +S+G +DI +   +   +  +EV+ ++ I
Sbjct  121  LQIFEELGQHLKVLENELR-----GREFFGGESIGFVDIVIFFIVHWFQLRQEVMQIEFI  175

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEK  206
              EK P +  ++E L E+ +V+E+LPP EK
Sbjct  176  SNEKFPVLCKYLEKLHEIDVVKESLPPKEK  205



>ref|XP_010937141.1| PREDICTED: glutathione S-transferase U10-like [Elaeis guineensis]
Length=231

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 141/221 (64%), Gaps = 1/221 (0%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L+G W S Y+  V+ ALK+KG+ +EYVEEDL+NKS  LL+ NP++KKVP+L+ +G+PI
Sbjct  7    VKLYGHWSSPYSVMVQYALKLKGVVYEYVEEDLQNKSESLLELNPVYKKVPVLVVDGKPI  66

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
             ES+VI+E+I+E W    P +LPED Y+KAKVRFWA + +Q       A + + G+ +  
Sbjct  67   AESLVILEFIEEMWKE-PPFLLPEDPYKKAKVRFWADFFYQKLVPAFYAIMRSEGEAQER  125

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDE  290
               EF  +L  LE   +   P E P I+ +  GLLD+ + +  G  + V +++GM+ ++ 
Sbjct  126  TTKEFTEHLTTLENGIQKDLPSEGPFINGEKPGLLDVIVGSASGAFRVVADLVGMEPLER  185

Query  289  EKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            EK P + S V S L+L + ++ + PHEK ++R+  +++   
Sbjct  186  EKVPLLHSSVASFLDLEVTKDIVVPHEKVINRVRAMREKAL  226



>ref|XP_008802611.1| PREDICTED: glutathione S-transferase U10-like [Phoenix dactylifera]
Length=230

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 142/219 (65%), Gaps = 2/219 (1%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
             V L+G W S Y   V  AL++KG+ +EYVEEDL+NKS  LL  NP+HKKVP+L+ +G+P
Sbjct  6    EVKLYGAWGSGYCAIVHHALRLKGVAYEYVEEDLQNKSEALLGLNPVHKKVPVLVLDGKP  65

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            + ES+VI+E+++ETW    P +LPED Y+KAKVRF+A +I+Q +     A I + G+ + 
Sbjct  66   VSESLVILEFVEETWK--EPPLLPEDTYKKAKVRFFADFIYQKTMPTSYAIILSDGEAQV  123

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             A  EF  ++  LEK  +   P   P I+ +  GLLD+ + A     + + +++G++++D
Sbjct  124  KATEEFIEHMSTLEKGIQNDLPSNGPFINGEKPGLLDVIVGACSAGFRVLADLVGVEVLD  183

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            +EK P + S V S ++L ++++T  P EK + R+  +++
Sbjct  184  KEKVPLLHSSVASFIDLEVIKDTAIPFEKLLERVHAMRE  222



>ref|XP_010922854.1| PREDICTED: probable glutathione S-transferase [Elaeis guineensis]
Length=224

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 146/222 (66%), Gaps = 15/222 (7%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L G+W S +   V+ AL+IKG+ +EY+EEDL NKS  LL+ NP+HKKVP+++HNG+PI
Sbjct  6    VKLFGIWSSPFVLIVKWALRIKGVEYEYIEEDLSNKSNLLLEYNPVHKKVPVMVHNGKPI  65

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKY-IHQLSDTMKKAFISARGQNKN  473
             ES VI+EYI+ETW N  P ILP+D Y++A  RFW K+ + +LS  + + FIS +G+ + 
Sbjct  66   AESAVILEYIEETWKN-NP-ILPDDPYERAMARFWCKFVVDKLSPPIWRLFIS-QGKEQE  122

Query  472  AAFSEFFVNLEILEKETR---VFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             A++    NL+ILE+E +    FC         +++GL DI++     +    EE+  +K
Sbjct  123  EAYALAIENLKILEQELQGKMFFC--------GETIGLADISIGPLAYVMPIYEEITKLK  174

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            ++D E+ P + +W+E+ L  P+V+++LPP EK + +   +++
Sbjct  175  MVDAERFPLLCAWMEAFLNSPVVKDSLPPGEKLLLKYRALRE  216



>ref|XP_011006430.1| PREDICTED: glutathione S-transferase U9, partial [Populus euphratica]
Length=197

 Score =   171 bits (432),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 119/194 (61%), Gaps = 6/194 (3%)
 Frame = -3

Query  733  LRNKSPQLLQQNPIHKKVPMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKV  554
            L NKS  LLQ NP+H KVP L+HNG+PI ES  I+EYIDETW    PR+LP+D YQ+AKV
Sbjct  1    LSNKSQALLQYNPVHNKVPALVHNGKPITESSTILEYIDETWKQ-APRLLPDDPYQRAKV  59

Query  553  RFWAKYIHQLSDTMK-----KAFISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKI  389
            RFWA +I Q    ++        I+  G+ +  A  E    + ILE+E +   P     I
Sbjct  60   RFWASFIQQQILRLQLFAGVSQVITRGGEAQEEAIGELLEKMNILEEEMKKLLPNGVSVI  119

Query  388  SAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHE  209
              Q+LGLLDI + A L  HKA EEV G++I+D EK+P I SWV +  +L  V+E LPPH+
Sbjct  120  EVQNLGLLDILVGAVLSPHKAQEEVAGVQILDPEKNPLILSWVTAWNQLTTVQELLPPHD  179

Query  208  KAVSRLELIKQHGF  167
            K V  L+ + +   
Sbjct  180  KIVGLLQSVNKTAL  193



>ref|XP_010521899.1| PREDICTED: glutathione S-transferase U7-like [Tarenaya hassleriana]
Length=222

 Score =   171 bits (432),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 146/227 (64%), Gaps = 15/227 (7%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
              + V L G+W S ++ ++E+ALK+KG+P++Y+EEDL NKSP LLQ NP+HKK+P+ +HN
Sbjct  3    EEEEVKLLGLWSSPFSCRIEMALKLKGVPYKYLEEDLENKSPLLLQLNPVHKKIPVFVHN  62

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            G+PI ES+VI++YIDETW +  P ILP+D Y++A  RFWA++I +         ++  G+
Sbjct  63   GKPIAESLVILDYIDETWKH-NP-ILPQDPYERAMARFWARFIDEQVLLTGLKIVAQTGR  120

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDI--ALVATLGMHKAVEEVLG  308
             + AA       ++ LEKE +      +     +S G LD+   LVA   M    ++++G
Sbjct  121  EREAAVEATRDLVKFLEKELK-----GKDFFGGESFGYLDMVATLVAFWLMRS--DDLVG  173

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAV----SRLELIK  179
            ++++ EEK P I  WV+ L E+P+V+E +PP +K V    +RLE IK
Sbjct  174  VEVLPEEKFPEIHRWVKKLSEIPVVKECVPPKDKHVQYLRARLERIK  220



>gb|EYU26623.1| hypothetical protein MIMGU_mgv1a013321mg [Erythranthe guttata]
Length=223

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 131/213 (62%), Gaps = 7/213 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W S   ++VE+ALK+KG+ +EY+EEDL+NKSP LL  NP+HKKVP+LLHNG+
Sbjct  3    EEVKLFGAWGSPSTRRVEIALKLKGVKYEYIEEDLKNKSPLLLTYNPVHKKVPVLLHNGQ  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQN  479
            PI ES++I+EYID+TW    P ILP+D YQ++K RFWAK++  + +  + KA     G+ 
Sbjct  63   PIAESLIILEYIDDTWQQQGPPILPKDPYQRSKARFWAKFLDDKFAPQIWKA-CWGEGEE  121

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +     E   +L++LE E +      +      +LGL+DI         + ++++LG+  
Sbjct  122  REKGIEEATESLKLLENEIK-----GKKLFGGDNLGLVDIVAHFMAYWSEILQQLLGLDF  176

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAV  200
               EK+P +F+W +       V+E LPP  + V
Sbjct  177  FTREKYPNLFNWGDEFCNCSFVKENLPPKHELV  209



>ref|XP_006852815.1| hypothetical protein AMTR_s00033p00172170 [Amborella trichopoda]
 gb|ERN14282.1| hypothetical protein AMTR_s00033p00172170 [Amborella trichopoda]
Length=233

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 136/211 (64%), Gaps = 8/211 (4%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L G+W S+Y  +VE+ALK+KGI +EY+EEDL  KSP LLQ NPIH+K+P+LLH G+ +
Sbjct  9    VKLIGLWASSYCVRVEVALKLKGISYEYLEEDLITKSPVLLQFNPIHRKIPVLLHKGKSL  68

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKA-FISARGQNK  476
             ES++I+EYIDETW +    ++P D +++A++RFWA +   ++S + K   F+    Q K
Sbjct  69   AESLIILEYIDETWPD--SPLMPTDPHERARLRFWASFFDTKMSGSGKTIFFVEGEEQEK  126

Query  475  N-AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
              AA  EF   L ILE   +     ++P  + +S G L++ + +T+G  K +E+  G K+
Sbjct  127  EVAALKEF---LNILENGLKKDFGSKKPFFNGESPGYLEVVIGSTIGWFKLLEDKTGAKL  183

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
            ID+E  PF+FSW+    E  +V+E LP   K
Sbjct  184  IDQETTPFLFSWITDFSEFGVVKEALPDQAK  214



>ref|XP_010923032.1| PREDICTED: probable glutathione S-transferase [Elaeis guineensis]
Length=222

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 147/226 (65%), Gaps = 19/226 (8%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L G W S + ++VE ALKIKGI +EY+EEDL NKSP LL  +PI+K+VP+LLH+G+PI
Sbjct  3    VKLFGAWSSPFVRRVEWALKIKGIKYEYIEEDLYNKSPSLLTYSPINKQVPVLLHDGKPI  62

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQNKN  473
            +ES+VI+EYID+TW   +P +LP D YQ++  RFW++Y+  +  +++K+AF +  G+ + 
Sbjct  63   IESMVIIEYIDDTWKQ-KP-LLPIDPYQRSMARFWSQYVEDKFYESVKRAFFT-EGEEQK  119

Query  472  AAFSEFFVNLEILEKE---TRVFCPMERPKISAQSLGLLDIALVATLGMH--KAVEEVLG  308
            AA       L+ LE+E    + FC         + +G +D  LVA    H  + VEEVL 
Sbjct  120  AAVESAVEALKPLEQELKGKKFFC--------GEEIGFVD--LVAGWIAHWLEVVEEVLC  169

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHG  170
            +K++D E  P + +W+++ +E+P+++E LP  ++      +++Q G
Sbjct  170  IKVVDPENFPSLCAWMKNFVEVPVIKENLPARDQMPGFYRMLRQSG  215



>gb|AFF18816.1| glutathione transferase, partial [Dimocarpus longan]
Length=224

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 139/221 (63%), Gaps = 9/221 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++V L   W S +  ++  ALK+KG+ ++ + EDL NKSP LLQ NPI+KKVP+LLHNG+
Sbjct  3    EKVKLFNTWSSRFGLRIVWALKLKGVEYDSINEDLSNKSPLLLQYNPIYKKVPVLLHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKY-IHQLSDTMKKAFISARGQN  479
            P  ES+VI+EYIDETW +  P +LPED Y+KA  RFWAK+   ++  ++  AF +  G+ 
Sbjct  63   PTSESLVILEYIDETWKH-NP-LLPEDPYEKATARFWAKFGDDKVMSSIWSAFTN-EGKE  119

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A  +   NL  LE++ +      +     + +GL D+AL     + +  EE++G+KI
Sbjct  120  QEDAIGQAIENLNFLEEQLK-----GKKFFGGEKIGLTDLALGWLANLVRVFEEIIGVKI  174

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            ID E+ P + +W +   E P+++E+ PPH+K + + + I+ 
Sbjct  175  IDHERFPSLLAWTQEFAEAPIIKESWPPHDKLIVKFQAIRD  215



>gb|EMS56906.1| putative glutathione S-transferase [Triticum urartu]
Length=252

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 137/211 (65%), Gaps = 4/211 (2%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++V L GMW S Y  KV+ AL IKG+ +EYVEEDLRNKS  LL+ NP+HKKVP+LL+ G+
Sbjct  10   EKVKLFGMWASPYVLKVKWALSIKGVEYEYVEEDLRNKSDDLLEHNPVHKKVPVLLYRGK  69

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            P+ ES VIVE++DE W+    RILP+D +++A  RFW +++H +LS  + K F +A  + 
Sbjct  70   PVAESDVIVEFVDEAWSYRGGRILPDDPHERAMARFWVRFVHDKLSPPIWKWFTAAPSEG  129

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            + AA       L++LE    +     +   + +S+GL+D++L A   +    EE++G+++
Sbjct  130  QEAALGAAVEQLQVLED---LLALGGKDFFAGESVGLVDLSLGALAYVIPMYEEIIGVRM  186

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
            + EE+ P + +W+   L+ P V++  PP E+
Sbjct  187  VTEERFPSLSAWMGRFLDSPPVKDHPPPVER  217



>ref|XP_006852814.1| hypothetical protein AMTR_s00033p00172070 [Amborella trichopoda]
 gb|ERN14281.1| hypothetical protein AMTR_s00033p00172070 [Amborella trichopoda]
Length=234

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 134/215 (62%), Gaps = 17/215 (8%)
 Frame = -3

Query  817  GMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESI  638
            G+W S+Y  ++E+ALK+KGI +EY++EDL NKSP LLQ NPIHKKVP+LLHNG+ I ES+
Sbjct  13   GLWASSYCVRIEVALKLKGISYEYIDEDLSNKSPLLLQLNPIHKKVPVLLHNGKTIAESL  72

Query  637  VIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQNKNAAFS  461
            +I+EYIDETW +L P +LP+D Y++A +RFWA +   +LS + +  FI+  G+ +    +
Sbjct  73   IILEYIDETWPDL-PALLPKDPYERALLRFWANFFDSKLSGSGRTIFIT-EGEEQEKEVA  130

Query  460  EFFVNLEILEK-------ETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
                NL +LE        + + FC  E P       G L++ +  +    K +E+V   K
Sbjct  131  VLKENLNVLENGLKKDFGDKKSFCNGETP-------GYLEVVMGPSFFWLKILEDVSRAK  183

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVS  197
            +ID +  PF+FSW+    E  + ++ LP   K V+
Sbjct  184  LIDHKNTPFLFSWLTEFCEFGVAKDALPDQAKLVA  218



>ref|XP_006354571.1| PREDICTED: glutathione transferase GST 23-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006354572.1| PREDICTED: glutathione transferase GST 23-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006354573.1| PREDICTED: glutathione transferase GST 23-like isoform X4 [Solanum 
tuberosum]
Length=223

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 133/219 (61%), Gaps = 7/219 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D V L+  W S Y  ++  A+ IKGI +E V EDL  KSPQLLQ NP+HKK+P+L+H G+
Sbjct  3    DEVKLYRTWSSPYGLRIVWAMHIKGIEYENVFEDLSQKSPQLLQYNPVHKKIPVLVHKGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQN  479
            PI ES+VI+EYIDETW    P +LP+D Y+KA  RFWAK++  +L  ++   F     + 
Sbjct  63   PICESLVILEYIDETWKETTP-LLPQDPYEKAMARFWAKFVDDKLLPSVWSVFTEKGYEA  121

