BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17781_g2_i1 len=768 path=[627:0-391 1019:392-767]

Length=768
                                                                      Score     E

gb|EYU38855.1|  hypothetical protein MIMGU_mgv1a000996mg                399   8e-129   
ref|XP_011083601.1|  PREDICTED: kinesin-like protein NACK1              398   2e-128   
emb|CDP07439.1|  unnamed protein product                                398   2e-128   
ref|XP_008775732.1|  PREDICTED: kinesin-like protein NACK1 isofor...    395   1e-127   
ref|XP_008775730.1|  PREDICTED: kinesin-like protein NACK1 isofor...    395   1e-126   
ref|XP_010445917.1|  PREDICTED: kinesin-like protein NACK1              385   2e-126   
ref|XP_010919403.1|  PREDICTED: kinesin-like protein NACK1 isofor...    389   3e-126   
ref|XP_011074636.1|  PREDICTED: kinesin-like protein NACK2 isofor...    394   3e-126   
ref|XP_011074638.1|  PREDICTED: kinesin-like protein NACK1 isofor...    393   3e-126   
ref|XP_010271468.1|  PREDICTED: kinesin-like protein NACK2              393   4e-126   
ref|XP_008791672.1|  PREDICTED: kinesin-like protein NACK1 isofor...    389   1e-125   
ref|XP_009767346.1|  PREDICTED: kinesin-like protein NACK2 isofor...    390   1e-125   
ref|XP_009767348.1|  PREDICTED: kinesin-like protein NACK2 isofor...    390   1e-125   
ref|XP_002280678.2|  PREDICTED: kinesin-like protein NACK1              390   2e-125   Vitis vinifera
gb|EPS66111.1|  hypothetical protein M569_08665                         387   4e-125   
ref|XP_009587868.1|  PREDICTED: kinesin-like protein NACK2              389   4e-125   
ref|XP_011090438.1|  PREDICTED: kinesin-like protein NACK1              391   4e-125   
ref|XP_010919401.1|  PREDICTED: kinesin-like protein NACK2 isofor...    390   5e-125   
ref|XP_007203241.1|  hypothetical protein PRUPE_ppa001146mg             387   1e-124   
ref|XP_010909958.1|  PREDICTED: kinesin-like protein NACK1              389   2e-124   
emb|CBI19799.3|  unnamed protein product                                389   2e-124   
ref|XP_010263901.1|  PREDICTED: kinesin-like protein NACK1 isofor...    387   2e-124   
ref|XP_008791670.1|  PREDICTED: kinesin-like protein NACK2 isofor...    389   2e-124   
ref|XP_007017694.1|  ATP binding microtubule motor family protein...    390   2e-124   
gb|EPS64209.1|  hypothetical protein M569_10571                         373   4e-124   
gb|KCW53110.1|  hypothetical protein EUGRSUZ_J02401                     384   5e-124   
ref|XP_010263900.1|  PREDICTED: kinesin-like protein NACK1 isofor...    387   5e-124   
gb|AAK50070.1|AF372930_1  AT5g66310/K1L20_9                             371   6e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006854867.1|  hypothetical protein AMTR_s00182p00038530          386   2e-123   
ref|XP_010535298.1|  PREDICTED: kinesin-like protein NACK1              389   2e-123   
ref|XP_009338641.1|  PREDICTED: kinesin-like protein NACK2 isofor...    385   2e-123   
ref|XP_004167109.1|  PREDICTED: uncharacterized LOC101212680            385   2e-123   
ref|XP_004152764.1|  PREDICTED: uncharacterized protein LOC101212680    385   3e-123   
ref|XP_004289095.1|  PREDICTED: uncharacterized protein LOC101300397    387   3e-123   
ref|XP_010033468.1|  PREDICTED: kinesin-like protein NACK1              385   3e-123   
ref|XP_009338640.1|  PREDICTED: kinesin-like protein NACK2 isofor...    385   3e-123   
ref|XP_008444776.1|  PREDICTED: kinesin-like protein NACK1              385   4e-123   
ref|XP_008372766.1|  PREDICTED: kinesin-like protein NACK1              385   4e-123   
ref|XP_008241798.1|  PREDICTED: kinesin-like protein NACK1              385   4e-123   
gb|EYU31140.1|  hypothetical protein MIMGU_mgv1a000697mg                385   7e-123   
ref|XP_010028653.1|  PREDICTED: kinesin-like protein NACK1 isofor...    380   1e-122   
ref|XP_011092853.1|  PREDICTED: kinesin-like protein NACK1 isofor...    378   2e-122   
emb|CDP01925.1|  unnamed protein product                                382   3e-122   
gb|KDO84748.1|  hypothetical protein CISIN_1g001290mg                   385   3e-122   
gb|KDO84747.1|  hypothetical protein CISIN_1g001290mg                   385   3e-122   
gb|KHF98716.1|  Kinesin-related 11                                      383   3e-122   
ref|XP_006473602.1|  PREDICTED: kinesin-like protein NACK1-like i...    385   3e-122   
ref|XP_006435104.1|  hypothetical protein CICLE_v10000097mg             385   4e-122   
ref|XP_006473600.1|  PREDICTED: kinesin-like protein NACK1-like i...    385   4e-122   
ref|XP_006473601.1|  PREDICTED: kinesin-like protein NACK1-like i...    385   4e-122   
ref|XP_004238322.1|  PREDICTED: kinesin-like protein NACK2              381   5e-122   
ref|XP_009378198.1|  PREDICTED: kinesin-like protein NACK2 isofor...    381   6e-122   
ref|XP_009378197.1|  PREDICTED: kinesin-like protein NACK1 isofor...    382   7e-122   
ref|XP_010028651.1|  PREDICTED: kinesin-like protein NACK1 isofor...    381   8e-122   
ref|XP_006342006.1|  PREDICTED: kinesin-like protein NACK2-like i...    380   8e-122   
ref|XP_006342008.1|  PREDICTED: kinesin-like protein NACK2-like i...    380   8e-122   
ref|NP_567695.1|  ATP binding microtubule motor family protein          382   8e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010113382.1|  Kinesin-related protein 4                          382   1e-121   
ref|XP_006380794.1|  hypothetical protein POPTR_0007s13860g             382   1e-121   
ref|XP_009389113.1|  PREDICTED: kinesin-like protein NACK1              381   1e-121   
ref|XP_010649060.1|  PREDICTED: kinesin-like protein NACK1              381   1e-121   
ref|XP_010494185.1|  PREDICTED: kinesin-like protein NACK2              386   2e-121   
ref|XP_010647602.1|  PREDICTED: kinesin-like protein NACK1              380   3e-121   
ref|XP_010933747.1|  PREDICTED: kinesin-like protein NACK1              380   4e-121   
ref|XP_011092849.1|  PREDICTED: kinesin-like protein NACK1 isofor...    379   4e-121   
ref|XP_009630370.1|  PREDICTED: kinesin-like protein NACK2 isofor...    381   4e-121   
ref|XP_009630368.1|  PREDICTED: kinesin-like protein NACK1 isofor...    381   5e-121   
ref|XP_009772334.1|  PREDICTED: kinesin-like protein NACK2              381   5e-121   
ref|XP_011100938.1|  PREDICTED: kinesin-like protein NACK1              380   5e-121   
ref|XP_011025920.1|  PREDICTED: kinesin-like protein NACK2              380   5e-121   
ref|XP_004512118.1|  PREDICTED: kinesin-related protein 4-like is...    379   6e-121   
ref|XP_004232466.1|  PREDICTED: kinesin-like protein NACK2              380   6e-121   
ref|XP_002510482.1|  ATP binding protein, putative                      379   7e-121   Ricinus communis
ref|XP_006340707.1|  PREDICTED: kinesin-like protein NACK1-like         380   8e-121   
ref|XP_003516550.1|  PREDICTED: kinesin-like protein NACK2-like i...    379   9e-121   
ref|XP_006383133.1|  kinesin motor family protein                       377   1e-120   
ref|XP_004512117.1|  PREDICTED: kinesin-related protein 4-like is...    378   1e-120   
ref|XP_010484663.1|  PREDICTED: kinesin-like protein NACK1 isofor...    377   1e-120   
ref|XP_010091188.1|  Kinesin-related protein 11                         377   2e-120   
ref|XP_008388154.1|  PREDICTED: kinesin-like protein NACK1              360   2e-120   
ref|XP_006466916.1|  PREDICTED: kinesin-like protein NACK1-like i...    376   3e-120   
gb|KDO71125.1|  hypothetical protein CISIN_1g001693mg                   375   4e-120   
gb|KHG01464.1|  Kinesin-related 4                                       377   5e-120   
ref|XP_008382370.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...    376   5e-120   
ref|XP_009378441.1|  PREDICTED: kinesin-like protein NACK1              376   5e-120   
ref|XP_010484662.1|  PREDICTED: kinesin-like protein NACK1 isofor...    378   9e-120   
ref|XP_007201806.1|  hypothetical protein PRUPE_ppa001038mg             375   1e-119   
emb|CAB51660.1|  putative protein                                       382   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433806.1|  PREDICTED: kinesin-like protein NACK1              377   1e-119   
ref|XP_007226270.1|  hypothetical protein PRUPE_ppa019074mg             377   1e-119   
ref|XP_006425531.1|  hypothetical protein CICLE_v10024791mg             377   2e-119   
gb|EPS66399.1|  hypothetical protein M569_08373                         360   2e-119   
ref|XP_003612133.1|  Kinesin-related protein                            375   2e-119   
gb|AES95091.2|  ATP-binding microtubule motor family protein            375   2e-119   
ref|XP_006466914.1|  PREDICTED: kinesin-like protein NACK1-like i...    377   2e-119   
ref|XP_008236841.1|  PREDICTED: kinesin-like protein NACK2              374   2e-119   
ref|XP_006599344.1|  PREDICTED: kinesin-like protein NACK1-like i...    373   2e-119   
ref|XP_008221318.1|  PREDICTED: kinesin-like protein NACK1              377   2e-119   
gb|KDO49885.1|  hypothetical protein CISIN_1g002139mg                   370   3e-119   
gb|KDO71124.1|  hypothetical protein CISIN_1g001693mg                   376   3e-119   
ref|XP_009336756.1|  PREDICTED: kinesin-like protein NACK1              377   4e-119   
emb|CDO96988.1|  unnamed protein product                                374   4e-119   
ref|XP_006403375.1|  hypothetical protein EUTSA_v10003349mg             377   5e-119   
ref|XP_007046742.1|  ATP binding microtubule motor family protein...    374   6e-119   
ref|XP_003538873.1|  PREDICTED: kinesin-like protein NACK1-like i...    374   7e-119   
ref|XP_002865077.1|  kinesin motor family protein                       375   8e-119   
ref|XP_006599340.1|  PREDICTED: kinesin-like protein NACK1-like i...    373   8e-119   
ref|XP_011028954.1|  PREDICTED: kinesin-like protein NACK1 isofor...    372   8e-119   
ref|XP_006285338.1|  hypothetical protein CARUB_v10006728mg             375   9e-119   
ref|XP_002305465.1|  kinesin motor family protein                       370   9e-119   Populus trichocarpa [western balsam poplar]
ref|XP_011028953.1|  PREDICTED: kinesin-like protein NACK1 isofor...    372   9e-119   
gb|KHN41676.1|  Kinesin-related protein 4                               373   1e-118   
gb|KEH20389.1|  ATP-binding microtubule motor family protein            373   1e-118   
ref|XP_009386197.1|  PREDICTED: kinesin-like protein NACK1              372   1e-118   
ref|XP_009617690.1|  PREDICTED: kinesin-like protein NACK2              372   1e-118   
ref|XP_010444813.1|  PREDICTED: kinesin-like protein NACK2              375   2e-118   
ref|XP_009345268.1|  PREDICTED: kinesin-like protein NACK1              372   2e-118   
gb|KDP46700.1|  hypothetical protein JCGZ_06488                         374   3e-118   
ref|XP_004148539.1|  PREDICTED: kinesin-like protein KIN12B-like        372   3e-118   
emb|CDY45220.1|  BnaA07g12700D                                          373   3e-118   
gb|KDO49884.1|  hypothetical protein CISIN_1g002139mg                   369   3e-118   
ref|XP_002531511.1|  conserved hypothetical protein                     372   3e-118   Ricinus communis
gb|KHN00495.1|  Kinesin-related protein 11                              371   4e-118   
ref|XP_006423484.1|  hypothetical protein CICLE_v10027758mg             369   4e-118   
ref|XP_006393829.1|  hypothetical protein EUTSA_v10003607mg             371   4e-118   
ref|XP_008452056.1|  PREDICTED: kinesin-like protein NACK1 isofor...    370   5e-118   
emb|CAE03025.3|  OSJNBa0091D06.23                                       370   6e-118   Oryza sativa [red rice]
ref|XP_011088489.1|  PREDICTED: kinesin-like protein NACK1              370   6e-118   
ref|XP_004509341.1|  PREDICTED: kinesin-related protein 4-like is...    371   6e-118   
gb|EEC77720.1|  hypothetical protein OsI_16807                          371   7e-118   Oryza sativa Indica Group [Indian rice]
emb|CDY30779.1|  BnaC07g16790D                                          372   7e-118   
ref|XP_009398104.1|  PREDICTED: kinesin-like protein NACK1              371   7e-118   
ref|XP_008448048.1|  PREDICTED: kinesin-like protein NACK2              370   8e-118   
ref|XP_004974129.1|  PREDICTED: kinesin-like protein NACK1-like i...    372   8e-118   
ref|XP_003519876.1|  PREDICTED: kinesin-like protein NACK1-like         370   9e-118   
ref|XP_006661465.1|  PREDICTED: kinesin-like protein NACK2-like         369   9e-118   
ref|XP_004974127.1|  PREDICTED: kinesin-like protein NACK1-like i...    372   9e-118   
ref|XP_009760421.1|  PREDICTED: kinesin-like protein NACK2              370   1e-117   
ref|NP_001053433.1|  Os04g0538800                                       370   1e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006281818.1|  hypothetical protein CARUB_v10028003mg             373   1e-117   
ref|XP_004974128.1|  PREDICTED: kinesin-like protein NACK1-like i...    372   1e-117   
ref|XP_009336747.1|  PREDICTED: kinesin-like protein NACK1              373   1e-117   
ref|NP_001063734.2|  Os09g0528000                                       368   1e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004509338.1|  PREDICTED: kinesin-related protein 4-like is...    371   1e-117   
ref|XP_010465682.1|  PREDICTED: kinesin-like protein NACK1              372   1e-117   
ref|XP_009407965.1|  PREDICTED: kinesin-like protein NACK2              370   1e-117   
gb|KDO49883.1|  hypothetical protein CISIN_1g002139mg                   369   2e-117   
ref|XP_010531480.1|  PREDICTED: kinesin-like protein NACK1              367   2e-117   
ref|XP_004160983.1|  PREDICTED: uncharacterized LOC101218717            370   2e-117   
gb|KGN53326.1|  hypothetical protein Csa_4G047870                       370   2e-117   
ref|XP_006659658.1|  PREDICTED: kinesin-like protein NACK2-like         370   2e-117   
ref|XP_004146557.1|  PREDICTED: uncharacterized protein LOC101218717    370   3e-117   
gb|KDO49879.1|  hypothetical protein CISIN_1g002139mg                   370   3e-117   
ref|XP_006487385.1|  PREDICTED: kinesin-like protein NACK1-like i...    370   3e-117   
ref|XP_007157943.1|  hypothetical protein PHAVU_002G111200g             369   3e-117   
ref|XP_006487377.1|  PREDICTED: kinesin-like protein NACK1-like i...    369   3e-117   
gb|AET03829.2|  ATP-binding microtubule motor family protein            373   3e-117   
ref|XP_006423482.1|  hypothetical protein CICLE_v10027758mg             369   4e-117   
ref|XP_006423481.1|  hypothetical protein CICLE_v10027758mg             369   4e-117   
gb|ABB45845.1|  hypothetical protein                                    371   4e-117   Eutrema halophilum
ref|XP_007156119.1|  hypothetical protein PHAVU_003G260200g             369   4e-117   
ref|XP_003629353.1|  Kinesin heavy chain DNA binding protein-like...    373   4e-117   
ref|XP_003607070.1|  Kinesin-related protein                            366   5e-117   
ref|XP_008452051.1|  PREDICTED: kinesin-like protein NACK1 isofor...    369   6e-117   
ref|XP_010672217.1|  PREDICTED: kinesin-like protein NACK2              370   6e-117   
dbj|BAB10710.1|  kinesin heavy chain DNA binding protein-like           370   7e-117   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001062429.1|  Os08g0547500                                       369   7e-117   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83991.1|  hypothetical protein OsI_30145                          369   7e-117   Oryza sativa Indica Group [Indian rice]
gb|EEE69110.1|  hypothetical protein OsJ_28179                          369   7e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010448602.1|  PREDICTED: kinesin-like protein NACK1              371   7e-117   
ref|NP_201432.2|  ATP binding microtubule motor family protein          370   7e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KGN43176.1|  hypothetical protein Csa_7G006260                       370   8e-117   
dbj|BAK06679.1|  predicted protein                                      367   8e-117   
gb|KHG01461.1|  Kinesin-related 11                                      368   8e-117   
ref|XP_011037209.1|  PREDICTED: kinesin-like protein NACK1              369   1e-116   
ref|XP_006652585.1|  PREDICTED: kinesin-like protein NACK1-like         367   1e-116   
gb|KHN33713.1|  Centromere-associated protein E                         367   1e-116   
gb|EMS46463.1|  Kinesin-related protein 11                              365   1e-116   
dbj|BAD09937.1|  putative kinesin heavy chain                           369   1e-116   Oryza sativa Japonica Group [Japonica rice]
gb|KDP27640.1|  hypothetical protein JCGZ_19645                         368   1e-116   
ref|XP_010690757.1|  PREDICTED: kinesin-like protein NACK1              366   2e-116   
ref|XP_003527612.1|  PREDICTED: kinesin-like protein NACK1-like i...    365   2e-116   
ref|XP_009393646.1|  PREDICTED: kinesin-like protein NACK1              366   2e-116   
ref|XP_010515506.1|  PREDICTED: kinesin-like protein NACK1 isofor...    366   2e-116   
ref|XP_010550454.1|  PREDICTED: kinesin-like protein NACK1 isofor...    367   2e-116   
ref|XP_007135918.1|  hypothetical protein PHAVU_009G003000g             365   2e-116   
ref|XP_010315333.1|  PREDICTED: kinesin-like protein NACK2 isofor...    366   3e-116   
ref|XP_010315335.1|  PREDICTED: kinesin-like protein NACK2 isofor...    366   3e-116   
emb|CDY34261.1|  BnaA01g13640D                                          363   5e-116   
ref|XP_002444630.1|  hypothetical protein SORBIDRAFT_07g025040          367   1e-115   Sorghum bicolor [broomcorn]
ref|XP_010526582.1|  PREDICTED: kinesin-like protein NACK1 isofor...    360   1e-115   
tpg|DAA36662.1|  TPA: hypothetical protein ZEAMMB73_386599              362   1e-115   
ref|XP_009123681.1|  PREDICTED: kinesin-like protein NACK1              367   1e-115   
ref|XP_010550452.1|  PREDICTED: kinesin-like protein NACK1 isofor...    367   1e-115   
ref|XP_008669086.1|  PREDICTED: kinesin-like protein NACK1 isofor...    362   2e-115   
ref|XP_010317235.1|  PREDICTED: kinesin-like protein NACK1 isofor...    363   2e-115   
ref|XP_010515505.1|  PREDICTED: kinesin-like protein NACK1 isofor...    366   2e-115   
ref|XP_002301999.2|  kinesin motor family protein                       363   3e-115   Populus trichocarpa [western balsam poplar]
ref|XP_002313758.2|  kinesin motor family protein                       364   4e-115   Populus trichocarpa [western balsam poplar]
ref|XP_004976382.1|  PREDICTED: kinesin-like protein NACK1-like i...    363   5e-115   
dbj|BAF00728.1|  hypothetical protein                                   363   5e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010317234.1|  PREDICTED: kinesin-like protein NACK1 isofor...    363   5e-115   
gb|EYU24075.1|  hypothetical protein MIMGU_mgv1a001308mg                361   6e-115   
gb|EEE70089.1|  hypothetical protein OsJ_30085                          361   7e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002448243.1|  hypothetical protein SORBIDRAFT_06g023880          362   9e-115   Sorghum bicolor [broomcorn]
emb|CAB62637.1|  putative protein                                       363   9e-115   Arabidopsis thaliana [mouse-ear cress]
gb|KHN20030.1|  Kinesin-related protein 4                               361   9e-115   
ref|XP_004293191.1|  PREDICTED: uncharacterized protein LOC101301847    364   9e-115   
ref|XP_008669081.1|  PREDICTED: kinesin-like protein NACK1 isofor...    362   1e-114   
ref|XP_006290553.1|  hypothetical protein CARUB_v10016639mg             363   1e-114   
ref|XP_010426660.1|  PREDICTED: kinesin-like protein NACK1 isofor...    362   1e-114   
ref|XP_008669085.1|  PREDICTED: kinesin-like protein NACK1 isofor...    361   1e-114   
ref|XP_008669084.1|  PREDICTED: kinesin-like protein NACK1 isofor...    362   1e-114   
ref|XP_011047311.1|  PREDICTED: kinesin-like protein NACK2 isofor...    363   1e-114   
tpg|DAA36661.1|  TPA: hypothetical protein ZEAMMB73_386599              362   1e-114   
ref|XP_010526578.1|  PREDICTED: kinesin-like protein NACK1 isofor...    360   1e-114   
ref|XP_011047336.1|  PREDICTED: kinesin-like protein NACK2 isofor...    363   2e-114   
ref|XP_006413467.1|  hypothetical protein EUTSA_v10026976mg             363   2e-114   
gb|KEH20388.1|  ATP-binding microtubule motor family protein            366   2e-114   
dbj|BAJ94998.1|  predicted protein                                      360   2e-114   
ref|XP_006404570.1|  hypothetical protein EUTSA_v10000043mg             359   3e-114   
ref|XP_010503800.1|  PREDICTED: kinesin-like protein NACK1              363   3e-114   
ref|XP_010240186.1|  PREDICTED: kinesin-like protein NACK1 isofor...    361   3e-114   
emb|CDX82016.1|  BnaC08g35850D                                          359   4e-114   
ref|NP_001190049.1|  ATP binding microtubule motor family protein       363   4e-114   
ref|NP_190684.3|  ATP binding microtubule motor family protein          363   4e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117419.1|  PREDICTED: kinesin-like protein NACK1              359   4e-114   
gb|EYU37862.1|  hypothetical protein MIMGU_mgv1a001175mg                359   4e-114   
emb|CDY13822.1|  BnaA09g43240D                                          359   4e-114   
ref|XP_004958729.1|  PREDICTED: kinesin-like protein NACK1-like         360   5e-114   
gb|KHG01762.1|  Kinesin-related 11                                      360   5e-114   
gb|KCW53111.1|  hypothetical protein EUGRSUZ_J02403                     359   5e-114   
ref|XP_008796871.1|  PREDICTED: kinesin-like protein NACK1              361   6e-114   
ref|XP_002876073.1|  kinesin motor family protein                       362   7e-114   
ref|XP_003578490.1|  PREDICTED: kinesin-like protein NACK1              358   9e-114   
ref|XP_009597015.1|  PREDICTED: kinesin-like protein NACK1              361   9e-114   
ref|XP_009137750.1|  PREDICTED: kinesin-like protein NACK2              364   1e-113   
dbj|BAJ95863.1|  predicted protein                                      360   1e-113   
ref|XP_010426656.1|  PREDICTED: kinesin-like protein NACK1 isofor...    362   1e-113   
ref|XP_008663419.1|  PREDICTED: kinesin-like protein NACK1 isofor...    359   1e-113   
ref|XP_008663418.1|  PREDICTED: kinesin-like protein NACK1 isofor...    359   2e-113   
emb|CDX99601.1|  BnaC04g33580D                                          356   2e-113   
gb|EMS68002.1|  Kinesin-related protein 11                              358   2e-113   
ref|XP_009777060.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...    357   3e-113   
ref|XP_010429028.1|  PREDICTED: kinesin-like protein NACK1              357   3e-113   
ref|XP_010416871.1|  PREDICTED: kinesin-like protein NACK1              357   3e-113   
gb|EEC73693.1|  hypothetical protein OsI_08272                          356   5e-113   Oryza sativa Indica Group [Indian rice]
gb|EEE57470.1|  hypothetical protein OsJ_07710                          356   5e-113   Oryza sativa Japonica Group [Japonica rice]
emb|CDX73746.1|  BnaC08g22570D                                          358   6e-113   
ref|XP_010679852.1|  PREDICTED: kinesin-like protein NACK1 isofor...    358   7e-113   
ref|XP_009115793.1|  PREDICTED: kinesin-like protein NACK1 isofor...    356   7e-113   
ref|XP_002880373.1|  kinesin motor family protein                       355   9e-113   
ref|XP_008668211.1|  PREDICTED: uncharacterized protein LOC100304...    356   9e-113   
ref|NP_179726.2|  ATP binding microtubule motor family protein          355   1e-112   Arabidopsis thaliana [mouse-ear cress]
gb|AFW63202.1|  hypothetical protein ZEAMMB73_949881                    353   1e-112   
ref|NP_001047571.1|  Os02g0645100                                       356   1e-112   Oryza sativa Japonica Group [Japonica rice]
gb|AAK91812.1|AF272749_1  kinesin heavy chain                           353   1e-112   Zea mays [maize]
ref|XP_008652981.1|  PREDICTED: kinesin-like protein NACK1 isofor...    356   1e-112   
ref|XP_008652983.1|  PREDICTED: kinesin-like protein NACK1 isofor...    356   1e-112   
ref|XP_008668212.1|  PREDICTED: uncharacterized protein LOC100304...    355   1e-112   
ref|XP_007042026.1|  ATP binding microtubule motor family protein...    357   1e-112   
ref|XP_010472110.1|  PREDICTED: kinesin-like protein NACK1              355   1e-112   
gb|EMT18151.1|  Kinesin-related protein 4                               355   2e-112   
ref|XP_008388149.1|  PREDICTED: kinesin-like protein NACK2              358   2e-112   
ref|XP_010679850.1|  PREDICTED: kinesin-like protein NACK1 isofor...    358   2e-112   
ref|XP_010679851.1|  PREDICTED: kinesin-like protein NACK1 isofor...    358   3e-112   
gb|KHN25430.1|  Centromere-associated protein E                         355   4e-112   
ref|XP_009140272.1|  PREDICTED: kinesin-like protein NACK1              353   4e-112   
ref|XP_006403945.1|  hypothetical protein EUTSA_v10010086mg             357   4e-112   
ref|XP_009115792.1|  PREDICTED: kinesin-like protein NACK1 isofor...    357   4e-112   
ref|XP_008678883.1|  PREDICTED: kinesin-like protein NACK1 isofor...    353   5e-112   
gb|EYU40392.1|  hypothetical protein MIMGU_mgv1a001117mg                354   5e-112   
ref|XP_006411686.1|  hypothetical protein EUTSA_v10024409mg             353   5e-112   
gb|ADQ43205.1|  kinesin motor family protein                            356   6e-112   
ref|XP_006647603.1|  PREDICTED: kinesin-like protein NACK1-like         353   6e-112   
ref|XP_004953277.1|  PREDICTED: kinesin-like protein NACK1-like i...    354   6e-112   
emb|CDX77978.1|  BnaA09g31730D                                          356   6e-112   
emb|CDY15900.1|  BnaA04g12110D                                          353   6e-112   
ref|XP_008388151.1|  PREDICTED: kinesin-like protein NACK1              358   6e-112   
ref|XP_010240187.1|  PREDICTED: kinesin-like protein NACK1 isofor...    352   7e-112   
ref|XP_010547443.1|  PREDICTED: kinesin-like protein NACK2 isofor...    354   7e-112   
ref|XP_008678882.1|  PREDICTED: kinesin-like protein NACK1 isofor...    353   9e-112   
ref|XP_007131749.1|  hypothetical protein PHAVU_011G038800g             353   1e-111   
dbj|BAD18096.1|  kinesin heavy chain-like protein                       344   1e-111   
ref|XP_007131750.1|  hypothetical protein PHAVU_011G038800g             353   1e-111   
ref|XP_003569980.1|  PREDICTED: kinesin-like protein NACK2              352   2e-111   
gb|KHF98979.1|  Kinesin-related 11                                      354   2e-111   
dbj|BAF02000.1|  kinesin like protein                                   351   3e-111   
ref|XP_010431843.1|  PREDICTED: kinesin-like protein NACK1              351   3e-111   
ref|NP_195606.2|  ATP binding microtubule motor family protein          350   4e-111   
gb|EEC84919.1|  hypothetical protein OsI_32119                          356   4e-111   
ref|XP_002868873.1|  kinesin motor family protein                       350   4e-111   
ref|XP_006296345.1|  hypothetical protein CARUB_v10025517mg             350   6e-111   
ref|XP_010547439.1|  PREDICTED: kinesin-like protein NACK2 isofor...    353   7e-111   
ref|XP_010547438.1|  PREDICTED: kinesin-like protein NACK1 isofor...    353   7e-111   
ref|XP_010240185.1|  PREDICTED: kinesin-like protein NACK1 isofor...    352   7e-111   
ref|XP_010547437.1|  PREDICTED: kinesin-like protein NACK1 isofor...    353   8e-111   
ref|XP_010547436.1|  PREDICTED: kinesin-like protein NACK1 isofor...    353   8e-111   
ref|XP_006283113.1|  hypothetical protein CARUB_v10004132mg             350   9e-111   
emb|CDY29004.1|  BnaC07g32100D                                          353   1e-110   
ref|XP_010446407.1|  PREDICTED: kinesin-like protein NACK1 isofor...    349   1e-110   
emb|CDY41952.1|  BnaA01g05240D                                          347   4e-110   
ref|XP_009140424.1|  PREDICTED: kinesin-like protein NACK1              347   4e-110   
ref|XP_010547440.1|  PREDICTED: kinesin-like protein NACK2 isofor...    351   4e-110   
ref|XP_010436987.1|  PREDICTED: kinesin-like protein NACK1              348   4e-110   
emb|CDX90660.1|  BnaA03g41210D                                          351   9e-110   
ref|XP_009136600.1|  PREDICTED: kinesin-like protein NACK1 isofor...    348   1e-109   
emb|CDY03482.1|  BnaC01g16000D                                          349   2e-109   
ref|XP_009791027.1|  PREDICTED: kinesin-like protein NACK1              350   2e-109   
ref|XP_010547441.1|  PREDICTED: kinesin-like protein NACK2 isofor...    349   2e-109   
ref|XP_010547442.1|  PREDICTED: kinesin-like protein NACK2 isofor...    348   3e-109   
emb|CDY42594.1|  BnaC01g00060D                                          345   3e-109   
ref|XP_010235379.1|  PREDICTED: kinesin-like protein NACK2 isofor...    349   4e-109   
ref|XP_010235378.1|  PREDICTED: kinesin-like protein NACK2 isofor...    349   5e-109   
ref|XP_009136598.1|  PREDICTED: kinesin-like protein NACK1 isofor...    348   8e-109   
ref|XP_009386558.1|  PREDICTED: kinesin-like protein NACK1              345   3e-108   
gb|EMS48622.1|  Kinesin-related protein 4                               346   1e-106   
gb|EMT22069.1|  Kinesin-related protein 4                               338   6e-105   
gb|KHN45902.1|  Kinesin-related protein 11                              333   1e-103   
gb|AAD23678.1|  putative kinesin heavy chain                            320   4e-102   
gb|KHN09110.1|  Kinesin-related protein 4                               328   2e-101   
ref|XP_007136058.1|  hypothetical protein PHAVU_009G014400g             325   3e-101   
gb|AAB63609.1|  kinesin heavy chain isolog                              322   7e-99    
ref|XP_006582466.1|  PREDICTED: kinesin-like protein NACK1-like         321   1e-98    
gb|AES73979.2|  ATP-binding microtubule motor family protein            325   2e-98    
ref|XP_008659376.1|  PREDICTED: kinesin-like protein NACK1              318   5e-98    
gb|KHN39844.1|  Centromere-associated protein E                         317   6e-98    
gb|AFW86156.1|  LOW QUALITY PROTEIN: kinesin heavy chain                318   7e-98    
ref|XP_009418072.1|  PREDICTED: kinesin-like protein NACK1              318   1e-97    
ref|XP_002516209.1|  microtubule motor, putative                        315   3e-97    
gb|KDP33977.1|  hypothetical protein JCGZ_07548                         316   3e-97    
gb|EEC70753.1|  hypothetical protein OsI_02166                          316   4e-97    
ref|NP_001043186.1|  Os01g0513900                                       316   4e-97    
gb|KHN36049.1|  Kinesin-related protein 4                               315   8e-97    
ref|XP_010107075.1|  Kinesin-related protein 4                          315   9e-97    
ref|XP_009407329.1|  PREDICTED: kinesin-like protein NACK1              315   2e-96    
ref|XP_009101918.1|  PREDICTED: kinesin-like protein NACK1              310   2e-96    
gb|KDO73778.1|  hypothetical protein CISIN_1g003967mg                   310   2e-96    
ref|XP_004968822.1|  PREDICTED: kinesin-like protein NACK1-like i...    314   2e-96    
ref|XP_002992286.1|  hypothetical protein SELMODRAFT_135047             312   4e-96    
ref|XP_006842375.1|  hypothetical protein AMTR_s00079p00190770          314   4e-96    
ref|XP_002987833.1|  hypothetical protein SELMODRAFT_126650             312   4e-96    
ref|XP_006644227.1|  PREDICTED: kinesin-like protein NACK1-like         313   6e-96    
gb|EMS48860.1|  Kinesin-related protein 4                               311   7e-96    
emb|CAB38815.1|  kinesin like protein                                   310   8e-96    
ref|XP_003603728.1|  Kinesin-related protein                            317   1e-95    
ref|XP_006452892.1|  hypothetical protein CICLE_v10007377mg             311   3e-95    
ref|XP_006474579.1|  PREDICTED: kinesin-like protein NACK2-like         310   4e-95    
ref|XP_003541319.1|  PREDICTED: kinesin-like protein NACK2-like i...    310   5e-95    
ref|XP_001779285.1|  predicted protein                                  310   5e-95    
ref|XP_003568740.1|  PREDICTED: kinesin-like protein NACK1              310   7e-95    
ref|XP_006381563.1|  TETRASPORE family protein                          310   9e-95    
ref|XP_010922342.1|  PREDICTED: kinesin-like protein NACK1              309   1e-94    
ref|XP_007154542.1|  hypothetical protein PHAVU_003G127400g             309   2e-94    
gb|EMT03608.1|  Kinesin-related protein 4                               307   2e-94    
ref|XP_002437695.1|  hypothetical protein SORBIDRAFT_10g001010          308   2e-94    
ref|XP_011039916.1|  PREDICTED: kinesin-like protein NACK2              308   2e-94    
ref|XP_011078149.1|  PREDICTED: kinesin-like protein NACK2              308   5e-94    
ref|XP_006588174.1|  PREDICTED: kinesin-like protein NACK1-like         288   7e-94    
ref|XP_004508037.1|  PREDICTED: centromere-associated protein E-l...    303   2e-93    
ref|XP_010110084.1|  Kinesin-related protein 4                          305   5e-93    
ref|XP_007012544.1|  ATP binding microtubule motor family protein...    305   5e-93    
gb|KHG14242.1|  Kinesin-related 4                                       305   5e-93    
ref|XP_007012545.1|  ATP binding microtubule motor family protein...    305   5e-93    
emb|CBI15491.3|  unnamed protein product                                302   1e-92    
ref|XP_004508036.1|  PREDICTED: centromere-associated protein E-l...    304   1e-92    
ref|XP_003534160.1|  PREDICTED: kinesin-like protein NACK1-like i...    304   1e-92    
gb|KHN23757.1|  Kinesin-related protein 4                               304   2e-92    
ref|XP_010906990.1|  PREDICTED: kinesin-like protein NACK1              303   2e-92    
ref|XP_010687583.1|  PREDICTED: kinesin-like protein NACK2              303   2e-92    
gb|EMS53749.1|  Kinesin-related protein 4                               303   2e-92    
gb|EMT03728.1|  Kinesin-related protein 4                               302   3e-92    
ref|XP_002279228.1|  PREDICTED: kinesin-like protein NACK1              303   5e-92    
ref|XP_004235748.1|  PREDICTED: kinesin-like protein NACK1              303   5e-92    
dbj|BAK03253.1|  predicted protein                                      302   5e-92    
ref|XP_007036598.1|  ATP binding microtubule motor family protein...    298   6e-92    
ref|XP_008393328.1|  PREDICTED: kinesin-like protein NACK1              302   9e-92    
ref|XP_009360131.1|  PREDICTED: kinesin-like protein NACK1              302   9e-92    
emb|CDY22404.1|  BnaA06g37260D                                          298   1e-91    
ref|XP_002462712.1|  hypothetical protein SORBIDRAFT_02g030680          300   1e-91    
ref|XP_003528955.1|  PREDICTED: kinesin-like protein NACK1-like i...    301   1e-91    
gb|KHN20772.1|  Kinesin-related protein 4                               301   2e-91    
ref|XP_006341574.1|  PREDICTED: kinesin-like protein NACK1-like i...    301   2e-91    
ref|XP_010227940.1|  PREDICTED: kinesin-like protein NACK1              301   3e-91    
ref|XP_002275046.2|  PREDICTED: kinesin-like protein NACK2              300   3e-91    
emb|CBI27754.3|  unnamed protein product                                300   3e-91    
gb|KDP35186.1|  hypothetical protein JCGZ_10720                         300   4e-91    
gb|KHG07572.1|  kif4                                                    300   5e-91    
gb|KHG07573.1|  kif4                                                    300   5e-91    
gb|EYU21085.1|  hypothetical protein MIMGU_mgv1a000841mg                300   6e-91    
ref|XP_010540004.1|  PREDICTED: kinesin-like protein NACK1              300   7e-91    
ref|XP_010036903.1|  PREDICTED: kinesin-like protein NACK1              300   8e-91    
ref|XP_009589619.1|  PREDICTED: kinesin-like protein NACK1              299   9e-91    
ref|XP_009804137.1|  PREDICTED: kinesin-like protein NACK1              299   1e-90    
ref|XP_011045827.1|  PREDICTED: kinesin-like protein NACK1 isofor...    296   1e-90    
ref|XP_007036597.1|  ATP binding microtubule motor family protein...    299   1e-90    
gb|KGN51423.1|  hypothetical protein Csa_5G537000                       298   2e-90    
ref|XP_008460891.1|  PREDICTED: kinesin-like protein NACK1              298   2e-90    
ref|XP_007210400.1|  hypothetical protein PRUPE_ppa000865mg             298   2e-90    
ref|XP_008240232.1|  PREDICTED: kinesin-like protein NACK1              298   3e-90    
ref|XP_007152726.1|  hypothetical protein PHAVU_004G154300g             298   3e-90    
ref|XP_011072914.1|  PREDICTED: kinesin-like protein NACK1              298   4e-90    
gb|EYU28300.1|  hypothetical protein MIMGU_mgv1a001029mg                296   4e-90    
ref|XP_008792831.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...    297   4e-90    
ref|XP_004512893.1|  PREDICTED: kinesin-II 95 kDa subunit-like is...    297   5e-90    
gb|KDO49802.1|  hypothetical protein CISIN_1g002128mg                   297   7e-90    
ref|XP_008460563.1|  PREDICTED: kinesin-like protein NACK2 isofor...    296   7e-90    
ref|XP_006442593.1|  hypothetical protein CICLE_v10018724mg             296   8e-90    
gb|KHN45051.1|  Kinesin-related protein 4                               296   8e-90    
ref|XP_006477781.1|  PREDICTED: kinesin-like protein NACK1-like         296   8e-90    
ref|XP_008460562.1|  PREDICTED: kinesin-like protein NACK2 isofor...    296   9e-90    
ref|XP_010693857.1|  PREDICTED: kinesin-like protein NACK1              296   1e-89    
ref|XP_003620405.1|  Kinesin-like protein KIF3A                         296   1e-89    
ref|XP_006353764.1|  PREDICTED: kinesin-like protein NACK2-like         296   1e-89    
ref|XP_004137483.1|  PREDICTED: uncharacterized protein LOC101215425    296   1e-89    
ref|XP_010279346.1|  PREDICTED: kinesin-like protein NACK1              296   1e-89    
ref|XP_010323978.1|  PREDICTED: kinesin-like protein NACK2              296   1e-89    
gb|KGN64145.1|  hypothetical protein Csa_1G042550                       296   1e-89    
ref|XP_004166306.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    296   1e-89    
gb|AES76623.2|  ATP-binding microtubule motor family protein            296   2e-89    
ref|XP_006416611.1|  hypothetical protein EUTSA_v10006702mg             296   2e-89    
ref|XP_011045825.1|  PREDICTED: kinesin-like protein NACK1 isofor...    296   2e-89    
ref|XP_006303901.1|  hypothetical protein CARUB_v10008207mg             296   2e-89    
emb|CDO98410.1|  unnamed protein product                                295   4e-89    
ref|XP_004300503.1|  PREDICTED: uncharacterized protein LOC101315243    295   4e-89    
emb|CDY19208.1|  BnaC05g14090D                                          295   5e-89    
gb|KHG01962.1|  Kinesin-related 4                                       295   5e-89    
ref|XP_010498223.1|  PREDICTED: kinesin-like protein NACK1              294   8e-89    
ref|XP_002318539.1|  hypothetical protein POPTR_0012s05060g             294   8e-89    
ref|XP_009786270.1|  PREDICTED: kinesin-like protein NACK2 isofor...    294   1e-88    
ref|XP_010535793.1|  PREDICTED: kinesin-like protein NACK2 isofor...    293   1e-88    
ref|XP_010535794.1|  PREDICTED: kinesin-like protein NACK2 isofor...    293   1e-88    
ref|XP_009786272.1|  PREDICTED: kinesin-like protein NACK2 isofor...    293   1e-88    
ref|XP_010537459.1|  PREDICTED: kinesin-like protein NACK1 isofor...    294   1e-88    
ref|XP_009149278.1|  PREDICTED: kinesin-like protein NACK1              293   2e-88    
emb|CDY26167.1|  BnaA06g12500D                                          293   2e-88    
ref|XP_010261715.1|  PREDICTED: kinesin-like protein NACK2              293   2e-88    
ref|NP_173273.2|  kinesin HINKEL                                        293   2e-88    
ref|XP_009347467.1|  PREDICTED: kinesin-like protein NACK1              293   2e-88    
emb|CDY21709.1|  BnaA09g44600D                                          293   2e-88    
ref|XP_002893000.1|  hypothetical protein ARALYDRAFT_472057             293   2e-88    
ref|XP_009117616.1|  PREDICTED: kinesin-like protein NACK1              293   2e-88    
ref|XP_008775906.1|  PREDICTED: kinesin-like protein NACK1              292   5e-88    
emb|CDX81870.1|  BnaC08g37310D                                          291   5e-88    
ref|XP_008356658.1|  PREDICTED: kinesin-like protein NACK1              291   1e-87    
gb|AAK91822.1|AF272759_1  kinesin heavy chain                           290   1e-87    
ref|XP_011008305.1|  PREDICTED: kinesin-like protein NACK1              290   1e-87    
ref|XP_010459448.1|  PREDICTED: kinesin-like protein NACK1              291   2e-87    
ref|XP_010250094.1|  PREDICTED: kinesin-like protein NACK1              290   2e-87    
gb|EMS62599.1|  Kinesin-related protein 4                               292   3e-87    
ref|XP_009786269.1|  PREDICTED: kinesin-like protein NACK2 isofor...    290   3e-87    
ref|XP_010477014.1|  PREDICTED: kinesin-like protein NACK1              290   3e-87    
ref|XP_009786271.1|  PREDICTED: kinesin-like protein NACK2 isofor...    289   4e-87    
emb|CDP03034.1|  unnamed protein product                                288   7e-87    
ref|XP_009625447.1|  PREDICTED: kinesin-like protein NACK2              288   9e-87    
ref|XP_008353949.1|  PREDICTED: kinesin-like protein KIF17              282   1e-86    
gb|EPS71432.1|  hypothetical protein M569_03327                         288   1e-86    
gb|KDP38590.1|  hypothetical protein JCGZ_04515                         288   1e-86    
ref|XP_008367780.1|  PREDICTED: kinesin-like protein NACK1              280   1e-86    
ref|XP_002321490.2|  nodulin-25 precursor family protein                288   2e-86    
sp|Q8S949.1|NACK2_TOBAC  RecName: Full=Kinesin-like protein NACK2...    286   4e-86    
ref|XP_002512997.1|  ATP binding protein, putative                      285   5e-86    
ref|XP_009365403.1|  PREDICTED: uncharacterized protein LOC103955247    285   7e-85    
ref|XP_002875601.1|  hypothetical protein ARALYDRAFT_323079             282   2e-84    
ref|XP_010430934.1|  PREDICTED: kinesin-like protein NACK2              281   2e-84    
ref|XP_006290563.1|  hypothetical protein CARUB_v10016650mg             281   2e-84    
ref|XP_010503028.1|  PREDICTED: kinesin-like protein NACK2              281   3e-84    
ref|XP_004287670.1|  PREDICTED: uncharacterized protein LOC101306666    281   4e-84    
ref|XP_010514712.1|  PREDICTED: kinesin-like protein NACK2              281   4e-84    
ref|XP_006419132.1|  hypothetical protein EUTSA_v10002392mg             281   5e-84    
ref|XP_011045826.1|  PREDICTED: kinesin-like protein NACK1 isofor...    280   1e-83    
emb|CDY44836.1|  BnaCnng11920D                                          279   2e-83    
gb|AAK91813.1|AF272750_1  kinesin heavy chain                           276   2e-83    
ref|XP_008361127.1|  PREDICTED: kinesin-like protein NACK1              280   2e-83    
ref|NP_189907.2|  kinesin TETRASPORE                                    278   5e-83    
emb|CAD42234.1|  kinesin-like protein                                   278   5e-83    
emb|CAD42658.1|  kinesin-like protein                                   278   5e-83    
emb|CAB89042.1|  kinesin-like protein                                   278   6e-83    
ref|XP_010537463.1|  PREDICTED: kinesin-like protein NACK1 isofor...    273   5e-82    
emb|CDY30956.1|  BnaA06g19570D                                          273   2e-81    
ref|XP_009150293.1|  PREDICTED: kinesin-like protein NACK2              273   2e-81    
ref|XP_008242294.1|  PREDICTED: kinesin-like protein NACK2              273   3e-81    
ref|XP_009359691.1|  PREDICTED: kinesin-like protein NACK2              269   8e-80    
gb|EEE57467.1|  hypothetical protein OsJ_07707                          264   1e-79    
gb|KCW81847.1|  hypothetical protein EUGRSUZ_C03198                     268   3e-79    
gb|AAF25984.1|AC013354_3  F15H18.12                                     268   5e-79    
ref|XP_008337808.1|  PREDICTED: kinesin-like protein NACK2 isofor...    266   7e-79    
ref|XP_008337807.1|  PREDICTED: kinesin-like protein NACK2 isofor...    266   8e-79    
ref|XP_007203229.1|  hypothetical protein PRUPE_ppa000925mg             265   5e-78    
gb|AES92142.2|  ATP-binding microtubule motor family protein            263   3e-77    
tpg|DAA62428.1|  TPA: hypothetical protein ZEAMMB73_515130              254   1e-75    
tpg|DAA40600.1|  TPA: hypothetical protein ZEAMMB73_646629              253   1e-75    
dbj|BAD25802.1|  putative kinesin heavy chain                           252   2e-75    
dbj|BAD93933.1|  putative kinesin heavy chain                           251   4e-75    
gb|KHN19178.1|  Kinesin-related protein 11                              244   1e-74    
ref|XP_003609945.1|  Kinesin-like protein                               254   1e-73    
ref|XP_010051345.1|  PREDICTED: kinesin-like protein NACK2              251   2e-73    
ref|XP_001754604.1|  predicted protein                                  213   1e-62    
ref|XP_002502548.1|  predicted protein                                  202   3e-59    
ref|XP_005648192.1|  kinesin-domain-containing protein                  200   4e-58    