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            K  A      NLEI+E++ +     E+     +S+G +D+AL     +    EEV+ +K+
Sbjct  122  KKEALVPAVQNLEIIEEQLK-----EKKFFGGESIGYVDLALGWVAYLLDVFEEVIDLKL  176

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELI  182
             D  K P +  W+++  + P +++ LPP +K V+R +L 
Sbjct  177  FDAHKFPLLSGWMKNFCDAPAIKQHLPPRDKLVTRFQLF  215



>ref|XP_002283736.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=226

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 139/216 (64%), Gaps = 14/216 (6%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPML-----  671
            D+V L G+W S + ++VE+AL++KG+ FEYVEEDL NKSP LL+ NP+HKK+P+L     
Sbjct  3    DQVQLFGVWGSFFGRRVEVALRLKGVQFEYVEEDLYNKSPSLLKYNPVHKKIPVLLCDNM  62

Query  670  LHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ-LSDTMKKAFIS  494
            LHNG P+ ES+VI+EYIDETW +  P I P+D Y++A+ RFWAK+I + L   ++KA  S
Sbjct  63   LHNGNPLAESLVILEYIDETWKH-NP-IFPKDPYERARARFWAKFIDEKLWPVVRKALGS  120

Query  493  ARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEV  314
               + +  A  E   +LE LE E +     E+     +S G LDIA +  + +  A +E 
Sbjct  121  KEEKEQREAIGETHEHLETLESELK-----EKKFFGGESWGYLDIAAMVIIWLGIA-QEA  174

Query  313  LGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
            LG++ I +EK P +  W + L+E  + +E +PP EK
Sbjct  175  LGVEFIPKEKFPRLHKWQQRLVEDAVFKECVPPREK  210



>ref|XP_008793319.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=226

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 146/222 (66%), Gaps = 9/222 (4%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L G W S +  +++ ALK+KG+ ++++EEDL+NKSP LL+ NP+HKKVP+L+H+G+ I
Sbjct  6    VKLLGTWSSPFVLRIKWALKLKGVEYDFIEEDLQNKSPLLLKYNPVHKKVPVLVHDGKSI  65

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKY-IHQLSDTMKKAFISARGQNKN  473
             ES VI+EYIDETW    P ILPED YQ+A  RFW+K+   +   +M K FIS +G+ + 
Sbjct  66   AESYVILEYIDETWKE-NP-ILPEDPYQRAMARFWSKFGDEKFLPSMWKFFIS-QGEKRE  122

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             A      NL+ILE E +      +   + ++LG  DI+L   + M   +EE++ +K+ID
Sbjct  123  EALVSASENLKILEGELK-----GKKFFNGETLGFADISLGWIVDMVSLLEEIMELKMID  177

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGF  167
            E+++P + +W+++  + P ++++ PP E+ +++   +++  F
Sbjct  178  EQRYPSLSAWMKNFSDFPGIKDSFPPQERMLTKYRTLREAYF  219



>ref|XP_004229525.1| PREDICTED: glutathione transferase GST 23-like [Solanum lycopersicum]
Length=223

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 134/219 (61%), Gaps = 7/219 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D V L+  W S +  ++  AL IKGI +E + EDL  KSPQLLQ NP+HKK+P+L+H G+
Sbjct  3    DEVKLYRTWSSPFGLRIVWALHIKGIEYEAIFEDLSQKSPQLLQYNPVHKKIPVLVHKGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            PI ES+VI+EYIDETW    P +LP+D Y+KA  RFWAK++  +L  ++   F       
Sbjct  63   PICESLVILEYIDETWKETAP-LLPQDPYEKAMARFWAKFVEDKLLPSVWSIFTEQGYDA  121

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            K  AF     NLEI+E++ +     E+     +S+G +D+ L     +    EEVL +K+
Sbjct  122  KKEAFVPAVQNLEIIEEQLK-----EKKFFGGESIGYVDLVLGWMAYLLDVFEEVLDLKL  176

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELI  182
             D +K P +  W+++  + P +++ LPP +K V++ +L+
Sbjct  177  FDADKFPLLSGWMKNFCDAPAIKQHLPPRDKLVTKFQLL  215



>emb|CAN73675.1| hypothetical protein VITISV_001110 [Vitis vinifera]
Length=221

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 133/210 (63%), Gaps = 7/210 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W S +++++E+ALK+KG+ FEY+EE+L NKSP LL+ NP+HKK+P+L+HNG+
Sbjct  3    EEVKLFGTWASPFSRRIEVALKLKGVQFEYIEENLXNKSPALLKYNPVHKKIPVLVHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES+VI+EYIDETW +  P ILP D Y+KA  RFWAKY+           + ++G+ +
Sbjct  63   PVAESLVILEYIDETWKH-NP-ILPTDPYEKAMARFWAKYMDDKLWPAATKVVVSKGEEQ  120

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
             A   E    L+ LE E +     E+     +SLG +DIA    + +  A E +  M+I+
Sbjct  121  KAVIEEIQEQLKTLESELK-----EKKFFGGESLGFVDIAANIIVFLLVAQEALGLMEIL  175

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEK  206
             EEK P +  W + L++  + +E +PP E+
Sbjct  176  TEEKFPVLHEWYZRLVDDAVFKECVPPRER  205



>ref|XP_003606407.1| Glutathione S-transferase 103-1A [Medicago truncatula]
 gb|AES88604.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=218

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/220 (37%), Positives = 139/220 (63%), Gaps = 5/220 (2%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D+V +HG W S +  +V L LK+KGIP+E +EED  NKSPQLLQ NP+HKK P+L+H+G+
Sbjct  3    DQVKIHGFWYSPFTLRVVLTLKLKGIPYENIEEDRFNKSPQLLQYNPVHKKTPVLVHDGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES++IVEYIDE W      +LP D +++A+ RFW KY+  +   +   F S   + +
Sbjct  63   PLCESMIIVEYIDEIWPQY--PLLPVDPFERAQARFWVKYVDDIIPVVGALFRSGGDEER  120

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
                ++ + +L+++E++   +   E+      ++ ++DIAL +T+     +E+++  KI+
Sbjct  121  KNIIAKIWEHLKVVEEQCIDY---EKKLFGGDTVNIVDIALGSTIKFLVTIEDIIEFKIL  177

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
              EK P + +W ++   +P++ E LP HEK ++ L+ + Q
Sbjct  178  QAEKFPHLHTWFDNFKNVPVIGENLPDHEKLIAFLKALIQ  217



>ref|XP_010938159.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=225

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 146/219 (67%), Gaps = 9/219 (4%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L G W S +  +++ ALK+KG+ ++++EEDL+NKSP LL+ NP+HKKVP+L+H G+PI
Sbjct  6    VKLLGTWSSPFVLRIKWALKMKGVEYDFIEEDLQNKSPLLLKYNPVHKKVPVLVHEGKPI  65

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLS-DTMKKAFISARGQNKN  473
             ES+VI+EY+DETW    P ILPED YQ+A  RFW+K+  +    ++ + FIS +G+N  
Sbjct  66   AESLVILEYMDETWKE-NP-ILPEDPYQRAMARFWSKFGEEKCLPSIWRVFIS-QGENTE  122

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             A      NL+ILE E +      +   + ++LG  DI+L   + M   +EE++ +K+ID
Sbjct  123  EALVSASENLKILEGELK-----GKKFFNGETLGFADISLGWIVNMVILLEEIMELKMID  177

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            ++++P + +W+++    P +R++ PP E+ +++  ++++
Sbjct  178  DQRYPSLSAWMKNFSNFPGIRDSFPPQERMLTKYRILRE  216



>ref|XP_007225529.1| hypothetical protein PRUPE_ppa025728mg [Prunus persica]
 gb|EMJ26728.1| hypothetical protein PRUPE_ppa025728mg [Prunus persica]
Length=223

 Score =   169 bits (427),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 135/219 (62%), Gaps = 2/219 (1%)
 Frame = -3

Query  844  HHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLH  665
            H    V+L G W S+++ +V++ALK+KGI +EYVEEDL NKS  LL  NP+HK+VP+L+H
Sbjct  3    HKQSEVVLFGTWASSFSGRVKIALKLKGIQYEYVEEDLVNKSQMLLSYNPVHKQVPVLVH  62

Query  664  NGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARG  485
             G+PI ES VI+EYIDE W+   P +LP+D Y++AK+RFWAKY  +       + I + G
Sbjct  63   RGKPIAESRVILEYIDENWSK-TPNLLPKDPYERAKIRFWAKYYDEKIIPGIYSIIRSTG  121

Query  484  QNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
            + +  A  +    +++ E+  +     +       SL  L I + +    ++A  E +  
Sbjct  122  KYREKAIEDLSELVKVFEEGMKRDFQEDPLFFIDGSLSFLGIVVSSYACTYEAFHEAVTT  181

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLE  188
             +I  EK+P  FSWV  L   PL++ETLPPH+K V+RL+
Sbjct  182  VLI-PEKNPAFFSWVHDLKGHPLIKETLPPHDKLVARLK  219



>ref|XP_006354574.1| PREDICTED: glutathione transferase GST 23-like [Solanum tuberosum]
Length=223

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 135/219 (62%), Gaps = 7/219 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D V L+  W S +  ++  AL IKGI +E + EDL  KS +LLQ NP+HKK+P+L+H G+
Sbjct  3    DEVKLYRTWSSPFGLRIVWALHIKGIEYEAIFEDLTQKSSELLQYNPVHKKIPVLVHKGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQN  479
            PI ES+VI+EYIDETWN   P +LP+D Y+KA  RFWAK++  +L  ++   F     + 
Sbjct  63   PICESLVILEYIDETWNETAP-LLPQDPYEKAMARFWAKFVDDKLLPSVWSIFTEKGDEA  121

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            K  AF     NLEI+E++ +     E+     +S+G +D+AL     +    EEV+ +K+
Sbjct  122  KKEAFVPAVQNLEIIEEQLK-----EKKFFGGESIGYVDLALGWMAYLLDVFEEVMDLKL  176

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELI  182
             D  K P +  W+++  + P +++ LPP +K V++ +L+
Sbjct  177  FDAHKFPLLSGWMKNFCDAPAIKQHLPPRDKLVTKFQLL  215



>gb|EYU26621.1| hypothetical protein MIMGU_mgv1a013264mg [Erythranthe guttata]
Length=225

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L G+W S ++K+VELALK+KG+ +EY+EEDL+NKSP LL  NP+HKKVP+LLHNG+PI
Sbjct  4    VKLFGVWDSPFSKRVELALKLKGVKYEYIEEDLKNKSPLLLNYNPVHKKVPVLLHNGKPI  63

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
             ES++I+EYID+TW    P ILP+D Y ++K RFWAK++              +G+    
Sbjct  64   SESLIILEYIDDTWQQ-GPPILPKDPYLRSKARFWAKFVDDKCIPAMWKACWQKGEEGEK  122

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDE  290
            A  E    LE LE E +     +R      S+GL+DIA       +  + E++G++ + +
Sbjct  123  AMEEANDALEFLENEIK----GKRFFGGDDSIGLVDIAADVIACRNGIIAELMGVQFLRK  178

Query  289  EKHPFIFSWVESLLELPLVRETLPPHEKAV  200
            +K P +  W +       V+E  PP++K +
Sbjct  179  DKFPNLCKWADEYCNCSFVKENQPPNQKLI  208



>ref|XP_006437357.1| hypothetical protein CICLE_v10032696mg [Citrus clementina]
 ref|XP_006484734.1| PREDICTED: glutathione transferase GST 23-like [Citrus sinensis]
 gb|ESR50597.1| hypothetical protein CICLE_v10032696mg [Citrus clementina]
Length=222

 Score =   168 bits (426),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/219 (41%), Positives = 143/219 (65%), Gaps = 10/219 (5%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L   W S +A +V  ALK+KG+ F+ +EEDL NKSP LLQ NP++KK+P+L+HNGR I
Sbjct  4    VKLLKTWSSHFALRVVWALKLKGVQFDSIEEDLSNKSPLLLQHNPVYKKIPVLVHNGRAI  63

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQNKN  473
             ES+VI+EYIDETW      +LP+D Y+ A+ RFWAK+   ++  ++   FI  +G+ + 
Sbjct  64   SESLVILEYIDETWKQY--PLLPDDPYESARARFWAKFSDDKVFPSIWGVFIK-QGKEQE  120

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             AF++ F N   LE+E +      +     + +G  D+AL         +EE+ G+K+I+
Sbjct  121  EAFAQVFENFSFLEEELK-----GKKFFGGEKIGYADLALGWIAERVFELEEI-GVKVIE  174

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            +EK P + +W++  L++P+++E+LPPHEK V+++  I++
Sbjct  175  KEKFPLVSAWMQEFLKVPVIKESLPPHEKLVTKMRGIRE  213



>ref|XP_004229524.1| PREDICTED: glutathione transferase GST 23-like [Solanum lycopersicum]
 ref|XP_010323325.1| PREDICTED: glutathione transferase GST 23-like [Solanum lycopersicum]
Length=223

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 132/219 (60%), Gaps = 7/219 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D V ++  W S Y  +V  AL IKGI +E + EDL  KSPQLLQ NP+HKK+P+L+H G+
Sbjct  3    DEVKIYRNWSSPYGLRVVWALDIKGIEYENIFEDLSQKSPQLLQYNPVHKKIPVLVHKGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQN  479
            PI ES+VI+EYIDETW    P +LP+D Y+KA  RFWAK++  +L  ++   F   R + 
Sbjct  63   PICESLVILEYIDETWKETTP-LLPKDPYEKAIARFWAKFVDDKLLPSIWSVFTEKRYEA  121

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            K  A      NLE +E++ +      +     +S+G +D+AL     +    EEVL +K+
Sbjct  122  KKEALVPAMQNLEFIEEQLK-----GKKFFGGESIGYVDLALGWMAYLLDVFEEVLDLKL  176

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELI  182
             D +K P +  W ++  + P +++ LPP +K V++ +L 
Sbjct  177  FDADKFPLLSGWTKNFCDAPAIKQHLPPRDKLVTKFQLF  215



>ref|XP_010666894.1| PREDICTED: glutathione S-transferase U10-like [Beta vulgaris 
subsp. vulgaris]
Length=229

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 135/212 (64%), Gaps = 3/212 (1%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +V+LHGMW S + + V++AL IKGI +EYVEE +  K   LL+ NP +KKVP+L+H+G+P
Sbjct  6    KVVLHGMWASPFVRWVKIALNIKGITYEYVEESMTRKGQLLLEHNPAYKKVPVLVHDGQP  65

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKY-IHQLSDTMKKAFISARGQNK  476
            I ES+VIV YIDETW    P++LP+D Y ++ V FWA + + QL  +++K   S     +
Sbjct  66   IAESLVIVCYIDETWKG-SPQLLPQDPYSRSMVHFWADFMLKQLHMSLRKLVASHYETEE  124

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              + +EF  N+ ILE+   +  P + P    Q +G+LD+ L     +  A+EE L + ++
Sbjct  125  KKSIAEFQKNMNILEENVEIIFPCDVPS-CGQDMGMLDMLLSTLPNVIYAIEEALNVTLM  183

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAV  200
            + +K+   FS +E+L  L +V++T P HEK V
Sbjct  184  EPKKYQSTFSRMEALSRLTVVKDTAPSHEKLV  215



>ref|XP_006827227.1| hypothetical protein AMTR_s00010p00260410 [Amborella trichopoda]
 gb|ERM94464.1| hypothetical protein AMTR_s00010p00260410 [Amborella trichopoda]
Length=233

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 137/213 (64%), Gaps = 1/213 (0%)
 Frame = -3

Query  817  GMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESI  638
            G+W S Y+ ++E+ALK+KGI +E++E+DL NKS  LLQ NP++KKVP+L+HNG+PIVES+
Sbjct  10   GVWHSPYSWRIEVALKLKGIEYEFIEDDLSNKSQLLLQLNPVYKKVPVLIHNGKPIVESL  69

Query  637  VIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNAAFSE  458
            +I+EYIDETW  L P ++P++ +QKA +RFWA +       + +  +  +G+ +     +
Sbjct  70   IILEYIDETWPEL-PALIPKNPHQKACMRFWADFFDNTFPEIGRNILKTQGEEQEKEVIK  128

Query  457  FFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEKHP  278
            F   LE++E         ++P ++ ++ G L++ + + L   KA EE+ G K+I +E+ P
Sbjct  129  FKEKLEVVEHGLERDFGGQKPFLNGENPGYLELVVGSCLAWVKAQEEMTGAKLISKEETP  188

Query  277  FIFSWVESLLELPLVRETLPPHEKAVSRLELIK  179
            F+FSW+    E  +V+E L        RLE +K
Sbjct  189  FLFSWLSEFCEFGVVKEALQNGPDQGRRLEHLK  221



>ref|XP_010663654.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=221

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/207 (40%), Positives = 129/207 (62%), Gaps = 7/207 (3%)
 Frame = -3

Query  817  GMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESI  638
            G  +S +  +VE ALK+KG+ +EY+EEDLRNKSP LLQ NP+HKKVP+L+H+GRPI ES+
Sbjct  8    GASLSFFCCRVEWALKLKGVAYEYLEEDLRNKSPMLLQSNPVHKKVPVLVHDGRPIAESL  67

Query  637  VIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNAAFSE  458
            VI+EYIDE W      +LPED  ++AK+RFWA++  +       A   A+G  +  A   
Sbjct  68   VILEYIDEAWKGY--PLLPEDPSERAKIRFWARFTDEKCVLGAWAACCAKGHEREKAIES  125

Query  457  FFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEKHP  278
               +L  LEK+        +     +++GLLD+ + +     + +EE  GMK++DEEK P
Sbjct  126  AQESLSFLEKQIE-----GKKFFGGETMGLLDLVVGSLPNWIEFLEEHGGMKLLDEEKFP  180

Query  277  FIFSWVESLLELPLVRETLPPHEKAVS  197
             ++ W +  + +P++ E +P  E+ ++
Sbjct  181  SLYEWAQKFINIPIISERIPTKEELIN  207



>gb|AFK43038.1| unknown [Medicago truncatula]
Length=218

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/220 (37%), Positives = 137/220 (62%), Gaps = 5/220 (2%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D+V +HG W S +  +V L LK+KGIP+E +EED  NKSPQLLQ NP+HKK P+L+H+G+
Sbjct  3    DQVKIHGFWYSPFTLRVVLTLKLKGIPYENIEEDRFNKSPQLLQYNPVHKKTPVLVHDGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES++IVEYIDE W      +LP D +++A+ RFW KY+  +   +   F S   + +
Sbjct  63   PLRESMIIVEYIDEIWPQY--PLLPVDPFERAQARFWVKYVDDIIPVVGALFRSGGDEER  120

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
                ++ + +L+++E++       E+      ++ ++DIAL  T+     +E+++  KI+
Sbjct  121  KNIIAKIWEHLKVVEEQC---IDYEKKLFGGDTVNIVDIALGPTIKFLVTIEDIIEFKIL  177

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
              EK P + +W ++   +P++ E LP HEK ++ L+ + Q
Sbjct  178  QAEKFPHLHTWFDNFKNVPVIGENLPDHEKLIAFLKALIQ  217



>ref|XP_006409999.1| hypothetical protein EUTSA_v10017210mg [Eutrema salsugineum]
 gb|ESQ51452.1| hypothetical protein EUTSA_v10017210mg [Eutrema salsugineum]
Length=225

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/216 (38%), Positives = 135/216 (63%), Gaps = 7/216 (3%)
 Frame = -3

Query  844  HHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLH  665
               D V L GMW S +++++E+AL +KG+P+++ E+D+ NKSP LLQ NP+HK +P+L+H
Sbjct  3    ERSDEVKLLGMWASPFSRRIEIALTLKGVPYDFSEQDITNKSPLLLQLNPVHKMIPVLVH  62

Query  664  NGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARG  485
            NG+PI ES+VI+EYID+TW N  P ILP+D Y++A  RFWAK++ +         +   G
Sbjct  63   NGKPISESLVILEYIDDTWQN-NP-ILPQDPYERAMARFWAKFVDEQICVTAMKVVGKIG  120

Query  484  QNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
            + + A        L  LEKE      +++  +  +S G +DI            EE++G+
Sbjct  121  EEREAVVEATRDLLMFLEKEL-----VQKDFLGGESFGFVDIVATLVAFWLMRTEEIVGV  175

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVS  197
            K++  EK P I  WV++L+E+ ++++ +PP ++ +S
Sbjct  176  KVVPVEKFPKIHRWVKNLMEINVIKKCIPPEDEHLS  211



>ref|XP_007016280.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
 gb|EOY33899.1| Glutathione S-transferase tau 7, putative [Theobroma cacao]
Length=221

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 128/210 (61%), Gaps = 8/210 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L GMW S ++++VELALK+KGIP+EY+EEDL NKSP LL+ NPIHKKVP+L+H  +
Sbjct  3    EEVKLFGMWASPFSRRVELALKLKGIPYEYIEEDLSNKSPSLLKYNPIHKKVPLLVHKEK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES+VI+EY+DETW N  P ILP+D Y++A  RFWAK+I +           + G+ +
Sbjct  63   PLAESLVILEYLDETWKN-NP-ILPQDPYERAMARFWAKFIDEKLLPTAAKVSHSTGKEQ  120

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
                 E    L+ILE E +      +   + QS+G LDI        + A  E  G+  +
Sbjct  121  EQGVEEVHQQLKILENELK-----GKEFFAGQSIGYLDIVAHVLFWFYSA-GEASGVNAL  174

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEK  206
              EK P I+ W+E L+++  V E   P EK
Sbjct  175  TTEKFPIIYEWIEKLIKIDAVNECRIPKEK  204



>ref|XP_008781341.1| PREDICTED: glutathione transferase GST 23-like [Phoenix dactylifera]
Length=231

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 131/217 (60%), Gaps = 13/217 (6%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L GMW S   ++VE ALK+KGI +EY+EEDL NKS  LL  NPI+K+VP+LLHNG+PI
Sbjct  8    VKLFGMWASPAVRRVEWALKMKGIEYEYIEEDLSNKSASLLAYNPINKQVPVLLHNGKPI  67

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQNKN  473
             ES+VI+EYIDE W +  P ILPED Y++ K RFW+ Y   +  D + K + +   + +N
Sbjct  68   AESLVIIEYIDEVWKH-NP-ILPEDPYERTKARFWSTYSEGKCRDAVGKGYFTEGEEKEN  125

Query  472  AAFSEFFVNLEILEKETRVFCPMERPK--ISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            A        ++ LE+  RV     + K     ++LG  D+ L          EEV   ++
Sbjct  126  A--------IKYLEETVRVLDEELKGKKFFGGENLGFSDLVLGWMAFWLPVAEEVAFFEV  177

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLE  188
            +D +K P+  SW ++ LE+P+++E LPP +K V   E
Sbjct  178  LDSKKFPWFASWTDNFLEVPVIKENLPPRDKTVEFFE  214



>gb|KDP34500.1| hypothetical protein JCGZ_11050 [Jatropha curcas]
Length=224

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 130/210 (62%), Gaps = 7/210 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W S ++ ++ELALK+KGI + Y+EEDL NKSP LLQ NP+HKKVP+L+HNG+
Sbjct  3    EEVKLLGAWASPFSHRIELALKLKGIQYHYIEEDLFNKSPLLLQSNPVHKKVPVLIHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+VI++YI+ETW N  P ILP+D Y +A VRFWAK+I +    +   F +A+G+ K
Sbjct  63   PISESLVILDYIEETWQN-NP-ILPKDPYDRAVVRFWAKFIDEKILKIASKFKAAKGEEK  120

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
                 E        + +       E+     +++G LDI     +   +  +EVL +K I
Sbjct  121  KQVLEELGE-----QLKILEKELEEKEFFGGETIGYLDIVAFFIVYWFQVRQEVLQIKFI  175

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEK  206
             EEK P ++ W+E L ++  V E LPP EK
Sbjct  176  SEEKFPVVWKWMEKLHQIDFVSECLPPKEK  205



>ref|XP_004490102.1| PREDICTED: LOW QUALITY PROTEIN: glutathione S-transferase U10-like 
[Cicer arietinum]
Length=222

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 127/215 (59%), Gaps = 7/215 (3%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
             V+L G W S+Y  KVELAL  K  P++Y EEDLRNKS  LLQ N +HKKVP+LLH G+P
Sbjct  7    EVVLLGYWASSYCSKVELALNXKAXPYKYEEEDLRNKSDLLLQHNYVHKKVPILLHKGKP  66

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            I ES +I+EYI + W++  P++  ED YQ+AKVR WA Y  Q           ++  + N
Sbjct  67   ICESNIILEYIYDIWDH-SPKLFTEDPYQRAKVRLWANYFDQKIIPCPYRIFQSKEGDIN  125

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             A  E    L++ E+  +     +    + ++LGLLDI + AT   +K +E      +  
Sbjct  126  KAIEEIDEILKVFEEGVKEDFDEQFQFFNGETLGLLDIVVAATCCTYKXIE------VFT  179

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLE  188
             E  P  F WV +L E PL++ETL PH+K V++L+
Sbjct  180  HENTPMFFMWVNALKEHPLIKETLLPHDKLVAKLK  214



>gb|KDP42500.1| hypothetical protein JCGZ_00297 [Jatropha curcas]
Length=221

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 135/214 (63%), Gaps = 10/214 (5%)
 Frame = -3

Query  811  WMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESIVI  632
            W S++A +   ALK+KGI +E V EDL NKSP LLQ NP++KKVP+LLHNG+P+ ES+VI
Sbjct  11   WSSSFALRAVWALKLKGIEYETVYEDLSNKSPLLLQYNPVYKKVPVLLHNGKPLCESLVI  70

Query  631  VEYIDETWNNLRPRILPEDAYQKAKVRFWAKY-IHQLSDTMKKAFISARGQNKNAAFSEF  455
            +EYIDETW   +  +LPED  ++A+ RFWAK+   ++  ++       +G+ +  A    
Sbjct  71   LEYIDETWK--QNPLLPEDPLERARARFWAKFGDDKVFQSIVYGIFLKQGKEQEEAIPLA  128

Query  454  FVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAV-EEVLGMKIIDEEKHP  278
              NL+ LEKE R      +     + +GLLD+AL   L  H  V EE+LG K+ID++K P
Sbjct  129  IENLKHLEKELR-----GKKFFGGEKIGLLDLAL-GWLAHHNGVFEEILGFKLIDQQKFP  182

Query  277  FIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
             +  W++     P+++E  PP +K V++ E I++
Sbjct  183  LLVQWIQEFANAPVIQENWPPRDKLVAKFEAIRK  216



>emb|CDP06552.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 132/220 (60%), Gaps = 17/220 (8%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W+S + + VE+AL IKGI +EY+EEDL NKSPQLLQ NP++KK+P+LLHNG+
Sbjct  2    EEVKLFGYWVSPFCRSVEIALNIKGIQYEYIEEDLTNKSPQLLQYNPVYKKIPVLLHNGK  61

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
            PIVES+VI+EYIDETW N  P ILPED ++KA+ RFWA ++ Q       K  + ++   
Sbjct  62   PIVESMVILEYIDETWKN-NP-ILPEDPFEKARARFWANFVDQKCFPALWKTIWSTSEQY  119

Query  481  NKNAAFSEFFVNLEILEKE---TRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVL  311
             +N A  E    L++LE E    R F           S+G++DI         + ++E L
Sbjct  120  EQNKA--EALERLKVLENELGGKRFF--------GGDSIGMVDIVANFIGFSFRTIQEAL  169

Query  310  GMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
             + +  E+  P ++ W E+      V++ LPP +K ++  
Sbjct  170  KLDVFTEDNFPKLWEWAENFANCSPVKKCLPPQDKLIANF  209



>ref|XP_004505976.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=222

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/219 (37%), Positives = 138/219 (63%), Gaps = 5/219 (2%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            +V LHG W S +  +V L LK+KGIP+E +EED  NKSPQLL+ NP+HKK P+L+H+G+P
Sbjct  3    QVKLHGFWYSPFTLRVVLTLKLKGIPYENIEEDRFNKSPQLLEYNPVHKKTPVLVHDGKP  62

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            + ES++IVEYIDE W      +LP D Y++A+ RFW KY  ++   +   F S+  + + 
Sbjct  63   LCESMIIVEYIDEKWPQY--PLLPVDPYERAQARFWVKYADEMIPAVGALFSSSGVEERE  120

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             + ++ + +L+++E+    +   E+      ++ ++DIA  + +     +E+++ +KI+D
Sbjct  121  NSINKIWEHLKVVEQHCFGY---EKNIFGGNTINIVDIAFGSAIKFLITIEDIIEVKILD  177

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
             EK P + SW  +  + P++ E LP H+K V+ ++ + Q
Sbjct  178  AEKFPHLHSWFNNFKDAPVINENLPDHQKVVAFIKSLLQ  216



>ref|XP_007036677.1| Tau class glutathione transferase GSTU26 [Theobroma cacao]
 gb|EOY21178.1| Tau class glutathione transferase GSTU26 [Theobroma cacao]
Length=224

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 126/208 (61%), Gaps = 11/208 (5%)
 Frame = -3

Query  808  MSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESIVIV  629
            +S +  ++E ALK+KG+ +EY+EEDLRNKSP LL  NP+HKKVP+LL NG+PI ES++I+
Sbjct  11   LSVFCARIEWALKLKGVGYEYLEEDLRNKSPLLLTHNPVHKKVPVLLQNGKPIAESLIIL  70

Query  628  EYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISAR--GQNKNAAFSEF  455
            EYI+ETW +    +LPED Y+KA  RFWAK+  +    +  AF + R  G  K  A    
Sbjct  71   EYIEETWKD--SPLLPEDPYEKAMARFWAKFADE--KCLHGAFDACRAVGDEKEKAIESA  126

Query  454  FVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEKHPF  275
              +   LEK+        +     + +G LD+AL         +EEV  MK++D ++ P 
Sbjct  127  AKSFAFLEKQLE-----GKKYFGGEQIGYLDLALGWIPHWLNVMEEVGCMKLVDTQRTPL  181