>gb|EYU38855.1| hypothetical protein MIMGU_mgv1a000996mg [Erythranthe guttata]
Length=917

 Score =   399 bits (1024),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 202/257 (79%), Positives = 225/257 (88%), Gaps = 2/257 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL +D TPLRLLDDPERGTVV+KL+EV  RD++HL ELLSICEAQRQIGETTLN +SSR
Sbjct  158  DLLCSDGTPLRLLDDPERGTVVDKLTEVTLRDENHLYELLSICEAQRQIGETTLNELSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LT+ES    Y    N+STL+A+VNF+DLAGSERASQT SAGTRLKEGCHINRSL
Sbjct  218  SHQILKLTVESEARGYFGAENSSTLTASVNFVDLAGSERASQTHSAGTRLKEGCHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRN HIPYRDSKLTRILQ+SLGGNARTAIICTMSPAH+HVEQSRNTLL
Sbjct  278  LTLGTVIRKLSKGRNAHIPYRDSKLTRILQNSLGGNARTAIICTMSPAHTHVEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRAL--RSRSVDETSSLVLKEKE  716
            FA+CAKQV T AQVNVVMS+KALVKQLQ+ELAK+E ELR L   S S   +SS  L+EKE
Sbjct  338  FASCAKQVNTNAQVNVVMSEKALVKQLQRELAKMEGELRNLSSLSSSSGVSSSSALREKE  397

Query  717  ALIEKMEKEMRDLMMQR  767
             LIEKM+KE+R+L  QR
Sbjct  398  LLIEKMDKEIRELTHQR  414



>ref|XP_011083601.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011083602.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=913

 Score =   398 bits (1022),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 204/255 (80%), Positives = 224/255 (88%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL  D  PLRLLDDPERGTVV+KL+EV  RD  HL ELLS+CEAQRQIGETTLN MSSR
Sbjct  161  DLLWPDGGPLRLLDDPERGTVVDKLTEVTLRDFDHLRELLSVCEAQRQIGETTLNEMSSR  220

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT++S   +Y    N+S L+A VNF+DLAGSERASQTLSAGTRLKEGCHINRSL
Sbjct  221  SHQILRLTVDSEAREYLGRDNSSVLTATVNFVDLAGSERASQTLSAGTRLKEGCHINRSL  280

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ+SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  281  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQNSLGGNARTAIICTMSPAHSHVEQSRNTLL  340

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAKQV+T AQVN+VMS+KALVKQLQ+ELA+LE+ELR LRS S   +SS  LKEKE L
Sbjct  341  FASCAKQVSTNAQVNLVMSEKALVKQLQRELARLENELRNLRSASA-SSSSSALKEKELL  399

Query  723  IEKMEKEMRDLMMQR  767
            IEKM KE+R+L  QR
Sbjct  400  IEKMSKEIRELKHQR  414



>emb|CDP07439.1| unnamed protein product [Coffea canephora]
Length=937

 Score =   398 bits (1023),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/255 (78%), Positives = 225/255 (88%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D TPLRLLDDP+RGTVVEK++EV  RD SHL ELLS+C AQR+IGET+LN MSSR
Sbjct  160  DLLSSDATPLRLLDDPDRGTVVEKITEVALRDWSHLKELLSLCAAQRKIGETSLNEMSSR  219

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT++SS  ++    N+STLSA VNF+DLAGSERASQTLSAGTRLKEG HINRSL
Sbjct  220  SHQILRLTVDSSAREFRRTENSSTLSATVNFVDLAGSERASQTLSAGTRLKEGSHINRSL  279

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRN HIPYRDSKLTRILQ+SLGGNARTAIICT+SPAHSHVEQSRNTLL
Sbjct  280  LTLGTVIRKLSKGRNAHIPYRDSKLTRILQNSLGGNARTAIICTLSPAHSHVEQSRNTLL  339

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAKQV+T A VNVVMS+KALVKQLQ+ELA+LES+L+ L S S +   SL LKEKE L
Sbjct  340  FASCAKQVSTNAHVNVVMSEKALVKQLQRELARLESQLKNLGSLS-NSCDSLALKEKELL  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKM+KE+R L  QR
Sbjct  399  IEKMDKEIRALTDQR  413



>ref|XP_008775732.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Phoenix dactylifera]
Length=918

 Score =   395 bits (1016),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/256 (78%), Positives = 225/256 (88%), Gaps = 1/256 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD++PLRLLDDPERGT+VEKL+E   RDQSHL ELLS+CEAQRQIGET+LN MSSR
Sbjct  189  DLLSTDSSPLRLLDDPERGTIVEKLTEETLRDQSHLKELLSLCEAQRQIGETSLNEMSSR  248

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRL IESS  ++    ++S+L+A VNF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  249  SHQILRLMIESSAREFLSRDSSSSLAATVNFVDLAGSERASQVLSAGTRLKEGCHINRSL  308

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ+SLG NARTAIICTMSPA SH+EQSRNTLL
Sbjct  309  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQYSLGSNARTAIICTMSPARSHIEQSRNTLL  368

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETS-SLVLKEKEA  719
            FA+CAK+V T AQVNVVMSDKALV+ LQ+ELA+LESEL+  RS S   TS S VL EK+ 
Sbjct  369  FASCAKEVVTNAQVNVVMSDKALVRHLQRELARLESELKYPRSASASCTSPSDVLSEKDV  428

Query  720  LIEKMEKEMRDLMMQR  767
             I+KMEKE+++LM QR
Sbjct  429  QIKKMEKEIKELMQQR  444



>ref|XP_008775730.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Phoenix dactylifera]
Length=1022

 Score =   395 bits (1016),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 199/256 (78%), Positives = 225/256 (88%), Gaps = 1/256 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD++PLRLLDDPERGT+VEKL+E   RDQSHL ELLS+CEAQRQIGET+LN MSSR
Sbjct  189  DLLSTDSSPLRLLDDPERGTIVEKLTEETLRDQSHLKELLSLCEAQRQIGETSLNEMSSR  248

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRL IESS  ++    ++S+L+A VNF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  249  SHQILRLMIESSAREFLSRDSSSSLAATVNFVDLAGSERASQVLSAGTRLKEGCHINRSL  308

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ+SLG NARTAIICTMSPA SH+EQSRNTLL
Sbjct  309  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQYSLGSNARTAIICTMSPARSHIEQSRNTLL  368

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETS-SLVLKEKEA  719
            FA+CAK+V T AQVNVVMSDKALV+ LQ+ELA+LESEL+  RS S   TS S VL EK+ 
Sbjct  369  FASCAKEVVTNAQVNVVMSDKALVRHLQRELARLESELKYPRSASASCTSPSDVLSEKDV  428

Query  720  LIEKMEKEMRDLMMQR  767
             I+KMEKE+++LM QR
Sbjct  429  QIKKMEKEIKELMQQR  444



>ref|XP_010445917.1| PREDICTED: kinesin-like protein NACK1, partial [Camelina sativa]
Length=645

 Score =   385 bits (989),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 190/255 (75%), Positives = 223/255 (87%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS DN PLRLLDDPERGTVVEKL E   +D++HL ELL++CE QR+IGET+LN  SSR
Sbjct  31   DLLSGDNNPLRLLDDPERGTVVEKLIEETIQDRTHLEELLTVCETQRKIGETSLNETSSR  90

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIES+  +YS P N+STL+A+V F+DLAGSERASQTLSAGTRLKEGCHINRSL
Sbjct  91   SHQILRLTIESTGREYS-PDNSSTLAASVCFVDLAGSERASQTLSAGTRLKEGCHINRSL  149

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ+SLGGNARTAI+CTMSPA SHVEQSRNTLL
Sbjct  150  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQNSLGGNARTAIVCTMSPARSHVEQSRNTLL  209

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V T AQVN+V+S+KALV+QLQKELA++E+EL+ L S S D     +LK+KE +
Sbjct  210  FAICAKEVTTNAQVNLVVSEKALVRQLQKELARMENELKNLGSASGDSDFYSLLKQKEEV  269

Query  723  IEKMEKEMRDLMMQR  767
            I KME++M++L  QR
Sbjct  270  IAKMEEQMKELKWQR  284



>ref|XP_010919403.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Elaeis guineensis]
Length=803

 Score =   389 bits (999),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 196/255 (77%), Positives = 222/255 (87%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GT+VEKL+E + RD +HL EL+S+CEAQR+IGET+LN  SSR
Sbjct  10   DLLSTDSTPLRLLDDPEKGTIVEKLTEEVLRDWNHLKELISVCEAQRKIGETSLNETSSR  69

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+STL A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  70   SHQILRLTIESSAREFLGKENSSTLVASVNFVDLAGSERASQALSAGARLKEGCHINRSL  129

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  130  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSHIEQSRNTLL  189

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V T AQVNVVMSDKALVK LQKELA+LES L+   S S  E+   VLKE++A 
Sbjct  190  FANCAKEVVTSAQVNVVMSDKALVKHLQKELARLESALKYPGSSSGAES---VLKERDAQ  246

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEKE+R+L+ QR
Sbjct  247  IKKMEKEIRELIQQR  261



>ref|XP_011074636.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Sesamum indicum]
 ref|XP_011074637.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Sesamum indicum]
Length=989

 Score =   394 bits (1011),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 222/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDP RGTVVEKL+EV  RD SHL ELLSICEAQR+IGETTLN MSSR
Sbjct  157  DLLSFDGTPLRLLDDPVRGTVVEKLTEVTLRDYSHLKELLSICEAQRKIGETTLNEMSSR  216

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL LT+ES   +Y    N+S+L+A VNF+DLAGSERASQT SAG RLKEGCHINRSL
Sbjct  217  SHQILCLTVESEARKYFSAENSSSLTATVNFVDLAGSERASQTSSAGMRLKEGCHINRSL  276

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTA+ICTMSPAHSHVEQSR+TL+
Sbjct  277  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAVICTMSPAHSHVEQSRSTLV  336

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAKQV+T A+VNVVMS+KALVKQL++E+ ++E+ELR L S +    ++  LKEKE L
Sbjct  337  FASCAKQVSTNAKVNVVMSEKALVKQLRREITRMENELRNLNSIATSCDTASALKEKELL  396

Query  723  IEKMEKEMRDLMMQR  767
            IEK++KE+R L+ QR
Sbjct  397  IEKLDKEIRQLIHQR  411



>ref|XP_011074638.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Sesamum indicum]
Length=974

 Score =   393 bits (1010),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 222/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDP RGTVVEKL+EV  RD SHL ELLSICEAQR+IGETTLN MSSR
Sbjct  157  DLLSFDGTPLRLLDDPVRGTVVEKLTEVTLRDYSHLKELLSICEAQRKIGETTLNEMSSR  216

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL LT+ES   +Y    N+S+L+A VNF+DLAGSERASQT SAG RLKEGCHINRSL
Sbjct  217  SHQILCLTVESEARKYFSAENSSSLTATVNFVDLAGSERASQTSSAGMRLKEGCHINRSL  276

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTA+ICTMSPAHSHVEQSR+TL+
Sbjct  277  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAVICTMSPAHSHVEQSRSTLV  336

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAKQV+T A+VNVVMS+KALVKQL++E+ ++E+ELR L S +    ++  LKEKE L
Sbjct  337  FASCAKQVSTNAKVNVVMSEKALVKQLRREITRMENELRNLNSIATSCDTASALKEKELL  396

Query  723  IEKMEKEMRDLMMQR  767
            IEK++KE+R L+ QR
Sbjct  397  IEKLDKEIRQLIHQR  411



>ref|XP_010271468.1| PREDICTED: kinesin-like protein NACK2 [Nelumbo nucifera]
Length=976

 Score =   393 bits (1010),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 197/255 (77%), Positives = 221/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPERGTVVEKL+E + RD +HL ELLSICEAQR+IGET+LN  SSR
Sbjct  159  DLLSVDSTPLRLLDDPERGTVVEKLTEEILRDWNHLKELLSICEAQRKIGETSLNETSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+STL+A+VNF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  219  SHQILRLTIESSAREFLGKDNSSTLAASVNFVDLAGSERASQALSAGTRLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTM PA SH+EQSRNTLL
Sbjct  279  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQPSLGGNARTAIICTMCPARSHLEQSRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+VAT AQVN+VMSDKALVK LQ+ELA+LESELR     S     S +LKEK+  
Sbjct  339  FASCAKEVATNAQVNIVMSDKALVKHLQRELARLESELRGPGPTSATCDFSALLKEKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKME+E+++L  QR
Sbjct  399  IEKMEREIKELTQQR  413



>ref|XP_008791672.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Phoenix dactylifera]
Length=867

 Score =   389 bits (999),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 195/255 (76%), Positives = 223/255 (87%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GT+VEKL+E + RD +HL EL+S+CEAQR+IGET+LN  SSR
Sbjct  174  DLLSTDSTPLRLLDDPEKGTIVEKLTEEVLRDWNHLKELISVCEAQRKIGETSLNETSSR  233

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +STL A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  234  SHQILRLTIESSAREFLGKETSSTLVASVNFVDLAGSERASQALSAGARLKEGCHINRSL  293

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  294  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSHIEQSRNTLL  353

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CA++V T AQVNVVMSDKALVK LQKELAKLES L+   S S  E+   VLKEK+A 
Sbjct  354  FASCAREVVTSAQVNVVMSDKALVKHLQKELAKLESALKYPGSSSSIES---VLKEKDAQ  410

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEKE+R+L++Q+
Sbjct  411  IKKMEKEIRELILQK  425



>ref|XP_009767346.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009767347.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Nicotiana sylvestris]
Length=907

 Score =   390 bits (1002),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 223/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL+ D+TPLRLLDDPERGTVVEKL+EV  +D +HL ELLS+CEAQR+IGET LN MSSR
Sbjct  159  DLLTPDDTPLRLLDDPERGTVVEKLTEVTLKDWNHLKELLSVCEAQRKIGETALNEMSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  ++   +N+STL++AVNF+DLAGSERASQTLSA  RLKEG HINRSL
Sbjct  219  SHQILRLTVESTAKKFVGFQNSSTLTSAVNFVDLAGSERASQTLSANVRLKEGSHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK  NGHIP+RDSKLTRILQ+SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  279  LTLGTVIRKLSKKGNGHIPFRDSKLTRILQNSLGGNARTAIICTMSPAHSHVEQSRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK V T A+VNVVMS+KALVKQL+KELA+LE+ELR L + +    S+  LKEKEAL
Sbjct  339  FATCAKNVITNAKVNVVMSEKALVKQLRKELARLEAELRNLSALAASGGSAEALKEKEAL  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKM +E+R+L  QR
Sbjct  399  IEKMSREIRELTEQR  413



>ref|XP_009767348.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Nicotiana sylvestris]
Length=905

 Score =   390 bits (1001),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 223/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL+ D+TPLRLLDDPERGTVVEKL+EV  +D +HL ELLS+CEAQR+IGET LN MSSR
Sbjct  159  DLLTPDDTPLRLLDDPERGTVVEKLTEVTLKDWNHLKELLSVCEAQRKIGETALNEMSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  ++   +N+STL++AVNF+DLAGSERASQTLSA  RLKEG HINRSL
Sbjct  219  SHQILRLTVESTAKKFVGFQNSSTLTSAVNFVDLAGSERASQTLSANVRLKEGSHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK  NGHIP+RDSKLTRILQ+SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  279  LTLGTVIRKLSKKGNGHIPFRDSKLTRILQNSLGGNARTAIICTMSPAHSHVEQSRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK V T A+VNVVMS+KALVKQL+KELA+LE+ELR L + +    S+  LKEKEAL
Sbjct  339  FATCAKNVITNAKVNVVMSEKALVKQLRKELARLEAELRNLSALAASGGSAEALKEKEAL  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKM +E+R+L  QR
Sbjct  399  IEKMSREIRELTEQR  413



>ref|XP_002280678.2| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010664763.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010664764.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
Length=937

 Score =   390 bits (1003),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 221/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D+ PLRLLDDPERGTVV+KL+E   RD++HL ELLSICEAQRQIGET LN  SSR
Sbjct  157  DLLSSDSAPLRLLDDPERGTVVDKLTEETLRDRNHLQELLSICEAQRQIGETALNETSSR  216

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+S+L+A V+F+DLAGSERASQTLS GTRLKEGCHINRSL
Sbjct  217  SHQILRLTIESSAHKFVGAENSSSLAATVSFVDLAGSERASQTLSEGTRLKEGCHINRSL  276

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRN HIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  277  LTLGTVIRKLSKGRNVHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHIEQSRNTLL  336

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T A VNVVMSDK LVK LQ+E+A+LESELR+L        S+ +LKEKE L
Sbjct  337  FASCAKEVSTNAHVNVVMSDKILVKHLQREMARLESELRSLELNHAANDSTALLKEKELL  396

Query  723  IEKMEKEMRDLMMQR  767
            IEKM+KE++DL  QR
Sbjct  397  IEKMDKEIKDLTQQR  411



>gb|EPS66111.1| hypothetical protein M569_08665, partial [Genlisea aurea]
Length=856

 Score =   387 bits (995),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 193/255 (76%), Positives = 222/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D T LRLLDDPERGTV++KL+E+  +  +HL ELLSICEAQRQIGET+LN MSSR
Sbjct  139  DLLSPDATSLRLLDDPERGTVIDKLTEISLKGCNHLKELLSICEAQRQIGETSLNEMSSR  198

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIES +  YS   N S+L+A+VNF+DLAGSERASQT+SAGTRLKEG HINRSL
Sbjct  199  SHQILRLTIESESRHYSGAANASSLTASVNFVDLAGSERASQTMSAGTRLKEGSHINRSL  258

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GH+PYRDSKLTRILQ SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  259  LTLGTVIRKLSKGRSGHVPYRDSKLTRILQTSLGGNARTAIICTMSPAHSHVEQSRNTLL  318

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAKQV T A VN+VMS+KALVKQLQKELA+LE+EL+ LRS S    S+  L EKE +
Sbjct  319  FASCAKQVNTNAHVNIVMSEKALVKQLQKELARLETELKNLRSLSAVCASASALNEKELI  378

Query  723  IEKMEKEMRDLMMQR  767
            I+KM++E+++L  QR
Sbjct  379  IQKMDREIKELTGQR  393



>ref|XP_009587868.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
 ref|XP_009587869.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
Length=907

 Score =   389 bits (998),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 222/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL+ D+TPLRLLDDPERGTVVEKL+EV  +D +HL ELL +CEAQR+IGET LN MSSR
Sbjct  159  DLLTPDDTPLRLLDDPERGTVVEKLTEVTLKDWNHLKELLLVCEAQRKIGETALNEMSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  ++   +N+STL+AAVNF+DLAGSERASQTLSA  RLKEG HINRSL
Sbjct  219  SHQILRLTVESTAKKFVGFQNSSTLTAAVNFVDLAGSERASQTLSANVRLKEGSHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK  NGHIP+RDSKLTRILQ+SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  279  LTLGTVIRKLSKKGNGHIPFRDSKLTRILQNSLGGNARTAIICTMSPAHSHVEQSRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK V T A+VNVVMS+KALVKQL+KELA+LE+ELR L + +    S+  LKEKEAL
Sbjct  339  FATCAKNVITNAKVNVVMSEKALVKQLRKELARLEAELRNLSALAASGGSAEALKEKEAL  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKM +E+R+L  QR
Sbjct  399  IEKMSREIRELTEQR  413



>ref|XP_011090438.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=991

 Score =   391 bits (1004),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 223/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPERGT+VEKL+E + RD  H+ +LLS+CEAQRQIGET+LN MSSR
Sbjct  155  DLLSVDSTPLRLLDDPERGTIVEKLTEEILRDWDHVVQLLSVCEAQRQIGETSLNEMSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIES++ ++    N STLSAAVNF+DLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  215  SHQIIRLTIESTSREFLGRENASTLSAAVNFVDLAGSERASQSLSAGTRLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SHVEQSRNTL 
Sbjct  275  LTLGTVIRKLSKGRGGHIPYRDSKLTRILQTSLGGNARTAIICTMSPARSHVEQSRNTLH  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+VAT AQVNVVMSDKALVK LQ+EL +LESELR+ +S       S +L+EK+  
Sbjct  335  FASCAKEVATNAQVNVVMSDKALVKYLQRELERLESELRSPQSALAHSNYSAILREKDLH  394

Query  723  IEKMEKEMRDLMMQR  767
            IEK+E+E+ DL++QR
Sbjct  395  IEKLEEEICDLILQR  409



>ref|XP_010919401.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Elaeis guineensis]
 ref|XP_010919402.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Elaeis guineensis]
Length=966

 Score =   390 bits (1002),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 196/255 (77%), Positives = 222/255 (87%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GT+VEKL+E + RD +HL EL+S+CEAQR+IGET+LN  SSR
Sbjct  173  DLLSTDSTPLRLLDDPEKGTIVEKLTEEVLRDWNHLKELISVCEAQRKIGETSLNETSSR  232

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+STL A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  233  SHQILRLTIESSAREFLGKENSSTLVASVNFVDLAGSERASQALSAGARLKEGCHINRSL  292

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  293  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSHIEQSRNTLL  352

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V T AQVNVVMSDKALVK LQKELA+LES L+   S S  E+   VLKE++A 
Sbjct  353  FANCAKEVVTSAQVNVVMSDKALVKHLQKELARLESALKYPGSSSGAES---VLKERDAQ  409

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEKE+R+L+ QR
Sbjct  410  IKKMEKEIRELIQQR  424



>ref|XP_007203241.1| hypothetical protein PRUPE_ppa001146mg [Prunus persica]
 gb|EMJ04440.1| hypothetical protein PRUPE_ppa001146mg [Prunus persica]
Length=896

 Score =   387 bits (994),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGT+VEKL+E   RD  H  ELLS+CE QRQIGET LN  SSR
Sbjct  156  DLLSADTTPLRLLDDPERGTIVEKLTEETLRDWDHFKELLSVCEDQRQIGETALNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRL IESS  ++     +S+L+A VNF+DLAGSERASQTLSAGTRLKEGCHINRSL
Sbjct  216  SHQILRLVIESSAREFLGYDKSSSLTAVVNFVDLAGSERASQTLSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGH+PYRDSKLTRILQ SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHVPYRDSKLTRILQSSLGGNARTAIICTMSPAHSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+EL +LE+ELR    ++V   SS +L+EK+  
Sbjct  336  FASCAKEVTTNAQVNVVMSDKALVKHLQRELTRLETELRGSGPKTVPADSSTLLREKDHQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IEK++KE+ +L  QR
Sbjct  396  IEKLKKEVSELTQQR  410



>ref|XP_010909958.1| PREDICTED: kinesin-like protein NACK1 [Elaeis guineensis]
Length=970

 Score =   389 bits (998),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 195/255 (76%), Positives = 221/255 (87%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D++PLRLLDDPERGT+VEKL+E   RDQSHL ELLS+CEAQRQIGET+LN MSSR
Sbjct  134  DLLSMDSSPLRLLDDPERGTIVEKLTEETLRDQSHLKELLSLCEAQRQIGETSLNEMSSR  193

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +     ++STL+A VNF+DLAGSERASQ  S GTRLKEGCHINRSL
Sbjct  194  SHQILRLTIESSARELHSRDSSSTLAATVNFVDLAGSERASQVSSDGTRLKEGCHINRSL  253

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  254  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQYSLGGNARTAIICTMSPARSHIEQSRNTLL  313

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+VMSDKALV+ LQ+ELA+LESEL+  RS S    S   L+EK+  
Sbjct  314  FASCAKEVVTNAQVNLVMSDKALVRHLQRELARLESELKYPRSASCTSHSD-ALREKDVQ  372

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEKE+++LM QR
Sbjct  373  IKKMEKEIKELMQQR  387



>emb|CBI19799.3| unnamed protein product [Vitis vinifera]
Length=1008

 Score =   389 bits (1000),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 221/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D+ PLRLLDDPERGTVV+KL+E   RD++HL ELLSICEAQRQIGET LN  SSR
Sbjct  157  DLLSSDSAPLRLLDDPERGTVVDKLTEETLRDRNHLQELLSICEAQRQIGETALNETSSR  216

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+S+L+A V+F+DLAGSERASQTLS GTRLKEGCHINRSL
Sbjct  217  SHQILRLTIESSAHKFVGAENSSSLAATVSFVDLAGSERASQTLSEGTRLKEGCHINRSL  276

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRN HIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  277  LTLGTVIRKLSKGRNVHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHIEQSRNTLL  336

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T A VNVVMSDK LVK LQ+E+A+LESELR+L        S+ +LKEKE L
Sbjct  337  FASCAKEVSTNAHVNVVMSDKILVKHLQREMARLESELRSLELNHAANDSTALLKEKELL  396

Query  723  IEKMEKEMRDLMMQR  767
            IEKM+KE++DL  QR
Sbjct  397  IEKMDKEIKDLTQQR  411



>ref|XP_010263901.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Nelumbo nucifera]
Length=894

 Score =   387 bits (993),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 217/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL  D+TPLRLLDDPERGTVVE+L+E   RD SHL ELL ICEAQRQIGET+LN  SSR
Sbjct  159  DLLGFDSTPLRLLDDPERGTVVERLTEETLRDWSHLQELLCICEAQRQIGETSLNETSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+STL+A+V+F+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  219  SHQILRLTIESSAREFLGKDNSSTLAASVDFVDLAGSERASQALSAGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  279  LTLGTVIRKLSKGRTGHIPFRDSKLTRILQPSLGGNARTAIICTMSPARSHVEQSRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CA +VAT AQVNVVMSDKALVK LQKELA+LESELR+    S  +  + +L+EK+  
Sbjct  339  FASCANKVATNAQVNVVMSDKALVKHLQKELARLESELRSTGPTSTPDNYAALLREKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKMEKE+ +L  QR
Sbjct  399  IEKMEKEINELTQQR  413



>ref|XP_008791670.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Phoenix dactylifera]
 ref|XP_008791671.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Phoenix dactylifera]
Length=975

 Score =   389 bits (998),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 195/255 (76%), Positives = 223/255 (87%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GT+VEKL+E + RD +HL EL+S+CEAQR+IGET+LN  SSR
Sbjct  174  DLLSTDSTPLRLLDDPEKGTIVEKLTEEVLRDWNHLKELISVCEAQRKIGETSLNETSSR  233