Query  274  IFSWVESLLELPLVRETLPPHEKAVSRL  191
            +  W +  +E+PL++E LPP +K + R 
Sbjct  182  LHQWGQEFMEIPLIKECLPPRDKLLGRF  209



>ref|XP_006437360.1| hypothetical protein CICLE_v10032686mg [Citrus clementina]
 gb|ESR50600.1| hypothetical protein CICLE_v10032686mg [Citrus clementina]
Length=225

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 141/221 (64%), Gaps = 9/221 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L   W S +  +    LK+KG+ F++V+EDL NKSP LLQ NP++KKVP+L+HNG+
Sbjct  3    EEVKLLKTWSSPFGLRAFWILKLKGVQFDFVDEDLSNKSPLLLQSNPVYKKVPVLIHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            PI ES+VI+EY+DETW    P +LPED Y++A+ RFWAK+   ++  ++  AFI  +G+ 
Sbjct  63   PISESLVILEYVDETWKQ-NP-LLPEDPYERARARFWAKFGEDKVLVSIWNAFIK-QGKE  119

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A       L+ LE+E +      +     + +GL D+AL     +    EEV+G+K+
Sbjct  120  QEEAIGLAIETLKFLEEELK-----GKRFFGGEKIGLADLALGWLANLIGVFEEVIGVKL  174

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            I++E+ P + +W++   E P+++E+ PPHEK V++   I++
Sbjct  175  IEKERFPLLSAWMQEFAEAPVIKESWPPHEKLVTKFRAIRE  215



>ref|XP_006484731.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=225

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 141/221 (64%), Gaps = 9/221 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L   W S +  +    LK+KG+ F++++EDL NKSP LLQ NP++KKVP+L+HNG+
Sbjct  3    EEVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            PI ES+VI+EY+DETW    P +LPED Y++A+ RFWAK+   ++  ++  AFI  +G+ 
Sbjct  63   PISESLVILEYVDETWKQ-NP-LLPEDPYERARARFWAKFGEDKVLVSIWNAFIK-QGKE  119

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A       L+ LE+E +      +     + +GL D+AL     +    EEV+G+K+
Sbjct  120  QEEAIGLAIETLKFLEEELK-----GKRFFGGEKIGLADLALGWLANLIGVFEEVIGVKL  174

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            I++E+ P + +W++   E P+++E+ PPHEK V++   I++
Sbjct  175  IEKERFPLLSAWMQEFAEAPVIKESWPPHEKLVTKFRAIRE  215



>ref|XP_011004953.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=225

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/223 (38%), Positives = 138/223 (62%), Gaps = 9/223 (4%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L   W S +  ++  ALK+KG+ FE ++EDL NKSP LL  NP+HKK+P+L+H+G+P+
Sbjct  5    VKLFKTWSSPFGIRIVWALKVKGVQFEQIDEDLANKSPLLLLYNPVHKKIPVLVHDGKPV  64

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKY-IHQLSDTMKKAFISARGQNKN  473
            VES+VI+EYI+ETW   +  + PED  ++A  RFWAK+   ++  ++ +AFI  R + + 
Sbjct  65   VESLVILEYIEETWK--QNPLFPEDPLERAAARFWAKFGDDKVMPSIWEAFIKGR-EEEE  121

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             AF+  F NL+ LE+E +      +     + +G++DIA      +    EE+  +K+ID
Sbjct  122  CAFAPAFENLKFLEEELK-----GKQFFGGERIGIVDIAFGWLANLVPVFEEIHAIKVID  176

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGFI  164
            EE+ P +++W++     PL+ +  PPHEK V++   I+    +
Sbjct  177  EERFPSLYAWMQEFSRAPLIADCWPPHEKLVNKFRAIRDQSLL  219



>gb|KDO46806.1| hypothetical protein CISIN_1g027333mg [Citrus sinensis]
Length=225

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 141/221 (64%), Gaps = 9/221 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L   W S +  +    LK+KG+ F++++EDL NKSP LLQ NP++KKVP+L+HNG+
Sbjct  3    EEVKLLKTWSSPFGLRAFWILKLKGVQFDFIDEDLSNKSPLLLQSNPVYKKVPVLIHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKY-IHQLSDTMKKAFISARGQN  479
            PI ES+VI+EY+DETW    P +LPED Y++A+ RFWAK+   ++  ++  AFI  +G+ 
Sbjct  63   PISESLVILEYVDETWKQ-NP-LLPEDPYERARARFWAKFGDDKVLASIWNAFIK-QGKE  119

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            +  A       L+ LE+E +      +     + +GL D+AL     +    EEV+G+K+
Sbjct  120  QEEAIGLAIETLKFLEEELK-----GKRFFGGEKIGLPDLALGWLANLIGVFEEVIGVKL  174

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            I++E+ P + +W++   E P+++E+ PPHEK V++   I++
Sbjct  175  IEKERFPLLSAWMQEFAEAPVIKESWPPHEKLVTKFRAIRE  215



>ref|XP_010278876.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=225

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/217 (39%), Positives = 133/217 (61%), Gaps = 9/217 (4%)
 Frame = -3

Query  823  LHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVE  644
            L G W S ++ +V+LALK+KGI +EY EEDL+NKSP+LL+ +P+HKK+P+L+H+G+PIVE
Sbjct  8    LFGAWFSPFSFRVKLALKLKGIQYEYAEEDLQNKSPELLKYSPVHKKIPVLVHDGKPIVE  67

Query  643  SIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ-LSDTMKKAFISARGQNKNAA  467
            S++I+EYIDETW   +  +LPED Y++A VRFW  +  +   + +++A  S  G  +   
Sbjct  68   SLIILEYIDETWK--QNPLLPEDPYERAMVRFWVTFAEEKFIEALRRALFS-EGTKQEKE  124

Query  466  FSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEE  287
              +    LEILE+E +      +     +++G LDIAL         +EEV   K+ D  
Sbjct  125  VKQIAEALEILERELK-----GKKFFGGETIGFLDIALSWVPAWLGVMEEVASFKVFDSN  179

Query  286  KHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            K P    W+++  E  + +ET PP ++ +   +  +Q
Sbjct  180  KFPCFKEWMDNFQEFSITKETFPPRDELLVFFQNFRQ  216



>gb|ADB11327.1| tau class glutathione transferase GSTU45 [Populus trichocarpa]
Length=220

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 133/213 (62%), Gaps = 7/213 (3%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L G W S ++++VE+ALK+KG+ +EY++EDL NKSP LL+ NPIHKKVP+LLHNG+ +
Sbjct  4    VKLLGAWGSPFSRRVEMALKLKGVEYEYIDEDLANKSPLLLKYNPIHKKVPVLLHNGKTM  63

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
             ES+VI+EYIDETW +  P ILPED Y KA  RFWAK+I +         + ++   +  
Sbjct  64   AESLVILEYIDETWKS-NP-ILPEDPYDKAMARFWAKFIDEKCMPAIWQIMLSKENEREK  121

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDE  290
            A  E   +L+ LE E +     ++     +++GL+DI          A +E  GM+++++
Sbjct  122  AIEEAIQHLKTLENELK-----DKKFFGGETIGLVDIVANFIGFWLGAAQEATGMELVNK  176

Query  289  EKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
            E+ P +  W++      +V+E LPP +K ++ L
Sbjct  177  ERFPVLCKWIDEYANCSVVKENLPPRDKLIAFL  209



>emb|CBI16040.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 133/210 (63%), Gaps = 7/210 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W S +++++E+ALK+KG+ FEY+EE+L NKSP LL+ NP+HKK+P+L+HNG+
Sbjct  134  EEVKLFGTWASPFSRRIEVALKLKGVQFEYIEENLSNKSPALLKYNPVHKKIPVLVHNGK  193

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES+VI+EYIDETW +  P ILP D Y+KA  RFWAKY+           + ++G+ +
Sbjct  194  PVAESLVILEYIDETWKH-NP-ILPTDPYEKAMARFWAKYMDDKLWPAATKVVVSKGEEQ  251

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
             A   E    L+ LE E +     E+     +SLG +DIA    + +  A E +  M+I+
Sbjct  252  KAVIEEIQEQLKTLESELK-----EKKFFGGESLGFVDIAANIIVFLLVAQEALGLMEIL  306

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEK  206
             EEK P +  W + L++  + +E +PP E+
Sbjct  307  TEEKFPVLHEWYQRLVDDAVFKECVPPRER  336


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 63/122 (52%), Gaps = 12/122 (10%)
 Frame = -3

Query  553  RFWAKYIHQLSDTMKKAFIS---ARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISA  383
            RFWAKY   + D +  A I    ++G+ +     E    L+ LE E +     E+     
Sbjct  3    RFWAKY---MDDKLLPAAIKVAMSKGEEQKGVIEEIQKQLKTLESELK-----EKKFFGG  54

Query  382  QSLGLLDIALVATLGMHKAVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKA  203
            +SLG +DIA   T+      +E LGM+I+ EEK P +  W + L++  + +E +PP E+ 
Sbjct  55   ESLGFVDIA-ANTIVWLVVAQEALGMEILTEEKFPVLHGWYQRLVDDAVFKECMPPREQH  113

Query  202  VS  197
            +S
Sbjct  114  LS  115



>gb|EMT08874.1| hypothetical protein F775_30884 [Aegilops tauschii]
Length=232

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 118/214 (55%), Gaps = 2/214 (1%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
             D + L G W S +  +V+LAL +KG+ +EYVE+DL NKS  LL  NP+HKKVP+L+HNG
Sbjct  4    EDELKLLGTWASPWVSRVKLALHLKGLSYEYVEQDLDNKSDLLLTSNPVHKKVPVLIHNG  63

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ-LSDTMKKAFISARGQ  482
            +PI ES+VI+EYIDE +    P +LP D Y++A  RFW  YI Q L    K AF +   +
Sbjct  64   KPICESVVILEYIDEAYGTTGPSLLPTDPYERAIARFWVDYIDQKLVIPWKVAFTADGEE  123

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             K     +    ++ LE   +  C   +P     S+G +DIAL   L   +  EE+ G K
Sbjct  124  EKTEGIKQMLAVVQTLEGALKE-CSKGKPFFGGDSVGYVDIALGGLLAFLQGTEELCGTK  182

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAV  200
              D    P + +WVE    L   +  LP   K V
Sbjct  183  PFDIANTPLLLAWVERFTALDAAKVALPDVTKLV  216



>gb|ADE76765.1| unknown [Picea sitchensis]
Length=236

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 128/217 (59%), Gaps = 2/217 (1%)
 Frame = -3

Query  853  ENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPM  674
            E      +V L GM  S +  +V +AL +KGI +E++EED +NKS  LLQ NP+HKK+P+
Sbjct  2    EACGEEGQVKLLGMARSPFVVRVRIALALKGIDYEFIEEDFQNKSQLLLQSNPVHKKIPV  61

Query  673  LLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFIS  494
            LLHNG+P+ ES++IV+YIDETW+   P ++P+D Y +A  RFWA ++       ++A ++
Sbjct  62   LLHNGKPVCESMIIVQYIDETWDTKAPNLMPKDPYDRAIARFWAAFVDDKLVPCEEA-LT  120

Query  493  ARGQNKNAAFSEFFVNLEILEKETRV-FCPMERPKISAQSLGLLDIALVATLGMHKAVEE  317
            ++G+ +  A  +   N  +LE+  R   C   +P      +G +DIAL   L   K +E+
Sbjct  121  SQGEQQQKAVEDSVANFLVLEEALRTSLCFSGKPYFGGDEIGFVDIALGGMLTFVKTLEK  180

Query  316  VLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
                 +ID EK P + +W++   +   V+E +P   K
Sbjct  181  ATNSVLIDVEKMPLLSAWMDRFCKADGVKEVMPDPAK  217



>ref|XP_002264117.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 132/218 (61%), Gaps = 10/218 (5%)
 Frame = -3

Query  823  LHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVE  644
            L   W S +A ++  ALKIKG+ +E + EDL NKSP LLQ NP+HKKVP+L+HNG+PI E
Sbjct  7    LFRTWSSVFALRIVWALKIKGVEYETIFEDLSNKSPSLLQYNPVHKKVPVLVHNGKPIAE  66

Query  643  SIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQNKNA  470
            S+VI+EYIDETW      +LPED Y++A  RFWAK+     L+  +   F    G+ +  
Sbjct  67   SLVILEYIDETWRE--TPLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFFK-EGKEQEE  123

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDE  290
            A  E   +L+ LE E +      +     + +G +D+AL     M    EEV G+K++DE
Sbjct  124  AMLEAMEHLQFLEDELK-----GKRFFGGERIGFVDLALGWLANMISIFEEVAGLKMVDE  178

Query  289  EKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            +K P + +W++   + P++++  PP +K +++ + ++ 
Sbjct  179  DKFPLLAAWMQEFADSPIIKDNWPPRDKMIAKFQALRD  216



>ref|XP_011000057.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
 ref|XP_011000058.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 133/213 (62%), Gaps = 7/213 (3%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L G W S ++++VE+ALK+KG+ +EY+E+DL NKSP LL+ NPIHKKVP+LLHNG+ +
Sbjct  4    VKLLGAWGSPFSRRVEMALKLKGVEYEYIEQDLANKSPLLLKYNPIHKKVPVLLHNGKAM  63

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
             ES+VI+EYIDETW +  P ILPED Y KA  RFWAK+I +         + ++   +  
Sbjct  64   AESLVILEYIDETWKS-NP-ILPEDPYDKAMARFWAKFIDEKCMPAIWQIMWSKENEREK  121

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDE  290
            A  E   +L+ LE E +     ++     +++GL+DI          A  E  GM+++++
Sbjct  122  AIEEAIQHLKTLENELK-----DKKFFGGETIGLVDIVANFIGFWLGAAAEATGMELVNK  176

Query  289  EKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
            E+ P +  W++  +   +V+E +PP +K ++ L
Sbjct  177  ERFPILCKWIDEYVNCSVVKENIPPRDKLIAFL  209



>ref|XP_006644548.1| PREDICTED: probable glutathione S-transferase GSTU6-like [Oryza 
brachyantha]
Length=239

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 128/229 (56%), Gaps = 9/229 (4%)
 Frame = -3

Query  823  LHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVE  644
            L G W S +  +V +AL+ KG+ ++YVEEDL  KS  LL+ NP+HKKVP+L+H G+P+ E
Sbjct  15   LLGTWSSPWVIRVRVALETKGLSYDYVEEDLSRKSDLLLKSNPLHKKVPVLIHGGQPVCE  74

Query  643  SIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ-LSDTMKKAFISARGQNKNAA  467
            S+VI+EY+DE W    P +LP D Y +A  RFWA Y++     + K  F S     +  A
Sbjct  75   SLVILEYVDEAWAGAGPPLLPADPYDRAAARFWASYVNDTFFPSWKALFRSTTTDQRAEA  134

Query  466  FSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEE  287
            F      +E LE+  R  C   +   +  + GL+D+AL + L   K V+EV G  + DE 
Sbjct  135  FKNVVPQVETLERAFRE-CSKGKAFFAGDAAGLVDVALGSHLVWIKVVDEVAGTNLFDEA  193