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +STL A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  234  SHQILRLTIESSAREFLGKETSSTLVASVNFVDLAGSERASQALSAGARLKEGCHINRSL  293

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  294  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSHIEQSRNTLL  353

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CA++V T AQVNVVMSDKALVK LQKELAKLES L+   S S  E+   VLKEK+A 
Sbjct  354  FASCAREVVTSAQVNVVMSDKALVKHLQKELAKLESALKYPGSSSSIES---VLKEKDAQ  410

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEKE+R+L++Q+
Sbjct  411  IKKMEKEIRELILQK  425



>ref|XP_007017694.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007017695.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14919.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14920.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
Length=1062

 Score =   390 bits (1003),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 192/255 (75%), Positives = 223/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D+TPLRLLDDPERGTVVEKL+E   RD+ HL ELLSICEAQRQIGET+LN  SSR
Sbjct  156  DLLSSDSTPLRLLDDPERGTVVEKLTEETLRDRDHLQELLSICEAQRQIGETSLNETSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS   Y+   N+S L+A+VNF+DLAGSERASQTLSAG RLKEGCHINRSL
Sbjct  216  SHQILRLTVESSARDYAGAENSSMLAASVNFVDLAGSERASQTLSAGARLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRN H+PYRDSKLTRILQ+SLGGNARTAIICTM+PA SHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRNAHVPYRDSKLTRILQNSLGGNARTAIICTMNPARSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T A VN+VMSDKALVKQLQ+ELA+LE+E+++L S S    ++++L+EKE L
Sbjct  336  FASCAKEVTTNAHVNLVMSDKALVKQLQRELARLENEMKSLGSASNKRDTAIMLREKELL  395

Query  723  IEKMEKEMRDLMMQR  767
            I +M KE+ +L  QR
Sbjct  396  IGQMAKEIAELTRQR  410



>gb|EPS64209.1| hypothetical protein M569_10571, partial [Genlisea aurea]
Length=466

 Score =   373 bits (958),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 181/255 (71%), Positives = 218/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGT+VE+LSE +  D +H+  LLSICEAQRQIGET+LN MSSR
Sbjct  139  DLLSMDTTPLRLLDDPERGTIVERLSEEVLSDWNHVIHLLSICEAQRQIGETSLNEMSSR  198

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIESS  ++    N+S+L+A VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  199  SHQIIRLTIESSAPEFLGRDNSSSLAATVNFVDLAGSERASQSLSAGPRLKEGCHINRSL  258

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGT+IRKLSK R+GH P+RDSKLTRILQ SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  259  LTLGTIIRKLSKSRSGHFPFRDSKLTRILQSSLGGNARTAIICTMSPAHSHVEQSRNTLL  318

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T A+VNVVMSDKALVK LQ ++ +LE ELR+ ++ ++    + +++EK+  
Sbjct  319  FASCAKEVTTNARVNVVMSDKALVKYLQSKVERLEGELRSCQTTNITANFTTLVREKDIQ  378

Query  723  IEKMEKEMRDLMMQR  767
            IEK+E E+ DL++QR
Sbjct  379  IEKLEGEIHDLILQR  393



>gb|KCW53110.1| hypothetical protein EUGRSUZ_J02401 [Eucalyptus grandis]
Length=849

 Score =   384 bits (987),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 221/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D++PLRLLDDPERGT+VEKL+E   +D SH  ELLS+CEAQRQ+GET LN  SSR
Sbjct  156  DLLSADSSPLRLLDDPERGTIVEKLTEETLKDWSHFQELLSVCEAQRQVGETCLNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+STLSA VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  216  SHQILRLTIESSAREFLGNDNSSTLSATVNFVDLAGSERASQSLSAGARLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNART+IICTMSPA SHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTSIICTMSPARSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+VAT AQVNVV+SDKALVK LQ+ELA+LESELR     SV   ++++L+EK+  
Sbjct  336  FASCAKEVATNAQVNVVVSDKALVKHLQRELARLESELRNPGLASVSSDTAVLLREKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IEK++KE+ +L +QR
Sbjct  396  IEKLKKEIAELSLQR  410



>ref|XP_010263900.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Nelumbo nucifera]
Length=972

 Score =   387 bits (995),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 217/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL  D+TPLRLLDDPERGTVVE+L+E   RD SHL ELL ICEAQRQIGET+LN  SSR
Sbjct  159  DLLGFDSTPLRLLDDPERGTVVERLTEETLRDWSHLQELLCICEAQRQIGETSLNETSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+STL+A+V+F+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  219  SHQILRLTIESSAREFLGKDNSSTLAASVDFVDLAGSERASQALSAGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  279  LTLGTVIRKLSKGRTGHIPFRDSKLTRILQPSLGGNARTAIICTMSPARSHVEQSRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CA +VAT AQVNVVMSDKALVK LQKELA+LESELR+    S  +  + +L+EK+  
Sbjct  339  FASCANKVATNAQVNVVMSDKALVKHLQKELARLESELRSTGPTSTPDNYAALLREKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKMEKE+ +L  QR
Sbjct  399  IEKMEKEINELTQQR  413



>gb|AAK50070.1|AF372930_1 AT5g66310/K1L20_9 [Arabidopsis thaliana]
Length=425

 Score =   371 bits (953),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 213/254 (84%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E   RD +H  ELLS+C+AQRQIGET LN +SSR
Sbjct  155  DLLSTDTSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCKAQRQIGETALNEVSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES   ++S     STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  215  SHQILRLTVESIAREFSTNDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK + GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  275  LTLGTVIRKLSKEKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLESELR+    S+   ++ +L EK+  
Sbjct  335  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESELRSPSQASIVSDTTALLTEKDLE  394

Query  723  IEKMEKEMRDLMMQ  764
            +EK++KE+  L  Q
Sbjct  395  VEKLKKEVFQLAQQ  408



>ref|XP_006854867.1| hypothetical protein AMTR_s00182p00038530 [Amborella trichopoda]
 gb|ERN16334.1| hypothetical protein AMTR_s00182p00038530 [Amborella trichopoda]
Length=969

 Score =   386 bits (991),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/256 (76%), Positives = 216/256 (84%), Gaps = 1/256 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPERGT+VEKL+E    D  HL +LLSICEAQRQIGET+LN MSSR
Sbjct  158  DLLSPDSTPLRLLDDPERGTIVEKLTEETLNDWDHLCKLLSICEAQRQIGETSLNEMSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+STL A+VNF+DLAGSERASQ LS GTRLKEGCHINRSL
Sbjct  218  SHQILRLTIESSAREFLGKENSSTLVASVNFVDLAGSERASQALSGGTRLKEGCHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGN+RTAIICTMSPAHSH+EQSRNTL 
Sbjct  278  LTLGTVIRKLSKNRNGHIPYRDSKLTRILQPSLGGNSRTAIICTMSPAHSHLEQSRNTLF  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRAL-RSRSVDETSSLVLKEKEA  719
            FA CAK+VAT AQVNVVMSDKALVK LQ ELA+LE+ELR   R       S  +L+EK+ 
Sbjct  338  FANCAKEVATSAQVNVVMSDKALVKHLQNELARLENELRTPGRPSLTTNYSEALLREKDN  397

Query  720  LIEKMEKEMRDLMMQR  767
            LI+KMEKE+R+L  QR
Sbjct  398  LIKKMEKEIRELKQQR  413



>ref|XP_010535298.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010535299.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010535300.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
Length=1118

 Score =   389 bits (1000),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 222/255 (87%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS DNTPLRLLDDPERGTVVEKL E   +D+SHL ELLSICE QR+IGET+LN  SSR
Sbjct  150  DLLSGDNTPLRLLDDPERGTVVEKLREETLKDRSHLEELLSICETQRKIGETSLNETSSR  209

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++S P N STL+A+V F+DLAGSERASQTLSAGTRLKEGCHINRSL
Sbjct  210  SHQILRLTIESSGREFS-PENASTLAASVCFVDLAGSERASQTLSAGTRLKEGCHINRSL  268

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  269  LTLGTVIRKLSKGKNGHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSRNTLL  328

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+V+S+KALVKQLQ+ELA++E EL+ + S S       +LK+KE L
Sbjct  329  FASCAKEVTTNAQVNLVVSEKALVKQLQRELARMEKELKNIGSGSASSGFYSMLKQKEEL  388

Query  723  IEKMEKEMRDLMMQR  767
            IEKM +++++L  QR
Sbjct  389  IEKMGQQIKELTWQR  403



>ref|XP_009338641.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Pyrus x bretschneideri]
Length=945

 Score =   385 bits (989),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/255 (75%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGT+VEKL+E    D +H  ELLSICEAQRQIGET LN  SSR
Sbjct  156  DLLSADTTPLRLLDDPERGTIVEKLTEETLTDWNHFKELLSICEAQRQIGETALNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRL IESS  ++     +S+L+A VNF+DLAGSERASQTLSAGTRLKEGCHINRSL
Sbjct  216  SHQILRLVIESSAREFLGYDKSSSLTAVVNFVDLAGSERASQTLSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GH+PYRDSKLTRILQ SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRSGHVPYRDSKLTRILQSSLGGNARTAIICTMSPAHSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQKEL +LE+ELR    R V   SS +L+EK+  
Sbjct  336  FASCAKEVTTSAQVNVVMSDKALVKHLQKELTRLENELRGSGHRIVSADSSTLLREKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IEK++K++ +L  QR
Sbjct  396  IEKLKKDVSELTQQR  410



>ref|XP_004167109.1| PREDICTED: uncharacterized LOC101212680 [Cucumis sativus]
Length=956

 Score =   385 bits (990),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 189/255 (74%), Positives = 222/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +N PLRLLDDPE+GTVVEKL+E + +D++HL EL+S CE QR+IGET+LN  SSR
Sbjct  155  DLLSLENVPLRLLDDPEKGTVVEKLTEEILKDRNHLQELISFCEVQRKIGETSLNETSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    ++STL+A VNF+DLAGSERASQT S GTRLKEGCHINRSL
Sbjct  215  SHQILRLTIESSARKFKKSESSSTLTATVNFVDLAGSERASQTNSGGTRLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ+SLGGN RTAIICTMSPA SHVEQSRNTLL
Sbjct  275  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQNSLGGNGRTAIICTMSPARSHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK+V+T A VNVV+SDKALVKQLQKELA+LESE++ L+   +   S+ +LKEKE +
Sbjct  335  FATCAKEVSTNAHVNVVVSDKALVKQLQKELARLESEMKNLKPLPLKGDSNSLLKEKELV  394

Query  723  IEKMEKEMRDLMMQR  767
            IE+M+KE+++L  QR
Sbjct  395  IEQMDKEIKELTRQR  409



>ref|XP_004152764.1| PREDICTED: uncharacterized protein LOC101212680 [Cucumis sativus]
 gb|KGN62654.1| hypothetical protein Csa_2G365120 [Cucumis sativus]
Length=956

 Score =   385 bits (989),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 189/255 (74%), Positives = 222/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +N PLRLLDDPE+GTVVEKL+E + +D++HL EL+S CE QR+IGET+LN  SSR
Sbjct  155  DLLSLENVPLRLLDDPEKGTVVEKLTEEILKDRNHLQELISFCEVQRKIGETSLNETSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    ++STL+A VNF+DLAGSERASQT S GTRLKEGCHINRSL
Sbjct  215  SHQILRLTIESSARKFKKSESSSTLTATVNFVDLAGSERASQTNSGGTRLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ+SLGGN RTAIICTMSPA SHVEQSRNTLL
Sbjct  275  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQNSLGGNGRTAIICTMSPARSHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK+V+T A VNVV+SDKALVKQLQKELA+LESE++ L+   +   S+ +LKEKE +
Sbjct  335  FATCAKEVSTNAHVNVVVSDKALVKQLQKELARLESEMKNLKPLPLKGDSNSLLKEKELV  394

Query  723  IEKMEKEMRDLMMQR  767
            IE+M+KE+++L  QR
Sbjct  395  IEQMDKEIKELTRQR  409



>ref|XP_004289095.1| PREDICTED: uncharacterized protein LOC101300397 [Fragaria vesca 
subsp. vesca]
Length=1040

 Score =   387 bits (994),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 190/255 (75%), Positives = 219/255 (86%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGT+VE+L+E   RD +H  ELLS+CEAQRQIGET+LN  SSR
Sbjct  155  DLLSADTTPLRLLDDPERGTIVERLTEETLRDWNHFRELLSVCEAQRQIGETSLNEASSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRL IESS  ++     +S+L+A VNF+DLAGSERASQTLSAGTRLKEGCHINRSL
Sbjct  215  SHQILRLVIESSAREFLGYDKSSSLTAMVNFVDLAGSERASQTLSAGTRLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTV+RKLSKGRNGHIPYRDSKLTRILQ SLGGNARTAIIC +SPAHSHVEQSRNTLL
Sbjct  275  LTLGTVVRKLSKGRNGHIPYRDSKLTRILQSSLGGNARTAIICNLSPAHSHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDK LVK LQKELAKLE+EL++   ++V   SS +L+EK+  
Sbjct  335  FASCAKEVTTNAQVNVVMSDKTLVKHLQKELAKLENELKSSGPKTVPADSSTLLREKDLQ  394

Query  723  IEKMEKEMRDLMMQR  767
            IEK++KE+ +L +QR
Sbjct  395  IEKLKKEVSELTLQR  409



>ref|XP_010033468.1| PREDICTED: kinesin-like protein NACK1 [Eucalyptus grandis]
 gb|KCW53109.1| hypothetical protein EUGRSUZ_J02401 [Eucalyptus grandis]
Length=952

 Score =   385 bits (989),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 221/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D++PLRLLDDPERGT+VEKL+E   +D SH  ELLS+CEAQRQ+GET LN  SSR
Sbjct  156  DLLSADSSPLRLLDDPERGTIVEKLTEETLKDWSHFQELLSVCEAQRQVGETCLNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+STLSA VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  216  SHQILRLTIESSAREFLGNDNSSTLSATVNFVDLAGSERASQSLSAGARLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNART+IICTMSPA SHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTSIICTMSPARSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+VAT AQVNVV+SDKALVK LQ+ELA+LESELR     SV   ++++L+EK+  
Sbjct  336  FASCAKEVATNAQVNVVVSDKALVKHLQRELARLESELRNPGLASVSSDTAVLLREKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IEK++KE+ +L +QR
Sbjct  396  IEKLKKEIAELSLQR  410



>ref|XP_009338640.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Pyrus x bretschneideri]
Length=976

 Score =   385 bits (990),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 192/255 (75%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGT+VEKL+E    D +H  ELLSICEAQRQIGET LN  SSR
Sbjct  156  DLLSADTTPLRLLDDPERGTIVEKLTEETLTDWNHFKELLSICEAQRQIGETALNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRL IESS  ++     +S+L+A VNF+DLAGSERASQTLSAGTRLKEGCHINRSL
Sbjct  216  SHQILRLVIESSAREFLGYDKSSSLTAVVNFVDLAGSERASQTLSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GH+PYRDSKLTRILQ SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRSGHVPYRDSKLTRILQSSLGGNARTAIICTMSPAHSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQKEL +LE+ELR    R V   SS +L+EK+  
Sbjct  336  FASCAKEVTTSAQVNVVMSDKALVKHLQKELTRLENELRGSGHRIVSADSSTLLREKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IEK++K++ +L  QR
Sbjct  396  IEKLKKDVSELTQQR  410



>ref|XP_008444776.1| PREDICTED: kinesin-like protein NACK1 [Cucumis melo]
Length=948

 Score =   385 bits (988),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 222/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +N PLRLLDDPE+GTVVEKL+E + +D++HL EL+S CE QR+IGET+LN  SSR
Sbjct  155  DLLSLENVPLRLLDDPEKGTVVEKLTEEILKDRNHLQELISFCEVQRKIGETSLNETSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    ++STL+A VNF+DLAGSERASQT S GTRLKEGCHINRSL
Sbjct  215  SHQILRLTIESSARKFKKSESSSTLTATVNFVDLAGSERASQTNSGGTRLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ+SLGGN RTAIICTMSPA SHVEQSRNTLL
Sbjct  275  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQNSLGGNGRTAIICTMSPARSHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK+V+T A VNVV+SDKALVKQLQKELA+LESE++ L+   +   S+ +LKEKE +
Sbjct  335  FATCAKEVSTNAHVNVVVSDKALVKQLQKELARLESEMKNLKPLPLKGDSTSLLKEKELV  394

Query  723  IEKMEKEMRDLMMQR  767
            IE+M+K++++L  QR
Sbjct  395  IEQMDKQIKELTRQR  409



>ref|XP_008372766.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
 ref|XP_008372767.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
Length=963

 Score =   385 bits (988),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/255 (75%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGT+VEKL+E    D +H  ELLSICEAQRQIGET LN  SSR
Sbjct  156  DLLSADTTPLRLLDDPERGTIVEKLTEETLTDWNHFKELLSICEAQRQIGETALNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRL IESS  ++     +S+L+A VNF+DLAGSERASQTLSAGTRLKEGCHINRSL
Sbjct  216  SHQILRLVIESSAREFLGYDKSSSLTAVVNFVDLAGSERASQTLSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GH+PYRDSKLTRILQ SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRSGHVPYRDSKLTRILQSSLGGNARTAIICTMSPAHSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQKEL +LE+ELR    R V   SS +L+EK+  
Sbjct  336  FASCAKEVTTSAQVNVVMSDKALVKHLQKELTRLENELRGSGHRIVSADSSTLLREKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IEK++K++ +L  QR
Sbjct  396  IEKLKKDVSELTQQR  410



>ref|XP_008241798.1| PREDICTED: kinesin-like protein NACK1 [Prunus mume]
Length=960

 Score =   385 bits (988),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 190/255 (75%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGT+VEKL+E   RD  H  ELLS+CE QRQIGET LN  SSR
Sbjct  156  DLLSADTTPLRLLDDPERGTIVEKLTEETLRDWDHFKELLSVCEDQRQIGETALNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRL IESS  ++     +S+L+A VNF+DLAGSERASQTLSAGTRLKEGCHINRSL
Sbjct  216  SHQILRLVIESSAREFLGYDKSSSLTAVVNFVDLAGSERASQTLSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGH+PYRDSKLTRIL  SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHVPYRDSKLTRILHSSLGGNARTAIICTMSPAHSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+EL +LE+ELR    ++V   SS +L+EK+  
Sbjct  336  FASCAKEVTTNAQVNVVMSDKALVKHLQRELTRLENELRGSGPKTVPADSSTLLREKDHQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IEK++KE+ +L  QR
Sbjct  396  IEKLKKEVSELTQQR  410



>gb|EYU31140.1| hypothetical protein MIMGU_mgv1a000697mg [Erythranthe guttata]
Length=1015

 Score =   385 bits (990),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 192/257 (75%), Positives = 222/257 (86%), Gaps = 2/257 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS DNTPLRLLDDPERGT+VEKL+E + RD SH+  LLSICEAQRQIGET+LN MSSR
Sbjct  146  DLLSVDNTPLRLLDDPERGTIVEKLTEEILRDWSHVIHLLSICEAQRQIGETSLNEMSSR  205

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIES +  +    N STL+AAVNF+DLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  206  SHQIIRLTIESCSRDFLGRDNASTLTAAVNFVDLAGSERASQSLSAGTRLKEGCHINRSL  265

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGT+IRKLSKGR+GHIPYRDSKLTRILQ SLGGNARTAIICTMSPA +HVEQSRNTLL
Sbjct  266  LTLGTIIRKLSKGRSGHIPYRDSKLTRILQTSLGGNARTAIICTMSPARTHVEQSRNTLL  325

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRA--LRSRSVDETSSLVLKEKE  716
            FA CAK+V T AQVNVVMSDKALVK LQ+EL ++E+ELR+  + + +     S VL+EK+
Sbjct  326  FACCAKEVTTNAQVNVVMSDKALVKYLQRELERVENELRSSQITTYAPPTNYSAVLREKD  385

Query  717  ALIEKMEKEMRDLMMQR  767
              IEK+E+E+ DL++QR
Sbjct  386  LRIEKLEEEINDLILQR  402



>ref|XP_010028653.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Eucalyptus 
grandis]
Length=809

 Score =   380 bits (975),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/255 (76%), Positives = 219/255 (86%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+T LRLLDDPERGT+VEK++E   RD +H +EL+SICEAQRQIGET LN  SSR
Sbjct  40   DLLSTDSTSLRLLDDPERGTIVEKVTEETLRDWNHFNELVSICEAQRQIGETLLNERSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LT+ESS  ++    N++TLSA+VNF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  100  SHQILKLTVESSAREFLGKDNSTTLSASVNFVDLAGSERASQALSAGTRLKEGCHINRSL  159

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GHI YRDSKLTRILQ +LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  160  LTLGTVIRKLSKGRHGHINYRDSKLTRILQPALGGNARTAIICTLSPARSHVEQTRNTLL  219

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELRA    S +     +LK+K+  
Sbjct  220  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRAPGPISSNCDYVALLKKKDLQ  279

Query  723  IEKMEKEMRDLMMQR  767
            IEKMEKE+RDL  QR
Sbjct  280  IEKMEKEIRDLKKQR  294



>ref|XP_011092853.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Sesamum indicum]
Length=762

 Score =   378 bits (970),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 193/255 (76%), Positives = 223/255 (87%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPERGT++EKL+E   RD++HL ELLSICEAQRQIGET+LN  SSR
Sbjct  10   DLLSTDNTPLRLLDDPERGTIIEKLTEETLRDRNHLKELLSICEAQRQIGETSLNETSSR  69

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N++TL+A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  70   SHQILRLTIESSAREFIGKGNSTTLAASVNFVDLAGSERASQALSAGQRLKEGCHINRSL  129

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GHI YRDSKLTRILQ +LGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  130  LTLGTVIRKLSKGRHGHINYRDSKLTRILQPALGGNARTAIICTLSPARSHVEQSRNTLL  189

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T A+VNVVMSDKALVK LQKE+A+LESELR     SV +  +L L++K+  
Sbjct  190  FASCAKEVSTNAKVNVVMSDKALVKHLQKEVARLESELRT--PGSVCDHGAL-LRKKDMQ  246

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+R+L  QR
Sbjct  247  IEKLEKEIRELKKQR  261



>emb|CDP01925.1| unnamed protein product [Coffea canephora]
Length=959

 Score =   382 bits (982),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 221/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD TPLRLLDDPERGT+VEKL+E + RD  H+ ELLS+CEAQRQIGET LN  SSR
Sbjct  153  DLLSTDTTPLRLLDDPERGTIVEKLTEEVVRDWDHVVELLSVCEAQRQIGETVLNETSSR  212

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL +ESS  ++    N STL+A VNF+DLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  213  SHQIIRLMVESSAREFLGRENYSTLAATVNFVDLAGSERASQSLSAGTRLKEGCHINRSL  272

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGH+P+RDSKLTRILQ SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  273  LTLGTVIRKLSKGKNGHVPFRDSKLTRILQSSLGGNARTAIICTMSPARSHVEQSRNTLL  332

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMS+KALVK LQ+ELA+LESELR+  +  V    + +L++K+  
Sbjct  333  FASCAKEVTTNAQVNVVMSEKALVKHLQRELARLESELRSPGTTVVTSDYAALLRDKDHQ  392

Query  723  IEKMEKEMRDLMMQR  767
            IE++EKE+++L++QR
Sbjct  393  IEELEKEVKNLILQR  407



>gb|KDO84748.1| hypothetical protein CISIN_1g001290mg [Citrus sinensis]
Length=1104

 Score =   385 bits (990),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 195/257 (76%), Positives = 224/257 (87%), Gaps = 5/257 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GTVVE+L+E    D SHL ELL++CEAQRQIGET LN  SSR
Sbjct  158  DLLSTDSTPLRLLDDPEKGTVVERLTEETLTDMSHLMELLAVCEAQRQIGETALNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +Y    N+S LSA+VNF+DLAGSERASQTL+AG RLKEG HINRSL
Sbjct  218  SHQILRLTIESSAREYLGAGNSSILSASVNFVDLAGSERASQTLNAGARLKEGSHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRN HIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  278  LTLGTVIRKLSKGRNAHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRS--RSVDETSSLVLKEKE  716
            FA+CAK+VAT AQVNVVMSDKALVKQLQKELA+LE+E++ L+S  +  D T   +LKEKE
Sbjct  338  FASCAKEVATNAQVNVVMSDKALVKQLQKELARLENEMKNLQSTPKKCDFT---LLKEKE  394

Query  717  ALIEKMEKEMRDLMMQR  767
             +IE+M++++R+L  +R
Sbjct  395  QVIEEMDRQIRELTKER  411



>gb|KDO84747.1| hypothetical protein CISIN_1g001290mg [Citrus sinensis]
Length=1106

 Score =   385 bits (990),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 195/257 (76%), Positives = 224/257 (87%), Gaps = 5/257 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GTVVE+L+E    D SHL ELL++CEAQRQIGET LN  SSR
Sbjct  158  DLLSTDSTPLRLLDDPEKGTVVERLTEETLTDMSHLMELLAVCEAQRQIGETALNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +Y    N+S LSA+VNF+DLAGSERASQTL+AG RLKEG HINRSL
Sbjct  218  SHQILRLTIESSAREYLGAGNSSILSASVNFVDLAGSERASQTLNAGARLKEGSHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRN HIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  278  LTLGTVIRKLSKGRNAHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRS--RSVDETSSLVLKEKE  716
            FA+CAK+VAT AQVNVVMSDKALVKQLQKELA+LE+E++ L+S  +  D T   +LKEKE
Sbjct  338  FASCAKEVATNAQVNVVMSDKALVKQLQKELARLENEMKNLQSTPKKCDFT---LLKEKE  394

Query  717  ALIEKMEKEMRDLMMQR  767
             +IE+M++++R+L  +R
Sbjct  395  QVIEEMDRQIRELTKER  411



>gb|KHF98716.1| Kinesin-related 11 [Gossypium arboreum]
Length=978

 Score =   383 bits (983),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 190/255 (75%), Positives = 220/255 (86%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPERGTVVEKL+E   +D +H  +LLS+CEAQRQIGET+LN  SSR
Sbjct  156  DLLSADSTPLRLLDDPERGTVVEKLTEETLQDWNHFKQLLSVCEAQRQIGETSLNETSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILR+ IESS  ++     +STL+A VNF+DLAGSERASQTLSAG RLKEGCHINRSL
Sbjct  216  SHQILRVMIESSAREFLGNGKSSTLAATVNFVDLAGSERASQTLSAGARLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVKQLQ+ELA+LE+ELR+ R+ S+   S+ +L+EK+  
Sbjct  336  FASCAKEVTTNAQVNVVMSDKALVKQLQRELARLENELRSARTTSISSDSAALLREKDLE  395

Query  723  IEKMEKEMRDLMMQR  767
            IEK++K++  L  QR
Sbjct  396  IEKLKKDVATLKQQR  410



>ref|XP_006473602.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Citrus 
sinensis]
Length=1100

 Score =   385 bits (990),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 195/257 (76%), Positives = 224/257 (87%), Gaps = 5/257 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GTVVE+L+E    D SHL ELL++CEAQRQIGET LN  SSR
Sbjct  158  DLLSTDSTPLRLLDDPEKGTVVERLTEETLTDMSHLMELLAVCEAQRQIGETALNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +Y    N+S LSA+VNF+DLAGSERASQTL+AG RLKEG HINRSL
Sbjct  218  SHQILRLTIESSAREYLGAGNSSILSASVNFVDLAGSERASQTLNAGARLKEGSHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRN HIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  278  LTLGTVIRKLSKGRNAHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRS--RSVDETSSLVLKEKE  716
            FA+CAK+VAT AQVNVVMSDKALVKQLQKELA+LE+E++ L+S  +  D T   +LKEKE
Sbjct  338  FASCAKEVATNAQVNVVMSDKALVKQLQKELARLENEMKNLQSTPKKCDFT---LLKEKE  394

Query  717  ALIEKMEKEMRDLMMQR  767
             +IE+M++++R+L  +R
Sbjct  395  QVIEEMDRQIRELTKER  411



>ref|XP_006435104.1| hypothetical protein CICLE_v10000097mg [Citrus clementina]
 gb|ESR48344.1| hypothetical protein CICLE_v10000097mg [Citrus clementina]
Length=1104

 Score =   385 bits (990),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 195/257 (76%), Positives = 224/257 (87%), Gaps = 5/257 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GTVVE+L+E    D SHL ELL++CEAQRQIGET LN  SSR
Sbjct  158  DLLSTDSTPLRLLDDPEKGTVVERLTEETLTDMSHLMELLAVCEAQRQIGETALNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +Y    N+S LSA+VNF+DLAGSERASQTL+AG RLKEG HINRSL
Sbjct  218  SHQILRLTIESSAREYLGAGNSSILSASVNFVDLAGSERASQTLNAGARLKEGSHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRN HIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  278  LTLGTVIRKLSKGRNAHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRS--RSVDETSSLVLKEKE  716
            FA+CAK+VAT AQVNVVMSDKALVKQLQKELA+LE+E++ L+S  +  D T   +LKEKE
Sbjct  338  FASCAKEVATNAQVNVVMSDKALVKQLQKELARLENEMKNLQSTPKKCDFT---LLKEKE  394

Query  717  ALIEKMEKEMRDLMMQR  767
             +IE+M++++R+L  +R
Sbjct  395  QVIEEMDRQIRELTKER  411



>ref|XP_006473600.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Citrus 
sinensis]
Length=1114

 Score =   385 bits (990),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 195/257 (76%), Positives = 224/257 (87%), Gaps = 5/257 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GTVVE+L+E    D SHL ELL++CEAQRQIGET LN  SSR
Sbjct  158  DLLSTDSTPLRLLDDPEKGTVVERLTEETLTDMSHLMELLAVCEAQRQIGETALNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +Y    N+S LSA+VNF+DLAGSERASQTL+AG RLKEG HINRSL
Sbjct  218  SHQILRLTIESSAREYLGAGNSSILSASVNFVDLAGSERASQTLNAGARLKEGSHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRN HIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  278  LTLGTVIRKLSKGRNAHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRS--RSVDETSSLVLKEKE  716
            FA+CAK+VAT AQVNVVMSDKALVKQLQKELA+LE+E++ L+S  +  D T   +LKEKE
Sbjct  338  FASCAKEVATNAQVNVVMSDKALVKQLQKELARLENEMKNLQSTPKKCDFT---LLKEKE  394

Query  717  ALIEKMEKEMRDLMMQR  767
             +IE+M++++R+L  +R
Sbjct  395  QVIEEMDRQIRELTKER  411



>ref|XP_006473601.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Citrus 
sinensis]
Length=1112

 Score =   385 bits (990),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 195/257 (76%), Positives = 224/257 (87%), Gaps = 5/257 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GTVVE+L+E    D SHL ELL++CEAQRQIGET LN  SSR
Sbjct  158  DLLSTDSTPLRLLDDPEKGTVVERLTEETLTDMSHLMELLAVCEAQRQIGETALNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +Y    N+S LSA+VNF+DLAGSERASQTL+AG RLKEG HINRSL
Sbjct  218  SHQILRLTIESSAREYLGAGNSSILSASVNFVDLAGSERASQTLNAGARLKEGSHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRN HIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  278  LTLGTVIRKLSKGRNAHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRS--RSVDETSSLVLKEKE  716
            FA+CAK+VAT AQVNVVMSDKALVKQLQKELA+LE+E++ L+S  +  D T   +LKEKE
Sbjct  338  FASCAKEVATNAQVNVVMSDKALVKQLQKELARLENEMKNLQSTPKKCDFT---LLKEKE  394

Query  717  ALIEKMEKEMRDLMMQR  767
             +IE+M++++R+L  +R
Sbjct  395  QVIEEMDRQIRELTKER  411



>ref|XP_004238322.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
 ref|XP_010320414.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
Length=926

 Score =   381 bits (979),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 222/255 (87%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL+ ++TPLRLLDDPERGTVVEKL+E+  +D +HL ELLS+CEAQR+IGET LN +SSR
Sbjct  161  DLLTPEDTPLRLLDDPERGTVVEKLTEITLKDWNHLKELLSVCEAQRKIGETALNEVSSR  220

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  ++    N+STL+AAVNF+DLAGSERASQT+SA  RLKEG HINRSL
Sbjct  221  SHQILRLTVESTAKKFVG-LNSSTLTAAVNFVDLAGSERASQTMSANVRLKEGSHINRSL  279

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK  NGHIP+RDSKLTRILQ+SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  280  LTLGTVIRKLSKKGNGHIPFRDSKLTRILQNSLGGNARTAIICTMSPAHSHVEQSRNTLL  339

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK V T A+VNVVMS+KALVKQL+KELA+LE+ELR+L + +    SS  LKEKE L
Sbjct  340  FATCAKNVITNAKVNVVMSEKALVKQLRKELARLEAELRSLSALAASGGSSEALKEKEDL  399

Query  723  IEKMEKEMRDLMMQR  767
            IEKM +E+R+L  QR
Sbjct  400  IEKMSREIRELTQQR  414



>ref|XP_009378198.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Pyrus x bretschneideri]
Length=945

 Score =   381 bits (979),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGT+VEKL+E    D +H  ELLSICEAQRQIGET LN  SSR
Sbjct  156  DLLSADTTPLRLLDDPERGTIVEKLTEETLTDWNHFKELLSICEAQRQIGETALNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRL IESS  ++     +S+L+A VNF+DLAGSERASQTLSAGTRLKEGCHINRSL
Sbjct  216  SHQILRLVIESSAREFLGYDKSSSLTAVVNFVDLAGSERASQTLSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GH+PYRDSKLTRILQ SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRSGHVPYRDSKLTRILQSSLGGNARTAIICTMSPAHSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQKEL +LE+ELR      V   SS +L+EK+  
Sbjct  336  FASCAKEVTTSAQVNVVMSDKALVKHLQKELTRLENELRGSGHIIVSADSSTLLREKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IEK++K++ +L  QR
Sbjct  396  IEKLKKDVSELTQQR  410



>ref|XP_009378197.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Pyrus x bretschneideri]
Length=976

 Score =   382 bits (981),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGT+VEKL+E    D +H  ELLSICEAQRQIGET LN  SSR
Sbjct  156  DLLSADTTPLRLLDDPERGTIVEKLTEETLTDWNHFKELLSICEAQRQIGETALNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRL IESS  ++     +S+L+A VNF+DLAGSERASQTLSAGTRLKEGCHINRSL
Sbjct  216  SHQILRLVIESSAREFLGYDKSSSLTAVVNFVDLAGSERASQTLSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GH+PYRDSKLTRILQ SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRSGHVPYRDSKLTRILQSSLGGNARTAIICTMSPAHSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQKEL +LE+ELR      V   SS +L+EK+  
Sbjct  336  FASCAKEVTTSAQVNVVMSDKALVKHLQKELTRLENELRGSGHIIVSADSSTLLREKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IEK++K++ +L  QR
Sbjct  396  IEKLKKDVSELTQQR  410



>ref|XP_010028651.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55426.1| hypothetical protein EUGRSUZ_I01329 [Eucalyptus grandis]
Length=928

 Score =   381 bits (978),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 193/255 (76%), Positives = 219/255 (86%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+T LRLLDDPERGT+VEK++E   RD +H +EL+SICEAQRQIGET LN  SSR
Sbjct  159  DLLSTDSTSLRLLDDPERGTIVEKVTEETLRDWNHFNELVSICEAQRQIGETLLNERSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LT+ESS  ++    N++TLSA+VNF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  219  SHQILKLTVESSAREFLGKDNSTTLSASVNFVDLAGSERASQALSAGTRLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GHI YRDSKLTRILQ +LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSKGRHGHINYRDSKLTRILQPALGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELRA    S +     +LK+K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRAPGPISSNCDYVALLKKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKMEKE+RDL  QR
Sbjct  399  IEKMEKEIRDLKKQR  413



>ref|XP_006342006.1| PREDICTED: kinesin-like protein NACK2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342007.1| PREDICTED: kinesin-like protein NACK2-like isoform X2 [Solanum 
tuberosum]
Length=924

 Score =   380 bits (977),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 222/255 (87%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL+ ++TPLRLLDDPERGTVVEKL+EV  +D +HL ELLS+CEAQR+IGET LN +SSR
Sbjct  161  DLLTPEDTPLRLLDDPERGTVVEKLTEVTLKDWNHLKELLSVCEAQRKIGETALNEVSSR  220

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  ++    N+STL+AAVNF+DLAGSERASQT+SA  RLKEG HINRSL
Sbjct  221  SHQILRLTVESTAKKFVG-LNSSTLTAAVNFVDLAGSERASQTMSANVRLKEGSHINRSL  279

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK  NGHIP+RDSKLTRILQ+SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  280  LTLGTVIRKLSKKGNGHIPFRDSKLTRILQNSLGGNARTAIICTMSPAHSHVEQSRNTLL  339

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK V T A+VNVVMS+KALVKQL+KELA+LE+ELR+L + +    S+  LKEKE L
Sbjct  340  FATCAKNVITNAKVNVVMSEKALVKQLRKELARLEAELRSLSALAASGGSAEALKEKEDL  399

Query  723  IEKMEKEMRDLMMQR  767
            IEKM +E+R+L  QR
Sbjct  400  IEKMSREIRELTQQR  414



>ref|XP_006342008.1| PREDICTED: kinesin-like protein NACK2-like isoform X3 [Solanum 
tuberosum]
Length=922

 Score =   380 bits (977),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 222/255 (87%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL+ ++TPLRLLDDPERGTVVEKL+EV  +D +HL ELLS+CEAQR+IGET LN +SSR
Sbjct  161  DLLTPEDTPLRLLDDPERGTVVEKLTEVTLKDWNHLKELLSVCEAQRKIGETALNEVSSR  220

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  ++    N+STL+AAVNF+DLAGSERASQT+SA  RLKEG HINRSL
Sbjct  221  SHQILRLTVESTAKKFVG-LNSSTLTAAVNFVDLAGSERASQTMSANVRLKEGSHINRSL  279

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK  NGHIP+RDSKLTRILQ+SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  280  LTLGTVIRKLSKKGNGHIPFRDSKLTRILQNSLGGNARTAIICTMSPAHSHVEQSRNTLL  339

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK V T A+VNVVMS+KALVKQL+KELA+LE+ELR+L + +    S+  LKEKE L
Sbjct  340  FATCAKNVITNAKVNVVMSEKALVKQLRKELARLEAELRSLSALAASGGSAEALKEKEDL  399

Query  723  IEKMEKEMRDLMMQR  767
            IEKM +E+R+L  QR
Sbjct  400  IEKMSREIRELTQQR  414



>ref|NP_567695.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE84858.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1004

 Score =   382 bits (982),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 194/259 (75%), Positives = 227/259 (88%), Gaps = 5/259 (2%)
 Frame = +3

Query  3    DLLSTDN-TPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSS  179
            DLL  D+ TPLRLLDDPERGTVVEKL E   RD+SHL ELLSICE QR+IGET+LN +SS
Sbjct  139  DLLCEDSSTPLRLLDDPERGTVVEKLREETLRDRSHLEELLSICETQRKIGETSLNEISS  198

Query  180  RSHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRS  359
            RSHQILRLTIESS+ Q+S P +++TL+A+V F+DLAGSERASQTLSAG+RLKEGCHINRS
Sbjct  199  RSHQILRLTIESSSQQFS-PESSATLAASVCFVDLAGSERASQTLSAGSRLKEGCHINRS  257

Query  360  LLTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTL  539
            LLTLGTVIRKLSKG+NGHIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SH+EQSRNTL
Sbjct  258  LLTLGTVIRKLSKGKNGHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHLEQSRNTL  317

Query  540  LFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETS---SLVLKE  710
            LFATCAK+V T AQVN+V+S+KALVKQLQ+ELA++E+EL+ L   S   TS   +L+LK+
Sbjct  318  LFATCAKEVTTNAQVNLVVSEKALVKQLQRELARMENELKNLGPASASSTSDFYALMLKQ  377

Query  711  KEALIEKMEKEMRDLMMQR  767
            KE LI KME+++ +L  QR
Sbjct  378  KEELIAKMEEQIHELKWQR  396



>ref|XP_010113382.1| Kinesin-related protein 4 [Morus notabilis]
 gb|EXC35389.1| Kinesin-related protein 4 [Morus notabilis]
Length=1016

 Score =   382 bits (982),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/255 (75%), Positives = 222/255 (87%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPERGTVVEKL+E   RD +H  ELLS+CEAQRQIGET+LN  SSR
Sbjct  156  DLLSADSTPLRLLDDPERGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETSLNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS+ ++     +S+LSA VNFIDLAGSERASQTLSAGTRLKEGCHINRSL
Sbjct  216  SHQILRLTIESSSREFKGNDKSSSLSATVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRN H+PYRDSKLTRILQ SLGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRNSHVPYRDSKLTRILQSSLGGNARTAIICTLSPARSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK+LQKELA+LE+ELR   + ++D  S+ +L EK+  
Sbjct  336  FASCAKEVTTSAQVNVVMSDKALVKKLQKELARLENELRCAGT-AID--SAGLLWEKDLQ  392

Query  723  IEKMEKEMRDLMMQR  767
            +EK++KE+ ++ +QR
Sbjct  393  VEKLKKEISEVTLQR  407



>ref|XP_006380794.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 ref|XP_006380795.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 ref|XP_006380796.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58591.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58592.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58593.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
Length=998

 Score =   382 bits (981),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 191/254 (75%), Positives = 216/254 (85%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD TPLRLLDDPERGTVVE+L+E   RD +H  ELLS+CEAQRQIGET+LN  SSR
Sbjct  161  DLLSTDTTPLRLLDDPERGTVVERLTEETIRDWNHFKELLSVCEAQRQIGETSLNEASSR  220

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +STL++ VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  221  SHQILRLTIESSAREFVGHYKSSTLASTVNFVDLAGSERASQSLSAGMRLKEGCHINRSL  280

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  281  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  340

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVV+SDK LVKQLQ+ELA+LESEL+  R  SV   S+ VL+EK+  
Sbjct  341  FASCAKEVTTNAQVNVVVSDKTLVKQLQRELARLESELKNTRPDSVAPDSTAVLREKDLQ  400

Query  723  IEKMEKEMRDLMMQ  764
            IEK+ KE+ +L  Q
Sbjct  401  IEKLMKEVAELTRQ  414



>ref|XP_009389113.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389114.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=947

 Score =   381 bits (978),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 189/255 (74%), Positives = 218/255 (85%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+ PLRLLDDPE+GTV+EKL+E   RD +HL  L+S+CEAQR+IGET+LN  SSR
Sbjct  168  DLLSTDSAPLRLLDDPEKGTVIEKLTEETLRDWNHLKALISVCEAQRKIGETSLNETSSR  227

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+STL A+VNF+DL GSERASQ LSAGTRLKEGCHINRSL
Sbjct  228  SHQILRLTIESSAREFLGKDNSSTLVASVNFVDLGGSERASQALSAGTRLKEGCHINRSL  287

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  288  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSHIEQSRNTLL  347

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+VAT AQVN+VMSDKALVKQLQKE+A+LE ELR      +      +L+EK+A 
Sbjct  348  FASCAKEVATNAQVNIVMSDKALVKQLQKEVARLECELRY---PGISPRVEALLREKDAQ  404

Query  723  IEKMEKEMRDLMMQR  767
            I+KME E+++L+ QR
Sbjct  405  IKKMENEIKELIKQR  419



>ref|XP_010649060.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649061.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649062.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649063.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649064.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649065.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649066.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649067.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649068.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649069.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 emb|CBI17403.3| unnamed protein product [Vitis vinifera]
Length=973

 Score =   381 bits (979),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 220/255 (86%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D  PLRLLDDPERGT+VEKL+E   RD +HL ELLS+CEAQRQIGET LN  SSR
Sbjct  156  DLLSSDTAPLRLLDDPERGTIVEKLTEETLRDWNHLIELLSLCEAQRQIGETALNETSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++    N+S L++ VNF+DLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  216  SHQILRLTVESSAREFLGNDNSSVLTSTVNFVDLAGSERASQSLSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GHIPYRDSKLTRILQ SLGGNA+TAIICTMSPA SHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRSGHIPYRDSKLTRILQSSLGGNAKTAIICTMSPARSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELA+LE+ LR+    S+   ++ +L++K+  
Sbjct  336  FASCAKEVTTNAQVNVVMSDKALVKHLQRELARLENSLRSPEPTSICLDTATLLRDKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+R+L +QR
Sbjct  396  IEKLEKELRELTLQR  410



>ref|XP_010494185.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
Length=1247

 Score =   386 bits (991),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 223/255 (87%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS DN PLRLLDDPERGTVVEKL E   +D++HL ELL++CE QR+IGET+LN  SSR
Sbjct  144  DLLSGDNNPLRLLDDPERGTVVEKLIEETIQDRTHLEELLTVCETQRKIGETSLNETSSR  203

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIES+  +YS P N+STL+A+V F+DLAGSERASQTLSAGTRLKEGCHINRSL
Sbjct  204  SHQILRLTIESTGREYS-PDNSSTLAASVCFVDLAGSERASQTLSAGTRLKEGCHINRSL  262

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  263  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSRNTLL  322

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V T AQVN+V+S+KALV+QLQKELA++E+EL+ L S S D     +LK+KE +
Sbjct  323  FAICAKEVTTNAQVNLVVSEKALVRQLQKELARMENELKNLGSASGDSDFYSLLKQKEEV  382

Query  723  IEKMEKEMRDLMMQR  767
            I KME++M++L  QR
Sbjct  383  IAKMEEQMKELKWQR  397



>ref|XP_010647602.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647606.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647611.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647615.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647617.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647621.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 emb|CAN75924.1| hypothetical protein VITISV_029516 [Vitis vinifera]
 emb|CBI37987.3| unnamed protein product [Vitis vinifera]
Length=969

 Score =   380 bits (976),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 194/253 (77%), Positives = 219/253 (87%), Gaps = 4/253 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDN PLRLLDDPERGT+VEKL+E   RD SHL  LLSICEAQRQIGET+LN  SSR
Sbjct  159  DLLSTDNLPLRLLDDPERGTIVEKLTEETLRDWSHLKNLLSICEAQRQIGETSLNETSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N++TL+A+VNF+DLAGSERASQ +SAG RLKEGCHINRSL
Sbjct  219  SHQILRLTIESSAREFLGKGNSTTLAASVNFVDLAGSERASQAMSAGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GH+ YRDSKLTRILQ SLGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  279  LTLGTVIRKLSKGRQGHVNYRDSKLTRILQPSLGGNARTAIICTLSPARSHVEQSRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELR--ALRSRSVDETSSLVLKEKE  716
            FA+CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR  A  S + D T+  +L++K+
Sbjct  339  FASCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRSPAPASSTCDHTA--LLRKKD  396

Query  717  ALIEKMEKEMRDL  755
              I+KMEKE+R+L
Sbjct  397  LQIDKMEKEIREL  409



>ref|XP_010933747.1| PREDICTED: kinesin-like protein NACK1 [Elaeis guineensis]
Length=961

 Score =   380 bits (975),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 189/255 (74%), Positives = 221/255 (87%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GT+VEKL+E + RD +HL EL+S+CEAQR+IGET+LN  SSR
Sbjct  168  DLLSTDSTPLRLLDDPEKGTIVEKLTEEILRDWNHLKELISVCEAQRKIGETSLNETSSR  227

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++    N+STL A VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  228  SHQILKLTIESSAREFLGRENSSTLVANVNFVDLAGSERASQALSIGARLKEGCHINRSL  287

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRN HIPYRDSKLTRILQ SLGGN+RTAIICTMSPA SH+EQS+NTLL
Sbjct  288  LTLGTVIRKLSKGRNSHIPYRDSKLTRILQPSLGGNSRTAIICTMSPARSHIEQSKNTLL  347

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CA++V T AQVNVVMSDKALVK LQKELA+LESELR  R+ S  E    V+KE++A 
Sbjct  348  FASCAREVVTSAQVNVVMSDKALVKHLQKELARLESELRYPRTSSGIEA---VIKERDAQ  404

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEK++++L+ QR
Sbjct  405  IKKMEKQIKELIQQR  419



>ref|XP_011092849.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Sesamum indicum]
 ref|XP_011092850.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Sesamum indicum]
 ref|XP_011092851.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Sesamum indicum]
Length=912

 Score =   379 bits (972),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 193/255 (76%), Positives = 223/255 (87%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPERGT++EKL+E   RD++HL ELLSICEAQRQIGET+LN  SSR
Sbjct  160  DLLSTDNTPLRLLDDPERGTIIEKLTEETLRDRNHLKELLSICEAQRQIGETSLNETSSR  219

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N++TL+A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  220  SHQILRLTIESSAREFIGKGNSTTLAASVNFVDLAGSERASQALSAGQRLKEGCHINRSL  279

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GHI YRDSKLTRILQ +LGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  280  LTLGTVIRKLSKGRHGHINYRDSKLTRILQPALGGNARTAIICTLSPARSHVEQSRNTLL  339

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T A+VNVVMSDKALVK LQKE+A+LESELR     SV +  +L L++K+  
Sbjct  340  FASCAKEVSTNAKVNVVMSDKALVKHLQKEVARLESELRT--PGSVCDHGAL-LRKKDMQ  396

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+R+L  QR
Sbjct  397  IEKLEKEIRELKKQR  411



>ref|XP_009630370.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Nicotiana tomentosiformis]
Length=1023

 Score =   381 bits (978),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPERGT+VEKL+E   RD +H+ +LLSICEAQRQIGET LN  SSR
Sbjct  155  DLLSADSTPLRLLDDPERGTIVEKLTEETLRDWNHVIQLLSICEAQRQIGETALNETSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIESS  +Y    N+STLSA VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  215  SHQIIRLTIESSAREYLGRDNSSTLSATVNFVDLAGSERASQSLSAGARLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIP+RDSKLTRILQ SLGGN RTAIICTMSPA SHVEQSRNTLL
Sbjct  275  LTLGTVIRKLSKSRNGHIPFRDSKLTRILQPSLGGNGRTAIICTMSPARSHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDK LVK LQ+ELA+LESELR+            +L+EK   
Sbjct  335  FASCAKEVTTTAQVNVVMSDKVLVKHLQRELARLESELRSPIPSLFPSDYEALLREKNKQ  394

Query  723  IEKMEKEMRDLMMQR  767
            IE+MEKE++DL +QR
Sbjct  395  IEQMEKEIKDLTLQR  409



>ref|XP_009630368.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Nicotiana tomentosiformis]
Length=1028

 Score =   381 bits (978),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPERGT+VEKL+E   RD +H+ +LLSICEAQRQIGET LN  SSR
Sbjct  155  DLLSADSTPLRLLDDPERGTIVEKLTEETLRDWNHVIQLLSICEAQRQIGETALNETSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIESS  +Y    N+STLSA VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  215  SHQIIRLTIESSAREYLGRDNSSTLSATVNFVDLAGSERASQSLSAGARLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIP+RDSKLTRILQ SLGGN RTAIICTMSPA SHVEQSRNTLL
Sbjct  275  LTLGTVIRKLSKSRNGHIPFRDSKLTRILQPSLGGNGRTAIICTMSPARSHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDK LVK LQ+ELA+LESELR+            +L+EK   
Sbjct  335  FASCAKEVTTTAQVNVVMSDKVLVKHLQRELARLESELRSPIPSLFPSDYEALLREKNKQ  394

Query  723  IEKMEKEMRDLMMQR  767
            IE+MEKE++DL +QR
Sbjct  395  IEQMEKEIKDLTLQR  409



>ref|XP_009772334.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
Length=1027

 Score =   381 bits (978),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPERGT+VEKL+E   RD +H+ +LLSICEAQRQIGET LN  SSR
Sbjct  155  DLLSADSTPLRLLDDPERGTIVEKLTEETLRDWNHVIQLLSICEAQRQIGETALNETSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIESS  +Y    N+STLSA VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  215  SHQIIRLTIESSAREYLGRDNSSTLSATVNFVDLAGSERASQSLSAGARLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIP+RDSKLTRILQ SLGGN RTAIICTMSPA SHVEQSRNTLL
Sbjct  275  LTLGTVIRKLSKSRNGHIPFRDSKLTRILQPSLGGNGRTAIICTMSPARSHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDK LVK LQ+ELA+LESELR+            +L+EK   
Sbjct  335  FASCAKEVTTTAQVNVVMSDKVLVKHLQRELARLESELRSPIPSLFPSDYEALLREKNKQ  394

Query  723  IEKMEKEMRDLMMQR  767
            IE+MEKE++DL +QR
Sbjct  395  IEQMEKEIKDLTLQR  409



>ref|XP_011100938.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=998

 Score =   380 bits (976),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 218/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPERGT+VEKL+E +  D++H ++LLS+CEAQRQIGET+LN MSSR
Sbjct  155  DLLSADSTPLRLLDDPERGTIVEKLTEEILTDRNHATQLLSVCEAQRQIGETSLNQMSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SH I+RLTIESS+ +     N STL AAVNF+DLAGSER SQ+LSAGTRLKEGCHINRSL
Sbjct  215  SHHIIRLTIESSSHESLGRENASTLEAAVNFVDLAGSERTSQSLSAGTRLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SL GNARTAIICTMSPA SH EQSRNTLL
Sbjct  275  LTLGTVIRKLSKERNGHIPYRDSKLTRILQTSLRGNARTAIICTMSPARSHAEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKAL+K LQKEL +LESELR+ +          +L+EK++ 
Sbjct  335  FASCAKEVTTNAQVNVVMSDKALIKHLQKELTRLESELRSSQFNFPPSNYPAILREKDSQ  394

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE++DL++QR
Sbjct  395  IEKLEKEIKDLILQR  409



>ref|XP_011025920.1| PREDICTED: kinesin-like protein NACK2 [Populus euphratica]
Length=998

 Score =   380 bits (976),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 190/254 (75%), Positives = 215/254 (85%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD TPLRLLDDPERGTVVE+L+E   RD +H  ELLS+CEAQRQIGET+LN  SSR
Sbjct  161  DLLSTDTTPLRLLDDPERGTVVERLTEETIRDWNHFKELLSVCEAQRQIGETSLNEASSR  220

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +STL++ VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  221  SHQILRLTIESSAREFVGHYKSSTLASTVNFVDLAGSERASQSLSAGMRLKEGCHINRSL  280

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  281  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  340

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVV+SDK LVKQLQ+ELA+LESEL+  R  S    S+ VL+EK+  
Sbjct  341  FASCAKEVTTNAQVNVVVSDKTLVKQLQRELARLESELKNTRPDSAAPDSTAVLREKDLQ  400

Query  723  IEKMEKEMRDLMMQ  764
            IEK+ KE+ +L  Q
Sbjct  401  IEKLMKEVAELTRQ  414



>ref|XP_004512118.1| PREDICTED: kinesin-related protein 4-like isoform X2 [Cicer arietinum]
Length=937

 Score =   379 bits (972),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 190/256 (74%), Positives = 221/256 (86%), Gaps = 1/256 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGTVVEKL++   RD +H +EL+S CE QRQIGET+LN  SSR
Sbjct  146  DLLSPDCTPLRLLDDPERGTVVEKLTDETLRDWNHFAELISFCETQRQIGETSLNDASSR  205

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++      STLSA+VNFIDLAGSERASQT SAGTRLKEGCHINRSL
Sbjct  206  SHQILRLTVESSACEFLGNEKCSTLSASVNFIDLAGSERASQTNSAGTRLKEGCHINRSL  265

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA SHVEQ+RNTLL
Sbjct  266  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARSHVEQTRNTLL  325

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRS-RSVDETSSLVLKEKEA  719
            FA+CAK+V+T AQVNVV+SDKALVKQLQKELAKLESELR   S R   ++++ +L+EK+ 
Sbjct  326  FASCAKEVSTNAQVNVVVSDKALVKQLQKELAKLESELRNSGSTRPNYDSAAALLREKDH  385

Query  720  LIEKMEKEMRDLMMQR  767
             IE ++KE++++ +QR
Sbjct  386  EIEMLKKELKEVTLQR  401



>ref|XP_004232466.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
Length=1019

 Score =   380 bits (977),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 190/255 (75%), Positives = 216/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+T LRLLDDPERGT+VEKL+E   RD +H+ +LLSICEAQRQIGET LN  SSR
Sbjct  154  DLLSADSTLLRLLDDPERGTIVEKLTEETLRDWNHVIQLLSICEAQRQIGETALNETSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIESS  +Y    N+S+LSA VNF+DLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  214  SHQIIRLTIESSAREYLGRDNSSSLSATVNFVDLAGSERASQSLSAGTRLKEGCHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGN RTAIICTMSPA SHVEQSRNTLL
Sbjct  274  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQPSLGGNGRTAIICTMSPARSHVEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVV+SDK LVK LQ+EL +LE+ELR+ R+         +L+EK   
Sbjct  334  FASCAKEVTTTAQVNVVVSDKVLVKHLQRELTRLENELRSPRTSLFPSDYEALLREKNKQ  393

Query  723  IEKMEKEMRDLMMQR  767
            IE+MEKE++DL MQR
Sbjct  394  IEQMEKEIKDLTMQR  408



>ref|XP_002510482.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF52669.1| ATP binding protein, putative [Ricinus communis]
Length=939

 Score =   379 bits (972),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 222/255 (87%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D+TPLR+LDDPE+GTVVE+L E    D +HL ELL+ICEAQRQIGET++N  SSR
Sbjct  162  DLLSSDSTPLRVLDDPEKGTVVERLIEETLIDWNHLQELLTICEAQRQIGETSMNENSSR  221

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQ++RLTIESS  +YS   N+S L + V+F+DLAGSERASQTL+ G RLKEG HINRSL
Sbjct  222  SHQVIRLTIESSAREYSGVGNSSILISTVHFVDLAGSERASQTLAGGARLKEGSHINRSL  281

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIPYRDSKLTRILQ+SLGGNARTA+ICT+SP+ SHVEQSRNTLL
Sbjct  282  LTLGTVIRKLSKGKNGHIPYRDSKLTRILQNSLGGNARTAMICTISPSRSHVEQSRNTLL  341

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CA +VAT AQVNVVMSDKALVKQL+KELAKLES L+++ S SV   ++ +L+EKE L
Sbjct  342  FASCANEVATNAQVNVVMSDKALVKQLRKELAKLESRLKSMESISVTGDTAALLREKELL  401

Query  723  IEKMEKEMRDLMMQR  767
            IEKM+KE+++L  QR
Sbjct  402  IEKMDKEIKELTWQR  416



>ref|XP_006340707.1| PREDICTED: kinesin-like protein NACK1-like [Solanum tuberosum]
Length=1023

 Score =   380 bits (976),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 190/255 (75%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D T LRLLDDPERGT+VEKL+E   RD +H+ +LLSICEAQRQIGET LN  SSR
Sbjct  158  DLLSADTTLLRLLDDPERGTIVEKLTEETLRDWNHVIQLLSICEAQRQIGETALNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIESS  +Y    N+S+LSA VNF+DLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  218  SHQIIRLTIESSAREYLGRDNSSSLSATVNFVDLAGSERASQSLSAGTRLKEGCHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGN RTAIICTMSPA SHVEQSRNTLL
Sbjct  278  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQPSLGGNGRTAIICTMSPARSHVEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVV+SDK LVK LQ+EL +LE+ELR+ R+         +L+EK   
Sbjct  338  FASCAKEVTTTAQVNVVVSDKVLVKHLQRELTRLENELRSPRTSLFPSDYEALLREKNKQ  397

Query  723  IEKMEKEMRDLMMQR  767
            IE+MEKE++DL MQR
Sbjct  398  IEQMEKEIKDLTMQR  412



>ref|XP_003516550.1| PREDICTED: kinesin-like protein NACK2-like isoform X1 [Glycine 
max]
 ref|XP_006573564.1| PREDICTED: kinesin-like protein NACK2-like isoform X2 [Glycine 
max]
Length=966

 Score =   379 bits (973),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 189/255 (74%), Positives = 218/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGTVVE+L+E   RD +H +EL+S CEAQRQIGET LN  SSR
Sbjct  156  DLLSPDCTPLRLLDDPERGTVVERLTEETLRDWNHFTELISFCEAQRQIGETALNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +S+LSA+VNF+DLAGSERASQT SAGTRLKEGCHINRSL
Sbjct  216  SHQILRLTIESSAREFLGNDKSSSLSASVNFVDLAGSERASQTHSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA SHVEQ+RNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARSHVEQTRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T AQVNVVMSDKALVKQLQKELA+LE ELR      +   ++ +L+EK+  
Sbjct  336  FASCAKEVSTNAQVNVVMSDKALVKQLQKELARLEDELRNSGPAHLTSETAALLREKDRQ  395

Query  723  IEKMEKEMRDLMMQR  767
            I+ ++KE+R+L +QR
Sbjct  396  IDMLKKEVRELTLQR  410



>ref|XP_006383133.1| kinesin motor family protein [Populus trichocarpa]
 gb|ERP60930.1| kinesin motor family protein [Populus trichocarpa]
Length=910

 Score =   377 bits (969),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 185/251 (74%), Positives = 215/251 (86%), Gaps = 0/251 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL  D TPLRLLDDPERGTVVE+L+E   RD +H  ELLS+CEAQRQIGET+LN  SSR
Sbjct  148  DLLGADATPLRLLDDPERGTVVERLTEESIRDWNHFKELLSVCEAQRQIGETSLNEASSR  207

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESST ++     +STL+A VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  208  SHQILRLTVESSTQEFLGHYKSSTLAATVNFVDLAGSERASQSLSAGMRLKEGCHINRSL  267

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGH+P+RDSKLTRILQ SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  268  LTLGTVIRKLSKGKNGHVPFRDSKLTRILQSSLGGNARTAIICTMSPARSHVEQSRNTLL  327

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVV+SDK LVKQLQ+ELA++E+EL+  R  SV   S++VL+EK+  
Sbjct  328  FASCAKEVTTNAQVNVVVSDKTLVKQLQRELARMENELKNTRPDSVTSDSTIVLREKDLQ  387

Query  723  IEKMEKEMRDL  755
            IEK+  E+ +L
Sbjct  388  IEKLMNEVAEL  398



>ref|XP_004512117.1| PREDICTED: kinesin-related protein 4-like isoform X1 [Cicer arietinum]
Length=948

 Score =   378 bits (971),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/256 (74%), Positives = 221/256 (86%), Gaps = 1/256 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGTVVEKL++   RD +H +EL+S CE QRQIGET+LN  SSR
Sbjct  157  DLLSPDCTPLRLLDDPERGTVVEKLTDETLRDWNHFAELISFCETQRQIGETSLNDASSR  216

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++      STLSA+VNFIDLAGSERASQT SAGTRLKEGCHINRSL
Sbjct  217  SHQILRLTVESSACEFLGNEKCSTLSASVNFIDLAGSERASQTNSAGTRLKEGCHINRSL  276

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA SHVEQ+RNTLL
Sbjct  277  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARSHVEQTRNTLL  336

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRS-RSVDETSSLVLKEKEA  719
            FA+CAK+V+T AQVNVV+SDKALVKQLQKELAKLESELR   S R   ++++ +L+EK+ 
Sbjct  337  FASCAKEVSTNAQVNVVVSDKALVKQLQKELAKLESELRNSGSTRPNYDSAAALLREKDH  396

Query  720  LIEKMEKEMRDLMMQR  767
             IE ++KE++++ +QR
Sbjct  397  EIEMLKKELKEVTLQR  412



>ref|XP_010484663.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Camelina sativa]
Length=925

 Score =   377 bits (969),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 214/254 (84%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E   RD +H  ELLS+CEAQRQIGET LN +SSR
Sbjct  40   DLLSTDTSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILR T+ESS  ++S     STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  100  SHQILRFTVESSAREFSTNDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  159

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  160  LTLGTVIRKLSKGKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  219

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+VMSDKALVK LQ+ELAKLESELR+    S+   ++ +L EKE  
Sbjct  220  FASCAKEVTTNAQVNIVMSDKALVKHLQRELAKLESELRSPGQASIVSDTTALLTEKELE  279

Query  723  IEKMEKEMRDLMMQ  764
            +EK++KE+  L  Q
Sbjct  280  VEKLKKEVFQLAQQ  293



>ref|XP_010091188.1| Kinesin-related protein 11 [Morus notabilis]
 gb|EXB43288.1| Kinesin-related protein 11 [Morus notabilis]
Length=940

 Score =   377 bits (969),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/255 (75%), Positives = 217/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDP+RGT+VEKL+E   RD SHL ELLSICEAQRQIGET+LN  SSR
Sbjct  159  DLLSTDNTPLRLLDDPDRGTIVEKLTEETLRDWSHLKELLSICEAQRQIGETSLNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TL+A+V+FIDLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  219  SHQIIRLGIESSAREFLGKDNSTTLAASVSFIDLAGSERASQALSAGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GHI YRDSKLTRILQ SLGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSKGRQGHINYRDSKLTRILQPSLGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V+TKAQVNVVMSDKALVK LQKELA+LESEL+     S       +L++K+  
Sbjct  339  FACCAKEVSTKAQVNVVMSDKALVKHLQKELARLESELKTPGPASSACDYVALLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKMEK++R+L  QR
Sbjct  399  IEKMEKQIRELTKQR  413



>ref|XP_008388154.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
Length=379

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS++   LRLLDDPE+GTVVEKLSE + RD++HL ELLS+CEAQR+IGET+LN  SSR
Sbjct  140  DLLSSEGAQLRLLDDPEKGTVVEKLSEEILRDRNHLEELLSVCEAQRKIGETSLNETSSR  199

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +Y   +++S L+A VNF+DLAGSER SQ LSAGTRLKEGCHINRSL
Sbjct  200  SHQILRLTIESSAREYLGIQSSSKLAATVNFVDLAGSERVSQALSAGTRLKEGCHINRSL  259

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGH+PYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQS+NTL 
Sbjct  260  LTLGTVIRKLSKGKNGHVPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSKNTLF  319

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDE  686
            FA+CAK+V T A+VNVV SDKALVKQLQKELAK+E  LR+L S+S+ E
Sbjct  320  FASCAKEVTTNAKVNVVRSDKALVKQLQKELAKMEDXLRSLASKSMQE  367



>ref|XP_006466916.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Citrus 
sinensis]
Length=910

 Score =   376 bits (965),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D +PLRLLDDPERGT+VEKL+E   +D +HL ELL ICEAQRQIGET+LN  SSR
Sbjct  40   DLLSADTSPLRLLDDPERGTIVEKLTEETLKDWNHLKELLFICEAQRQIGETSLNETSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++    + S+L+A VNF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  100  SHQILRLTVESSACEFIG-NDPSSLTATVNFVDLAGSERASQALSAGTRLKEGCHINRSL  158

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGH+P+RDSKLTRILQ SLGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  159  LTLGTVIRKLSKGRNGHVPFRDSKLTRILQSSLGGNARTAIICTLSPARSHVEQSRNTLL  218

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+VMSDKALVK LQ+EL++LE+ELR      +   S  VL+EK+  
Sbjct  219  FASCAKEVTTNAQVNIVMSDKALVKHLQRELSRLENELRGSGPVFITPDSVSVLREKDLR  278

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+ +L MQR
Sbjct  279  IEKLEKEVDELTMQR  293



>gb|KDO71125.1| hypothetical protein CISIN_1g001693mg [Citrus sinensis]
Length=909

 Score =   375 bits (964),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D +PLRLLDDPERGT+VEKL+E   +D +HL ELLS CEAQRQIGET+LN  SSR
Sbjct  40   DLLSADTSPLRLLDDPERGTIVEKLTEETLKDWNHLKELLSTCEAQRQIGETSLNETSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++    + S+L+A VNF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  100  SHQILRLTVESSACEFIG-NDPSSLTATVNFVDLAGSERASQALSAGTRLKEGCHINRSL  158

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGH+P+RDSKLTRILQ SLGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  159  LTLGTVIRKLSKGRNGHVPFRDSKLTRILQSSLGGNARTAIICTLSPARSHVEQSRNTLL  218

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+VMSDKALVK LQ+EL++LE+ELR      +   S  VL+EK+  
Sbjct  219  FASCAKEVTTNAQVNIVMSDKALVKHLQRELSRLENELRGSGPVFITPDSVSVLREKDLR  278

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+ +L MQR
Sbjct  279  IEKLEKEVDELTMQR  293



>gb|KHG01464.1| Kinesin-related 4 [Gossypium arboreum]
Length=988

 Score =   377 bits (969),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 191/268 (71%), Positives = 219/268 (82%), Gaps = 13/268 (5%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICE-------------AQR  143
            DLLS D+ PLR+LDDPERGTVVEKL+EV  RD+ HL ELL+ICE             AQR
Sbjct  146  DLLSPDSYPLRVLDDPERGTVVEKLTEVALRDRDHLHELLTICEDDIIYAIWYGICSAQR  205

Query  144  QIGETTLNGMSSRSHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAG  323
            QIGET LN  SSRSHQILRLTIESS  +Y+   N+S L+A+VNF+DLAGSERASQT +AG
Sbjct  206  QIGETALNETSSRSHQILRLTIESSAREYAGAGNSSILAASVNFVDLAGSERASQTSAAG  265

Query  324  TRLKEGCHINRSLLTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSP  503
            TRLKEGCHINRSLLTLGTVIRKLSKGR GH+PYRDSKLTRILQ++LGGNARTAIICTMSP
Sbjct  266  TRLKEGCHINRSLLTLGTVIRKLSKGRTGHVPYRDSKLTRILQNALGGNARTAIICTMSP  325

Query  504  AHSHVEQSRNTLLFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVD  683
               HVEQSRNTLLFA CA++V T AQVN++MSDKALVKQLQ+ELA+LE E+R+L S SV 
Sbjct  326  ERIHVEQSRNTLLFAKCAREVRTNAQVNLIMSDKALVKQLQRELARLEKEMRSLGSASVK  385

Query  684  ETSSLVLKEKEALIEKMEKEMRDLMMQR  767
              ++ VL+EKE LI +M KE+ DL  QR
Sbjct  386  GDTAGVLREKEKLIGQMAKEIEDLTWQR  413



>ref|XP_008382370.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein NACK1 [Malus 
domestica]
Length=929

 Score =   376 bits (965),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPERGT++EK++E   RD SHL ELLS CEAQRQIGET LN  SSR
Sbjct  159  DLLSTDNTPLRLLDDPERGTIIEKITEETLRDWSHLKELLSTCEAQRQIGETALNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TL+A+VNF+DLAGSERA+Q LSAG RLKEGCHINRSL
Sbjct  219  SHQIIRLAIESSAREFLGKGNSTTLAASVNFVDLAGSERAAQALSAGMRLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TVIRKLSKGRNGH+ YRDSKLTRILQ +LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLSTVIRKLSKGRNGHVNYRDSKLTRILQPALGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR     S       +L++K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRTPGPPSSTCDYPALLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKM+KE+R+L  QR
Sbjct  399  IEKMDKEIRELKKQR  413



>ref|XP_009378441.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378442.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378443.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378444.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=928

 Score =   376 bits (965),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPERGT++EK++E   RD SHL ELLS CEAQRQIGET LN  SSR
Sbjct  159  DLLSTDNTPLRLLDDPERGTIIEKITEETLRDWSHLKELLSTCEAQRQIGETALNDKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TL+A+VNF+DLAGSERA+Q LSAG RLKEGCHINRSL
Sbjct  219  SHQIIRLAIESSAREFLGKGNSTTLAASVNFVDLAGSERAAQALSAGMRLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TVIRKLSKGRNGH+ YRDSKLTRILQ +LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLSTVIRKLSKGRNGHVNYRDSKLTRILQPALGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR     S       +L++K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRTPGPPSSTCDYPALLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKM+KE+R+L  QR
Sbjct  399  IEKMDKEIRELKKQR  413



>ref|XP_010484662.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=1040

 Score =   378 bits (970),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 214/254 (84%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E   RD +H  ELLS+CEAQRQIGET LN +SSR
Sbjct  155  DLLSTDTSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILR T+ESS  ++S     STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  215  SHQILRFTVESSAREFSTNDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  275  LTLGTVIRKLSKGKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+VMSDKALVK LQ+ELAKLESELR+    S+   ++ +L EKE  
Sbjct  335  FASCAKEVTTNAQVNIVMSDKALVKHLQRELAKLESELRSPGQASIVSDTTALLTEKELE  394

Query  723  IEKMEKEMRDLMMQ  764
            +EK++KE+  L  Q
Sbjct  395  VEKLKKEVFQLAQQ  408



>ref|XP_007201806.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica]
 gb|EMJ03005.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica]
Length=926

 Score =   375 bits (963),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 217/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+DNTPLRLLDDPERGT++EK++E + RD SHL ELLSICEAQRQIGET LN  SSR
Sbjct  159  DLLSSDNTPLRLLDDPERGTIIEKITEEVLRDWSHLKELLSICEAQRQIGETALNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TL+A+VNF+DLAGSERA+Q LSAGTRLKEG HINRSL
Sbjct  219  SHQIIRLAIESSAREFLGKGNSTTLAASVNFVDLAGSERAAQALSAGTRLKEGSHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GHI YRDSKLTRILQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSKGRHGHINYRDSKLTRILQPCLGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESEL+     S     + +L++K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELKTPGPPSSTCDYTTLLRKKDVQ  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKM+KE+R+L  QR
Sbjct  399  IEKMDKEIRELKKQR  413



>emb|CAB51660.1| putative protein [Arabidopsis thaliana]
 emb|CAB79327.1| putative protein [Arabidopsis thaliana]
Length=1263

 Score =   382 bits (980),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 194/259 (75%), Positives = 227/259 (88%), Gaps = 5/259 (2%)
 Frame = +3

Query  3    DLLSTDN-TPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSS  179
            DLL  D+ TPLRLLDDPERGTVVEKL E   RD+SHL ELLSICE QR+IGET+LN +SS
Sbjct  139  DLLCEDSSTPLRLLDDPERGTVVEKLREETLRDRSHLEELLSICETQRKIGETSLNEISS  198