Query  286  KHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQH-GFI**WNSAT  143
            K P + +W E  L L  V++  P         E++KQ+ GF+  WN   
Sbjct  194  KFPGLAAWAERFLSLDAVKKAAPDAG------EVLKQYEGFLAKWNEGA  236



>ref|XP_002465034.1| hypothetical protein SORBIDRAFT_01g030930 [Sorghum bicolor]
 gb|EER92032.1| hypothetical protein SORBIDRAFT_01g030930 [Sorghum bicolor]
Length=236

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/216 (41%), Positives = 126/216 (58%), Gaps = 6/216 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D + L GMW S Y  +V+LAL +KG+ +EYVEEDLR+KS  LL+ NP+H KVP+L+HNG+
Sbjct  5    DDLKLLGMWASPYVLRVKLALSLKGLSYEYVEEDLRDKSELLLKSNPVHSKVPVLIHNGK  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQN  479
            P+ ES VI++YIDE +    P +LP D Y++A  RFWA YI  +++    K+ +    + 
Sbjct  65   PVCESQVILQYIDEAFAGTGPSLLPADPYERAIARFWAAYIDDKMTPAWNKSTMGKTEEE  124

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            K     +  V LE LE   R  C   +P     S+G +D+ L   LG  +A +E+ G+K 
Sbjct  125  KAEGKKQSLVALETLEGALRD-CGKGKPFFGGDSVGFVDVVLGGMLGWVRAADEMHGVKP  183

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
             D E+ P + +W E    L  V   +P     VSRL
Sbjct  184  FDPERTPQLAAWSERFGALEAVEPVMP----DVSRL  215



>ref|XP_008793317.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=226

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 130/220 (59%), Gaps = 6/220 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W S ++++VELAL++KGI ++Y+EEDL NKSP LL+ NPIHKKVP+ LH G+
Sbjct  3    EEVKLLGSWGSPFSRRVELALRLKGISYDYIEEDLSNKSPLLLKYNPIHKKVPVFLHGGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+VES+VI+EYI+ETW      ILP+D Y++A  RFW+ ++ +             G  +
Sbjct  63   PVVESLVILEYIEETWEGDHA-ILPKDPYERAMARFWSTFVDEKCIPAFWMSCWTEGDMQ  121

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
                 +   NL ILE E +      +      ++G++DIA          ++EV G+ +I
Sbjct  122  QNFMIQSKENLSILEGELK-----GKKFFGGDAIGMVDIAAFFIAHWAGVLQEVAGISLI  176

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            +EEKHP +F W+E  +   +V E LP  E  ++  +  K+
Sbjct  177  NEEKHPILFKWIEEFMSSSIVMECLPAREGLLAYFQAKKE  216



>gb|AFK47124.1| unknown [Lotus japonicus]
Length=221

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 131/209 (63%), Gaps = 9/209 (4%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V   G+  S +A++V++ALK+KGI + Y+EEDLRNKS QLL+ NP+HKKVP+L+HNG+P+
Sbjct  4    VQFFGVGGSPFARRVQIALKLKGIQYTYIEEDLRNKSEQLLKYNPVHKKVPVLVHNGKPL  63

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQNKN  473
             ES+VI+EYIDETWNN    ILP+  Y++A  RFW+++I  ++   + +A  +A  + + 
Sbjct  64   AESLVILEYIDETWNNY--PILPQQPYERALARFWSRFIDDKILPAISRAAWTANQEERE  121

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
                E    L+ LEKE      ++      +++GL+DIA          +EE  G  ++ 
Sbjct  122  KGIQESVEALQFLEKE------LKHKFFGGETIGLVDIAGAFLAFWLPVIEESTGFSLLT  175

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEK  206
             EK P ++ W +  +  P+V+E LPP +K
Sbjct  176  SEKFPKLYKWSQDFINHPVVKENLPPRDK  204



>ref|XP_008793318.1| PREDICTED: glutathione transferase GST 23-like [Phoenix dactylifera]
Length=225

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 132/214 (62%), Gaps = 13/214 (6%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L GMW S   ++VE ALK+KGI +EYVEED+ NKS  L++ NPI+K+VP+LLHNG+PI
Sbjct  7    VKLFGMWASPAVRRVEWALKLKGIKYEYVEEDISNKSGALVRYNPINKQVPVLLHNGKPI  66

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQNKN  473
            VES+VI+EYIDE W +  P ILP+D Y++A  RFWA Y   +  D +++ F +  G+   
Sbjct  67   VESLVILEYIDEVWKH-HP-ILPKDPYERAMARFWAAYSEDKCRDAVRRVFFAEGGERAK  124

Query  472  AAFSEFFVNLEILEKETRVFCPMERPK--ISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            A        +E LE+  R        K     +++G  D+ L          EEV   ++
Sbjct  125  A--------IECLEETLRALDGELEGKEFFGGENIGFSDLVLGWMAFWLGVSEEVASFEV  176

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVS  197
            +D +K P+  SW+++ L++P+++E LPP +K V+
Sbjct  177  LDPKKFPWFTSWIDNFLQVPVIKENLPPRDKTVA  210



>ref|XP_008781207.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
 ref|XP_008781208.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera]
Length=225

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 134/220 (61%), Gaps = 7/220 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V + G W S ++ +V +AL++KG+P+EY+EEDL NKS  LL+ NP+HKKVP+L+H GR
Sbjct  3    EEVKVFGHWTSPFSCRVGIALRLKGVPYEYIEEDLSNKSSLLLEYNPVHKKVPVLVHGGR  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+V++EYI+ETW    P +LP+D +++A  RFW K++ +    +    + + G+ +
Sbjct  63   PIAESLVVLEYIEETWRG-NP-MLPQDPHRRAMARFWTKFVDEKCMPIMWKSLWSEGEMQ  120

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
                 E   NL ILE+E        +      S+GL+DIA        + ++EV G+ + 
Sbjct  121  QKLMEETNENLSILERELD-----GKKFFGGNSIGLVDIAANFLSYWTEVLQEVAGISLF  175

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            +EEKHP +F W    +    V+E LPP ++ +S  + +K+
Sbjct  176  NEEKHPILFKWANEFMSSDAVKECLPPKDELLSHFQAMKE  215



>ref|XP_002532525.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF29859.1| glutathione s-transferase, putative [Ricinus communis]
Length=224

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 131/209 (63%), Gaps = 11/209 (5%)
 Frame = -3

Query  817  GMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESI  638
            G + S +  +VE ALKIKG+ +EY++EDLRNKSP LL+ NP+HKKVP+L+H  +PI ES+
Sbjct  8    GSYTSLFCTRVEWALKIKGVEYEYLKEDLRNKSPILLKVNPVHKKVPVLVHEEKPIAESL  67

Query  637  VIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISA--RGQNKNAAF  464
            VI+EYIDETWN  +  + P+D Y++A  RFWAK+       +  AF +    G+ K  A 
Sbjct  68   VILEYIDETWN--KNPLFPQDPYERAMARFWAKFAD--DKCLYGAFHACWKEGEEKEKAI  123

Query  463  SEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEK  284
                 +  +LE++ +      +   + + +G LD+AL         +EEV GMK++D EK
Sbjct  124  ESAMESFAMLEEQIK-----GKKFFNGEQIGYLDLALGWIPYWLNVMEEVGGMKLVDAEK  178

Query  283  HPFIFSWVESLLELPLVRETLPPHEKAVS  197
             P +  W +S +E+PL++E LPP ++ V+
Sbjct  179  FPSLHEWTQSFIEIPLIKECLPPRDQLVN  207



>ref|XP_009593034.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana tomentosiformis]
Length=225

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/210 (42%), Positives = 133/210 (63%), Gaps = 10/210 (5%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L G W S YA +V  ALK+KG+ ++Y EEDL NKSP LLQ NP+HKK+P+L+HNG+PI
Sbjct  6    VKLLGYWASPYALRVHWALKLKGVEYDYQEEDLPNKSPLLLQYNPVHKKIPVLVHNGKPI  65

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
             ES+VI+EYIDETW   +  +LPED Y++AK RFWAK++         A  S  G+ +  
Sbjct  66   AESLVILEYIDETWK--QNPLLPEDPYERAKARFWAKFVDDKCVPGIFATFSKVGEEQQK  123

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQS-LGLLDIALVATLGMHKAVEEVLGMKIID  293
               E   NL++LE E      +++ +    + +G +D+A    +   + VEE++ +K+ID
Sbjct  124  IVKEARENLKLLEGE------LDKKRFFGDTRIGFIDVASAWIICWAQIVEEIIDIKLID  177

Query  292  EEKHPFIFSWVESLLE-LPLVRETLPPHEK  206
             E+ P +  W +++LE  P+++E  PP +K
Sbjct  178  AEEMPSLVVWFQNILEAAPILKECTPPKDK  207



>ref|XP_002277759.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=221

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/207 (40%), Positives = 126/207 (61%), Gaps = 7/207 (3%)
 Frame = -3

Query  817  GMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESI  638
            G  +S +  +VE ALK+KG+ +EY+EEDLRNKSP LLQ NP+HKKVP+L+ +GRPI ES+
Sbjct  8    GASLSFFCCRVEWALKLKGVAYEYLEEDLRNKSPMLLQSNPVHKKVPVLVQDGRPIAESL  67

Query  637  VIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNAAFSE  458
            VI+EYIDE W      +LPED  ++AK RFWA++  +       A   A+G  +  A   
Sbjct  68   VILEYIDEAWKGY--PLLPEDPSERAKTRFWARFTDEKCVLGAWAACCAKGHEREKAIES  125

Query  457  FFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEKHP  278
               +L  LEK+        +     +++GLLD+ + +     + +EE  GMK++DEEK P
Sbjct  126  AQESLSFLEKQIE-----GKKFFGGETMGLLDLVVGSLPNWIEFLEEHGGMKLLDEEKFP  180

Query  277  FIFSWVESLLELPLVRETLPPHEKAVS  197
             ++ W +  + +P++ E +P  E  ++
Sbjct  181  SLYEWAQKFINIPIISERIPTKEGLIN  207



>emb|CAN72240.1| hypothetical protein VITISV_010777 [Vitis vinifera]
Length=225

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 131/218 (60%), Gaps = 10/218 (5%)
 Frame = -3

Query  823  LHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVE  644
            L   W S +A ++  ALKIKG+ +E + EDL NKSP LLQ NP+HKKVP+L+HNG+PI E
Sbjct  7    LFRTWSSVFALRIVWALKIKGVEYETIFEDLSNKSPSLLQYNPVHKKVPVLVHNGKPIAE  66

Query  643  SIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQNKNA  470
            S+VI+EYIDETW      +LPED Y++A  RFWAK+     L+  +   F    G+ +  
Sbjct  67   SLVILEYIDETWRE--TPLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFFK-EGKEQEE  123

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDE  290
            A  E   +L+ LE E +      +     + +G +D+AL     M    EEV G+K++DE
Sbjct  124  AMLEAMEHLQFLEDELK-----GKRFFGGERIGFVDLALGWLANMISIFEEVAGLKMVDE  178

Query  289  EKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            +K P + +W++   + P++++  PP +K + + + ++ 
Sbjct  179  DKFPLLAAWMQEFADSPIIKDNWPPRDKMIXKFQALRD  216



>gb|KDP42181.1| hypothetical protein JCGZ_02911 [Jatropha curcas]
Length=224

 Score =   164 bits (414),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 135/220 (61%), Gaps = 16/220 (7%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            MGE       V L G W S ++ +++LALK+KGI +EY+E+DL NKS  LL+ NP+HKK+
Sbjct  1    MGEGE-----VKLLGTWASPFSHRIKLALKLKGIQYEYIEQDLTNKSTLLLKSNPVHKKI  55

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKK  506
            P+LLHNG+PI ES+VI+EY+DE W N  P  LPED Y KA  RFWA ++ Q  L  T+K 
Sbjct  56   PVLLHNGKPIAESLVILEYVDEKWQN-NP-FLPEDPYNKAMARFWATFVDQKILQVTLKA  113

Query  505  AFISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKA  326
            +  +A G+ K     E    L++LE E       E+     +++G LDI   + L   + 
Sbjct  114  S--AATGEEKEQILEEVDQYLKLLENELN-----EKDLFGGENIGYLDIVAFSILYFFQI  166

Query  325  VEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
             +E++ +++I EEK P +  W+  + E+  V ++LPP ++
Sbjct  167  RKEIMRIELISEEKFPVLNRWIGKICEVDEVNQSLPPKDR  206



>ref|NP_001065124.1| Os10g0528400 [Oryza sativa Japonica Group]
 gb|AAG32472.1|AF309379_1 putative glutathione S-transferase OsGSTU3 [Oryza sativa Japonica 
Group]
 gb|AAM12325.1|AC091680_26 putative glutathione S-transferase [Oryza sativa Japonica Group]
 gb|AAM94544.1| putative glutathione S-transferase [Oryza sativa Japonica Group]
 gb|AAP54745.1| glutathione S-transferase GSTU6, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27038.1| Os10g0528400 [Oryza sativa Japonica Group]
 gb|EAZ16756.1| hypothetical protein OsJ_32232 [Oryza sativa Japonica Group]
Length=233

 Score =   164 bits (414),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 122/210 (58%), Gaps = 8/210 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D + L GMW S +A + +LAL  KG+ +EYVEEDL+NKS  LL  NP+HKKVP+L+HNG+
Sbjct  6    DELKLLGMWASPFALRAKLALSFKGLSYEYVEEDLKNKSELLLTSNPVHKKVPVLIHNGK  65

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQN  479
            P+ ES VIV+YIDE + +    +LP D Y +A  RFWA YI  +L  +  +A +    Q 
Sbjct  66   PVCESQVIVQYIDEAFPDAGVPLLPSDPYDRAVARFWAAYIDDKLLKSWLQASMCKTEQE  125

Query  478  KNAAFSEFF---VNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLG  308
            K AA  E F    NLE   KE    C   +P     ++G +D+ L A +G  +  E V G
Sbjct  126  KAAAMKETFAAVANLEAAFKE----CSKGKPFFGGDAVGYVDVTLGAVIGFVRVGEAVHG  181

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRETLP  218
            M++ D  + P + +W++    L   +  LP
Sbjct  182  MRLFDASRSPLLDAWLDRFAALDAAKAVLP  211



>ref|XP_010276441.1| PREDICTED: glutathione S-transferase U7-like [Nelumbo nucifera]
Length=251

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 135/222 (61%), Gaps = 9/222 (4%)
 Frame = -3

Query  853  ENHHHH-----DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIH  689
            +NH        D+V L G W S+Y  + +LALK+KG+ FEYVEE+L NKSPQLL  NP++
Sbjct  5    DNHQQESFVCVDQVKLFGSWASSYTHRAQLALKLKGVEFEYVEEELTNKSPQLLLYNPVY  64

Query  688  KKVPMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTM  512
            KKVP+LLH  + + ES++I++YIDETW+   P ILP++ Y+++ VRFW+ +   QL  ++
Sbjct  65   KKVPVLLHGDKAVAESVIILQYIDETWSE-NP-ILPDNPYERSLVRFWSHFADDQLGPSV  122