Query  180  RSHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRS  359
            RSHQILRLTIESS+ Q+S P +++TL+A+V F+DLAGSERASQTLSAG+RLKEGCHINRS
Sbjct  199  RSHQILRLTIESSSQQFS-PESSATLAASVCFVDLAGSERASQTLSAGSRLKEGCHINRS  257

Query  360  LLTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTL  539
            LLTLGTVIRKLSKG+NGHIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SH+EQSRNTL
Sbjct  258  LLTLGTVIRKLSKGKNGHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHLEQSRNTL  317

Query  540  LFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETS---SLVLKE  710
            LFATCAK+V T AQVN+V+S+KALVKQLQ+ELA++E+EL+ L   S   TS   +L+LK+
Sbjct  318  LFATCAKEVTTNAQVNLVVSEKALVKQLQRELARMENELKNLGPASASSTSDFYALMLKQ  377

Query  711  KEALIEKMEKEMRDLMMQR  767
            KE LI KME+++ +L  QR
Sbjct  378  KEELIAKMEEQIHELKWQR  396



>ref|XP_010433806.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=1017

 Score =   377 bits (968),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 192/259 (74%), Positives = 225/259 (87%), Gaps = 5/259 (2%)
 Frame = +3

Query  3    DLLSTD-NTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSS  179
            DLL  D NTPLRLLDDPERGTVVEKL E    D++HL ELLSICE QR+IGET+LN  SS
Sbjct  141  DLLCEDSNTPLRLLDDPERGTVVEKLREETLTDRNHLEELLSICETQRKIGETSLNEASS  200

Query  180  RSHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRS  359
            RSHQILRLTIESS  ++S P +++TL+A+V FIDLAGSERASQTLSAG+RLKEGCHINRS
Sbjct  201  RSHQILRLTIESSNREFS-PESSATLAASVCFIDLAGSERASQTLSAGSRLKEGCHINRS  259

Query  360  LLTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTL  539
            LLTLGTVIRKLSKG+NGHIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SH+EQSRNTL
Sbjct  260  LLTLGTVIRKLSKGKNGHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHLEQSRNTL  319

Query  540  LFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRAL---RSRSVDETSSLVLKE  710
            LFA+CAK+V T AQVN+V+S+KALVKQLQ+ELA++E+EL+ L    S S  E  +L+LK+
Sbjct  320  LFASCAKEVTTNAQVNLVVSEKALVKQLQRELARMENELKNLGPASSSSTSEFYTLMLKQ  379

Query  711  KEALIEKMEKEMRDLMMQR  767
            KE LI KME+++++L  QR
Sbjct  380  KEELIVKMEEQIQELKWQR  398



>ref|XP_007226270.1| hypothetical protein PRUPE_ppa019074mg [Prunus persica]
 gb|EMJ27469.1| hypothetical protein PRUPE_ppa019074mg [Prunus persica]
Length=1044

 Score =   377 bits (969),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 218/255 (85%), Gaps = 8/255 (3%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D+ PLRLLDDPE+GTV+EKLSE + RDQ+HL ELLSICEAQR+IGET+LN  SSR
Sbjct  146  DLLSSDSGPLRLLDDPEKGTVIEKLSEEILRDQNHLQELLSICEAQRKIGETSLNETSSR  205

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +Y    ++STL+A VNF+DLAGSER SQ LSAG RLKEGCHINRSL
Sbjct  206  SHQILRLTIESSAREYLGIESSSTLAATVNFVDLAGSERVSQALSAGARLKEGCHINRSL  265

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG VIRKLSKGRNGH+PYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQS+NTL 
Sbjct  266  LTLGGVIRKLSKGRNGHVPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSKNTLF  325

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T A+VNVV SDKALVKQLQKELAK+E  L +L S+S        ++EKE L
Sbjct  326  FASCAKEVSTNAKVNVVTSDKALVKQLQKELAKMEGALTSLTSKS--------MQEKELL  377

Query  723  IEKMEKEMRDLMMQR  767
            +E+M KE+++L  QR
Sbjct  378  LEQMNKEIKELTRQR  392



>ref|XP_006425531.1| hypothetical protein CICLE_v10024791mg [Citrus clementina]
 gb|ESR38771.1| hypothetical protein CICLE_v10024791mg [Citrus clementina]
Length=1028

 Score =   377 bits (968),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 217/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D +PLRLLDDPERGT+VEKL+E   +D +HL+ELL ICEAQRQIGET+LN  SSR
Sbjct  158  DLLSADTSPLRLLDDPERGTIVEKLTEETLKDWNHLTELLFICEAQRQIGETSLNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++    + S+L+A VNF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  218  SHQILRLTVESSACEFIG-NDPSSLTATVNFVDLAGSERASQALSAGTRLKEGCHINRSL  276

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGH+P+RDSKLTRILQ SLGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  277  LTLGTVIRKLSKGRNGHVPFRDSKLTRILQSSLGGNARTAIICTLSPARSHVEQSRNTLL  336

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+VMSDKALVK LQ+EL++LE+ELR      +   S  VL+EK+  
Sbjct  337  FASCAKEVTTNAQVNIVMSDKALVKHLQRELSRLENELRGSGPVFITPDSVSVLREKDLR  396

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+ +L MQR
Sbjct  397  IEKLEKEVDELTMQR  411



>gb|EPS66399.1| hypothetical protein M569_08373, partial [Genlisea aurea]
Length=430

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/257 (72%), Positives = 215/257 (84%), Gaps = 8/257 (3%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL+TD T LRLLDDPE+GT++EKL+E   RD SHL ELLSICEAQR+IGET LN  SSR
Sbjct  161  DLLATDGTSLRLLDDPEKGTIIEKLTEETLRDWSHLRELLSICEAQRRIGETLLNETSSR  220

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRL+IESS  ++    N++TL    NF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  221  SHQILRLSIESSAREFIGKGNSTTL----NFVDLAGSERASQALSVGQRLKEGCHINRSL  276

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GH+ YRDSKLTRILQ SLGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  277  LTLGTVIRKLSKGRQGHVNYRDSKLTRILQPSLGGNARTAIICTLSPARSHVEQSRNTLL  336

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELR--ALRSRSVDETSSLVLKEKE  716
            FA+CAK+V+T AQVNVVMSDKALVK LQKE+A+LESELR  A+ S + D     +L++K+
Sbjct  337  FASCAKEVSTNAQVNVVMSDKALVKHLQKEVARLESELRTPAVSSSTCDHGP--LLRKKD  394

Query  717  ALIEKMEKEMRDLMMQR  767
            A I+++EKE R+L MQR
Sbjct  395  AQIQQLEKENRELKMQR  411



>ref|XP_003612133.1| Kinesin-related protein [Medicago truncatula]
Length=963

 Score =   375 bits (964),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/258 (74%), Positives = 217/258 (84%), Gaps = 5/258 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGTVVEKL+E   RD +H +EL+S CE QRQIGET+LN  SSR
Sbjct  164  DLLSADYTPLRLLDDPERGTVVEKLTEETIRDWNHFTELISFCETQRQIGETSLNEASSR  223

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++      S+LSA+VNF+DLAGSERASQT SAG RLKEGCHINRSL
Sbjct  224  SHQILRLTVESSAREFLGNDKCSSLSASVNFVDLAGSERASQTNSAGVRLKEGCHINRSL  283

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA SHVEQ+RNTL 
Sbjct  284  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARSHVEQTRNTLF  343

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELR---ALRSRSVDETSSLVLKEK  713
            FA+CAK+V T AQVNVV+SDKALVKQLQKE+AKLESELR     R  S D T+  +L+EK
Sbjct  344  FASCAKEVETNAQVNVVVSDKALVKQLQKEVAKLESELRNSGPARPNSSDSTA--LLREK  401

Query  714  EALIEKMEKEMRDLMMQR  767
            +  IE ++KE+++L +QR
Sbjct  402  DQEIEMLKKEVKELTLQR  419



>gb|AES95091.2| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=956

 Score =   375 bits (963),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/258 (74%), Positives = 217/258 (84%), Gaps = 5/258 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGTVVEKL+E   RD +H +EL+S CE QRQIGET+LN  SSR
Sbjct  157  DLLSADYTPLRLLDDPERGTVVEKLTEETIRDWNHFTELISFCETQRQIGETSLNEASSR  216

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++      S+LSA+VNF+DLAGSERASQT SAG RLKEGCHINRSL
Sbjct  217  SHQILRLTVESSAREFLGNDKCSSLSASVNFVDLAGSERASQTNSAGVRLKEGCHINRSL  276

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA SHVEQ+RNTL 
Sbjct  277  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARSHVEQTRNTLF  336

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELR---ALRSRSVDETSSLVLKEK  713
            FA+CAK+V T AQVNVV+SDKALVKQLQKE+AKLESELR     R  S D T+  +L+EK
Sbjct  337  FASCAKEVETNAQVNVVVSDKALVKQLQKEVAKLESELRNSGPARPNSSDSTA--LLREK  394

Query  714  EALIEKMEKEMRDLMMQR  767
            +  IE ++KE+++L +QR
Sbjct  395  DQEIEMLKKEVKELTLQR  412



>ref|XP_006466914.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006466915.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Citrus 
sinensis]
Length=1028

 Score =   377 bits (967),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D +PLRLLDDPERGT+VEKL+E   +D +HL ELL ICEAQRQIGET+LN  SSR
Sbjct  158  DLLSADTSPLRLLDDPERGTIVEKLTEETLKDWNHLKELLFICEAQRQIGETSLNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++    + S+L+A VNF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  218  SHQILRLTVESSACEFIG-NDPSSLTATVNFVDLAGSERASQALSAGTRLKEGCHINRSL  276

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGH+P+RDSKLTRILQ SLGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  277  LTLGTVIRKLSKGRNGHVPFRDSKLTRILQSSLGGNARTAIICTLSPARSHVEQSRNTLL  336

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+VMSDKALVK LQ+EL++LE+ELR      +   S  VL+EK+  
Sbjct  337  FASCAKEVTTNAQVNIVMSDKALVKHLQRELSRLENELRGSGPVFITPDSVSVLREKDLR  396

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+ +L MQR
Sbjct  397  IEKLEKEVDELTMQR  411



>ref|XP_008236841.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
 ref|XP_008236842.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
Length=926

 Score =   374 bits (961),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/255 (74%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+DN PLRLLDDPERGT++EK+ E + RD SHL ELLSICEAQRQIGET LN  SSR
Sbjct  159  DLLSSDNIPLRLLDDPERGTIIEKIREEVLRDWSHLKELLSICEAQRQIGETALNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TL+A+VNF+DLAGSERA+Q LSAGTRLKEG HINRSL
Sbjct  219  SHQIIRLAIESSAREFLGKGNSTTLAASVNFVDLAGSERAAQALSAGTRLKEGSHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GHI YRDSKLTRILQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSKGRHGHINYRDSKLTRILQPCLGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR     S     + +L++K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRTPGPPSSTCDYTTLLRKKDVQ  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKMEKE+R+L  QR
Sbjct  399  IEKMEKEIRELKKQR  413



>ref|XP_006599344.1| PREDICTED: kinesin-like protein NACK1-like isoform X5 [Glycine 
max]
Length=866

 Score =   373 bits (957),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 216/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPE+GTVVE+L+E   RD SH  EL+S CEAQRQIGET LN +SSR
Sbjct  87   DLLSVDSTPLRLLDDPEKGTVVERLTEETLRDWSHFQELISFCEAQRQIGETALNEVSSR  146

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++      S+LSA+VNF+DLAGSER+SQT SAGTRLKEGCHINRSL
Sbjct  147  SHQILRLTIESSAREFLGNDKMSSLSASVNFVDLAGSERSSQTNSAGTRLKEGCHINRSL  206

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SL GNA+TAIICTMSPA SHVEQ+RNTLL
Sbjct  207  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLAGNAKTAIICTMSPARSHVEQTRNTLL  266

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T A+VNVV+SDK LVKQLQKELA+LESEL+      +   S+ +LKEK+  
Sbjct  267  FASCAKEVTTNAKVNVVVSDKLLVKQLQKELARLESELKNSGPTRLKFDSAALLKEKDLQ  326

Query  723  IEKMEKEMRDLMMQR  767
            IE+++KE+ D+ MQR
Sbjct  327  IERLKKEVMDVSMQR  341



>ref|XP_008221318.1| PREDICTED: kinesin-like protein NACK1 [Prunus mume]
Length=1069

 Score =   377 bits (969),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 219/255 (86%), Gaps = 8/255 (3%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D+ PLRLLDDPE+GTV+EKLSE + RDQ+HL ELLSICEAQR+IGET+LN  SSR
Sbjct  146  DLLSSDSGPLRLLDDPEKGTVIEKLSEEILRDQNHLQELLSICEAQRKIGETSLNETSSR  205

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +Y    ++STL+A VNF+DLAGSER SQ LSAG RLKEGCHINRSL
Sbjct  206  SHQILRLTIESSAREYLGIESSSTLAATVNFVDLAGSERVSQALSAGARLKEGCHINRSL  265

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG VIRKLSKGRNGH+PYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQS+NTL 
Sbjct  266  LTLGGVIRKLSKGRNGHVPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSKNTLF  325

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T A+VNVV SDKALVKQLQKELAK+E  L +L S+S        ++EKE L
Sbjct  326  FASCAKEVSTNAKVNVVTSDKALVKQLQKELAKMEGALTSLTSKS--------MQEKELL  377

Query  723  IEKMEKEMRDLMMQR  767
            +E+M+KE+++L  QR
Sbjct  378  LEQMDKEIKELTRQR  392



>gb|KDO49885.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=758

 Score =   370 bits (949),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPE+G VVEK++E + +D +HL ELLSICEAQR+IGET LN  SSR
Sbjct  159  DLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TLSA+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  219  SHQIIRLMIESSAREFLGKENSTTLSASVNFVDLAGSERASQALSTGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TVIRKLSKGRNGHI YRDSKLTR+LQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLSTVIRKLSKGRNGHINYRDSKLTRMLQPCLGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR+    S       +L++K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRSPAPASSTCDYVALLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KME+E+R+L  QR
Sbjct  399  IQKMEREIRELTKQR  413



>gb|KDO71124.1| hypothetical protein CISIN_1g001693mg [Citrus sinensis]
Length=1027

 Score =   376 bits (965),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D +PLRLLDDPERGT+VEKL+E   +D +HL ELLS CEAQRQIGET+LN  SSR
Sbjct  158  DLLSADTSPLRLLDDPERGTIVEKLTEETLKDWNHLKELLSTCEAQRQIGETSLNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++    + S+L+A VNF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  218  SHQILRLTVESSACEFIG-NDPSSLTATVNFVDLAGSERASQALSAGTRLKEGCHINRSL  276

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGH+P+RDSKLTRILQ SLGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  277  LTLGTVIRKLSKGRNGHVPFRDSKLTRILQSSLGGNARTAIICTLSPARSHVEQSRNTLL  336

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+VMSDKALVK LQ+EL++LE+ELR      +   S  VL+EK+  
Sbjct  337  FASCAKEVTTNAQVNIVMSDKALVKHLQRELSRLENELRGSGPVFITPDSVSVLREKDLR  396

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+ +L MQR
Sbjct  397  IEKLEKEVDELTMQR  411



>ref|XP_009336756.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=1068

 Score =   377 bits (967),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 220/255 (86%), Gaps = 8/255 (3%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D+  LRLLDDPE+GTVVEKLSE + +D++HL ELLS+CEAQR+IGET+LN  SSR
Sbjct  140  DLLSSDSAHLRLLDDPEKGTVVEKLSEEILKDRNHLEELLSVCEAQRKIGETSLNETSSR  199

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +Y   +++STL+A VNF+DLAGSER SQ LSAGTRLKEGCHINRSL
Sbjct  200  SHQILRLTIESSAQEYLGIQSSSTLAATVNFVDLAGSERVSQALSAGTRLKEGCHINRSL  259

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGH+PYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQS+NTL 
Sbjct  260  LTLGTVIRKLSKGKNGHVPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSKNTLF  319

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T A+VNVV SDKALVKQLQKELAK+E  LR+L S+S        ++EKE L
Sbjct  320  FASCAKEVTTNAKVNVVRSDKALVKQLQKELAKMEDALRSLASKS--------MQEKELL  371

Query  723  IEKMEKEMRDLMMQR  767
            +E+M KE+++L  QR
Sbjct  372  LEQMNKEIKELTQQR  386



>emb|CDO96988.1| unnamed protein product [Coffea canephora]
Length=961

 Score =   374 bits (961),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 222/254 (87%), Gaps = 3/254 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPERGT++E+L+E   RD +HL ELLSICEAQRQIGET+LN  SSR
Sbjct  160  DLLSTDNTPLRLLDDPERGTIIERLTEETLRDWNHLKELLSICEAQRQIGETSLNETSSR  219

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N++TL+A+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  220  SHQILRLTIESSAREFIGKDNSTTLAASVNFVDLAGSERASQALSVGQRLKEGCHINRSL  279

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GH+ YRDSKLTRILQ SLGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  280  LTLGTVIRKLSKGRHGHVNYRDSKLTRILQPSLGGNARTAIICTLSPARSHVEQSRNTLL  339

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T AQVNVVMSDKALVK LQ+E+A+LESELR     S+++ ++L L++K+  
Sbjct  340  FASCAKEVSTNAQVNVVMSDKALVKHLQREVARLESELRT--PGSINDHTAL-LRKKDLQ  396

Query  723  IEKMEKEMRDLMMQ  764
            IEK+E+E+R+L  Q
Sbjct  397  IEKLEREVRELTKQ  410



>ref|XP_006403375.1| hypothetical protein EUTSA_v10003349mg [Eutrema salsugineum]
 gb|ESQ44828.1| hypothetical protein EUTSA_v10003349mg [Eutrema salsugineum]
Length=1118

 Score =   377 bits (969),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 190/246 (77%), Positives = 215/246 (87%), Gaps = 2/246 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS DN PLRLLDDPERGTVVEKL E   RD++HL ELLS+CE QR+IGET+LN  SSR
Sbjct  145  DLLSGDNNPLRLLDDPERGTVVEKLIEETLRDRTHLEELLSVCETQRKIGETSLNETSSR  204

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +YS P N+STL+A+V F+DLAGSERASQTLSAG RLKEGCHINRSL
Sbjct  205  SHQILRLTIESSVREYS-PENSSTLAASVCFVDLAGSERASQTLSAGKRLKEGCHINRSL  263

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGH+PYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  264  LTLGTVIRKLSKGRNGHVPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSRNTLL  323

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRS-RSVDETSSLVLKEKEA  719
            FATCAK+V T AQVNVV+S+KALVKQLQ+ELA++E+EL+ L S  S      L+LK+KE 
Sbjct  324  FATCAKEVTTNAQVNVVVSEKALVKQLQQELARMENELKNLGSASSAGSDFYLLLKQKEE  383

Query  720  LIEKME  737
            +I K++
Sbjct  384  VIAKLD  389



>ref|XP_007046742.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
 gb|EOX90899.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
Length=982

 Score =   374 bits (961),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 217/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPERGTVVE+L+E   +D +H   LLS+CEAQRQIGET+LN  SSR
Sbjct  156  DLLSADSTPLRLLDDPERGTVVERLTEETLQDWNHFKVLLSVCEAQRQIGETSLNETSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +STL+A VNF+DLAGSERASQTLSAG RLKEGCHINRSL
Sbjct  216  SHQILRLTIESSAREFFGNDKSSTLAATVNFVDLAGSERASQTLSAGARLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GHIP+RDSKLTRILQ S+GGNARTAIICTMSPA +HVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGRSGHIPFRDSKLTRILQSSIGGNARTAIICTMSPARTHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V T AQVNVVMSDKALVKQLQ+ELA+LE+ELR+  + SV    + +L+EK+  
Sbjct  336  FACCAKEVTTNAQVNVVMSDKALVKQLQRELARLENELRSAGTMSVSSDLAALLREKDLE  395

Query  723  IEKMEKEMRDLMMQR  767
            IEK++KE+  L  QR
Sbjct  396  IEKLKKEVILLTQQR  410



>ref|XP_003538873.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006590716.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
 gb|KHN41913.1| Kinesin-related protein 4 [Glycine soja]
Length=953

 Score =   374 bits (959),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 217/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGTVVE+L+E    D +H +EL+S CEAQRQIGET LN  SSR
Sbjct  156  DLLSPDCTPLRLLDDPERGTVVERLTEETLGDWNHFTELISFCEAQRQIGETALNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +S+LSA+VNF+DLAGSERASQT SAGTRLKEGCHINRSL
Sbjct  216  SHQILRLTIESSAREFLGNDKSSSLSASVNFVDLAGSERASQTHSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA SHVEQ+RNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARSHVEQTRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T AQVNVV+SDKALVKQLQKELA+LE ELR      +   ++ +L+EK+  
Sbjct  336  FASCAKEVSTNAQVNVVVSDKALVKQLQKELARLEDELRNSGPAHLTSETAALLREKDRQ  395

Query  723  IEKMEKEMRDLMMQR  767
            I+ ++KE+R+L +QR
Sbjct  396  IDMLKKEVRELTLQR  410



>ref|XP_002865077.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41336.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=1039

 Score =   375 bits (964),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 214/254 (84%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E   RD +H  ELLS+CEAQRQIGET LN +SSR
Sbjct  155  DLLSTDTSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  ++S     STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  215  SHQILRLTVESTAREFSTNDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  275  LTLGTVIRKLSKGKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLESELR+    SV   ++ +L EK   
Sbjct  335  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESELRSPGQASVVSDTTALLTEKNLE  394

Query  723  IEKMEKEMRDLMMQ  764
            +EK++KE+  L  Q
Sbjct  395  VEKLKKEVLQLARQ  408



>ref|XP_006599340.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006599341.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
 ref|XP_006599342.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Glycine 
max]
 ref|XP_006599343.1| PREDICTED: kinesin-like protein NACK1-like isoform X4 [Glycine 
max]
Length=935

 Score =   373 bits (957),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 216/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPE+GTVVE+L+E   RD SH  EL+S CEAQRQIGET LN +SSR
Sbjct  156  DLLSVDSTPLRLLDDPEKGTVVERLTEETLRDWSHFQELISFCEAQRQIGETALNEVSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++      S+LSA+VNF+DLAGSER+SQT SAGTRLKEGCHINRSL
Sbjct  216  SHQILRLTIESSAREFLGNDKMSSLSASVNFVDLAGSERSSQTNSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SL GNA+TAIICTMSPA SHVEQ+RNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLAGNAKTAIICTMSPARSHVEQTRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T A+VNVV+SDK LVKQLQKELA+LESEL+      +   S+ +LKEK+  
Sbjct  336  FASCAKEVTTNAKVNVVVSDKLLVKQLQKELARLESELKNSGPTRLKFDSAALLKEKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IE+++KE+ D+ MQR
Sbjct  396  IERLKKEVMDVSMQR  410



>ref|XP_011028954.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Populus euphratica]
Length=912

 Score =   372 bits (956),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 216/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLST ++PLRLLDDPERGTVVE L E    D +HL EL+SICE QRQIGETTLN  SSR
Sbjct  158  DLLSTSSSPLRLLDDPERGTVVEGLIEDTLVDWNHLLELISICEDQRQIGETTLNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS   Y    N++TL+A VNF+DLAGSERASQTL+  TRLKEG HINRSL
Sbjct  218  SHQILRLTVESSARGYLGAGNSTTLTATVNFVDLAGSERASQTLAVVTRLKEGSHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ+SLGGNARTAIICT+SPAHSHVEQSRNTLL
Sbjct  278  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQNSLGGNARTAIICTLSPAHSHVEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+VMSDK LVK+LQKE+A+LE+EL++  S S    S+ +L+EKE  
Sbjct  338  FASCAKEVTTNAQVNLVMSDKTLVKKLQKEVARLENELKSAGSNSFVGDSTALLREKELQ  397

Query  723  IEKMEKEMRDLMMQR  767
            IEKM +E+++L  QR
Sbjct  398  IEKMHQEIQELTWQR  412



>ref|XP_006285338.1| hypothetical protein CARUB_v10006728mg [Capsella rubella]
 gb|EOA18236.1| hypothetical protein CARUB_v10006728mg [Capsella rubella]
Length=1014

 Score =   375 bits (962),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 191/259 (74%), Positives = 223/259 (86%), Gaps = 5/259 (2%)
 Frame = +3

Query  3    DLLSTD-NTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSS  179
            DLL  D N PLRLLDDPERGTVVEKL E    D++HL ELLSICE QR+IGET+LN  SS
Sbjct  141  DLLCEDSNIPLRLLDDPERGTVVEKLREETLTDRNHLQELLSICETQRKIGETSLNETSS  200

Query  180  RSHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRS  359
            RSHQILRLTIESS  ++S P +++TL+A+V FIDLAGSERASQTLSAG+RLKEGCHINRS
Sbjct  201  RSHQILRLTIESSNLEFS-PESSATLAASVCFIDLAGSERASQTLSAGSRLKEGCHINRS  259

Query  360  LLTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTL  539
            LLTLGTVIRKLSKG+NGHIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SH+EQSRNTL
Sbjct  260  LLTLGTVIRKLSKGKNGHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHLEQSRNTL  319

Query  540  LFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRAL---RSRSVDETSSLVLKE  710
            LFA+CAK+V T AQVN+V+S+KALVKQLQ+ELA++E+EL+ L    S S  E  +L+LK+
Sbjct  320  LFASCAKEVITNAQVNLVVSEKALVKQLQRELARMENELKNLGPASSSSTSEFYTLMLKQ  379

Query  711  KEALIEKMEKEMRDLMMQR  767
            KE LI KME+++ +L  QR
Sbjct  380  KEELIAKMEEQIEELKWQR  398



>ref|XP_002305465.1| kinesin motor family protein [Populus trichocarpa]
 gb|EEE85976.1| kinesin motor family protein [Populus trichocarpa]
Length=842

 Score =   370 bits (951),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 189/257 (74%), Positives = 217/257 (84%), Gaps = 4/257 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GTVVEK +E   +D  HL ELLS+CEAQR+IGET+LN  SSR
Sbjct  148  DLLSTDDTPLRLLDDPEKGTVVEKATEETLKDWDHLKELLSVCEAQRRIGETSLNEKSSR  207

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N++TLSA VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  208  SHQILRLTIESSAREFLGKENSTTLSATVNFVDLAGSERASQALSTGARLKEGCHINRSL  267

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GHI YRDSKLTR+LQ +LGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  268  LTLGTVIRKLSKGRQGHINYRDSKLTRLLQPALGGNARTAIICTLSPARSHVEQSRNTLL  327

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELR--ALRSRSVDETSSLVLKEKE  716
            FA CAK+V TKAQVNVVMSDKALVK LQKE+A+LESELR  A  S + D  S  +L++++
Sbjct  328  FACCAKEVTTKAQVNVVMSDKALVKHLQKEVARLESELRSPAPASSTCDYVS--LLRKRD  385

Query  717  ALIEKMEKEMRDLMMQR  767
              I+KMEKE+++L  QR
Sbjct  386  LQIQKMEKEIKELTKQR  402



>ref|XP_011028953.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Populus euphratica]
Length=915

 Score =   372 bits (956),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 216/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLST ++PLRLLDDPERGTVVE L E    D +HL EL+SICE QRQIGETTLN  SSR
Sbjct  158  DLLSTSSSPLRLLDDPERGTVVEGLIEDTLVDWNHLLELISICEDQRQIGETTLNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS   Y    N++TL+A VNF+DLAGSERASQTL+  TRLKEG HINRSL
Sbjct  218  SHQILRLTVESSARGYLGAGNSTTLTATVNFVDLAGSERASQTLAVVTRLKEGSHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ+SLGGNARTAIICT+SPAHSHVEQSRNTLL
Sbjct  278  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQNSLGGNARTAIICTLSPAHSHVEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+VMSDK LVK+LQKE+A+LE+EL++  S S    S+ +L+EKE  
Sbjct  338  FASCAKEVTTNAQVNLVMSDKTLVKKLQKEVARLENELKSAGSNSFVGDSTALLREKELQ  397

Query  723  IEKMEKEMRDLMMQR  767
            IEKM +E+++L  QR
Sbjct  398  IEKMHQEIQELTWQR  412



>gb|KHN41676.1| Kinesin-related protein 4 [Glycine soja]
Length=935

 Score =   373 bits (957),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 216/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPE+GTVVE+L+E   RD SH  EL+S CEAQRQIGET LN +SSR
Sbjct  156  DLLSVDSTPLRLLDDPEKGTVVERLTEETLRDWSHFQELISFCEAQRQIGETALNEVSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++      S+LSA+VNF+DLAGSER+SQT SAGTRLKEGCHINRSL
Sbjct  216  SHQILRLTIESSAREFLGNDKMSSLSASVNFVDLAGSERSSQTNSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SL GNA+TAIICTMSPA SHVEQ+RNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLAGNAKTAIICTMSPARSHVEQTRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T A+VNVV+SDK LVKQLQKELA+LESEL+      +   S+ +LKEK+  
Sbjct  336  FASCAKEVTTNAKVNVVVSDKLLVKQLQKELARLESELKNSGPTRLKFDSAALLKEKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IE+++KE+ D+ MQR
Sbjct  396  IERLKKEVMDVSMQR  410



>gb|KEH20389.1| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=954

 Score =   373 bits (958),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 218/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPE+GTVVEKL+E   RD +H +EL+S CE QRQIGET+LN +SSR
Sbjct  156  DLLSNDTTPLRLLDDPEKGTVVEKLTEETLRDWNHFTELISFCETQRQIGETSLNEVSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILR+TIESS  ++     +S L+A+VNF+DLAGSERASQT SAGTRLKEGCHINRSL
Sbjct  216  SHQILRMTIESSAREFLGNYKSSALAASVNFVDLAGSERASQTNSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ S+GGNARTAIICTMSPA S+VEQ+RNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSIGGNARTAIICTMSPARSYVEQTRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T A+VNVV+SDK+LVKQLQ+ELA+LESEL+   S      S+ +L+EK+  
Sbjct  336  FASCAKEVSTNAKVNVVVSDKSLVKQLQRELARLESELKKSGSTQRKPDSAELLREKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IE ++KE+ DL MQR
Sbjct  396  IEMLKKEIMDLAMQR  410



>ref|XP_009386197.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=941

 Score =   372 bits (956),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 190/255 (75%), Positives = 214/255 (84%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD++PLRLLDDPERGTVVEKL+E   RDQ HL EL+  C AQRQ+GET+LN MSSR
Sbjct  158  DLLSTDSSPLRLLDDPERGTVVEKLTEETLRDQRHLKELVFTCAAQRQVGETSLNEMSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    +++TL AAVNFIDLAGSERASQ  SA  RLKEGCHINRSL
Sbjct  218  SHQILRLTIESSAREFMGKDSSTTLLAAVNFIDLAGSERASQVSSASNRLKEGCHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GHIPYRDSKLTRILQ  LGGNARTAIICTMSPA SH+EQSRNTL 
Sbjct  278  LTLGTVIRKLSKGRTGHIPYRDSKLTRILQPFLGGNARTAIICTMSPARSHIEQSRNTLS  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAKQVAT AQVNVV+SDKALVK LQ+ELA+LE+ELR   S +    S   L++K+A 
Sbjct  338  FASCAKQVATNAQVNVVVSDKALVKHLQRELARLENELRYTESATCTHHSD-ALRDKDAK  396

Query  723  IEKMEKEMRDLMMQR  767
            I+KME+E+ DLM QR
Sbjct  397  IKKMEREIMDLMQQR  411



>ref|XP_009617690.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
 ref|XP_009617691.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
Length=928

 Score =   372 bits (955),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/255 (74%), Positives = 217/255 (85%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D+TPLRLLDDPE+GT++EKL+E   RD  HL ELLSICEAQRQIGET LN  SSR
Sbjct  160  DLLSSDSTPLRLLDDPEKGTIIEKLTEETLRDWDHLKELLSICEAQRQIGETYLNENSSR  219

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N +TLSA+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  220  SHQILRLTIESSAREFIGKDNKTTLSASVNFVDLAGSERASQALSVGQRLKEGCHINRSL  279

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GH+ YRDSKLTRILQ +LGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  280  LTLGTVIRKLSKGRHGHVNYRDSKLTRILQPALGGNARTAIICTLSPARSHVEQSRNTLL  339

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V+T AQVNVVMSDKALVK LQKELA+LESEL+   + + D  S  +L++K+  
Sbjct  340  FACCAKEVSTNAQVNVVMSDKALVKHLQKELARLESELKT-PTTTCDHVS--LLRKKDQQ  396

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+R+L  QR
Sbjct  397  IEKLEKEVRELTKQR  411



>ref|XP_010444813.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
Length=1040

 Score =   375 bits (962),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 214/254 (84%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E   RD +H  ELLS+CEAQRQIGET LN +SSR
Sbjct  155  DLLSTDTSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILR T+ESS  ++S     STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  215  SHQILRFTVESSAREFSTNDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  275  LTLGTVIRKLSKGKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+VMSDKALVK LQ+ELAKLESELR+    S+   ++ +L EK+  
Sbjct  335  FASCAKEVTTNAQVNIVMSDKALVKHLQRELAKLESELRSPGQASIVSDTTALLTEKDLE  394

Query  723  IEKMEKEMRDLMMQ  764
            +EK++KE+  L  Q
Sbjct  395  VEKLKKEVFLLAQQ  408



>ref|XP_009345268.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009345269.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009345270.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=928

 Score =   372 bits (954),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 213/254 (84%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPERGT++EK++E   RD +HL ELLSICEAQRQIGET LN  SSR
Sbjct  159  DLLSTDNTPLRLLDDPERGTIIEKITEETLRDWNHLKELLSICEAQRQIGETALNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI++L IESS  ++    N++TL+A+VNF+DLAGSERA+Q LSAG RLKEGCHINRSL
Sbjct  219  SHQIIKLAIESSAREFLGKGNSTTLAASVNFVDLAGSERAAQALSAGMRLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TVIRKLSKGRNGHI YRDSKLTRILQ +LGGNARTAIICT+SP  SHVEQ+RNTLL
Sbjct  279  LTLSTVIRKLSKGRNGHINYRDSKLTRILQPALGGNARTAIICTLSPTRSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR     S       +L++K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRFPGPPSSTCDYPALLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQ  764
            IEKM+KE+R+L  Q
Sbjct  399  IEKMDKEIRELKKQ  412



>gb|KDP46700.1| hypothetical protein JCGZ_06488 [Jatropha curcas]
Length=1012

 Score =   374 bits (959),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 217/254 (85%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGTVVE+L+E   RD +H  ELLSICEAQRQIGET++N  SSR
Sbjct  152  DLLSVDTTPLRLLDDPERGTVVERLTEETLRDWNHFIELLSICEAQRQIGETSMNETSSR  211

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +S+L+A VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  212  SHQILRLTIESSAREFLGNDKSSSLAATVNFVDLAGSERASQSLSAGMRLKEGCHINRSL  271

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  272  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTISPARSHVEQSRNTLL  331

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T A+VNVV+SDKALVK+LQ+ELA+L+SELR   S SV   S  +L+EK+  
Sbjct  332  FASCAKEVTTNARVNVVVSDKALVKKLQRELARLQSELRNTGSNSVISDSISLLREKDLQ  391

Query  723  IEKMEKEMRDLMMQ  764
            IEK++KE+ +L  Q
Sbjct  392  IEKLKKEVLELNQQ  405



>ref|XP_004148539.1| PREDICTED: kinesin-like protein KIN12B-like [Cucumis sativus]
 ref|XP_004167100.1| PREDICTED: kinesin-like protein KIN12B-like [Cucumis sativus]
Length=930

 Score =   372 bits (954),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 216/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDD ERGT+VEK++E + RD +HL EL+SICEAQR+IGET+LN  SSR
Sbjct  158  DLLSTDTSPLRLLDDQERGTIVEKVTEEILRDWNHLRELISICEAQRRIGETSLNEKSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI++LTIESS  ++    N++TL+A+V+FIDLAGSERA+Q LSAG RLKEGCHINRSL
Sbjct  218  SHQIIKLTIESSAREFLGKDNSTTLAASVSFIDLAGSERAAQALSAGARLKEGCHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHI YRDSKLTRILQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  278  LTLGTVIRKLSKGRNGHINYRDSKLTRILQPCLGGNARTAIICTLSPARSHVEQTRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR     S     + +LK+K+  
Sbjct  338  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRTPAPVSSSSEYAALLKKKDLQ  397

Query  723  IEKMEKEMRDLMMQR  767
            IEKM KE+R+L  QR
Sbjct  398  IEKMAKEIRELTKQR  412



>emb|CDY45220.1| BnaA07g12700D [Brassica napus]
Length=1015

 Score =   373 bits (958),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 217/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD++PLRLLDDPE+GTVVEKL+E   RD +H  ELLS+CEAQRQIGET LN +SSR
Sbjct  158  DLLSTDSSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  ++      STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  218  SHQILRLTVESTAREFFTNDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  278  LTLGTVIRKLSKGKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSV-DETSSLVLKEKEA  719
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLESELR+    SV  +T++ +L EK+ 
Sbjct  338  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESELRSPGQPSVASDTTTALLTEKDL  397