Query  511  KKAFISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMH  332
               F S  G+ + AA  +   NL++LEKE        R       +G+LDI L       
Sbjct  123  GLVFRST-GEQQKAAVEQVNDNLKLLEKEMEEGYFKGRRFFGGDKIGMLDIVLGCGSYWL  181

Query  331  KAVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
              +EEV G+K+++  + P   SW+    E P V+ET+PP +K
Sbjct  182  WVLEEVAGVKLVESGRFPRFHSWLRDFEEQPEVKETIPPTDK  223



>ref|XP_010650966.1| PREDICTED: glutathione S-transferase U8 [Vitis vinifera]
Length=220

 Score =   163 bits (412),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 140/217 (65%), Gaps = 8/217 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W S Y++++ELALK+KG+ FEY+EE+L NKSP LL+ NP+HKKVP+L+HNG+
Sbjct  3    EEVKLFGAWGSPYSRRIELALKLKGLQFEYIEENLYNKSPALLKYNPVHKKVPVLVHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES+VI+EYIDETW +  P  LP D Y+KAK RFWA++I +      K  +++RG+ +
Sbjct  63   PVAESLVILEYIDETWKH-NP-FLPTDPYEKAKARFWARFIDEKFWPAAKKAMASRGRER  120

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  E   +L+ LE E +     E+     +SLG +DIA      +  A +E  G++I+
Sbjct  121  EEAIEEAQQHLKTLESELK-----EKKIFGRESLGFVDIAAHLLFWLVVA-QEAFGVEIL  174

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLEL  185
             EEK P +    + L +  + +E +PP E+ ++ L++
Sbjct  175  TEEKFPAVHELYQRLADEAVFKECMPPKEQLIAYLKV  211



>pdb|2VO4|A Chain A, Glutathione Transferase From Glycine Max
 pdb|2VO4|B Chain B, Glutathione Transferase From Glycine Max
Length=219

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 127/211 (60%), Gaps = 8/211 (4%)
 Frame = -3

Query  838  HDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNG  659
             D V+L   W S +  +V +AL  KGI +EY EEDLRNKSP LLQ NP+HKK+P+L+HNG
Sbjct  2    QDEVVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNG  61

Query  658  RPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQN  479
            +PI ES++ V+YI+E WN+  P +LP D YQ+A+ RFWA Y+ +    + +   +++G+ 
Sbjct  62   KPICESLIAVQYIEEVWNDRNP-LLPSDPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEE  120

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            K AA  EF   L++LE++       ++      +LG +DIALV      KA E    + I
Sbjct  121  KEAAKKEFIEALKLLEEQLG-----DKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNI  175

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
              E + P   +W +  L+   V ++LP  +K
Sbjct  176  --ESECPKFIAWAKRCLQKESVAKSLPDQQK  204



>ref|XP_004978487.1| PREDICTED: glutathione transferase GST 23-like [Setaria italica]
Length=231

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 139/232 (60%), Gaps = 13/232 (6%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            M        +V L G W S Y  KV  AL+IKG+ ++Y+EEDL NKS QLL+ NP+HKKV
Sbjct  1    MNHQQEGDKQVKLFGFWPSPYVLKVIWALRIKGVEYDYIEEDLSNKSDQLLEYNPVHKKV  60

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKA  503
            P+L++ G+PI ES VI+++IDE W +    ILPED Y++A  RFW +++  +LS  + K 
Sbjct  61   PVLVYQGKPIAESEVIIQFIDEAWKDRGDPILPEDPYERAMARFWVRFLQDKLSPPIWKW  120

Query  502  FISARGQNKNAAFSEFFVNLEILEKE---TRVFCPMERPKISAQSLGLLDIALVATLGMH  332
            F + +GQ +  A       L +LEKE    R F        + + +G +D++L     + 
Sbjct  121  F-TTQGQQQEDAHGAAIDQLLVLEKELDGKRFF--------AGEKIGFVDLSLGPLSYVI  171

Query  331  KAVEEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
               EE+ G+K+I EEK P + +W+ + L  P+V++ LPP +K   RL+ I++
Sbjct  172  PIYEEITGVKMITEEKLPSLSAWMGNFLSSPVVKDHLPPLDKLRLRLQAIRE  223



>ref|XP_006354570.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Solanum 
tuberosum]
Length=225

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 133/219 (61%), Gaps = 6/219 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D V L+  W S ++ ++  AL IKGI +E + EDL +KSPQLLQ NP+HKKVP+L+H G+
Sbjct  3    DEVKLYRTWSSRFSLRIVWALHIKGIEYEAIFEDLSHKSPQLLQYNPVHKKVPVLVHQGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQN  479
            PI ES+VI+EYIDETW      +LP+D Y+KA  RFWAK++  +L  ++   F     + 
Sbjct  63   PICESLVILEYIDETWKKETTPLLPQDPYEKAMARFWAKFVDDKLLPSVTSVFTEKGYEA  122

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            K  A      NLE++E++ +      +     +S+G +D+ L     +    EEV+ +K+
Sbjct  123  KKEALVPAVQNLELIEEQLK-----GKKFFGGESIGYVDLVLGWMAFLLDVFEEVIDLKL  177

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELI  182
             D  K P +  W+++  + P +++ LPP ++ V++ +L+
Sbjct  178  FDAHKFPLLSGWMKNFCDAPAIKQHLPPRDRLVTKYQLL  216



>ref|XP_002281694.2| PREDICTED: uncharacterized protein LOC100246830 [Vitis vinifera]
Length=446

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 133/210 (63%), Gaps = 7/210 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L G W S +++++E+ALK+KG+ FEY+EE+L NKSP LL+ NP+HKK+P+L+HNG+
Sbjct  3    EEVKLFGTWASPFSRRIEVALKLKGVQFEYIEENLSNKSPALLKYNPVHKKIPVLVHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES+VI+EYIDETW +  P ILP D Y+KA  RFWAKY+           + ++G+ +
Sbjct  63   PVAESLVILEYIDETWKH-NP-ILPTDPYEKAMARFWAKYMDDKLWPAATKVVVSKGEEQ  120

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
             A   E    L+ LE E +     E+     +SLG +DIA    + +  A E +  M+I+
Sbjct  121  KAVIEEIQEQLKTLESELK-----EKKFFGGESLGFVDIAANIIVFLLVAQEALGLMEIL  175

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEK  206
             EEK P +  W + L++  + +E +PP E+
Sbjct  176  TEEKFPVLHEWYQRLVDDAVFKECVPPRER  205


 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 132/206 (64%), Gaps = 10/206 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L GMW S +++++E+ALK+KGI +EY+EEDL NKSP LL+ NP+HKK+P+LLH G+
Sbjct  230  EEVKLFGMWASPFSRRIEVALKLKGIQYEYIEEDLSNKSPSLLKYNPVHKKIPVLLHKGK  289

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ-LSDTMKKAFISARGQN  479
            P+ ES+VI+EYIDETW +  P ILP D Y++A  RFWAK++ + L    KK  +S +G+ 
Sbjct  290  PVAESLVILEYIDETWKH-NP-ILPADPYERAMARFWAKFLDEKLWPAAKKVALS-KGEE  346

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
             N    E   +L+ LE E +     E+     +SLG +DIA      +   V+E LG+ I
Sbjct  347  HNGLIEEIQEHLKTLESELK-----EKKFFGGESLGFVDIAADIIFWLL-VVQETLGLDI  400

Query  298  IDEEKHPFIFSWVESLLELPLVRETL  221
            + E+K P +  W   LL+  + +E +
Sbjct  401  LTEDKFPGLHEWYHRLLDDAVFKECV  426



>ref|NP_001237713.1| 2,4-D inducible glutathione S-transferase [Glycine max]
 pdb|4TOP|A Chain A, Glycine Max Glutathione Transferase
 pdb|4TOP|B Chain B, Glycine Max Glutathione Transferase
 gb|AAC18566.1| 2,4-D inducible glutathione S-transferase [Glycine max]
Length=219

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 127/210 (60%), Gaps = 8/210 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D V+L   W S +  +V +AL  KGI +EY EEDLRNKSP LLQ NP+HKK+P+L+HNG+
Sbjct  3    DEVVLLDFWPSPFGMRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPVHKKIPVLIHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES++ V+YI+E WN+  P +LP D YQ+A+ RFWA Y+ +    + +   +++G+ K
Sbjct  63   PICESLIAVQYIEEVWNDRNP-LLPSDPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEEK  121

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
             AA  EF   L++LE++       ++      +LG +DIALV      KA E    + I 
Sbjct  122  EAAKKEFIEALKLLEEQLG-----DKTYFGGDNLGFVDIALVPFYTWFKAYETFGTLNI-  175

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEK  206
             E + P   +W +  L+   V ++LP  +K
Sbjct  176  -ESECPKFIAWAKRCLQKESVAKSLPDQQK  204



>gb|EYU26622.1| hypothetical protein MIMGU_mgv1a013365mg [Erythranthe guttata]
Length=222

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 123/212 (58%), Gaps = 6/212 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V + G W S ++K+VE+ALK KG+ +EY+E+DL+NKSP LL  NP+HKKVP+LLHNG+
Sbjct  3    EEVQVLGSWASPFSKRVEMALKFKGVEYEYIEQDLKNKSPLLLNYNPVHKKVPVLLHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES++I+EYID+TW    P ILP+D YQ+A  RFWAK++             + G+ +
Sbjct  63   PIAESLIILEYIDDTWQQ-GPPILPKDPYQRAHARFWAKFVDDKCMPQVWKACWSEGEER  121

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A  E    LE LE E +      +      ++GL+D +          + E+ G++ +
Sbjct  122  EKAMEEASKALEFLENEIK-----GKKFFGGDNVGLVDFSANFLAYWCGILAELSGLQFL  176

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAV  200
             EEK+P +  W +       V+E LP   K V
Sbjct  177  TEEKYPNLTKWADEFCGCSFVKENLPDKGKMV  208



>ref|XP_009778650.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana sylvestris]
Length=225

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 133/210 (63%), Gaps = 10/210 (5%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L G W S +A +V  ALK+KG+ ++Y EEDL NKSP LLQ NP+HKK+P+L+HNG+PI
Sbjct  6    VKLLGHWASPFALRVHWALKLKGVEYDYQEEDLPNKSPLLLQYNPVHKKIPVLVHNGKPI  65

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
             ES VI+EYIDETW   +  +LPED Y++AK RFWAK+I            S  G+ +  
Sbjct  66   AESSVILEYIDETWK--KNPLLPEDPYERAKARFWAKFIDDKCVPGIFRTFSKVGEEQQK  123

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQS-LGLLDIALVATLGMHKAVEEVLGMKIID  293
               E   NL++LE E      +++ ++   S +G +D+A    +   + VEE++ +K+ID
Sbjct  124  IAKEARENLKLLEGE------LDKKRVFGDSRIGFIDVASAWIICWAQIVEEIVDIKLID  177

Query  292  EEKHPFIFSWVESLLE-LPLVRETLPPHEK  206
             E+ P + +W E++LE  P+++E  PP +K
Sbjct  178  AEEMPSLVAWFENVLEAAPVLKECTPPKDK  207



>gb|AAQ02687.1| tau class GST protein 3 [Oryza sativa Indica Group]
 gb|EAY79295.1| hypothetical protein OsI_34421 [Oryza sativa Indica Group]
 emb|CAZ68078.1| glutathione S-transferase [Oryza sativa Indica Group]
Length=233

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 122/210 (58%), Gaps = 8/210 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D + L GMW S +A + +LAL  KG+ +EYVEEDL+NKS  LL  NP+HKKVP+L+HNG+
Sbjct  6    DELKLLGMWASPFALRAKLALSFKGLSYEYVEEDLKNKSELLLSSNPVHKKVPVLIHNGK  65

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYI-HQLSDTMKKAFISARGQN  479
            P+ ES VIV+YIDE + +    +LP D Y +A  RFWA YI  +L  +  +A +    Q 
Sbjct  66   PVCESQVIVQYIDEAFPDAGVPLLPSDPYDRAVARFWAAYIDDKLLKSWLQASMCKTEQE  125

Query  478  KNAAFSEFF---VNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLG  308
            K AA  E F    NLE   KE    C   +P     ++G +D+ L A +G  +  E + G
Sbjct  126  KAAAMKETFAAVANLEAAFKE----CSKGKPFFGGDAVGYVDVTLGAVIGFVRVGEALHG  181

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRETLP  218
            M++ D  + P + +W++    L   +  LP
Sbjct  182  MRLFDASRSPLLDAWLDRFAALDAAKAVLP  211



>ref|XP_010646030.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=231

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 134/222 (60%), Gaps = 10/222 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L   W S +A ++  ALKIKG+ +E + EDL +KSP LLQ NP HKK+P+L+H+G+
Sbjct  3    EEVKLFRTWSSPFALRIVWALKIKGVEYETIFEDLSDKSPSLLQYNPAHKKIPVLVHSGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
            PI ES VI+EYIDETW      +LPED Y++A  RFWAK+     L+  +   FI   G 
Sbjct  63   PIAESYVILEYIDETWKET--PLLPEDPYERAMARFWAKFGDDKVLTSIVWGVFIK-EGN  119

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             +  A  E   NL +LE+E R      +     + +G +D+AL     +   +E+V G+K
Sbjct  120  EQEEAMVEAMKNLWLLEEELR-----GKKFFGGERIGFVDLALGWLANLISILEDVAGLK  174

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            I+DE+K P + +W++   + P++++  PP +K +++ + ++ 
Sbjct  175  IVDEDKFPLLSAWMKDFADSPIIKDNWPPRDKMIAKFQALRD  216



>ref|XP_010279423.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=223

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/211 (39%), Positives = 129/211 (61%), Gaps = 7/211 (3%)
 Frame = -3

Query  805  STYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVESIVIVE  626
            S +  ++E ALK++GI +EY++EDLRNKSP LL+ NP+HKKVP+ LHNGRPI ES+VI+E
Sbjct  12   SLFCYRIEWALKLQGIEYEYLKEDLRNKSPLLLKYNPVHKKVPVFLHNGRPIAESLVILE  71

Query  625  YIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNAAFSEFFVN  446
            YIDETW N  P +LPED +++A  RFWAK+  +       A + A G  K  A       
Sbjct  72   YIDETWKN-NP-LLPEDPHERALARFWAKFGDEKCLMGAWAALCAEGPEKEKAVETAMET  129

Query  445  LEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEKHPFIFS  266
            L  LEK+        +     +++G LD+ +         ++EV GMK+ D E+ P +  
Sbjct  130  LNYLEKQIE-----GKKFFGGKTIGFLDLVIGWIPHWLDVLDEVGGMKLFDAERFPCLHE  184

Query  265  WVESLLELPLVRETLPPHEKAVSRLELIKQH  173
            W ++ +++P++++  PP ++ V+  +  +Q+
Sbjct  185  WAQNFIQIPIIKDCHPPRDEMVAYFQSSRQY  215



>ref|XP_002319750.2| hypothetical protein POPTR_0013s06950g [Populus trichocarpa]
 gb|EEE95673.2| hypothetical protein POPTR_0013s06950g [Populus trichocarpa]
Length=225