Query  720  LIEKMEKEMRDLMMQ  764
             +EK++KE+  L  +
Sbjct  398  EVEKLKKEVFQLAQE  412



>gb|KDO49884.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=841

 Score =   369 bits (947),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPE+G VVEK++E + +D +HL ELLSICEAQR+IGET LN  SSR
Sbjct  40   DLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TLSA+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  100  SHQIIRLMIESSAREFLGKENSTTLSASVNFVDLAGSERASQALSTGARLKEGCHINRSL  159

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TVIRKLSKGRNGHI YRDSKLTR+LQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  160  LTLSTVIRKLSKGRNGHINYRDSKLTRMLQPCLGGNARTAIICTLSPARSHVEQTRNTLL  219

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR+    S       +L++K+  
Sbjct  220  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRSPAPASSTCDYVALLRKKDLQ  279

Query  723  IEKMEKEMRDLMMQR  767
            I+KME+E+R+L  QR
Sbjct  280  IQKMEREIRELTKQR  294



>ref|XP_002531511.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30865.1| conserved hypothetical protein [Ricinus communis]
Length=959

 Score =   372 bits (955),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 215/254 (85%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL  D TPLRLLDDPERGTVVE+L+E   RD +H  ELLS+CEAQRQIGET++N  SSR
Sbjct  152  DLLIMDTTPLRLLDDPERGTVVERLTEETLRDWNHFKELLSVCEAQRQIGETSMNETSSR  211

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++     +S L+A VNF+DLAGSERASQ+ SAG RLKEGCHINRSL
Sbjct  212  SHQILRLTMESSAREFIGNDKSSNLAATVNFVDLAGSERASQSSSAGMRLKEGCHINRSL  271

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  272  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTISPARSHVEQSRNTLL  331

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T A+VNVV+SDKALVKQLQ+ELA+LESELR+  S SV   S+ VLKEK+  
Sbjct  332  FASCAKEVSTNARVNVVVSDKALVKQLQRELARLESELRSAGSDSVTSVSTAVLKEKDLQ  391

Query  723  IEKMEKEMRDLMMQ  764
            IEK+  E+ +L  Q
Sbjct  392  IEKLMNEVVELNRQ  405



>gb|KHN00495.1| Kinesin-related protein 11 [Glycine soja]
Length=914

 Score =   371 bits (952),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPE+GTVVE+L+E   RD +H  EL+S CEAQRQIGET LN +SSR
Sbjct  106  DLLSVDSTPLRLLDDPEKGTVVERLTEETLRDWNHFQELISFCEAQRQIGETALNEVSSR  165

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++      S+LSA+VNF+DLAGSERASQT SAGTRLKEGCHINRSL
Sbjct  166  SHQILRLTIESSAREFLGNDKMSSLSASVNFVDLAGSERASQTNSAGTRLKEGCHINRSL  225

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGH+P+RDSKLTRILQ SL GNA+TAIICTMSPA SHVEQ+RNTLL
Sbjct  226  LTLGTVIRKLSKGRNGHVPFRDSKLTRILQSSLAGNAKTAIICTMSPARSHVEQTRNTLL  285

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T A+VNVV+SDK LVKQLQKELA+LESEL+      +   S+ +LKEK+  
Sbjct  286  FASCAKEVTTNAKVNVVVSDKLLVKQLQKELARLESELKNSGPTRLKFDSAALLKEKDLQ  345

Query  723  IEKMEKEMRDLMMQR  767
            IE ++KE+ D+ MQR
Sbjct  346  IEMLKKEVMDVSMQR  360



>ref|XP_006423484.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 ref|XP_006423485.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36724.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36725.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
Length=843

 Score =   369 bits (947),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPE+G VVEK++E + +D +HL ELLSICEAQR+IGET LN  SSR
Sbjct  40   DLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TLSA+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  100  SHQIIRLMIESSAREFLGKENSTTLSASVNFVDLAGSERASQALSTGARLKEGCHINRSL  159

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TVIRKLSKGRNGHI YRDSKLTR+LQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  160  LTLSTVIRKLSKGRNGHINYRDSKLTRMLQPCLGGNARTAIICTLSPARSHVEQTRNTLL  219

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR+    S       +L++K+  
Sbjct  220  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRSPAPASSTCDYVALLRKKDLQ  279

Query  723  IEKMEKEMRDLMMQR  767
            I+KME+E+R+L  QR
Sbjct  280  IQKMEREIRELTKQR  294



>ref|XP_006393829.1| hypothetical protein EUTSA_v10003607mg [Eutrema salsugineum]
 gb|ESQ31115.1| hypothetical protein EUTSA_v10003607mg [Eutrema salsugineum]
Length=947

 Score =   371 bits (953),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 213/254 (84%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD++PLRLLDDPE+GTVVEKL+E   RD +H  ELL +CEAQRQIGET LN +SSR
Sbjct  40   DLLSTDSSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLCVCEAQRQIGETALNEVSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  ++      STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  100  SHQILRLTVESTAREFFTNDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  159

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  160  LTLGTVIRKLSKGKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  219

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLESELR+     +   S+ +L EK+  
Sbjct  220  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESELRSPSQPLIASDSTALLTEKDLE  279

Query  723  IEKMEKEMRDLMMQ  764
            +EK++KE+  L  Q
Sbjct  280  VEKLKKEVVQLAQQ  293



>ref|XP_008452056.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Cucumis melo]
Length=891

 Score =   370 bits (950),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 218/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D++PLRLLDDPERGT VEKL+E   RD++H  +LLS+CEAQRQIGET+LN  SSR
Sbjct  155  DLLSVDSSPLRLLDDPERGTTVEKLTEETLRDRNHFRQLLSLCEAQRQIGETSLNEASSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +S+L+A VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  215  SHQILRLTIESSAREFLGKDKSSSLTATVNFVDLAGSERASQSLSAGARLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTL 
Sbjct  275  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPAQIHVEQSRNTLF  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVV+SDKALVKQLQ+ELA+LESEL++    S     +L+ +EK+  
Sbjct  335  FASCAKEVVTNAQVNVVVSDKALVKQLQRELARLESELKSSVQTSGTPDFALI-REKDLQ  393

Query  723  IEKMEKEMRDLMMQR  767
            IEK++K++R+L ++R
Sbjct  394  IEKLKKDLRELTLER  408



>emb|CAE03025.3| OSJNBa0091D06.23 [Oryza sativa Japonica Group]
Length=915

 Score =   370 bits (950),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 215/255 (84%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NTPLRL DD E+GT VE L+EV+ RD +HL EL+S+CEAQR+ GET LN  SSR
Sbjct  139  DLLSAENTPLRLWDDAEKGTYVENLTEVVLRDWNHLKELISVCEAQRKTGETYLNENSSR  198

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++     ++TL A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  199  SHQILKLTIESSAREFLGKDKSTTLVASVNFVDLAGSERASQALSAGARLKEGCHINRSL  258

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  259  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSHMEQSRNTLL  318

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVKQLQKELA+LESELR   S S  E+   ++KEK+  
Sbjct  319  FASCAKEVVTNAQVNVVMSDKALVKQLQKELARLESELRCPASYSSLES---LVKEKDNQ  375

Query  723  IEKMEKEMRDLMMQR  767
            I KMEKE+++L +QR
Sbjct  376  IRKMEKEIKELKLQR  390



>ref|XP_011088489.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011088490.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011088491.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011088492.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=909

 Score =   370 bits (950),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 218/254 (86%), Gaps = 3/254 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPERGT++EKL+E   RD +HL +LLS CEAQRQIGET+LN  SSR
Sbjct  160  DLLSTDNTPLRLLDDPERGTIIEKLTEETLRDWNHLKQLLSTCEAQRQIGETSLNETSSR  219

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N++TL+A+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  220  SHQILRLTIESSAREFLGKGNSTTLAASVNFVDLAGSERASQALSVGQRLKEGCHINRSL  279

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GH+ YRDSKLTRILQ +LGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  280  LTLGTVIRKLSKGRHGHVNYRDSKLTRILQPALGGNARTAIICTLSPARSHVEQSRNTLL  339

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T AQVNVVMSDKALVK LQKE+A+LESEL+   S       +++L++K+  
Sbjct  340  FASCAKEVSTNAQVNVVMSDKALVKHLQKEVARLESELKTPGSMC---DHAVLLRKKDMQ  396

Query  723  IEKMEKEMRDLMMQ  764
            IEK+EKE+R+L  Q
Sbjct  397  IEKLEKEVRELKKQ  410



>ref|XP_004509341.1| PREDICTED: kinesin-related protein 4-like isoform X4 [Cicer arietinum]
Length=960

 Score =   371 bits (953),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 213/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GTVVEKL+E   RD +H  EL+S CE QRQIGET+LN  SSR
Sbjct  156  DLLSTDSTPLRLLDDPEKGTVVEKLTEETMRDWNHFIELISFCETQRQIGETSLNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++      S+L+A+VNFIDLAGSERASQT SAG RLKEGCHINRSL
Sbjct  216  SHQILRLTIESSAREFFGNDKLSSLAASVNFIDLAGSERASQTNSAGARLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ S+GGNARTAIICTMSPA S+VEQ+RNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSIGGNARTAIICTMSPARSYVEQTRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+VAT A+VNVVMSDK LVKQLQ+ELA+LE ELR   S      S+ +L+EK+  
Sbjct  336  FACCAKEVATNAKVNVVMSDKLLVKQLQRELARLEGELRNSGSTLRKSDSAALLREKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IE ++KE+ DL  QR
Sbjct  396  IEMLKKEIMDLAFQR  410



>gb|EEC77720.1| hypothetical protein OsI_16807 [Oryza sativa Indica Group]
Length=945

 Score =   371 bits (952),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 215/255 (84%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NTPLRL DD E+GT VE L+EV+ RD +HL EL+S+CEAQR+ GET LN  SSR
Sbjct  169  DLLSAENTPLRLWDDAEKGTYVENLTEVVLRDWNHLKELISVCEAQRKTGETYLNENSSR  228

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++     ++TL A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  229  SHQILKLTIESSAREFLGKDKSTTLVASVNFVDLAGSERASQALSAGARLKEGCHINRSL  288

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  289  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSHMEQSRNTLL  348

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVKQLQKELA+LESELR   S S  E+   ++KEK+  
Sbjct  349  FASCAKEVVTNAQVNVVMSDKALVKQLQKELARLESELRCPASYSSLES---LVKEKDNQ  405

Query  723  IEKMEKEMRDLMMQR  767
            I KMEKE+++L +QR
Sbjct  406  IRKMEKEIKELKLQR  420



>emb|CDY30779.1| BnaC07g16790D [Brassica napus]
Length=989

 Score =   372 bits (954),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 190/257 (74%), Positives = 217/257 (84%), Gaps = 4/257 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD++PLRLLDDPE+GTVVEKL+E   RD +H  ELLS+CEAQRQIGET LN +SSR
Sbjct  158  DLLSTDSSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  ++      STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  218  SHQILRLTVESTAREFFTNDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  278  LTLGTVIRKLSKGKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSV---DETSSLVLKEK  713
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLESELR+    SV   D T++L L EK
Sbjct  338  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESELRSPGQPSVVASDATTAL-LTEK  396

Query  714  EALIEKMEKEMRDLMMQ  764
            +  +EK++KE+  L  +
Sbjct  397  DLEVEKLKKEVFQLAQE  413



>ref|XP_009398104.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398105.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398106.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=957

 Score =   371 bits (952),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 217/255 (85%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+  LRLLDDPE+GTV+EKL+E   +D +HL  L+S+CEAQR+IGET+LN  SSR
Sbjct  169  DLLSTDSGHLRLLDDPEKGTVIEKLTEETLKDWNHLKALISVCEAQRKIGETSLNETSSR  228

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+STL A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  229  SHQILRLTIESSAQEFLGKDNSSTLVASVNFVDLAGSERASQALSAGARLKEGCHINRSL  288

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGH+PYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQS+NTLL
Sbjct  289  LTLGTVIRKLSKGRNGHVPYRDSKLTRILQPSLGGNARTAIICTMSPAISHIEQSKNTLL  348

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQKELA+LE+ELR      +  +   +L+EK+A 
Sbjct  349  FASCAKEVVTSAQVNVVMSDKALVKHLQKELARLETELRY---PGISPSIEALLREKDAQ  405

Query  723  IEKMEKEMRDLMMQR  767
            I+KME E+++L+ QR
Sbjct  406  IKKMESEIQELIQQR  420



>ref|XP_008448048.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
 ref|XP_008448049.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
 ref|XP_008448050.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
Length=930

 Score =   370 bits (950),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDD ERGT+VEK++E   RD +HL EL+SICEAQR+IGET+LN  SSR
Sbjct  158  DLLSTDTSPLRLLDDQERGTIVEKVTEETLRDWNHLRELISICEAQRRIGETSLNEKSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI++LTIESS  ++    N++TL+A+V+FIDLAGSERA+Q LSAG RLKEGCHINRSL
Sbjct  218  SHQIIKLTIESSAREFLGKDNSTTLAASVSFIDLAGSERAAQALSAGARLKEGCHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHI YRDSKLTRILQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  278  LTLGTVIRKLSKGRNGHINYRDSKLTRILQPCLGGNARTAIICTLSPARSHVEQTRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR     S     + +LK+K+  
Sbjct  338  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRTPAPVSSSSEYAALLKKKDLQ  397

Query  723  IEKMEKEMRDLMMQR  767
            IEKM KE+R+L  QR
Sbjct  398  IEKMAKEIRELTKQR  412



>ref|XP_004974129.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Setaria 
italica]
 ref|XP_004974130.1| PREDICTED: kinesin-like protein NACK1-like isoform X4 [Setaria 
italica]
Length=1028

 Score =   372 bits (956),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPE+GT VE+L+E   RD  HL +LL++CEAQRQIGET LN  SSR
Sbjct  149  DLLSHDSTPLRLLDDPEKGTTVERLTEETLRDYDHLRDLLAVCEAQRQIGETALNETSSR  208

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESST QY    N+STL A VNF+DLAGSERASQT SAG RLKEG HINRSL
Sbjct  209  SHQILRLTIESSTRQYLGRGNSSTLVACVNFVDLAGSERASQTASAGMRLKEGSHINRSL  268

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG V+R+LSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPAH+H+EQSRNTLL
Sbjct  269  LTLGKVVRQLSKGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPAHTHIEQSRNTLL  328

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK+V T A VNVVMSDKALVK LQ+ELA+LE+EL+   S S   T +  L+EK+A 
Sbjct  329  FATCAKEVITNAHVNVVMSDKALVKHLQRELARLENELKFPGSASC-TTHTEALREKDAQ  387

Query  723  IEKMEKEMRDLMMQR  767
            I+K+EK++++LM +R
Sbjct  388  IKKLEKQLKELMEER  402



>ref|XP_003519876.1| PREDICTED: kinesin-like protein NACK1-like [Glycine max]
Length=949

 Score =   370 bits (951),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPE+GTVVE+L+E   RD +H  EL+S CEAQRQIGET LN +SSR
Sbjct  156  DLLSVDSTPLRLLDDPEKGTVVERLTEETLRDWNHFQELISFCEAQRQIGETALNEVSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++      S+LSA+VNF+DLAGSERASQT SAGTRLKEGCHINRSL
Sbjct  216  SHQILRLTIESSAREFLGNDKMSSLSASVNFVDLAGSERASQTNSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGH+P+RDSKLTRILQ SL GNA+TAIICTMSPA SHVEQ+RNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHVPFRDSKLTRILQSSLAGNAKTAIICTMSPARSHVEQTRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T A+VNVV+SDK LVKQLQKELA+LESEL+      +   S+ +LKEK+  
Sbjct  336  FASCAKEVTTNAKVNVVVSDKLLVKQLQKELARLESELKNSGPTRLKFDSAALLKEKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IE ++KE+ D+ MQR
Sbjct  396  IEMLKKEVMDVSMQR  410



>ref|XP_006661465.1| PREDICTED: kinesin-like protein NACK2-like [Oryza brachyantha]
Length=881

 Score =   369 bits (947),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 215/255 (84%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPE+GTVVEKL+E   RD+ HL ELL++CEAQRQIGET LN  SSR
Sbjct  159  DLLSPDATPLRLLDDPEKGTVVEKLTEETLRDKGHLLELLAVCEAQRQIGETALNEASSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  Q+    N+STL A VNF+DLAGSERASQT SAG RLKEG HINRSL
Sbjct  219  SHQILRLTVESSAKQFLGRGNSSTLLACVNFVDLAGSERASQTASAGMRLKEGSHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG VIR+LSKGRNGHIPYRDSKLTRILQ SLGGNA+TAIICTMSPAH H+EQSRNTLL
Sbjct  279  LTLGKVIRQLSKGRNGHIPYRDSKLTRILQSSLGGNAKTAIICTMSPAHCHIEQSRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK V T AQVNVVMSDKALVK LQ+E+A+LE+EL+   S S   + + +L+EK+ L
Sbjct  339  FANCAKDVVTNAQVNVVMSDKALVKHLQREIARLENELKFPGSASC-ASHAEILREKDEL  397

Query  723  IEKMEKEMRDLMMQR  767
            I+K+E+++++LM Q+
Sbjct  398  IKKLEEQLKELMEQK  412



>ref|XP_004974127.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Setaria 
italica]
Length=1045

 Score =   372 bits (956),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPE+GT VE+L+E   RD  HL +LL++CEAQRQIGET LN  SSR
Sbjct  166  DLLSHDSTPLRLLDDPEKGTTVERLTEETLRDYDHLRDLLAVCEAQRQIGETALNETSSR  225

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESST QY    N+STL A VNF+DLAGSERASQT SAG RLKEG HINRSL
Sbjct  226  SHQILRLTIESSTRQYLGRGNSSTLVACVNFVDLAGSERASQTASAGMRLKEGSHINRSL  285

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG V+R+LSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPAH+H+EQSRNTLL
Sbjct  286  LTLGKVVRQLSKGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPAHTHIEQSRNTLL  345

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK+V T A VNVVMSDKALVK LQ+ELA+LE+EL+   S S   T +  L+EK+A 
Sbjct  346  FATCAKEVITNAHVNVVMSDKALVKHLQRELARLENELKFPGSASC-TTHTEALREKDAQ  404

Query  723  IEKMEKEMRDLMMQR  767
            I+K+EK++++LM +R
Sbjct  405  IKKLEKQLKELMEER  419



>ref|XP_009760421.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
 ref|XP_009760422.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
 ref|XP_009760423.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
Length=929

 Score =   370 bits (950),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 214/255 (84%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL +D TPLRLLDDPE+GT++EKL+E   RD  HL ELLSICEAQRQIGET LN  SSR
Sbjct  160  DLLGSDTTPLRLLDDPEKGTIIEKLTEETLRDWDHLKELLSICEAQRQIGETYLNENSSR  219

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N +TLSA+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  220  SHQILRLTIESSAREFIGKDNKTTLSASVNFVDLAGSERASQALSVGQRLKEGCHINRSL  279

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GH+ YRDSKLTRILQ +LGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  280  LTLGTVIRKLSKGRQGHVNYRDSKLTRILQPALGGNARTAIICTLSPARSHVEQSRNTLL  339

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V+T AQVNVVMSDKALVK LQKELA+LESEL+   + + D  S  +L++K+  
Sbjct  340  FACCAKEVSTNAQVNVVMSDKALVKHLQKELARLESELKT-PTTTCDHVS--LLRKKDQQ  396

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+R+L  QR
Sbjct  397  IEKLEKEVRELTKQR  411



>ref|NP_001053433.1| Os04g0538800 [Oryza sativa Japonica Group]
 emb|CAE02777.2| OSJNBa0011L07.1 [Oryza sativa Japonica Group]
 dbj|BAF15347.1| Os04g0538800 [Oryza sativa Japonica Group]
 dbj|BAG95469.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61418.1| hypothetical protein OsJ_15615 [Oryza sativa Japonica Group]
Length=945

 Score =   370 bits (951),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 215/255 (84%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NTPLRL DD E+GT VE L+EV+ RD +HL EL+S+CEAQR+ GET LN  SSR
Sbjct  169  DLLSAENTPLRLWDDAEKGTYVENLTEVVLRDWNHLKELISVCEAQRKTGETYLNENSSR  228

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++     ++TL A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  229  SHQILKLTIESSAREFLGKDKSTTLVASVNFVDLAGSERASQALSAGARLKEGCHINRSL  288

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  289  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSHMEQSRNTLL  348

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVKQLQKELA+LESELR   S S  E+   ++KEK+  
Sbjct  349  FASCAKEVVTNAQVNVVMSDKALVKQLQKELARLESELRCPASYSSLES---LVKEKDNQ  405

Query  723  IEKMEKEMRDLMMQR  767
            I KMEKE+++L +QR
Sbjct  406  IRKMEKEIKELKLQR  420



>ref|XP_006281818.1| hypothetical protein CARUB_v10028003mg [Capsella rubella]
 gb|EOA14716.1| hypothetical protein CARUB_v10028003mg [Capsella rubella]
Length=1049

 Score =   373 bits (957),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/254 (74%), Positives = 213/254 (84%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E    D +H  ELLS+CEAQRQIGET LN +SSR
Sbjct  154  DLLSTDTSPLRLLDDPEKGTVVEKLTEETLLDWNHFKELLSVCEAQRQIGETALNEVSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+   +S     STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  214  SHQILRLTVESTARDFSTNDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  274  LTLGTVIRKLSKGKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLESELR+    S+   ++ +L EK+  
Sbjct  334  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESELRSPGQASIVSNTTALLTEKDLE  393

Query  723  IEKMEKEMRDLMMQ  764
            +EK++KE+  L  Q
Sbjct  394  VEKLKKEVFQLAQQ  407



>ref|XP_004974128.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Setaria 
italica]
Length=1044

 Score =   372 bits (956),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 216/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPE+GT VE+L+E   RD  HL +LL++CEAQRQIGET LN  SSR
Sbjct  166  DLLSHDSTPLRLLDDPEKGTTVERLTEETLRDYDHLRDLLAVCEAQRQIGETALNETSSR  225

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESST QY    N+STL A VNF+DLAGSERASQT SAG RLKEG HINRSL
Sbjct  226  SHQILRLTIESSTRQYLGRGNSSTLVACVNFVDLAGSERASQTASAGMRLKEGSHINRSL  285

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG V+R+LSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPAH+H+EQSRNTLL
Sbjct  286  LTLGKVVRQLSKGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPAHTHIEQSRNTLL  345

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK+V T A VNVVMSDKALVK LQ+ELA+LE+EL+   S S   T +  L+EK+A 
Sbjct  346  FATCAKEVITNAHVNVVMSDKALVKHLQRELARLENELKFPGSASC-TTHTEALREKDAQ  404

Query  723  IEKMEKEMRDLMMQR  767
            I+K+EK++++LM +R
Sbjct  405  IKKLEKQLKELMEER  419



>ref|XP_009336747.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=1073

 Score =   373 bits (958),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 220/255 (86%), Gaps = 8/255 (3%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+++  LRLLDDPE+GTVVEKLSE + RD++HL ELLS+CEAQR+IGET+LN  SSR
Sbjct  140  DLLSSESAQLRLLDDPEKGTVVEKLSEEILRDRNHLEELLSVCEAQRKIGETSLNETSSR  199

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +Y   +++STL+A VNF+DLAGSER SQ LSAG RLKEGCHINRSL
Sbjct  200  SHQILRLTIESSAREYLGIQSSSTLAATVNFVDLAGSERVSQALSAGMRLKEGCHINRSL  259

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGH+PYRDSKLTRILQ+SLGGNARTAIICT+SPA SHVEQS+NTL 
Sbjct  260  LTLGTVIRKLSKGKNGHVPYRDSKLTRILQNSLGGNARTAIICTLSPARSHVEQSKNTLF  319

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T A+VNVV SDKALVKQLQKELAK+E  LR+L S+S        ++EKE L
Sbjct  320  FASCAKEVTTNAKVNVVRSDKALVKQLQKELAKMEDALRSLASKS--------MQEKELL  371

Query  723  IEKMEKEMRDLMMQR  767
            +E+M+KE+++L  QR
Sbjct  372  LEQMDKEIKELTQQR  386



>ref|NP_001063734.2| Os09g0528000 [Oryza sativa Japonica Group]
 dbj|BAD46370.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAG93071.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF25648.2| Os09g0528000 [Oryza sativa Japonica Group]
Length=862

 Score =   368 bits (945),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 215/255 (84%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D TPLRLLDDPE+GTVVEKL+E   RD+ HL ELL++CEAQRQIGET +N  SSR
Sbjct  144  DLLSSDATPLRLLDDPEKGTVVEKLTEETLRDKGHLLELLAVCEAQRQIGETAMNEASSR  203

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILR+T+ESS  Q+    N+STL A VNF+DLAGSERASQT SAG RLKEG HINRSL
Sbjct  204  SHQILRMTVESSAKQFLGKGNSSTLIACVNFVDLAGSERASQTASAGMRLKEGSHINRSL  263

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG VIR+LSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPAH H+EQSRNTLL
Sbjct  264  LTLGKVIRQLSKGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPAHCHIEQSRNTLL  323

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK V T AQVNVVMSDKALVK LQ+E+A+LE+EL+   S S   + + +L+EK+ L
Sbjct  324  FANCAKDVVTNAQVNVVMSDKALVKHLQREIARLENELKFPASASCT-SHAEILREKDEL  382

Query  723  IEKMEKEMRDLMMQR  767
            I+ +E+++++LM Q+
Sbjct  383  IKNLEEQLKELMEQK  397



>ref|XP_004509338.1| PREDICTED: kinesin-related protein 4-like isoform X1 [Cicer arietinum]
 ref|XP_004509339.1| PREDICTED: kinesin-related protein 4-like isoform X2 [Cicer arietinum]
 ref|XP_004509340.1| PREDICTED: kinesin-related protein 4-like isoform X3 [Cicer arietinum]
Length=985

 Score =   371 bits (953),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 213/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GTVVEKL+E   RD +H  EL+S CE QRQIGET+LN  SSR
Sbjct  181  DLLSTDSTPLRLLDDPEKGTVVEKLTEETMRDWNHFIELISFCETQRQIGETSLNEASSR  240

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++      S+L+A+VNFIDLAGSERASQT SAG RLKEGCHINRSL
Sbjct  241  SHQILRLTIESSAREFFGNDKLSSLAASVNFIDLAGSERASQTNSAGARLKEGCHINRSL  300

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ S+GGNARTAIICTMSPA S+VEQ+RNTLL
Sbjct  301  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSIGGNARTAIICTMSPARSYVEQTRNTLL  360

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+VAT A+VNVVMSDK LVKQLQ+ELA+LE ELR   S      S+ +L+EK+  
Sbjct  361  FACCAKEVATNAKVNVVMSDKLLVKQLQRELARLEGELRNSGSTLRKSDSAALLREKDLQ  420

Query  723  IEKMEKEMRDLMMQR  767
            IE ++KE+ DL  QR
Sbjct  421  IEMLKKEIMDLAFQR  435



>ref|XP_010465682.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=1039

 Score =   372 bits (955),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/254 (73%), Positives = 213/254 (84%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E   RD +H  ELLS+CEAQRQIGET LN +SSR
Sbjct  155  DLLSTDTSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILR T+ESS  ++S     STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  215  SHQILRFTVESSAREFSTSDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  275  LTLGTVIRKLSKGKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+VMSDKALVK LQ+ELAKLESELR+    S+   ++ +L EK+  
Sbjct  335  FASCAKEVTTNAQVNIVMSDKALVKHLQRELAKLESELRSPGQASIVSDTTALLTEKDLE  394

Query  723  IEKMEKEMRDLMMQ  764
            +EK++ E+  L  +
Sbjct  395  VEKLKIEVFQLAQE  408



>ref|XP_009407965.1| PREDICTED: kinesin-like protein NACK2 [Musa acuminata subsp. 
malaccensis]
Length=959

 Score =   370 bits (950),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 216/255 (85%), Gaps = 4/255 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D +PLRLLDDPERGT+VEKL+E   RD++HL ELLS CEAQRQ GET+LN MSSR
Sbjct  161  DLLSMDGSPLRLLDDPERGTIVEKLTEETLRDENHLKELLSTCEAQRQTGETSLNEMSSR  220

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  +  +  ++STL+A VNF+DLAGSERASQT   G RLKEGCHINRSL
Sbjct  221  SHQILRLTIESSARELLNRNSSSTLAATVNFVDLAGSERASQT---GARLKEGCHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ SLGGN+RTAIICTMSPA SH+EQSRNTLL
Sbjct  278  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQSSLGGNSRTAIICTMSPARSHIEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAKQV T AQVNVVMSDKALVK LQ+E+ +LESEL+   S S   +    L++K+A 
Sbjct  338  FASCAKQVVTNAQVNVVMSDKALVKHLQREVFRLESELKYPGSASCS-SHFEALRDKDAQ  396

Query  723  IEKMEKEMRDLMMQR  767
            IEKME+E+++L+ QR
Sbjct  397  IEKMEREIKELIQQR  411



>gb|KDO49883.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=920

 Score =   369 bits (947),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPE+G VVEK++E + +D +HL ELLSICEAQR+IGET LN  SSR
Sbjct  119  DLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSSR  178

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TLSA+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  179  SHQIIRLMIESSAREFLGKENSTTLSASVNFVDLAGSERASQALSTGARLKEGCHINRSL  238

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TVIRKLSKGRNGHI YRDSKLTR+LQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  239  LTLSTVIRKLSKGRNGHINYRDSKLTRMLQPCLGGNARTAIICTLSPARSHVEQTRNTLL  298

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR+    S       +L++K+  
Sbjct  299  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRSPAPASSTCDYVALLRKKDLQ  358

Query  723  IEKMEKEMRDLMMQR  767
            I+KME+E+R+L  QR
Sbjct  359  IQKMEREIRELTKQR  373



>ref|XP_010531480.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010531481.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010531482.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
Length=830

 Score =   367 bits (941),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 217/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D TPLRL DDPE+GT+VEK +E + RD +HL +LLSICEAQR+IGET+LN  SSR
Sbjct  159  DLLSSDGTPLRLRDDPEKGTIVEKATEEILRDWNHLKDLLSICEAQRKIGETSLNERSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLT+ESS  ++    N++TL+A+VNFIDLAGSERASQ +SAG RLKEGCHINRSL
Sbjct  219  SHQIIRLTVESSAREFLGKENSTTLTASVNFIDLAGSERASQAMSAGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GHI YRDSKLTRILQ  LGGNARTAI+CT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSKGRQGHINYRDSKLTRILQPCLGGNARTAIVCTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQ+NVVMSDKALVK LQ+ELA+LESELR     +++   ++VL++K+  
Sbjct  339  FACCAKEVTTKAQINVVMSDKALVKHLQQELARLESELRNPAPAALNCDCAVVLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEK++ +L  QR
Sbjct  399  IQKMEKQIEELTKQR  413



>ref|XP_004160983.1| PREDICTED: uncharacterized LOC101218717 [Cucumis sativus]
Length=992

 Score =   370 bits (951),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 217/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D++PLRLLDDPERGT VEKL+E   RD +H  +LLS+CEAQRQIGET+LN  SSR
Sbjct  155  DLLSVDSSPLRLLDDPERGTTVEKLTEETLRDWNHFRQLLSLCEAQRQIGETSLNEASSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +S+L+A VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  215  SHQILRLTIESSAREFLGKDKSSSLTATVNFVDLAGSERASQSLSAGARLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTL 
Sbjct  275  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPAQIHVEQSRNTLF  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVV+SDKALVKQLQ+ELA+LESEL++    S     +L+ +EK+  
Sbjct  335  FASCAKEVVTNAQVNVVVSDKALVKQLQRELARLESELKSTVQTSGTPDFALI-REKDLQ  393

Query  723  IEKMEKEMRDLMMQR  767
            IEK++K++R+L ++R
Sbjct  394  IEKLKKDLRELTLER  408



>gb|KGN53326.1| hypothetical protein Csa_4G047870 [Cucumis sativus]
Length=993

 Score =   370 bits (951),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 217/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D++PLRLLDDPERGT VEKL+E   RD +H  +LLS+CEAQRQIGET+LN  SSR
Sbjct  155  DLLSVDSSPLRLLDDPERGTTVEKLTEETLRDWNHFRQLLSLCEAQRQIGETSLNEASSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +S+L+A VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  215  SHQILRLTIESSAREFLGKDKSSSLTATVNFVDLAGSERASQSLSAGARLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTL 
Sbjct  275  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPAQIHVEQSRNTLF  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVV+SDKALVKQLQ+ELA+LESEL++    S     +L+ +EK+  
Sbjct  335  FASCAKEVVTNAQVNVVVSDKALVKQLQRELARLESELKSTVQTSGTPDFALI-REKDLQ  393

Query  723  IEKMEKEMRDLMMQR  767
            IEK++K++R+L ++R
Sbjct  394  IEKLKKDLRELTLER  408



>ref|XP_006659658.1| PREDICTED: kinesin-like protein NACK2-like [Oryza brachyantha]
Length=998

 Score =   370 bits (951),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 214/255 (84%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPE+GT VEKL+E   RD+ HL +LL++CEAQRQIGET LN  SSR
Sbjct  154  DLLSHDTTPLRLLDDPEKGTTVEKLTEETLRDKEHLRDLLAVCEAQRQIGETALNETSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  QY    N+STL A VNF+DLAGSERASQT SAG RLKEG HINRSL
Sbjct  214  SHQILRLTIESSARQYLGRGNSSTLVACVNFVDLAGSERASQTASAGVRLKEGSHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG V+R+LSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  274  LTLGKVVRQLSKGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPARSHIEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK+V T AQVNVVMSDKALVK LQ+ELA+LESE++   S S   T +  L+EK+  
Sbjct  334  FATCAKEVVTNAQVNVVMSDKALVKHLQRELARLESEMKFPGSASC-TTHAEALREKDTQ  392

Query  723  IEKMEKEMRDLMMQR  767
            I+K+EK++++LM +R
Sbjct  393  IKKLEKQLKELMEER  407



>ref|XP_004146557.1| PREDICTED: uncharacterized protein LOC101218717 [Cucumis sativus]
Length=1000

 Score =   370 bits (951),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 217/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D++PLRLLDDPERGT VEKL+E   RD +H  +LLS+CEAQRQIGET+LN  SSR
Sbjct  162  DLLSVDSSPLRLLDDPERGTTVEKLTEETLRDWNHFRQLLSLCEAQRQIGETSLNEASSR  221

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +S+L+A VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  222  SHQILRLTIESSAREFLGKDKSSSLTATVNFVDLAGSERASQSLSAGARLKEGCHINRSL  281

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTL 
Sbjct  282  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPAQIHVEQSRNTLF  341

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVV+SDKALVKQLQ+ELA+LESEL++    S     +L+ +EK+  
Sbjct  342  FASCAKEVVTNAQVNVVVSDKALVKQLQRELARLESELKSTVQTSGTPDFALI-REKDLQ  400

Query  723  IEKMEKEMRDLMMQR  767
            IEK++K++R+L ++R
Sbjct  401  IEKLKKDLRELTLER  415



>gb|KDO49879.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
 gb|KDO49880.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
 gb|KDO49881.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
 gb|KDO49882.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=960

 Score =   370 bits (949),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPE+G VVEK++E + +D +HL ELLSICEAQR+IGET LN  SSR
Sbjct  159  DLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TLSA+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  219  SHQIIRLMIESSAREFLGKENSTTLSASVNFVDLAGSERASQALSTGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TVIRKLSKGRNGHI YRDSKLTR+LQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLSTVIRKLSKGRNGHINYRDSKLTRMLQPCLGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR+    S       +L++K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRSPAPASSTCDYVALLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KME+E+R+L  QR
Sbjct  399  IQKMEREIRELTKQR  413



>ref|XP_006487385.1| PREDICTED: kinesin-like protein NACK1-like isoform X9 [Citrus 
sinensis]
Length=960

 Score =   370 bits (949),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPE+G VVEK++E + +D +HL ELLSICEAQR+IGET LN  SSR
Sbjct  159  DLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TLSA+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  219  SHQIIRLMIESSAREFLGKENSTTLSASVNFVDLAGSERASQALSTGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TVIRKLSKGRNGHI YRDSKLTR+LQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLSTVIRKLSKGRNGHINYRDSKLTRMLQPCLGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR+    S       +L++K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRSPAPASSTCDYVALLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KME+E+R+L  QR
Sbjct  399  IQKMEREIRELTKQR  413



>ref|XP_007157943.1| hypothetical protein PHAVU_002G111200g [Phaseolus vulgaris]
 gb|ESW29937.1| hypothetical protein PHAVU_002G111200g [Phaseolus vulgaris]
Length=963

 Score =   369 bits (948),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 213/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPERGTVVEKL+E   RD  H  EL+S  EAQRQIGET LN  SSR
Sbjct  156  DLLSPDCTPLRLLDDPERGTVVEKLTEETLRDWEHFIELISFSEAQRQIGETALNEASSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +S+LSA+VNF+DLAGSERASQT SAGTRLKEGCHINRSL
Sbjct  216  SHQILRLTIESSACEFLGNDKSSSLSASVNFVDLAGSERASQTNSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGH P+RDSKLTRILQ SLGGNARTAIICTMSPA SHVEQ+RNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHFPFRDSKLTRILQSSLGGNARTAIICTMSPARSHVEQTRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVV+SDKALV+QLQKELA+LE ELR      V   ++ VL+E++  
Sbjct  336  FASCAKEVTTNAQVNVVVSDKALVRQLQKELARLEEELRNSGPPHVTSDTASVLRERDRQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IE ++KE+++L +QR
Sbjct  396  IEMLKKEVKELTLQR  410