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 139/223 (62%), Gaps = 9/223 (4%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V L   W S +  ++  ALK+KG+ FE ++EDL NKSP LL  NP+HKK+P+L+H+G+P+
Sbjct  5    VKLFKTWSSPFGIRIVWALKVKGVQFEQIDEDLVNKSPLLLLYNPVHKKIPVLVHDGKPV  64

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKY-IHQLSDTMKKAFISARGQNKN  473
            VES++I+EYI+ TW   +  + PED  ++A  RFWAK+   ++  ++ +AFI  R + + 
Sbjct  65   VESLIILEYIEGTWK--QNPLFPEDPLERAAARFWAKFGDDKVMPSIWEAFIKGR-EEEE  121

Query  472  AAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIID  293
             AF+  F NL+ LE+E +      +     + +G++DIAL     +    EE+  +K+ID
Sbjct  122  CAFAPAFENLKFLEEELK-----GKQFFGGERIGIVDIALGWLANLVPVFEEIHAIKMID  176

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQHGFI  164
            EE+ P +++W++   + P++ +  PPHEK V++   I+    +
Sbjct  177  EERFPLLYAWMQEFSKAPVIADCRPPHEKLVNKFRAIRDQSLL  219



>ref|XP_010521903.1| PREDICTED: glutathione S-transferase U1-like [Tarenaya hassleriana]
 gb|ABW81097.1| GST20 [Cleome spinosa]
Length=221

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 135/218 (62%), Gaps = 12/218 (6%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L  +W   +  +VE+ALK+KG+P++Y+E+DLRNKSP LLQ NP+HK+VP+ +HNGR
Sbjct  5    EEVKLLSLWALPFGHRVEIALKLKGVPYDYLEQDLRNKSPLLLQMNPVHKQVPVFVHNGR  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
            PI ES+VI+EYIDETW      ILP D Y +A  RFWAK++ +  +S  +K    + +G 
Sbjct  65   PIAESLVILEYIDETWTQY--PILPRDPYDRAMARFWAKFVDEKIVSAGLKSVVKAEKG-  121

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMH-KAVEEVLGM  305
             + AA  E    +++LEKE      + +     + +G LD+   + + M    + E +G+
Sbjct  122  -REAAIEETQQLMKLLEKEL-----VGKDFFGGERVGFLDLVAGSMIPMSLMMLWEGMGV  175

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
             +I +EK P    W+ +LLE+  V+E LPP EK +  +
Sbjct  176  DVIPKEKFPEFHRWMNNLLEVEAVKECLPPREKHIEHM  213



>ref|XP_004488707.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=219

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 128/210 (61%), Gaps = 8/210 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D+VIL   W S +  ++ +AL  KGI FEY EEDLRNKSP LLQ NPIHKK+P+L+HNG+
Sbjct  3    DQVILLDFWPSPFGMRLRIALAEKGIEFEYREEDLRNKSPLLLQMNPIHKKIPVLVHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES++ V+YIDE WN+  P +LP D YQ+++ RFWA Y+ +      +   + +G+ +
Sbjct  63   PICESLIAVQYIDEVWNHKSP-LLPSDPYQRSQARFWADYVDKKIYDAGRNIWTKKGEEQ  121

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
             AA  EF   L++LE+E       ++       LG +D+AL+      K   E  G  I+
Sbjct  122  EAAKKEFIDALKLLEQELG-----DKTYFGGDKLGFVDVALIPFYTWFKGY-ETFGNFIV  175

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEK  206
            ++E   FI +W +  +++  V ++LP  EK
Sbjct  176  EKECPKFI-AWAKRCMQIESVSKSLPDQEK  204



>ref|XP_002465037.1| hypothetical protein SORBIDRAFT_01g031040 [Sorghum bicolor]
 gb|EER92035.1| hypothetical protein SORBIDRAFT_01g031040 [Sorghum bicolor]
Length=241

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/216 (42%), Positives = 134/216 (62%), Gaps = 11/216 (5%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRP  653
            RVI  G W S YA +V +ALK+KG+ +E+++E + NKS  LLQ NP+HKK+P+LLH+G+P
Sbjct  15   RVI--GGWASHYAIRVYVALKLKGVEYEFLQEVVGNKSELLLQSNPVHKKIPVLLHHGKP  72

Query  652  IVESIVIVEYIDETW--NNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARG--  485
            + ES++I++YIDE W  NN RP IL  D Y++A  RFWA+Y+    D +  A +  RG  
Sbjct  73   VAESMIILQYIDEVWASNNGRPAILSPDPYERAVQRFWAQYV---DDKIAPASVVFRGVT  129

Query  484  -QNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLG  308
              +K+ A ++    L+ LE E  V C   +      SLG LDI L + LG  KAVE++ G
Sbjct  130  AGDKDEAAAQVSEALQHLE-EAFVKCSRGKSYFGGDSLGFLDIVLGSHLGWLKAVEQIAG  188

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAV  200
            +K++ E K P + +W +       VR+ +P  ++ V
Sbjct  189  VKVLVESKFPELTAWAQRFYAHHAVRDVMPETDRLV  224



>ref|XP_009790678.1| PREDICTED: glutathione transferase GST 23-like [Nicotiana sylvestris]
Length=224

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 130/217 (60%), Gaps = 7/217 (3%)
 Frame = -3

Query  823  LHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVE  644
            LH  W S +  +   AL IKGI ++ + EDL  KSP+LLQ NP+HKK+P+L+H G+PI E
Sbjct  7    LHRTWSSPFGLRAVWALHIKGIQYDTIYEDLSQKSPELLQHNPVHKKIPVLVHKGKPICE  66

Query  643  SIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNAAF  464
            S+VI+EYIDETW      +LP+D Y+KA VRFWAK+  +       +  + +G  KN A 
Sbjct  67   SLVILEYIDETWK--EAPLLPQDPYEKATVRFWAKFGEEKLLPSIWSVFTGQGNEKNEAL  124

Query  463  SEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEK  284
                 NLE+ E++ +     E+     + +G LD++L     +    EEV+ +K+ D  K
Sbjct  125  GPAVQNLELFEEQLK-----EKKFFGGEEIGYLDLSLGWLAYLLDVFEEVIDLKLFDAAK  179

Query  283  HPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQH  173
             P + +W+ +  + P+++E  PP +K V++ +L+ ++
Sbjct  180  LPLLSAWMNNFYDAPVIKEHWPPRDKLVTKFQLLHEN  216



>dbj|BAJ94042.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=236

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 126/212 (59%), Gaps = 8/212 (4%)
 Frame = -3

Query  823  LHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVE  644
            L G W S +  +V+LAL +KG+ FE VEEDL NKS  LL  NP+HKKVP+L+HNG+P+ E
Sbjct  9    LLGAWASPFVTRVKLALSLKGLSFEDVEEDLGNKSELLLSSNPVHKKVPVLVHNGKPVCE  68

Query  643  SIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISA-RGQN---K  476
            S++I++YIDE +  + P +LP D YQ+A  RFWA YI    D +   ++ A RG+    K
Sbjct  69   SVIILQYIDEAFAGIGPSLLPSDPYQRAVARFWAAYID---DKLVAPWVQATRGKTEEEK  125

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
            +   ++ F  +E+LE   R  C         +++GL+D++L + L    A E + G KI 
Sbjct  126  SEGINQTFAAVEMLEGALRE-CSKGEGYFGGETVGLVDVSLGSLLSWLNATEVMSGTKIF  184

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAV  200
            D  K P + +W++   EL   +  LP  ++ V
Sbjct  185  DPVKTPLLAAWMDRFSELDAAKAALPEVDRVV  216



>ref|XP_010103479.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB96021.1| putative glutathione S-transferase [Morus notabilis]
Length=218

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 126/211 (60%), Gaps = 10/211 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + VIL   W S +  +V +AL  KGI +EY EEDLRNKSP LLQ NPIHKK+P+L+HNG+
Sbjct  2    NEVILLDFWASMFGMRVRIALAEKGIKYEYKEEDLRNKSPLLLQMNPIHKKIPVLIHNGK  61

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIH-QLSDTMKKAFISARGQN  479
            PI ES++IV+Y+DE WN   P +LP D YQ+A+ RFWA +I  ++ D   K + +A+G+ 
Sbjct  62   PISESLIIVQYVDEVWNEKAP-LLPSDPYQRAQARFWADFIDKKVYDAAGKVW-TAKGEE  119

Query  478  KNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
            K AA  EF   L++LE E       ++P     S G LDIALV       A+E      +
Sbjct  120  KEAAKKEFIDILKLLETELG-----DKPYFGGDSFGFLDIALVGFYPWFYALETFGNFSV  174

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
              E + P +  W +S  E   V ++L   +K
Sbjct  175  --EAECPKLIEWAKSCKEKESVSKSLADEKK  203



>ref|NP_001104998.1| glutathione transferase41 [Zea mays]
 gb|AAG34849.1|AF244706_1 glutathione S-transferase GST 41 [Zea mays]
Length=267

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 124/213 (58%), Gaps = 5/213 (2%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            ++L G W S+Y  +V+LAL++KG+ F+YVEEDL NKS +LL+ NP+HKKVP+L+H GR +
Sbjct  16   LMLFGSWASSYTHRVQLALRLKGLEFDYVEEDLGNKSDELLRHNPVHKKVPVLVHGGRAL  75

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
             ES++I++Y+D+ W   RP +LP DA+ +A  RFW  +          A  ++ G+ + A
Sbjct  76   PESVIILQYLDDAWPETRP-LLPADAFDRALARFWCHFADDKLGPAVGAVFASTGEGQEA  134

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDE  290
            A  +   NL ++E E R      R       +GLLD+ L          EEV G++++D 
Sbjct  135  AVRQVHENLALIESELRDGAFRGRRFFGGDEVGLLDVVLGCGSYWLAVFEEVTGVRLVDA  194

Query  289  EKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
            +  P   +W+     L  VRET+P    AV RL
Sbjct  195  DAFPRFHAWLRDFEALDEVRETIP----AVDRL  223



>ref|XP_010939722.1| PREDICTED: glutathione transferase GST 23-like [Elaeis guineensis]
Length=237

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 129/213 (61%), Gaps = 13/213 (6%)
 Frame = -3

Query  832  RVILHGMWMSTYAKKVELALKIKGIPFEYVEEDL-RNKSPQLLQQNPIHKKVPMLLHNGR  656
            RV L GMW S +A + E ALK+KG+ +EYVEEDL   KS +LL+ NP+ KKVP+L+H+G+
Sbjct  20   RVKLFGMWCSPFALRAEWALKLKGVEYEYVEEDLFHKKSEELLRYNPVTKKVPVLVHDGK  79

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+VI+EY+DE W +  P ILP+D Y++A+ RFWAK+     +    A  S  G+ +
Sbjct  80   PIAESLVIIEYVDEVWKDGYP-ILPKDPYERAQARFWAKFAEDKINPATFAVYSTTGEQQ  138

Query  475  NAAF---SEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGM  305
              A     E F  LE   K  + F          +++G +DIA        + +EE++G+
Sbjct  139  QKALQDAQEVFKTLEEALKGKKFF--------GGETIGFVDIAAGWLPCWVRIIEEIVGI  190

Query  304  KIIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
             I++E   P I +W +  +EL LV+ +LPP +K
Sbjct  191  NIVNENNLPLINAWFDDFMELELVKGSLPPKDK  223



>ref|XP_002441097.1| hypothetical protein SORBIDRAFT_09g020350 [Sorghum bicolor]
 gb|EES19527.1| hypothetical protein SORBIDRAFT_09g020350 [Sorghum bicolor]
Length=262

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 123/211 (58%), Gaps = 5/211 (2%)
 Frame = -3

Query  823  LHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPIVE  644
            L G W S+Y  +V+LAL++KG+ F+YVEEDL NKS +LL+ NP+HKKVP+L+H GR + E
Sbjct  14   LFGSWASSYTHRVQLALRLKGLEFDYVEEDLGNKSDELLRHNPVHKKVPVLVHGGRALPE  73

Query  643  SIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNAAF  464
            S++I++Y+D+ W   RP +LP DA+ +A  RFW  +          A  ++ G+++ AA 
Sbjct  74   SVIILQYLDDAWPETRP-LLPADAFDRALARFWCHFADDKLGPAVGAVFASTGEDQEAAV  132

Query  463  SEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDEEK  284
             +   NL +LE E R      R       +GLLD+ L          E+V G++++D + 
Sbjct  133  RQVHENLALLETELRDGAFRGRRFFGGDEVGLLDVVLGCGSYWLAVFEDVTGLRLVDADA  192

Query  283  HPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
             P   +W+     L  VR+T+P    AV RL
Sbjct  193  FPRFHAWLRDFEALDEVRDTIP----AVDRL  219



>ref|XP_007134772.1| hypothetical protein PHAVU_010G074600g [Phaseolus vulgaris]
 gb|ESW06766.1| hypothetical protein PHAVU_010G074600g [Phaseolus vulgaris]
Length=224

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 134/218 (61%), Gaps = 11/218 (5%)
 Frame = -3

Query  844  HHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLH  665
            +H+  V L G+  S YA +V++AL++KGI + Y EEDLRNKS  LL+ NPIHKKVP+L+H
Sbjct  3    NHYGDVELFGVRGSPYAVRVQIALELKGIQYTYFEEDLRNKSDLLLKYNPIHKKVPVLVH  62

Query  664  NGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISA  491
            NGRP+ ES+VI+EYIDETW N  P I P+  Y +A  RFW+++I    L   +K AF +A
Sbjct  63   NGRPLAESLVILEYIDETWGN-HP-IFPQQPYHRALARFWSRFIDDKCLPAILKAAF-TA  119

Query  490  RGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVL  311
              + +     E    L+ILE E      +++     +S+GL+DIA         A+EE +
Sbjct  120  NEEERQKGTEESLDALQILEDE------LKQKFFGGESIGLVDIAAGFIAFWLPAIEEAV  173

Query  310  GMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVS  197
            G+K++  +K P +  W E     P+V+E+LP  E+ V 
Sbjct  174  GLKLLISQKFPKLSKWSEEYTNHPVVKESLPQRERVVG  211



>ref|XP_002264055.2| PREDICTED: probable glutathione S-transferase isoform X1 [Vitis 
vinifera]
Length=225

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 132/222 (59%), Gaps = 10/222 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L   W + +A ++  ALKIKG+ +E + EDL NKSP LLQ NP HKKVP+L+HNG+
Sbjct  3    EEVKLFRTWSTPFALRIVWALKIKGVEYETIFEDLYNKSPSLLQYNPAHKKVPVLVHNGK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
            PI ES VI+EYIDETW      +LPED Y++A  RFWAK+      +      F+   G+
Sbjct  63   PISESYVILEYIDETWKET--PLLPEDPYERAMARFWAKFGDDKVFTSIFGGVFVK-EGK  119

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             +  A  E   NL+ LE+E R      +     + +G +D+AL     +   +E+V G+K
Sbjct  120  EQEEAMVEAMENLQFLEEELR-----GKKFFGGERIGFVDLALGWLANLISILEDVAGLK  174

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRLELIKQ  176
            I+ E+K P + +W++   + P++++  PP +K +++ + ++ 
Sbjct  175  IVGEDKFPLLSAWMKDFADSPIIKDNWPPRDKMIAKFQALRD  216



>ref|XP_010674216.1| PREDICTED: glutathione S-transferase U8-like [Beta vulgaris subsp. 
vulgaris]
Length=222

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 134/222 (60%), Gaps = 7/222 (3%)
 Frame = -3

Query  859  MGENHHHHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKV  680
            M +    ++ V L G W S ++ +++ ALK+KGIP+EY+EEDL NKSPQLL+ NPIHKK+
Sbjct  1    MKKKTMANEEVKLFGRWASPFSHRIQTALKLKGIPYEYIEEDLTNKSPQLLKYNPIHKKI  60

Query  679  PMLLHNGRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAF  500
            P+L+HNG+PIVES++I++YIDETW  L P +LP D ++KA   FWA +I +     +K  
Sbjct  61   PVLVHNGKPIVESLIILKYIDETW-ELFP-LLPNDPWEKANALFWAIFIDEKLFRARKMA  118

Query  499  ISARGQNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAV-  323
            +    +    A  E F  L  LE E +V    +      + +G +DI +   +G    V 
Sbjct  119  LWGDEKESKEAMEETFECLRWLENELKV---KKSKFFGGECIGFVDI-VANGIGFWVGVQ  174

Query  322  EEVLGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVS  197
            EEV   +++ +E+ P ++ W +  +    V+E LPP EK ++
Sbjct  175  EEVTNKRMLVQERFPLLWDWAQDFVSCDAVKECLPPREKLLA  216



>ref|XP_007223941.1| hypothetical protein PRUPE_ppa011108mg [Prunus persica]
 gb|EMJ25140.1| hypothetical protein PRUPE_ppa011108mg [Prunus persica]
Length=223

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 131/210 (62%), Gaps = 9/210 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D V L G W S  A +V+  LK+K I ++YVEEDL+NKSP LL  NP+HKK+P+L+H+G+
Sbjct  4    DSVKLLGCWASPAALRVKWTLKLKEIEYQYVEEDLQNKSPLLLHYNPVHKKIPVLVHDGK  63

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            P+ ES++I+EYI+ETW  ++  ILPED Y++A+ RFWAK++ +       +  + +G+ K
Sbjct  64   PVAESLIILEYIEETW--MQNPILPEDPYERAQARFWAKFVEEKCGPSIMSAFTKKGEEK  121

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGM-HKAVEEVLGMKI  299
                 E   NL+ILE          +     +S+G +DIA    +G+  + VEE+  + +
Sbjct  122  EKGAKEARENLKILESGLG-----GKQFFGGESIGFVDIA-AGWIGLWARIVEEIAEVNL  175

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHE  209
            ID E  P + +W   +LE P+++E LPP +
Sbjct  176  IDTETMPLLNAWFGRVLEFPILKECLPPQD  205



>ref|XP_006354565.1| PREDICTED: glutathione transferase GST 23-like isoform X1 [Solanum 
tuberosum]
Length=225

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 132/211 (63%), Gaps = 8/211 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++V L G W S  A +V  ALK+KGI ++Y EEDLRNKSP LLQ NP+HKK+P+L+HNG+
Sbjct  4    EKVKLLGNWASPSALRVHWALKLKGIEYDYQEEDLRNKSPLLLQYNPVHKKIPVLVHNGK  63

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+VI+EYI+ETW +  P +LPED Y++AK RFWAK++               G+ +
Sbjct  64   PIAESLVILEYIEETWKH-NP-LLPEDPYERAKARFWAKFVDDKCVPGIFGTFVKVGEEQ  121

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
                 E   NL+ILE E       ++       +G +D+A    +   + VEE++ +K+I
Sbjct  122  QKIAKEARENLKILEGELG-----KKHFFGDTKIGFMDVASAWIICWAQIVEEIVDIKLI  176

Query  295  DEEKHPFIFSWVESLLE-LPLVRETLPPHEK  206
            D E+ P + SW +++LE  P+++E  PP +K
Sbjct  177  DAEEMPSLVSWFQNVLEAAPILKECTPPKDK  207



>ref|XP_002520473.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF41886.1| glutathione s-transferase, putative [Ricinus communis]
Length=242

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 132/212 (62%), Gaps = 11/212 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V L GMW S +  + +LALK+KG+ +EY+EEDL NKSP LL+ NP++KK+P+L+H G+
Sbjct  26   EEVQLIGMWASPFNCRAQLALKLKGVQYEYIEEDLSNKSPLLLKYNPVYKKIPVLVHKGK  85

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQ--LSDTMKKAFISARGQ  482
            PI ES+VI+EYI+ETW N  P I+P+D+Y  A  RFWA +  +  L   +K +   A+G+
Sbjct  86   PISESLVILEYIEETWKN-NP-IMPQDSYSTAIARFWANFADENILQTAIKSS--KAKGE  141

Query  481  NKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMK  302
             +   + E   NL++LE E        +     +++G LDI   + +   +   EV  M+
Sbjct  142  EREKLWDEVCQNLKLLENELN-----GKQFFGGKNIGYLDIVAFSLVHWFQVANEVTQME  196

Query  301  IIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
            +I EE  P +  W E + ++ +V+ETLPP +K
Sbjct  197  LITEENFPGLLKWTEKMGDIDVVKETLPPRDK  228



>ref|XP_010693951.1| PREDICTED: glutathione S-transferase U7-like [Beta vulgaris subsp. 
vulgaris]
Length=221

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 133/208 (64%), Gaps = 7/208 (3%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGRPI  650
            V ++G W S ++ +VE+AL+IKGI +E+VEEDL +KS +L + NPIHKKVP+L+H+G+ +
Sbjct  3    VKIYGTWASPFSMRVEIALQIKGIEYEFVEEDLLHKSDELAKYNPIHKKVPVLIHDGKVM  62

Query  649  VESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNA  470
            VES+VI+EYIDETW    P ILP DAYQKA+ RFWAK++      + ++ + + G+    
Sbjct  63   VESLVILEYIDETWKA-NP-ILPTDAYQKAQARFWAKFVDDKVTPLVRSALMSEGEESEK  120

Query  469  AFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKIIDE  290
            A  +    L+ILE E +      +     +S+G LDI           ++EV+G ++I +
Sbjct  121  AIPQLDEVLQILESEIK-----GKQFFGGKSIGYLDIVASMVPFWITCLQEVVGKEVITK  175

Query  289  EKHPFIFSWVESLLELPLVRETLPPHEK  206
            EK P I SW + LL   ++++ +P H++
Sbjct  176  EKFPSISSWADELLGCSVMKQNVPHHDR  203



>gb|AFS51729.1| tau class glutathione S-transferase [Glycine soja]
Length=219

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/216 (41%), Positives = 139/216 (64%), Gaps = 15/216 (7%)
 Frame = -3

Query  841  HHDRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHN  662
            +H+ VIL G W S ++ +V+LALK+KG+P++Y EEDL NKS  LL+ NP+HKKVP+L+HN
Sbjct  4    YHEEVILLGKWASPFSNRVDLALKLKGVPYKYSEEDLANKSADLLRYNPVHKKVPVLVHN  63

Query  661  GRPIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQ  482
            G P+ ES++IVEYIDETW N  P +LP D Y++A  RFW+K    L D +  A  +A   
Sbjct  64   GNPLPESLIIVEYIDETWKN-NP-LLPRDPYERALARFWSK---TLDDKILPAIWNACWS  118

Query  481  NKNA---AFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAV-EEV  314
            ++N    A  E    L+IL++  +     ++     +S+GL+DIA    +G   A+ +E+
Sbjct  119  DENGREKAVEEALEALKILQEALK-----DKKFFGGESIGLVDIA-ANFIGYWVAILQEI  172

Query  313  LGMKIIDEEKHPFIFSWVESLLELPLVRETLPPHEK  206
             G++++  EK P ++ W +  +  P+++E LPP ++
Sbjct  173  AGLELLTIEKFPKLYKWSQEFINHPVIKEGLPPRDE  208



>ref|NP_001234088.1| uncharacterized protein LOC543815 [Solanum lycopersicum]
 gb|AAG16758.1| putative glutathione S-transferase T3 [Solanum lycopersicum]
Length=225

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 131/211 (62%), Gaps = 8/211 (4%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            ++V L G W S +A KV  ALK+KGI +EY EEDL NKSP LLQ NP+HKK+P+L+HNG+
Sbjct  4    EKVKLLGYWASPFALKVHWALKLKGIEYEYQEEDLSNKSPLLLQYNPVHKKIPVLVHNGK  63

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+VI+EYI+ETW +  P +LPED Y++AK RFWAK++            +  G  +
Sbjct  64   PIAESLVILEYIEETWKH-NP-LLPEDPYERAKARFWAKFVDDKCVPGIFGTFAKVGVEQ  121

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
                 E   NL+ILE E       ++       +G +D+     +   + VEEV+ +++I
Sbjct  122  QKIAKEARENLKILEDELG-----KKHFFGDAKIGFMDVTSAWIICWAQIVEEVVDIRLI  176

Query  295  DEEKHPFIFSWVESLLE-LPLVRETLPPHEK  206
            D E+ P + SW +++LE  P+++E  PP +K
Sbjct  177  DAEEMPSLVSWFQNVLEAAPILKECTPPKDK  207



>ref|XP_010060069.1| PREDICTED: glutathione transferase GST 23-like [Eucalyptus grandis]
 gb|KCW66601.1| hypothetical protein EUGRSUZ_F00396 [Eucalyptus grandis]
Length=225

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 129/213 (61%), Gaps = 12/213 (6%)
 Frame = -3

Query  829  VILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNK-SPQLLQQNPIHKKVPMLLHNGRP  653
            V LHG W S YA +V   LK+K +P++Y+EEDL NK S  LLQ NP+HKKVP+L+H+G+P
Sbjct  7    VKLHGFWGSPYALRVIWTLKLKQVPYDYLEEDLPNKKSSLLLQYNPVHKKVPVLVHHGKP  66

Query  652  IVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKN  473
            I ES+VI+EYIDETW   +  +LP+D Y++A+VRFWAK+  +      KA     G+ + 
Sbjct  67   IPESLVILEYIDETWK--QSPLLPQDPYERARVRFWAKFADEKCMPAMKAVFCTEGEEQQ  124

Query  472  AAFSEFFVNLEILEK--ETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKI  299
             A  E    L+ LE   E ++F          +++   D+A        + VEE+ G  +
Sbjct  125  KAVLEARETLKTLESGLEGKLF-------FGGETINFADVATGYIGCWARIVEEITGTTL  177

Query  298  IDEEKHPFIFSWVESLLELPLVRETLPPHEKAV  200
            ID E  P + +W +  LELP+++E +PP +K +
Sbjct  178  IDAESMPSLDAWSKRFLELPVIKECVPPWDKLI  210



>ref|XP_002280532.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=225

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 128/215 (60%), Gaps = 7/215 (3%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            + V + G  +S +  +VE ALK+KG+ +EY++EDLRNKSP LL+ NP+HKKVP+L+H  +
Sbjct  3    EEVKVIGSILSGFCVRVEWALKLKGVEYEYIKEDLRNKSPMLLKYNPVHKKVPVLVHGDK  62

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNK  476
            PI ES+VI+EYIDETW +  P +LPED Y++A  RFWAKY  +           A G+ K
Sbjct  63   PIPESLVILEYIDETWKD-NP-LLPEDPYERAMARFWAKYADEKCLFGAWEAFKAEGEEK  120

Query  475  NAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLGMKII  296
              A      +   LEK  +      +     + +G LD+ +         +EEV GMK++
Sbjct  121  EKAMESALESFAFLEKAIK-----GKKFFGGEKMGFLDLVVGWIPHWLSVLEEVGGMKML  175

Query  295  DEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
            D E+ P +  W E+ +++PL++E +PP +  V+  
Sbjct  176  DAERFPSLHEWAENFIQIPLIKECIPPRDDLVNHF  210



>ref|XP_010037769.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW49508.1| hypothetical protein EUGRSUZ_K03029 [Eucalyptus grandis]
Length=226

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 136/221 (62%), Gaps = 16/221 (7%)
 Frame = -3

Query  823  LHGMWMSTYAKKVELALKIKGIPFEYVEEDL-RNKSPQLLQQNPIHKKVPMLLHNGRPIV  647
            L G+W S +++++E+ALKIKG+ +EY+EED+  NKS  LL+ NP+HKK+P+L+HNG+PI 
Sbjct  7    LFGVWGSPFSRRIEIALKIKGVEYEYLEEDIFHNKSALLLKYNPVHKKIPVLVHNGKPIA  66

Query  646  ESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISARGQNKNAA  467
            ES VI+EYIDETWN+  P ILP D Y++A  RFWAK+I +         +++ G  K  A
Sbjct  67   ESQVILEYIDETWND-NP-ILPRDPYKRAMARFWAKFIDEKCVPAIWKSLTSVGPEKEKA  124

Query  466  FSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMH--KAVEEVLGMKIID  293
              E    L  LE E +      +     +++G +DI  VA+   H   AV+E  G   + 
Sbjct  125  NEEACELLSTLEGELK-----GKKFFGGETVGFVDI--VASFIGHWVGAVQEAAGFDFLT  177

Query  292  EEKHPFIFSWVESLLELPLVRETLPPHEKAV----SRLELI  182
            E+K P ++ W E     P+++E LPP +K +    +RLE+I
Sbjct  178  EDKFPVLYKWAEEFKNCPVIKENLPPRDKILADFKARLEMI  218



>ref|XP_004983859.1| PREDICTED: probable glutathione S-transferase GSTU6-like isoform 
X1 [Setaria italica]
Length=232

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 126/219 (58%), Gaps = 12/219 (5%)
 Frame = -3

Query  835  DRVILHGMWMSTYAKKVELALKIKGIPFEYVEEDLRNKSPQLLQQNPIHKKVPMLLHNGR  656
            D + L GMW S +  +V+LAL +KG+ +EYVEEDLRNKS  LL+ NP+H KVP+L+H+G+
Sbjct  5    DDLKLLGMWASPFVLRVKLALSLKGLSYEYVEEDLRNKSELLLKSNPVHNKVPVLIHDGK  64

Query  655  PIVESIVIVEYIDETWNNLRPRILPEDAYQKAKVRFWAKYIHQLSDTMKKAFISA-RG--  485
            P+ ES VI++YIDE +    P +LP D Y++A  RFWA YI    D M  A+  A RG  
Sbjct  65   PVCESSVILQYIDEAFAGTGPPLLPADPYERAIARFWAAYID---DKMLAAWTQASRGKT  121

Query  484  -QNKNAAFSEFFVNLEILEKETRVFCPMERPKISAQSLGLLDIALVATLGMHKAVEEVLG  308
             +++     +    +E LE   R  C   +P     ++G +D+ L   LG  +A EE+ G
Sbjct  122  EEDRAEGMKQSLATVETLEGALRD-CGKGKPFFGGDNVGYVDVVLGGMLGWVRANEELQG  180

Query  307  MKIIDEEKHPFIFSWVESLLELPLVRETLPPHEKAVSRL  191
             K  D E+ P + +W +    L  V   +P     VSRL
Sbjct  181  AKPFDPERTPLLAAWADRFWSLEAVEPVMPD----VSRL  215



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1997200541776