>ref|XP_006487377.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487378.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006487379.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Citrus 
sinensis]
 ref|XP_006487380.1| PREDICTED: kinesin-like protein NACK1-like isoform X4 [Citrus 
sinensis]
 ref|XP_006487381.1| PREDICTED: kinesin-like protein NACK1-like isoform X5 [Citrus 
sinensis]
 ref|XP_006487382.1| PREDICTED: kinesin-like protein NACK1-like isoform X6 [Citrus 
sinensis]
 ref|XP_006487383.1| PREDICTED: kinesin-like protein NACK1-like isoform X7 [Citrus 
sinensis]
 ref|XP_006487384.1| PREDICTED: kinesin-like protein NACK1-like isoform X8 [Citrus 
sinensis]
Length=962

 Score =   369 bits (948),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPE+G VVEK++E + +D +HL ELLSICEAQR+IGET LN  SSR
Sbjct  159  DLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TLSA+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  219  SHQIIRLMIESSAREFLGKENSTTLSASVNFVDLAGSERASQALSTGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TVIRKLSKGRNGHI YRDSKLTR+LQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLSTVIRKLSKGRNGHINYRDSKLTRMLQPCLGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR+    S       +L++K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRSPAPASSTCDYVALLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KME+E+R+L  QR
Sbjct  399  IQKMEREIRELTKQR  413



>gb|AET03829.2| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=1139

 Score =   373 bits (957),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 218/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPE+GTVVEKL+E   RD +H +EL+S CE QRQIGET+LN +SSR
Sbjct  156  DLLSNDTTPLRLLDDPEKGTVVEKLTEETLRDWNHFTELISFCETQRQIGETSLNEVSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILR+TIESS  ++     +S L+A+VNF+DLAGSERASQT SAGTRLKEGCHINRSL
Sbjct  216  SHQILRMTIESSAREFLGNYKSSALAASVNFVDLAGSERASQTNSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ S+GGNARTAIICTMSPA S+VEQ+RNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSIGGNARTAIICTMSPARSYVEQTRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T A+VNVV+SDK+LVKQLQ+ELA+LESEL+   S      S+ +L+EK+  
Sbjct  336  FASCAKEVSTNAKVNVVVSDKSLVKQLQRELARLESELKKSGSTQRKPDSAELLREKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            IE ++KE+ DL MQR
Sbjct  396  IEMLKKEIMDLAMQR  410



>ref|XP_006423482.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 ref|XP_006423483.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 ref|XP_006423486.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36722.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36723.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36726.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
Length=962

 Score =   369 bits (948),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPE+G VVEK++E + +D +HL ELLSICEAQR+IGET LN  SSR
Sbjct  159  DLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TLSA+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  219  SHQIIRLMIESSAREFLGKENSTTLSASVNFVDLAGSERASQALSTGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TVIRKLSKGRNGHI YRDSKLTR+LQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLSTVIRKLSKGRNGHINYRDSKLTRMLQPCLGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR+    S       +L++K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRSPAPASSTCDYVALLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KME+E+R+L  QR
Sbjct  399  IQKMEREIRELTKQR  413



>ref|XP_006423481.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36721.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
Length=960

 Score =   369 bits (948),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRLLDDPE+G VVEK++E + +D +HL ELLSICEAQR+IGET LN  SSR
Sbjct  159  DLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RL IESS  ++    N++TLSA+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  219  SHQIIRLMIESSAREFLGKENSTTLSASVNFVDLAGSERASQALSTGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TVIRKLSKGRNGHI YRDSKLTR+LQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLSTVIRKLSKGRNGHINYRDSKLTRMLQPCLGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR+    S       +L++K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRSPAPASSTCDYVALLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KME+E+R+L  QR
Sbjct  399  IQKMEREIRELTKQR  413



>gb|ABB45845.1| hypothetical protein [Eutrema halophilum]
Length=1061

 Score =   371 bits (953),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 213/254 (84%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD++PLRLLDDPE+GTVVEKL+E   RD +H  ELL +CEAQRQIGET LN +SSR
Sbjct  154  DLLSTDSSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLCVCEAQRQIGETALNEVSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  ++      STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  214  SHQILRLTVESTAREFFTNDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  274  LTLGTVIRKLSKGKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLESELR+     +   S+ +L EK+  
Sbjct  334  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESELRSPSQPLIASDSTALLTEKDLE  393

Query  723  IEKMEKEMRDLMMQ  764
            +EK++KE+  L  Q
Sbjct  394  VEKLKKEVVQLAQQ  407



>ref|XP_007156119.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
 ref|XP_007156120.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
 gb|ESW28113.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
 gb|ESW28114.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
Length=961

 Score =   369 bits (947),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPE+GTVVE+L+E   R+ +H  EL+  CEAQRQIGET LN +SSR
Sbjct  156  DLLSVDSTPLRLLDDPEKGTVVERLTEETLRNWNHFQELIFFCEAQRQIGETALNEVSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS +++      S+L+A+VNF+DLAGSERASQT S GTRLKEGCHINRSL
Sbjct  216  SHQILRLTVESSASEFMGNDKMSSLAASVNFVDLAGSERASQTNSGGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SL GNA+TAIICTMSPA SHVEQ+RNTLL
Sbjct  276  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLAGNAKTAIICTMSPARSHVEQTRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T A+VNVVMSDK LVKQLQKELA+LES+L+      +   +S +LKEK+ L
Sbjct  336  FASCAKEVTTNAKVNVVMSDKLLVKQLQKELARLESDLKNSGPTCLKPDTSALLKEKDLL  395

Query  723  IEKMEKEMRDLMMQR  767
            IE +++E+ DL MQR
Sbjct  396  IEMLKREVMDLRMQR  410



>ref|XP_003629353.1| Kinesin heavy chain DNA binding protein-like protein [Medicago 
truncatula]
Length=1167

 Score =   373 bits (958),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 218/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPE+GTVVEKL+E   RD +H +EL+S CE QRQIGET+LN +SSR
Sbjct  184  DLLSNDTTPLRLLDDPEKGTVVEKLTEETLRDWNHFTELISFCETQRQIGETSLNEVSSR  243

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILR+TIESS  ++     +S L+A+VNF+DLAGSERASQT SAGTRLKEGCHINRSL
Sbjct  244  SHQILRMTIESSAREFLGNYKSSALAASVNFVDLAGSERASQTNSAGTRLKEGCHINRSL  303

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ S+GGNARTAIICTMSPA S+VEQ+RNTLL
Sbjct  304  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSIGGNARTAIICTMSPARSYVEQTRNTLL  363

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T A+VNVV+SDK+LVKQLQ+ELA+LESEL+   S      S+ +L+EK+  
Sbjct  364  FASCAKEVSTNAKVNVVVSDKSLVKQLQRELARLESELKKSGSTQRKPDSAELLREKDLQ  423

Query  723  IEKMEKEMRDLMMQR  767
            IE ++KE+ DL MQR
Sbjct  424  IEMLKKEIMDLAMQR  438



>ref|XP_003607070.1| Kinesin-related protein [Medicago truncatula]
 gb|AES89267.1| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=853

 Score =   366 bits (940),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 211/255 (83%), Gaps = 2/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRL DDPERG V+EKL+E   +D  H  ELLS CEAQRQ+GET LN  SSR
Sbjct  159  DLLSTDNTPLRLRDDPERGPVLEKLTEETLQDWGHFQELLSFCEAQRQVGETYLNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIESS  ++    N++TLSA+VNF+DLAGSERASQ  SAG RLKEGCHINRSL
Sbjct  219  SHQIIRLTIESSAREFLGKGNSTTLSASVNFVDLAGSERASQVSSAGVRLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TVIRKLSKGR GHI YRDSKLTRILQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLSTVIRKLSKGRQGHINYRDSKLTRILQPCLGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVKQLQKELA+LE EL+   + + D  +  +L++K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKQLQKELARLEGELKTPATSNTDYVA--LLRKKDQQ  396

Query  723  IEKMEKEMRDLMMQR  767
            IEKM+KE+R+L  QR
Sbjct  397  IEKMDKEIRELTKQR  411



>ref|XP_008452051.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452052.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452053.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452054.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452055.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
Length=993

 Score =   369 bits (948),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 218/255 (85%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D++PLRLLDDPERGT VEKL+E   RD++H  +LLS+CEAQRQIGET+LN  SSR
Sbjct  155  DLLSVDSSPLRLLDDPERGTTVEKLTEETLRDRNHFRQLLSLCEAQRQIGETSLNEASSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++     +S+L+A VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  215  SHQILRLTIESSAREFLGKDKSSSLTATVNFVDLAGSERASQSLSAGARLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTL 
Sbjct  275  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPAQIHVEQSRNTLF  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVV+SDKALVKQLQ+ELA+LESEL++    S     +L+ +EK+  
Sbjct  335  FASCAKEVVTNAQVNVVVSDKALVKQLQRELARLESELKSSVQTSGTPDFALI-REKDLQ  393

Query  723  IEKMEKEMRDLMMQR  767
            IEK++K++R+L ++R
Sbjct  394  IEKLKKDLRELTLER  408



>ref|XP_010672217.1| PREDICTED: kinesin-like protein NACK2 [Beta vulgaris subsp. vulgaris]
Length=1052

 Score =   370 bits (951),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 188/255 (74%), Positives = 212/255 (83%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D  PLRLLDDPERGTVVEKL E    D+SHL EL+++CEAQRQ GET LN  SSR
Sbjct  159  DLLSADTNPLRLLDDPERGTVVEKLIEETLEDKSHLLELIAVCEAQRQTGETNLNETSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  Q+    N+S L+A VNF+DLAGSER SQTL+ G RLKEG HINRSL
Sbjct  219  SHQILRLTVESSARQFGGG-NSSILAANVNFVDLAGSERTSQTLATGARLKEGSHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG VIR LSKGRNGHIPYRDSKLTRILQ+SLGGNARTAIICTMSPAHSH+EQSRNTLL
Sbjct  278  LTLGKVIRTLSKGRNGHIPYRDSKLTRILQNSLGGNARTAIICTMSPAHSHLEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVKQL+KELAKLESEL+ + +       + VL+EKE  
Sbjct  338  FASCAKEVTTNAQVNVVMSDKALVKQLRKELAKLESELKTISTVPSKGDVAAVLREKELQ  397

Query  723  IEKMEKEMRDLMMQR  767
            IEKM+KE+++L  QR
Sbjct  398  IEKMDKEIKELSRQR  412



>dbj|BAB10710.1| kinesin heavy chain DNA binding protein-like [Arabidopsis thaliana]
Length=1037

 Score =   370 bits (950),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 213/254 (84%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E   RD +H  ELLS+C+AQRQIGET LN +SSR
Sbjct  155  DLLSTDTSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCKAQRQIGETALNEVSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES   ++S     STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  215  SHQILRLTVESIAREFSTNDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK + GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  275  LTLGTVIRKLSKEKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLESELR+    S+   ++ +L EK+  
Sbjct  335  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESELRSPSQASIVSDTTALLTEKDLE  394

Query  723  IEKMEKEMRDLMMQ  764
            +EK++KE+  L  Q
Sbjct  395  VEKLKKEVFQLAQQ  408



>ref|NP_001062429.1| Os08g0547500 [Oryza sativa Japonica Group]
 dbj|BAD09938.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAF24343.1| Os08g0547500 [Oryza sativa Japonica Group]
Length=986

 Score =   369 bits (947),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 213/255 (84%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPE+GT VEKL+E   RD+ HL  LL++CEAQRQIGET LN  SSR
Sbjct  154  DLLSHDTTPLRLLDDPEKGTTVEKLTEETLRDKDHLRNLLAVCEAQRQIGETALNETSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESST QY    N+STL A VNF+DLAGSERASQT SAG RLKEG HINRSL
Sbjct  214  SHQILRLTIESSTRQYLGRGNSSTLVACVNFVDLAGSERASQTASAGVRLKEGSHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG V+R+LSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  274  LTLGKVVRQLSKGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPARSHIEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK+V T AQVNVVMSDKALVK LQ+EL +L+SE++     S   T +  L+EK+A 
Sbjct  334  FATCAKEVVTNAQVNVVMSDKALVKHLQRELERLQSEIKFPAPASC-TTHAEALREKDAQ  392

Query  723  IEKMEKEMRDLMMQR  767
            I+K+EK++++LM +R
Sbjct  393  IKKLEKQLKELMEER  407



>gb|EEC83991.1| hypothetical protein OsI_30145 [Oryza sativa Indica Group]
Length=969

 Score =   369 bits (946),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 213/255 (84%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPE+GT VEKL+E   RD+ HL  LL++CEAQRQIGET LN  SSR
Sbjct  154  DLLSHDTTPLRLLDDPEKGTTVEKLTEETLRDKDHLRNLLAVCEAQRQIGETALNETSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESST QY    N+STL A VNF+DLAGSERASQT SAG RLKEG HINRSL
Sbjct  214  SHQILRLTIESSTRQYLGRGNSSTLVACVNFVDLAGSERASQTASAGVRLKEGSHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG V+R+LSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  274  LTLGKVVRQLSKGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPARSHIEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK+V T AQVNVVMSDKALVK LQ+EL +L+SE++     S   T +  L+EK+A 
Sbjct  334  FATCAKEVVTNAQVNVVMSDKALVKHLQRELERLQSEIKFPAPASC-TTHAEALREKDAQ  392

Query  723  IEKMEKEMRDLMMQR  767
            I+K+EK++++LM +R
Sbjct  393  IKKLEKQLKELMEER  407



>gb|EEE69110.1| hypothetical protein OsJ_28179 [Oryza sativa Japonica Group]
Length=987

 Score =   369 bits (947),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 213/255 (84%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPE+GT VEKL+E   RD+ HL  LL++CEAQRQIGET LN  SSR
Sbjct  154  DLLSHDTTPLRLLDDPEKGTTVEKLTEETLRDKDHLRNLLAVCEAQRQIGETALNETSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESST QY    N+STL A VNF+DLAGSERASQT SAG RLKEG HINRSL
Sbjct  214  SHQILRLTIESSTRQYLGRGNSSTLVACVNFVDLAGSERASQTASAGVRLKEGSHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG V+R+LSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  274  LTLGKVVRQLSKGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPARSHIEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK+V T AQVNVVMSDKALVK LQ+EL +L+SE++     S   T +  L+EK+A 
Sbjct  334  FATCAKEVVTNAQVNVVMSDKALVKHLQRELERLQSEIKFPAPASC-TTHAEALREKDAQ  392

Query  723  IEKMEKEMRDLMMQR  767
            I+K+EK++++LM +R
Sbjct  393  IKKLEKQLKELMEER  407



>ref|XP_010448602.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=1087

 Score =   371 bits (953),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 191/262 (73%), Positives = 224/262 (85%), Gaps = 8/262 (3%)
 Frame = +3

Query  3    DLLSTD-NTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSS  179
            DLL  D NTPLRLLDDPERGTVVEKL E    D++HL ELL ICE QR+IGET+LN  SS
Sbjct  141  DLLCEDSNTPLRLLDDPERGTVVEKLREETLTDRNHLEELLDICETQRKIGETSLNEASS  200

Query  180  RSHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRS  359
            RSHQILRLTIE+S  ++S P +++TL+A+V FIDLAGSERASQTLSAG+RLKEGCHINRS
Sbjct  201  RSHQILRLTIENSNREFS-PESSATLAASVCFIDLAGSERASQTLSAGSRLKEGCHINRS  259

Query  360  LLTLGTVIRKLSKGRNG---HIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSR  530
            LLTLGTVIRKLSKG+NG   HIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SH+EQSR
Sbjct  260  LLTLGTVIRKLSKGKNGXNGHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHLEQSR  319

Query  531  NTLLFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRAL---RSRSVDETSSLV  701
            NTLLFA+CAK+V T AQVN+V+S+KALVKQLQ+ELA++E+EL+ L    S S  E  +L+
Sbjct  320  NTLLFASCAKEVTTNAQVNMVVSEKALVKQLQRELARMENELKNLGPASSSSTSEFYTLM  379

Query  702  LKEKEALIEKMEKEMRDLMMQR  767
            LKEKE LI KME+++++L  QR
Sbjct  380  LKEKEELIAKMEEQIQELKWQR  401



>ref|NP_201432.2| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AED98197.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1063

 Score =   370 bits (951),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 186/254 (73%), Positives = 213/254 (84%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E   RD +H  ELLS+C+AQRQIGET LN +SSR
Sbjct  155  DLLSTDTSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCKAQRQIGETALNEVSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES   ++S     STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  215  SHQILRLTVESIAREFSTNDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK + GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  275  LTLGTVIRKLSKEKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARIHVEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLESELR+    S+   ++ +L EK+  
Sbjct  335  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESELRSPSQASIVSDTTALLTEKDLE  394

Query  723  IEKMEKEMRDLMMQ  764
            +EK++KE+  L  Q
Sbjct  395  VEKLKKEVFQLAQQ  408



>gb|KGN43176.1| hypothetical protein Csa_7G006260 [Cucumis sativus]
Length=1027

 Score =   370 bits (949),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 216/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDD ERGT+VEK++E + RD +HL EL+SICEAQR+IGET+LN  SSR
Sbjct  348  DLLSTDTSPLRLLDDQERGTIVEKVTEEILRDWNHLRELISICEAQRRIGETSLNEKSSR  407

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI++LTIESS  ++    N++TL+A+V+FIDLAGSERA+Q LSAG RLKEGCHINRSL
Sbjct  408  SHQIIKLTIESSAREFLGKDNSTTLAASVSFIDLAGSERAAQALSAGARLKEGCHINRSL  467

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHI YRDSKLTRILQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  468  LTLGTVIRKLSKGRNGHINYRDSKLTRILQPCLGGNARTAIICTLSPARSHVEQTRNTLL  527

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQKELA+LESELR     S     + +LK+K+  
Sbjct  528  FACCAKEVTTKAQVNVVMSDKALVKHLQKELARLESELRTPAPVSSSSEYAALLKKKDLQ  587

Query  723  IEKMEKEMRDLMMQR  767
            IEKM KE+R+L  QR
Sbjct  588  IEKMAKEIRELTKQR  602



>dbj|BAK06679.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=891

 Score =   367 bits (941),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 214/255 (84%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D  PLRLLDDPE+GTVVEKL+E   RD+ HL ELL++CEAQRQIGET LN  SSR
Sbjct  146  DLLSSDAAPLRLLDDPEKGTVVEKLTEETLRDKGHLLELLAVCEAQRQIGETALNETSSR  205

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESST Q+    N+STL A VNF+DLAGSERASQT ++G RLKEG HIN+SL
Sbjct  206  SHQILRLTVESSTKQFLGKGNSSTLQACVNFVDLAGSERASQTAASGMRLKEGSHINKSL  265

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG VIR+LS GRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPAHSHVEQSRNTLL
Sbjct  266  LTLGKVIRQLSGGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPAHSHVEQSRNTLL  325

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK V T AQVNVVMSDKALVK LQ+EL +LE+EL+   S S   T + VLKEK+  
Sbjct  326  FANCAKNVVTNAQVNVVMSDKALVKHLQRELTRLENELKLPGSASCS-THAEVLKEKDEQ  384

Query  723  IEKMEKEMRDLMMQR  767
            I+K+E+++++LM ++
Sbjct  385  IKKLEEQLKELMEEK  399



>gb|KHG01461.1| Kinesin-related 11 [Gossypium arboreum]
Length=953

 Score =   368 bits (945),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 183/248 (74%), Positives = 214/248 (86%), Gaps = 0/248 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPERG VVEKL+E   RD +H   LLS+CEAQRQIGET+LN  SSR
Sbjct  154  DLLSADSTPLRLLDDPERGIVVEKLTEETLRDWNHFKGLLSVCEAQRQIGETSLNEASSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILR+TIESS  +      +S L+A V+F+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  214  SHQILRVTIESSARECLGNDKSSMLAATVSFVDLAGSERASQSLSAGARLKEGCHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNARTAIICTMSPA SHVEQSRNTLL
Sbjct  274  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTAIICTMSPARSHVEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVKQLQ+ELA+LE+EL++  + S+   S+++L+EK+  
Sbjct  334  FASCAKEVTTNAQVNVVMSDKALVKQLQRELARLENELKSAGTASISFDSAVLLREKDLE  393

Query  723  IEKMEKEM  746
            IEK++K++
Sbjct  394  IEKLKKQV  401



>ref|XP_011037209.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037210.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037211.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037212.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037214.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037215.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
Length=973

 Score =   369 bits (946),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 188/257 (73%), Positives = 217/257 (84%), Gaps = 4/257 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GTVVEK +E   +D  HL ELLS+CEAQR+IGET+LN  SSR
Sbjct  159  DLLSTDDTPLRLLDDPEKGTVVEKATEETLKDWDHLKELLSVCEAQRRIGETSLNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N++TLSA VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  219  SHQILRLTIESSAREFLGKENSTTLSATVNFVDLAGSERASQALSTGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHI YRDSKLTR+LQ +LGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  279  LTLGTVIRKLSKGKQGHINYRDSKLTRLLQPALGGNARTAIICTLSPARSHVEQSRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELR--ALRSRSVDETSSLVLKEKE  716
            FA CAK+V TKAQVNVVMSDKALVK LQKE+A+LESELR  A  S + D  S  +L++++
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKEVARLESELRSPAPASSACDYVS--LLRKRD  396

Query  717  ALIEKMEKEMRDLMMQR  767
              I+KMEKE+++L  QR
Sbjct  397  LQIQKMEKEIKELTKQR  413



>ref|XP_006652585.1| PREDICTED: kinesin-like protein NACK1-like [Oryza brachyantha]
Length=941

 Score =   367 bits (943),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 212/255 (83%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NTPLRL DD E+GT VE L+EV+ RD  HL EL+SICEAQR+ GET LN  SSR
Sbjct  168  DLLSAENTPLRLWDDAEKGTYVENLTEVVLRDWDHLKELISICEAQRKTGETYLNENSSR  227

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++     ++TL A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  228  SHQILKLTIESSAREFLGKDKSTTLVASVNFVDLAGSERASQALSAGARLKEGCHINRSL  287

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRN LL
Sbjct  288  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSHMEQSRNALL  347

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVKQLQKELA+LESELR   + S  E    ++KEK+  
Sbjct  348  FASCAKEVVTNAQVNVVMSDKALVKQLQKELARLESELRYPATYSSLEA---LVKEKDNQ  404

Query  723  IEKMEKEMRDLMMQR  767
            I KMEKE+++L +QR
Sbjct  405  IRKMEKEIKELKLQR  419



>gb|KHN33713.1| Centromere-associated protein E [Glycine soja]
Length=899

 Score =   367 bits (941),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 213/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLST+NT LRL DDPERG +VEKL+E   R+  HL ELLS CEAQRQ+GET LN  SSR
Sbjct  159  DLLSTENTSLRLRDDPERGPIVEKLTEETLRNWVHLKELLSFCEAQRQVGETYLNDKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIESS  ++    +++TL+A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  219  SHQIIRLTIESSAREFMGKSSSTTLAASVNFVDLAGSERASQALSAGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GHI YRDSKLTRILQ SLGGN+RTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSKGRQGHINYRDSKLTRILQPSLGGNSRTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAKQV TKAQVNVVMSDK LVKQLQKE+A+LESELR     S +   + +L++K   
Sbjct  339  FACCAKQVTTKAQVNVVMSDKVLVKQLQKEVARLESELRTPCPPSTNCDCAAMLRKKNLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KME+E+R+L+ QR
Sbjct  399  IQKMEREIRELIEQR  413



>gb|EMS46463.1| Kinesin-related protein 11 [Triticum urartu]
Length=857

 Score =   365 bits (938),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 214/255 (84%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D TPLRLLDDPE+GTVVEKL+E   RD+ HL ELL++CEAQRQIGET LN  SSR
Sbjct  138  DLLSSDATPLRLLDDPEKGTVVEKLTEETLRDKGHLLELLAVCEAQRQIGETALNETSSR  197

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  Q+    N+STL A VNF+DLAGSERASQT ++G RLKEG HIN+SL
Sbjct  198  SHQILRLTVESSAKQFLGKGNSSTLQACVNFVDLAGSERASQTAASGMRLKEGSHINKSL  257

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG VIR+LS GRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPAH HVEQSRNTLL
Sbjct  258  LTLGKVIRQLSGGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPAHCHVEQSRNTLL  317

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK V T AQVNVVMSDKALVK LQ+EL +LE+EL+   S S+  T + VLKEK+  
Sbjct  318  FANCAKNVVTNAQVNVVMSDKALVKHLQRELTRLENELKFPGSASLS-THAEVLKEKDEQ  376

Query  723  IEKMEKEMRDLMMQR  767
            I+K+E+++++LM ++
Sbjct  377  IKKLEEQLKELMEEK  391



>dbj|BAD09937.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
Length=1003

 Score =   369 bits (946),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 213/255 (84%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPE+GT VEKL+E   RD+ HL  LL++CEAQRQIGET LN  SSR
Sbjct  170  DLLSHDTTPLRLLDDPEKGTTVEKLTEETLRDKDHLRNLLAVCEAQRQIGETALNETSSR  229

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESST QY    N+STL A VNF+DLAGSERASQT SAG RLKEG HINRSL
Sbjct  230  SHQILRLTIESSTRQYLGRGNSSTLVACVNFVDLAGSERASQTASAGVRLKEGSHINRSL  289

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG V+R+LSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  290  LTLGKVVRQLSKGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPARSHIEQSRNTLL  349

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK+V T AQVNVVMSDKALVK LQ+EL +L+SE++     S   T +  L+EK+A 
Sbjct  350  FATCAKEVVTNAQVNVVMSDKALVKHLQRELERLQSEIKFPAPASC-TTHAEALREKDAQ  408

Query  723  IEKMEKEMRDLMMQR  767
            I+K+EK++++LM +R
Sbjct  409  IKKLEKQLKELMEER  423



>gb|KDP27640.1| hypothetical protein JCGZ_19645 [Jatropha curcas]
Length=965

 Score =   368 bits (944),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 216/255 (85%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+ PLRLLDDPE+GT+VEK++E   RD +HL ELLS+CEAQR+IGET+LN  SSR
Sbjct  159  DLLSRDSAPLRLLDDPEKGTIVEKVTEETLRDWNHLQELLSVCEAQRRIGETSLNDKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N++TL+A VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  219  SHQILRLTIESSAREFLGKENSTTLAATVNFVDLAGSERASQALSTGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GHI YRDSKLTR+LQ +LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSKGRHGHINYRDSKLTRLLQPALGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQ+E+A+LESELR+    S     + +L++K+  
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQQEVARLESELRSPAPASSTTDYAALLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEKE+R+L  Q+
Sbjct  399  IQKMEKEIRELTKQK  413



>ref|XP_010690757.1| PREDICTED: kinesin-like protein NACK1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690758.1| PREDICTED: kinesin-like protein NACK1 [Beta vulgaris subsp. vulgaris]
Length=894

 Score =   366 bits (939),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 213/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+DNTPLRL+DDPE+GT+VEKL+E    D  HL +LL+ICEAQR+IGET+LN  SSR
Sbjct  156  DLLSSDNTPLRLMDDPEKGTIVEKLTEEKLNDWGHLKKLLAICEAQRKIGETSLNEQSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++    N+STLSA+V FIDLAGSERASQ +SAGTRLKEGCHINRSL
Sbjct  216  SHQILKLTIESSAREFIGKGNSSTLSASVFFIDLAGSERASQAMSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG VIRKLS GR GHI YRDSKLTRILQ  LGGNART IICT+SPA  HVEQSRNTLL
Sbjct  276  LTLGNVIRKLSNGRQGHINYRDSKLTRILQPCLGGNARTTIICTLSPARIHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQKELA+LE+ELR+    S     S+++++K+  
Sbjct  336  FASCAKEVTTNAQVNVVMSDKALVKHLQKELARLENELRSPAPTSSSCHCSVIIRKKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            +EKMEKE+R+L  QR
Sbjct  396  LEKMEKEIRELTKQR  410



>ref|XP_003527612.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006581109.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
Length=880

 Score =   365 bits (938),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 212/255 (83%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL T NT LRL DDPERG +VEKL+E   RD  HL ELLS CEAQRQ+GET LN  SSR
Sbjct  159  DLLITKNTSLRLRDDPERGPIVEKLTEETLRDWVHLKELLSFCEAQRQVGETYLNDKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIESS  ++    +++TL+A+VNF+DLAGSERASQ LSAG+RLKEGCHINRSL
Sbjct  219  SHQIIRLTIESSAREFMGKSSSTTLAASVNFVDLAGSERASQALSAGSRLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GHI YRDSKLTRILQ SLGGN+RTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSKGRQGHINYRDSKLTRILQPSLGGNSRTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAKQV TKAQVNVVMSDK LVKQLQKE+A+LESELR     S +   + +L++K   
Sbjct  339  FACCAKQVTTKAQVNVVMSDKVLVKQLQKEVARLESELRTPCPPSTNCDCAAMLRKKNLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KME+E+R+L+ QR
Sbjct  399  IQKMEREIRELIEQR  413



>ref|XP_009393646.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=913

 Score =   366 bits (940),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 191/257 (74%), Positives = 213/257 (83%), Gaps = 4/257 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D +PLRLLDDPERGTVVEKL+E  PRDQ HL ELLS C  QRQ+ ET+LN  SSR
Sbjct  158  DLLSSDGSPLRLLDDPERGTVVEKLTEETPRDQWHLRELLSTCAEQRQVEETSLNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNS--TLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINR  356
            SHQILRLTIES T + S  R++S  TL AAVNF+DLAGSERASQ+ SAG RLKEGCHINR
Sbjct  218  SHQILRLTIES-TARASKGRDSSSSTLLAAVNFVDLAGSERASQSSSAGNRLKEGCHINR  276

Query  357  SLLTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNT  536
            SLLTLGTVIRKLSKGR GHIPYRDSKLTRILQ  LGGNARTAIICTMSPA SH+EQSRNT
Sbjct  277  SLLTLGTVIRKLSKGRTGHIPYRDSKLTRILQPFLGGNARTAIICTMSPARSHIEQSRNT  336

Query  537  LLFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKE  716
            LLFA+CAKQV   AQVNVVMSDKALVK LQ+ELA+LE ELR   S S    S   L++K+
Sbjct  337  LLFASCAKQVVINAQVNVVMSDKALVKHLQRELARLEHELRYPGSASCTHHSD-ALRDKD  395

Query  717  ALIEKMEKEMRDLMMQR  767
              I+KME+E+++LM QR
Sbjct  396  TQIKKMEREIKELMQQR  412



>ref|XP_010515506.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Camelina sativa]
Length=918

 Score =   366 bits (940),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 187/251 (75%), Positives = 213/251 (85%), Gaps = 0/251 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVV+KL+E + RD +H  ELLSIC AQRQIGETTLN +SSR
Sbjct  40   DLLSTDISPLRLLDDPEKGTVVDKLTEEILRDWNHFKELLSICIAQRQIGETTLNEVSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  +Y      STL+A VNFIDLAGSERASQ+LSAGTRLKEG HINRSL
Sbjct  100  SHQILRLTVESTAREYLANDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGGHINRSL  159

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ SLGGNART+IICT+SPA  HVEQSRNTLL
Sbjct  160  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQTSLGGNARTSIICTLSPARIHVEQSRNTLL  219

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLESEL + R   V   ++ +LKEK+  
Sbjct  220  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESELSSPRQALVVSDTTALLKEKDLQ  279

Query  723  IEKMEKEMRDL  755
            IEK+ KE+  L
Sbjct  280  IEKLHKEVFQL  290



>ref|XP_010550454.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Tarenaya hassleriana]
Length=948

 Score =   367 bits (942),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/254 (72%), Positives = 212/254 (83%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDN+PLRLLDDPE+GTVVEK++E   RD +H  ELLS+C+AQRQIGET LN +SSR
Sbjct  40   DLLSTDNSPLRLLDDPEKGTVVEKITEATLRDWNHFKELLSVCKAQRQIGETALNEVSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIES+  +Y      STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  100  SHQILRLTIESTAHEYLANDKLSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  159

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  160  LTLGTVIRKLSKGKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPAKIHVEQSRNTLL  219

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN VMSDK LVK LQ+ELA+LES LR+     V+  ++ +L+EK+  
Sbjct  220  FASCAKEVTTNAQVNAVMSDKVLVKHLQRELARLESVLRSPGRAFVEPDTAALLREKDIQ  279

Query  723  IEKMEKEMRDLMMQ  764
            IEK+  E+ +L  Q
Sbjct  280  IEKLNIEVFELKQQ  293



>ref|XP_007135918.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
 ref|XP_007135919.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
 gb|ESW07912.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
 gb|ESW07913.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
Length=888

 Score =   365 bits (938),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS++NTPLRL DDPERG +VEKL E   RD  HL ELLS CEAQRQ+GET LN  SSR
Sbjct  159  DLLSSENTPLRLRDDPERGPIVEKLIEETLRDWMHLKELLSFCEAQRQVGETYLNDKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIESS  ++    +++TL+A++NF+DLAGSERASQ LSAG+RLKEGCHINRSL
Sbjct  219  SHQIIRLTIESSAREFMGKSSSTTLAASLNFVDLAGSERASQALSAGSRLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GHI YRDSKLTRILQ SLGGN+RTAIICT+SPA  HVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSKGRHGHINYRDSKLTRILQPSLGGNSRTAIICTLSPARCHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAKQV TKAQVNVVMSDK LVKQLQKE+A+LESELR     S +   + +L++K   
Sbjct  339  FACCAKQVTTKAQVNVVMSDKVLVKQLQKEVARLESELRTPCPPSTNCDCASMLRKKNLR  398

Query  723  IEKMEKEMRDLMMQR  767
            IEKME+E+++L+ QR
Sbjct  399  IEKMEREIQELIKQR  413



>ref|XP_010315333.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Solanum lycopersicum]
 ref|XP_010315334.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Solanum lycopersicum]
Length=924

 Score =   366 bits (939),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 216/255 (85%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D++PLRLLDDPE+GT++EKL+E   RD  HL +LLS+CEAQRQIGET LN  SSR
Sbjct  160  DLLSSDSSPLRLLDDPEKGTIIEKLTEETLRDWDHLKDLLSVCEAQRQIGETYLNENSSR  219

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N +TLSA+VNF+DLAGSERASQ+LS G RLKEGCHINRSL
Sbjct  220  SHQILRLTIESSAREFIGKDNKTTLSASVNFVDLAGSERASQSLSVGQRLKEGCHINRSL  279

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GH+ YRDSKLTRILQ +LGGNART IICT+SPA SHVEQSRNTLL
Sbjct  280  LTLGTVIRKLSKGRHGHVNYRDSKLTRILQPALGGNARTGIICTLSPARSHVEQSRNTLL  339

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V T AQVNVVMSDKALVK LQKELA+LESEL+   + + D    ++L++K+  
Sbjct  340  FACCAKEVTTNAQVNVVMSDKALVKHLQKELARLESELKT-PTTTCDHV--VLLRKKDQQ  396

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+R+L  QR
Sbjct  397  IEKLEKEVRELTKQR  411



>ref|XP_010315335.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Solanum lycopersicum]
Length=922

 Score =   366 bits (939),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 216/255 (85%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D++PLRLLDDPE+GT++EKL+E   RD  HL +LLS+CEAQRQIGET LN  SSR
Sbjct  160  DLLSSDSSPLRLLDDPEKGTIIEKLTEETLRDWDHLKDLLSVCEAQRQIGETYLNENSSR  219

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N +TLSA+VNF+DLAGSERASQ+LS G RLKEGCHINRSL
Sbjct  220  SHQILRLTIESSAREFIGKDNKTTLSASVNFVDLAGSERASQSLSVGQRLKEGCHINRSL  279

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GH+ YRDSKLTRILQ +LGGNART IICT+SPA SHVEQSRNTLL
Sbjct  280  LTLGTVIRKLSKGRHGHVNYRDSKLTRILQPALGGNARTGIICTLSPARSHVEQSRNTLL  339

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V T AQVNVVMSDKALVK LQKELA+LESEL+   + + D    ++L++K+  
Sbjct  340  FACCAKEVTTNAQVNVVMSDKALVKHLQKELARLESELKT-PTTTCDHV--VLLRKKDQQ  396

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+R+L  QR
Sbjct  397  IEKLEKEVRELTKQR  411



>emb|CDY34261.1| BnaA01g13640D [Brassica napus]
Length=847

 Score =   363 bits (933),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 188/261 (72%), Positives = 222/261 (85%), Gaps = 8/261 (3%)
 Frame = +3

Query  3    DLLSTDNT-PLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSS  179
            DLL  DN  PLRLLDDPERGTVVEKL E   RD++HL EL+SICE QR+IGET+LN  SS
Sbjct  142  DLLCEDNNNPLRLLDDPERGTVVEKLKEETIRDRNHLEELISICETQRKIGETSLNETSS  201

Query  180  RSHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRS  359
            RSHQILRLTIESS  + S P +++ L+A+V F+DLAGSERASQTLSAG+RLKEGCHINRS
Sbjct  202  RSHQILRLTIESSKREVS-PESSAILAASVCFVDLAGSERASQTLSAGSRLKEGCHINRS  260

Query  360  LLTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTL  539
            LLTLGTVIRKLSKG++GHIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SH+EQSRNTL
Sbjct  261  LLTLGTVIRKLSKGKHGHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHLEQSRNTL  320

Query  540  LFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELR-----ALRSRSVDETSSLVL  704
            LFATCAK+V T AQVN+V+S+KALVKQLQ+EL ++E+EL+        S + DE  SL L
Sbjct  321  LFATCAKEVTTNAQVNMVVSEKALVKQLQRELMRMENELKNLGLGGSSSSTSDEFHSL-L  379

Query  705  KEKEALIEKMEKEMRDLMMQR  767
            K+KE +IEKME+++++L  QR
Sbjct  380  KQKEEVIEKMEEQIQELKWQR  400



>ref|XP_002444630.1| hypothetical protein SORBIDRAFT_07g025040 [Sorghum bicolor]
 gb|EES14125.1| hypothetical protein SORBIDRAFT_07g025040 [Sorghum bicolor]
Length=1032

 Score =   367 bits (942),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 214/255 (84%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPE+GT VE+L+E   RD  HL +LL++CEAQRQIGET LN  SSR
Sbjct  155  DLLSHDPTPLRLLDDPEKGTTVERLTEETLRDYGHLRDLLAVCEAQRQIGETALNETSSR  214

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  Q+    N+STL A VNF+DLAGSERASQT SAG RLKEG HINRSL
Sbjct  215  SHQILRLTIESSARQFLGRGNSSTLVACVNFVDLAGSERASQTASAGMRLKEGSHINRSL  274

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG V+R LSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPAH+H+EQSRNTLL
Sbjct  275  LTLGKVVRLLSKGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPAHTHMEQSRNTLL  334

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FATCAK+V T AQVNVVMSDKALVK LQ+ELA+LE+EL+     +V  T +  L+EK+A 
Sbjct  335  FATCAKEVITNAQVNVVMSDKALVKHLQRELARLENELK-FPGSTVCTTHTEALREKDAQ  393

Query  723  IEKMEKEMRDLMMQR  767
            I+K+EK++++LM +R
Sbjct  394  IKKLEKQLKELMEER  408



>ref|XP_010526582.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Tarenaya hassleriana]
Length=732

 Score =   360 bits (923),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/255 (70%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+DNTPLRL DDPE+GT+VEK +E + RD +HL +LLSICEAQR+IGET+LN  SSR
Sbjct  159  DLLSSDNTPLRLRDDPEKGTIVEKTTEEVLRDWNHLKDLLSICEAQRKIGETSLNERSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLT+ESS  ++    N++TL+A+VNFIDLAGSERASQ +SAG RLKEGCHINRSL
Sbjct  219  SHQIIRLTVESSAREFLGKENSTTLAASVNFIDLAGSERASQAMSAGERLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GHI YRDSKLTRILQ  LGGNARTAI+CT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSKGRHGHINYRDSKLTRILQPCLGGNARTAIVCTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQ+NVVMSDKALVK LQ+ELA+LE ELR     ++    ++  + K+  
Sbjct  339  FACCAKEVTTKAQINVVMSDKALVKHLQRELARLEGELRNPAPAAMICDCAVASRRKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEK++ +L  QR
Sbjct  399  IQKMEKQIGELTKQR  413



>tpg|DAA36662.1| TPA: hypothetical protein ZEAMMB73_386599 [Zea mays]
Length=808

 Score =   362 bits (928),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 212/255 (83%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NT LRL DD E+GT +E L+EV+ RD  HL EL+S+CEAQR+ GET LNG SSR
Sbjct  40   DLLSAENTSLRLWDDAEKGTYIENLTEVILRDLDHLKELISVCEAQRRTGETYLNGNSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++S    ++TL A+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  100  SHQILKLTIESSAREFSGKDKSTTLVASVNFVDLAGSERASQALSVGARLKEGCHINRSL  159

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  160  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQISLGGNARTAIICTMSPARSHMEQSRNTLL  219

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKAL+KQLQKELA+LESELR   S    E    ++KEK+  
Sbjct  220  FASCAKEVVTNAQVNVVMSDKALIKQLQKELARLESELRCPASYPGLEA---LVKEKDNQ  276

Query  723  IEKMEKEMRDLMMQR  767
            I +MEKE+++L +QR
Sbjct  277  ILEMEKEIKELKLQR  291



>ref|XP_009123681.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=1060

 Score =   367 bits (943),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 192/258 (74%), Positives = 221/258 (86%), Gaps = 5/258 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS DN  LRLLDDPERGTVVEKL E   RD++HL ELLSICE QR+IGET+LN  SSR
Sbjct  145  DLLSGDNNQLRLLDDPERGTVVEKLIEETLRDRTHLEELLSICETQRKIGETSLNETSSR  204

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++S   ++ TL+A+V F+DLAGSERASQTLSAG RLKEGCHINRSL
Sbjct  205  SHQILRLTIESSGREFSL-ESSRTLAASVCFVDLAGSERASQTLSAGARLKEGCHINRSL  263

Query  363  LTLGTVIRKLSKGRNG-HIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTL  539
            LTLGTVIRKLSKGRNG HIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQSRNTL
Sbjct  264  LTLGTVIRKLSKGRNGGHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSRNTL  323

Query  540  LFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSV--DETSSLVLKEK  713
            LFATCAK+V T AQVN+V+S+KALVKQLQ+ELA++E+EL+ + S S    E  SL LK+K
Sbjct  324  LFATCAKEVTTNAQVNLVVSEKALVKQLQQELARMENELKNIGSSSSAGSEFYSL-LKQK  382

Query  714  EALIEKMEKEMRDLMMQR  767
            E +I +ME++M++L  QR
Sbjct  383  EEVISQMEEQMKELKWQR  400



>ref|XP_010550452.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550453.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=1064

 Score =   367 bits (942),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/254 (72%), Positives = 212/254 (83%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDN+PLRLLDDPE+GTVVEK++E   RD +H  ELLS+C+AQRQIGET LN +SSR
Sbjct  156  DLLSTDNSPLRLLDDPEKGTVVEKITEATLRDWNHFKELLSVCKAQRQIGETALNEVSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIES+  +Y      STL+A VNFIDLAGSERASQ+LSAGTRLKEGCHINRSL
Sbjct  216  SHQILRLTIESTAHEYLANDKLSTLTATVNFIDLAGSERASQSLSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHIP+RDSKLTRILQ SLGGNARTAIICTMSPA  HVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKGKTGHIPFRDSKLTRILQSSLGGNARTAIICTMSPAKIHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN VMSDK LVK LQ+ELA+LES LR+     V+  ++ +L+EK+  
Sbjct  336  FASCAKEVTTNAQVNAVMSDKVLVKHLQRELARLESVLRSPGRAFVEPDTAALLREKDIQ  395

Query  723  IEKMEKEMRDLMMQ  764
            IEK+  E+ +L  Q
Sbjct  396  IEKLNIEVFELKQQ  409



>ref|XP_008669086.1| PREDICTED: kinesin-like protein NACK1 isoform X4 [Zea mays]
Length=818

 Score =   362 bits (928),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 212/255 (83%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NT LRL DD E+GT +E L+EV+ RD  HL EL+S+CEAQR+ GET LNG SSR
Sbjct  40   DLLSAENTSLRLWDDAEKGTYIENLTEVILRDLDHLKELISVCEAQRRTGETYLNGNSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++S    ++TL A+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  100  SHQILKLTIESSAREFSGKDKSTTLVASVNFVDLAGSERASQALSVGARLKEGCHINRSL  159

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  160  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQISLGGNARTAIICTMSPARSHMEQSRNTLL  219

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKAL+KQLQKELA+LESELR   S    E    ++KEK+  
Sbjct  220  FASCAKEVVTNAQVNVVMSDKALIKQLQKELARLESELRCPASYPGLEA---LVKEKDNQ  276

Query  723  IEKMEKEMRDLMMQR  767
            I +MEKE+++L +QR
Sbjct  277  ILEMEKEIKELKLQR  291



>ref|XP_010317235.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Solanum lycopersicum]
Length=865

 Score =   363 bits (931),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/256 (71%), Positives = 213/256 (83%), Gaps = 1/256 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS DNTPLRLLDDPERGTV+EKL+E   RD +H+  LLSICEAQRQIGET+LN  SSR
Sbjct  40   DLLSEDNTPLRLLDDPERGTVIEKLTEETLRDWNHVIHLLSICEAQRQIGETSLNETSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNN-STLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRS  359
            SHQI+RLTIESS  +     N+ STL A VNF+DLAGSERASQ+LSAGTRLKEGCHINRS
Sbjct  100  SHQIIRLTIESSAGENIGRDNDLSTLLATVNFVDLAGSERASQSLSAGTRLKEGCHINRS  159

Query  360  LLTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTL  539
            LLTLGTVIRKLSK R GHIP+RDSKLTRILQ SLGGN RTAIICT+ PA SHV+Q+RNTL
Sbjct  160  LLTLGTVIRKLSKDRTGHIPFRDSKLTRILQPSLGGNGRTAIICTICPARSHVDQTRNTL  219

Query  540  LFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEA  719
            LFA+CAK+V T AQ N+VMSDK LVK LQ+ELA+LESELR  R+         +L+EK+ 
Sbjct  220  LFASCAKEVTTNAQANIVMSDKTLVKHLQRELARLESELRYPRACIFPSDYEALLQEKDH  279

Query  720  LIEKMEKEMRDLMMQR  767
             I+++EKE++DL++QR
Sbjct  280  QIQQLEKEIKDLILQR  295



>ref|XP_010515505.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=1032

 Score =   366 bits (939),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 187/251 (75%), Positives = 213/251 (85%), Gaps = 0/251 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVV+KL+E + RD +H  ELLSIC AQRQIGETTLN +SSR
Sbjct  154  DLLSTDISPLRLLDDPEKGTVVDKLTEEILRDWNHFKELLSICIAQRQIGETTLNEVSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  +Y      STL+A VNFIDLAGSERASQ+LSAGTRLKEG HINRSL
Sbjct  214  SHQILRLTVESTAREYLANDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGGHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ SLGGNART+IICT+SPA  HVEQSRNTLL
Sbjct  274  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQTSLGGNARTSIICTLSPARIHVEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLESEL + R   V   ++ +LKEK+  
Sbjct  334  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESELSSPRQALVVSDTTALLKEKDLQ  393

Query  723  IEKMEKEMRDL  755
            IEK+ KE+  L
Sbjct  394  IEKLHKEVFQL  404



>ref|XP_002301999.2| kinesin motor family protein [Populus trichocarpa]
 gb|EEE81272.2| kinesin motor family protein [Populus trichocarpa]
Length=915

 Score =   363 bits (932),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 187/258 (72%), Positives = 215/258 (83%), Gaps = 3/258 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLST ++PLRLLDDPERGTVVE L E    D +HL EL+SICE QRQIGETTLN  SSR
Sbjct  158  DLLSTSSSPLRLLDDPERGTVVEGLIEDTLVDWNHLLELISICEDQRQIGETTLNETSSR  217

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS   Y    N++TL+A VNF+DLAGSERASQTL+  TRLKEG HINRSL
Sbjct  218  SHQILRLTVESSARGYLGAGNSTTLTATVNFVDLAGSERASQTLAVVTRLKEGSHINRSL  277

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ+SLGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  278  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQNSLGGNARTAIICTLSPARSHVEQSRNTLL  337

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVN+VMSDK LVK+LQKE+A+LE+EL++  S S    S+ +L+EKE  
Sbjct  338  FASCAKEVTTNAQVNLVMSDKTLVKKLQKEVARLENELKSAGSNSFVGDSTALLREKELQ  397

Query  723  IE---KMEKEMRDLMMQR  767
            IE   KM +E+++L  QR
Sbjct  398  IEKVRKMHQEIQELTWQR  415



>ref|XP_002313758.2| kinesin motor family protein [Populus trichocarpa]
 gb|EEE87713.2| kinesin motor family protein [Populus trichocarpa]
Length=975

 Score =   364 bits (935),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 187/257 (73%), Positives = 217/257 (84%), Gaps = 4/257 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GTVVEK +E   +D  HL ELLS+CEAQR+IGET+LN  SSR
Sbjct  159  DLLSTDSTPLRLLDDPEKGTVVEKATEETLKDWDHLKELLSVCEAQRRIGETSLNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++    N++TLSA +NF+DLAGSERASQ LS G RLKEG HINRSL
Sbjct  219  SHQILRLTVESSACEFLGKENSTTLSATLNFVDLAGSERASQALSTGARLKEGSHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLS  R GHI YRDSKLTR+LQ +LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSNRRQGHINYRDSKLTRLLQPALGGNARTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRA--LRSRSVDETSSLVLKEKE  716
            FA CAK+VATKAQVNVVMSDKALVK LQKE+A+LESELR+  L S + D TS  +L++K+
Sbjct  339  FACCAKEVATKAQVNVVMSDKALVKHLQKEVARLESELRSPDLASSTCDYTS--LLRQKD  396

Query  717  ALIEKMEKEMRDLMMQR  767
              I+KMEKE+R+L  QR
Sbjct  397  LQIQKMEKEIRELTKQR  413



>ref|XP_004976382.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Setaria 
italica]
 ref|XP_004976383.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Setaria 
italica]
Length=946

 Score =   363 bits (932),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 213/255 (84%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS ++T LRL DD E+GT VE L+EV+ RD  HL EL+S+CEAQR+ GET LN  SSR
Sbjct  169  DLLSAESTSLRLWDDAEKGTYVENLTEVVLRDSDHLKELISVCEAQRRTGETYLNENSSR  228

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++     ++TL A+VNF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  229  SHQILKLTIESSAREFLGKDKSTTLVASVNFVDLAGSERASQALSAGTRLKEGCHINRSL  288

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  289  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSHMEQSRNTLL  348

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVKQLQKELA+LESELR   S S  E    ++KEK++ 
Sbjct  349  FASCAKEVVTNAQVNVVMSDKALVKQLQKELARLESELRCPASYSGLEA---LVKEKDSQ  405

Query  723  IEKMEKEMRDLMMQR  767
            I KMEKE+++L  QR
Sbjct  406  IRKMEKEIKELKSQR  420



>dbj|BAF00728.1| hypothetical protein [Arabidopsis thaliana]
Length=940

 Score =   363 bits (932),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 185/251 (74%), Positives = 211/251 (84%), Gaps = 0/251 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLR+LDDPE+GTVVEKL+E   RD +H  ELLSIC AQRQIGET LN +SSR
Sbjct  40   DLLSTDISPLRVLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRQIGETALNEVSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  +Y      STL+A VNFIDLAGSERASQ+LSAGTRLKEG HINRSL
Sbjct  100  SHQILRLTVESTAREYLAKDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGGHINRSL  159

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ SLGGNART+IICT+SPA  HVEQSRNTLL
Sbjct  160  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQTSLGGNARTSIICTLSPARVHVEQSRNTLL  219

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALV+ LQ+ELAKLESEL + R   V   ++ +LKEK+  
Sbjct  220  FASCAKEVTTNAQVNVVMSDKALVRHLQRELAKLESELSSPRQALVVSDTTALLKEKDLQ  279

Query  723  IEKMEKEMRDL  755
            IEK+ KE+  L
Sbjct  280  IEKLNKEVFQL  290



>ref|XP_010317234.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Solanum lycopersicum]
Length=964

 Score =   363 bits (933),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 183/256 (71%), Positives = 213/256 (83%), Gaps = 1/256 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS DNTPLRLLDDPERGTV+EKL+E   RD +H+  LLSICEAQRQIGET+LN  SSR
Sbjct  139  DLLSEDNTPLRLLDDPERGTVIEKLTEETLRDWNHVIHLLSICEAQRQIGETSLNETSSR  198

Query  183  SHQILRLTIESSTTQYSHPRNN-STLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRS  359
            SHQI+RLTIESS  +     N+ STL A VNF+DLAGSERASQ+LSAGTRLKEGCHINRS
Sbjct  199  SHQIIRLTIESSAGENIGRDNDLSTLLATVNFVDLAGSERASQSLSAGTRLKEGCHINRS  258

Query  360  LLTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTL  539
            LLTLGTVIRKLSK R GHIP+RDSKLTRILQ SLGGN RTAIICT+ PA SHV+Q+RNTL
Sbjct  259  LLTLGTVIRKLSKDRTGHIPFRDSKLTRILQPSLGGNGRTAIICTICPARSHVDQTRNTL  318

Query  540  LFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEA  719
            LFA+CAK+V T AQ N+VMSDK LVK LQ+ELA+LESELR  R+         +L+EK+ 
Sbjct  319  LFASCAKEVTTNAQANIVMSDKTLVKHLQRELARLESELRYPRACIFPSDYEALLQEKDH  378

Query  720  LIEKMEKEMRDLMMQR  767
             I+++EKE++DL++QR
Sbjct  379  QIQQLEKEIKDLILQR  394



>gb|EYU24075.1| hypothetical protein MIMGU_mgv1a001308mg [Erythranthe guttata]
Length=843

 Score =   361 bits (926),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 177/255 (69%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL+ DNT LRLLDDPERGT+VEKL+E +  D+ H++ LLS+CEAQRQIGET++N  SSR
Sbjct  152  DLLNVDNTSLRLLDDPERGTIVEKLTEEILNDRDHVTRLLSVCEAQRQIGETSINERSSR  211

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLT+ESS+ +     + STLSA VNF+DLAGSERASQ+LSAGTRLKEG HINRSL
Sbjct  212  SHQIIRLTVESSSREILAGNSASTLSAIVNFVDLAGSERASQSLSAGTRLKEGSHINRSL  271

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGN RTA+ICT+ P+HSH EQSRNTLL
Sbjct  272  LTLGTVIRKLSKDRNGHIPYRDSKLTRILQTSLGGNTRTAVICTIIPSHSHSEQSRNTLL  331

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVV+S+KALVK LQKE+ +LE+EL+           S +L+EK++ 
Sbjct  332  FASCAKEVTTNAQVNVVLSEKALVKHLQKEVQRLENELKGRPHNFAPSNYSALLREKDSQ  391

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+++L++QR
Sbjct  392  IEKLEKEIKELILQR  406



>gb|EEE70089.1| hypothetical protein OsJ_30085 [Oryza sativa Japonica Group]
Length=870

 Score =   361 bits (927),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 183/263 (70%), Positives = 215/263 (82%), Gaps = 9/263 (3%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D TPLRLLDDPE+GTVVEKL+E   RD+ HL ELL++CEAQRQIGET +N  SSR
Sbjct  144  DLLSSDATPLRLLDDPEKGTVVEKLTEETLRDKGHLLELLAVCEAQRQIGETAMNEASSR  203

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAV--------NFIDLAGSERASQTLSAGTRLKE  338
            SHQILR+T+ESS  Q+    N+STL A V        NF+DLAGSERASQT SAG RLKE
Sbjct  204  SHQILRMTVESSAKQFLGKGNSSTLIACVVLMKYLHLNFVDLAGSERASQTASAGMRLKE  263

Query  339  GCHINRSLLTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHV  518
            G HINRSLLTLG VIR+LSKGRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPAH H+
Sbjct  264  GSHINRSLLTLGKVIRQLSKGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPAHCHI  323

Query  519  EQSRNTLLFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSL  698
            EQSRNTLLFA CAK V T AQVNVVMSDKALVK LQ+E+A+LE+EL+   S S   + + 
Sbjct  324  EQSRNTLLFANCAKDVVTNAQVNVVMSDKALVKHLQREIARLENELKFPASASCT-SHAE  382

Query  699  VLKEKEALIEKMEKEMRDLMMQR  767
            +L+EK+ LI+ +E+++++LM Q+
Sbjct  383  ILREKDELIKNLEEQLKELMEQK  405



>ref|XP_002448243.1| hypothetical protein SORBIDRAFT_06g023880 [Sorghum bicolor]
 gb|EES12571.1| hypothetical protein SORBIDRAFT_06g023880 [Sorghum bicolor]
Length=941

 Score =   362 bits (930),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 213/255 (84%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS ++T LRL DD E+GT VE L+EV+ RD +HL EL+S+CEAQR+ GET LN  SSR
Sbjct  169  DLLSAESTSLRLWDDAEKGTYVENLTEVILRDSNHLKELISVCEAQRRTGETYLNENSSR  228

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++     ++TL A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  229  SHQILKLTIESSAREFLGKDKSTTLVASVNFVDLAGSERASQALSAGARLKEGCHINRSL  288

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  289  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSHMEQSRNTLL  348

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVKQLQKELA+LESELR   S S  E    ++KEK+  
Sbjct  349  FASCAKEVVTNAQVNVVMSDKALVKQLQKELARLESELRCPTSYSGLEA---LVKEKDNQ  405

Query  723  IEKMEKEMRDLMMQR  767
            I KMEKE+++L +QR
Sbjct  406  IRKMEKEIKELKLQR  420



>emb|CAB62637.1| putative protein [Arabidopsis thaliana]
Length=968

 Score =   363 bits (932),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 185/254 (73%), Positives = 212/254 (83%), Gaps = 0/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLR+LDDPE+GTVVEKL+E   RD +H  ELLSIC AQRQIGET LN +SSR
Sbjct  154  DLLSTDISPLRVLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRQIGETALNEVSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  +Y      STL+A VNFIDLAGSERASQ+LSAGTRLKEG HINRSL
Sbjct  214  SHQILRLTVESTAREYLAKDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGGHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ SLGGNART+IICT+SPA  HVEQSRNTLL
Sbjct  274  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQTSLGGNARTSIICTLSPARVHVEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALV+ LQ+ELAKLESEL + R   V   ++ +LKEK+  
Sbjct  334  FASCAKEVTTNAQVNVVMSDKALVRHLQRELAKLESELSSPRQALVVSDTTALLKEKDLQ  393

Query  723  IEKMEKEMRDLMMQ  764
            IEK+ KE+  L  +
Sbjct  394  IEKLNKEVFQLAQE  407



>gb|KHN20030.1| Kinesin-related protein 4 [Glycine soja]
Length=887

 Score =   361 bits (927),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 211/255 (83%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL T NT LRL DDPERG +VEKL+E   RD  HL ELLS CEAQRQ+GET LN  SSR
Sbjct  159  DLLITKNTSLRLRDDPERGPIVEKLTEETLRDWVHLKELLSFCEAQRQVGETYLNDKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI++LTIESS  ++    +++TL+A+VNF+DLAGSERASQ LSA +RLKEGCHINRSL
Sbjct  219  SHQIIKLTIESSAREFMGKSSSTTLAASVNFVDLAGSERASQALSAESRLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GHI YRDSKLTRILQ SLGGN+RTAIICT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSKGRQGHINYRDSKLTRILQPSLGGNSRTAIICTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAKQV TKAQVNVVMSDK LVKQLQKE+A+LESELR     S +   + +L++K   
Sbjct  339  FACCAKQVTTKAQVNVVMSDKVLVKQLQKEVARLESELRTPCPPSTNCDCAAMLRKKNLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KME+E+R+L+ QR
Sbjct  399  IQKMEREIRELIEQR  413



>ref|XP_004293191.1| PREDICTED: uncharacterized protein LOC101301847 [Fragaria vesca 
subsp. vesca]
Length=1009

 Score =   364 bits (934),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 216/255 (85%), Gaps = 8/255 (3%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS++N  LRLLDDPE+GTVVEKLSE + RD++HL ELLS C AQR+IGET+LN  SSR
Sbjct  146  DLLSSENAQLRLLDDPEKGTVVEKLSEEVLRDRNHLEELLSTCAAQRKIGETSLNETSSR  205

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIES+  Q    +++ TL+A VNF+DLAGSER +Q LSAG RLKEGCHIN+SL
Sbjct  206  SHQILRLTIESTAKQLDGLQSSGTLAATVNFVDLAGSERVAQALSAGARLKEGCHINKSL  265

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SHVEQS+NTL 
Sbjct  266  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHVEQSKNTLF  325

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T A+VNVV SDKALVKQLQ++LAK+E+ L++L + S        +KEKE L
Sbjct  326  FASCAKEVTTNAKVNVVRSDKALVKQLQQQLAKMENALKSLETNS--------MKEKELL  377

Query  723  IEKMEKEMRDLMMQR  767
            +++M+KE+++L  QR
Sbjct  378  LQQMDKEIKELTKQR  392



>ref|XP_008669081.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
 ref|XP_008669082.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
 ref|XP_008669083.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
Length=947

 Score =   362 bits (930),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 212/255 (83%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NT LRL DD E+GT +E L+EV+ RD  HL EL+S+CEAQR+ GET LNG SSR
Sbjct  169  DLLSAENTSLRLWDDAEKGTYIENLTEVILRDLDHLKELISVCEAQRRTGETYLNGNSSR  228

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++S    ++TL A+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  229  SHQILKLTIESSAREFSGKDKSTTLVASVNFVDLAGSERASQALSVGARLKEGCHINRSL  288

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  289  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQISLGGNARTAIICTMSPARSHMEQSRNTLL  348

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKAL+KQLQKELA+LESELR   S    E    ++KEK+  
Sbjct  349  FASCAKEVVTNAQVNVVMSDKALIKQLQKELARLESELRCPASYPGLEA---LVKEKDNQ  405

Query  723  IEKMEKEMRDLMMQR  767
            I +MEKE+++L +QR
Sbjct  406  ILEMEKEIKELKLQR  420



>ref|XP_006290553.1| hypothetical protein CARUB_v10016639mg [Capsella rubella]
 gb|EOA23451.1| hypothetical protein CARUB_v10016639mg [Capsella rubella]
Length=981

 Score =   363 bits (932),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 185/251 (74%), Positives = 211/251 (84%), Gaps = 0/251 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E   RD +H  ELLS+C AQRQIGET LN +SSR
Sbjct  89   DLLSTDISPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCIAQRQIGETALNEVSSR  148

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  +Y      STL+A VNFIDLAGSERASQ+LSAGTRLKEG HINRSL
Sbjct  149  SHQILRLTVESTAREYLANDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGGHINRSL  208

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ SLGGNART+IICT+SPA  HVEQSRNTLL
Sbjct  209  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQTSLGGNARTSIICTLSPARIHVEQSRNTLL  268

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLE+EL + R   V   ++ +LKEK+  
Sbjct  269  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLENELSSPRQALVVSDTTALLKEKDLQ  328

Query  723  IEKMEKEMRDL  755
            IEK+ KE+  L
Sbjct  329  IEKLNKELFQL  339



>ref|XP_010426660.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Camelina sativa]
Length=926

 Score =   362 bits (929),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 210/251 (84%), Gaps = 0/251 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E   RD +H  ELLSIC AQRQIGET LN  SSR
Sbjct  40   DLLSTDISPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRQIGETALNEDSSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  +Y      STL+A VNFIDLAGSERASQ+LSAGTRLKEG HINRSL
Sbjct  100  SHQILRLTVESTAREYLANDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGGHINRSL  159

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ SLGGNART+IICT+SPA  HVEQSRNTLL
Sbjct  160  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQTSLGGNARTSIICTLSPARIHVEQSRNTLL  219

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLES+L + R   V   ++ +LKEK+  
Sbjct  220  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESQLSSPRQALVVSDTTALLKEKDLQ  279

Query  723  IEKMEKEMRDL  755
            IEK+ KE+  L
Sbjct  280  IEKLHKEVYRL  290



>ref|XP_008669085.1| PREDICTED: kinesin-like protein NACK1 isoform X3 [Zea mays]
Length=893

 Score =   361 bits (927),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 212/255 (83%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NT LRL DD E+GT +E L+EV+ RD  HL EL+S+CEAQR+ GET LNG SSR
Sbjct  169  DLLSAENTSLRLWDDAEKGTYIENLTEVILRDLDHLKELISVCEAQRRTGETYLNGNSSR  228

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++S    ++TL A+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  229  SHQILKLTIESSAREFSGKDKSTTLVASVNFVDLAGSERASQALSVGARLKEGCHINRSL  288

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  289  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQISLGGNARTAIICTMSPARSHMEQSRNTLL  348

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKAL+KQLQKELA+LESELR   S    E    ++KEK+  
Sbjct  349  FASCAKEVVTNAQVNVVMSDKALIKQLQKELARLESELRCPASYPGLEA---LVKEKDNQ  405

Query  723  IEKMEKEMRDLMMQR  767
            I +MEKE+++L +QR
Sbjct  406  ILEMEKEIKELKLQR  420



>ref|XP_008669084.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Zea mays]
Length=934

 Score =   362 bits (929),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 212/255 (83%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NT LRL DD E+GT +E L+EV+ RD  HL EL+S+CEAQR+ GET LNG SSR
Sbjct  169  DLLSAENTSLRLWDDAEKGTYIENLTEVILRDLDHLKELISVCEAQRRTGETYLNGNSSR  228

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++S    ++TL A+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  229  SHQILKLTIESSAREFSGKDKSTTLVASVNFVDLAGSERASQALSVGARLKEGCHINRSL  288

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  289  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQISLGGNARTAIICTMSPARSHMEQSRNTLL  348

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKAL+KQLQKELA+LESELR   S    E    ++KEK+  
Sbjct  349  FASCAKEVVTNAQVNVVMSDKALIKQLQKELARLESELRCPASYPGLEA---LVKEKDNQ  405

Query  723  IEKMEKEMRDLMMQR  767
            I +MEKE+++L +QR
Sbjct  406  ILEMEKEIKELKLQR  420



>ref|XP_011047311.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
 ref|XP_011047320.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
 ref|XP_011047328.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
Length=983

 Score =   363 bits (932),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 188/257 (73%), Positives = 215/257 (84%), Gaps = 4/257 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GTVVEK +E   +D  HL ELLS+CEAQR+IGET+LN  SSR
Sbjct  159  DLLSTDSTPLRLLDDPEKGTVVEKATEETLKDWDHLKELLSVCEAQRRIGETSLNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N++TLSA VNF+DLAG ERASQ LS G RLKEG HINRSL
Sbjct  219  SHQILRLTIESSACEFLGKENSTTLSATVNFVDLAGRERASQALSTGARLKEGSHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLS  R GHI YRDSKLTR+LQ +LGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  279  LTLGTVIRKLSNRRQGHINYRDSKLTRLLQPALGGNARTAIICTLSPARSHVEQSRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRA--LRSRSVDETSSLVLKEKE  716
            FA CAK+V TKAQVNVVMSDKALVK LQKE+A+LESELR+  L S + D TS  +L++K+
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKEVARLESELRSPDLASSTCDYTS--LLRQKD  396

Query  717  ALIEKMEKEMRDLMMQR  767
              I+KMEKE+R+L  QR
Sbjct  397  LQIQKMEKEIRELTNQR  413



>tpg|DAA36661.1| TPA: hypothetical protein ZEAMMB73_386599 [Zea mays]
Length=937

 Score =   362 bits (929),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 212/255 (83%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NT LRL DD E+GT +E L+EV+ RD  HL EL+S+CEAQR+ GET LNG SSR
Sbjct  169  DLLSAENTSLRLWDDAEKGTYIENLTEVILRDLDHLKELISVCEAQRRTGETYLNGNSSR  228

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++S    ++TL A+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  229  SHQILKLTIESSAREFSGKDKSTTLVASVNFVDLAGSERASQALSVGARLKEGCHINRSL  288

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  289  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQISLGGNARTAIICTMSPARSHMEQSRNTLL  348

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKAL+KQLQKELA+LESELR   S    E    ++KEK+  
Sbjct  349  FASCAKEVVTNAQVNVVMSDKALIKQLQKELARLESELRCPASYPGLEA---LVKEKDNQ  405

Query  723  IEKMEKEMRDLMMQR  767
            I +MEKE+++L +QR
Sbjct  406  ILEMEKEIKELKLQR  420



>ref|XP_010526578.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526579.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526580.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526581.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=840

 Score =   360 bits (923),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 178/255 (70%), Positives = 214/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+DNTPLRL DDPE+GT+VEK +E + RD +HL +LLSICEAQR+IGET+LN  SSR
Sbjct  159  DLLSSDNTPLRLRDDPEKGTIVEKTTEEVLRDWNHLKDLLSICEAQRKIGETSLNERSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLT+ESS  ++    N++TL+A+VNFIDLAGSERASQ +SAG RLKEGCHINRSL
Sbjct  219  SHQIIRLTVESSAREFLGKENSTTLAASVNFIDLAGSERASQAMSAGERLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR+GHI YRDSKLTRILQ  LGGNARTAI+CT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSKGRHGHINYRDSKLTRILQPCLGGNARTAIVCTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQ+NVVMSDKALVK LQ+ELA+LE ELR     ++    ++  + K+  
Sbjct  339  FACCAKEVTTKAQINVVMSDKALVKHLQRELARLEGELRNPAPAAMICDCAVASRRKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEK++ +L  QR
Sbjct  399  IQKMEKQIGELTKQR  413



>ref|XP_011047336.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Populus euphratica]
Length=976

 Score =   363 bits (931),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/257 (73%), Positives = 215/257 (84%), Gaps = 4/257 (2%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+TPLRLLDDPE+GTVVEK +E   +D  HL ELLS+CEAQR+IGET+LN  SSR
Sbjct  159  DLLSTDSTPLRLLDDPEKGTVVEKATEETLKDWDHLKELLSVCEAQRRIGETSLNEKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N++TLSA VNF+DLAG ERASQ LS G RLKEG HINRSL
Sbjct  219  SHQILRLTIESSACEFLGKENSTTLSATVNFVDLAGRERASQALSTGARLKEGSHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLS  R GHI YRDSKLTR+LQ +LGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  279  LTLGTVIRKLSNRRQGHINYRDSKLTRLLQPALGGNARTAIICTLSPARSHVEQSRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRA--LRSRSVDETSSLVLKEKE  716
            FA CAK+V TKAQVNVVMSDKALVK LQKE+A+LESELR+  L S + D TS  +L++K+
Sbjct  339  FACCAKEVTTKAQVNVVMSDKALVKHLQKEVARLESELRSPDLASSTCDYTS--LLRQKD  396

Query  717  ALIEKMEKEMRDLMMQR  767
              I+KMEKE+R+L  QR
Sbjct  397  LQIQKMEKEIRELTNQR  413



>ref|XP_006413467.1| hypothetical protein EUTSA_v10026976mg [Eutrema salsugineum]
 gb|ESQ54920.1| hypothetical protein EUTSA_v10026976mg [Eutrema salsugineum]
Length=997

 Score =   363 bits (932),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 189/261 (72%), Positives = 221/261 (85%), Gaps = 11/261 (4%)
 Frame = +3

Query  3    DLLSTD-NTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSS  179
            DLL  D NTPLRLLDDPERGTVVEKL E    D++HL ELLSICE QR+IGET+LN  SS
Sbjct  141  DLLCEDSNTPLRLLDDPERGTVVEKLREETLTDRNHLEELLSICETQRKIGETSLNETSS  200

Query  180  RSHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRS  359
            RSHQILRLTIESS  + S    ++ L+A+V F+DLAGSERASQTLSAG+RLKEGCHINRS
Sbjct  201  RSHQILRLTIESSNREDS----SAILAASVCFVDLAGSERASQTLSAGSRLKEGCHINRS  256

Query  360  LLTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTL  539
            LLTLGTVIRKLSKG+NGHIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SH+EQSRNTL
Sbjct  257  LLTLGTVIRKLSKGKNGHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHMEQSRNTL  316

Query  540  LFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRAL-----RSRSVDETSSLVL  704
            LFATCAK+V T AQVN+V+S+KALV+QLQ+ELA++E+EL+ L      S + DE  +L L
Sbjct  317  LFATCAKEVTTNAQVNMVVSEKALVRQLQRELARMENELKNLGPASSSSSASDEFYAL-L  375

Query  705  KEKEALIEKMEKEMRDLMMQR  767
            K+KE LI KME+++++L  QR
Sbjct  376  KQKEELIAKMEEQIQELKWQR  396



>gb|KEH20388.1| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=1146

 Score =   366 bits (939),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 184/262 (70%), Positives = 218/262 (83%), Gaps = 7/262 (3%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D TPLRLLDDPE+GTVVEKL+E   RD +H +EL+S CE QRQIGET+LN +SSR
Sbjct  156  DLLSNDTTPLRLLDDPEKGTVVEKLTEETLRDWNHFTELISFCETQRQIGETSLNEVSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILR+TIESS  ++     +S L+A+VNF+DLAGSERASQT SAGTRLKEGCHINRSL
Sbjct  216  SHQILRMTIESSAREFLGNYKSSALAASVNFVDLAGSERASQTNSAGTRLKEGCHINRSL  275

Query  363  LTLGTVIRKL-------SKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVE  521
            LTLGTVIRKL       SKGRNGHIP+RDSKLTRILQ S+GGNARTAIICTMSPA S+VE
Sbjct  276  LTLGTVIRKLRKHEFDHSKGRNGHIPFRDSKLTRILQSSIGGNARTAIICTMSPARSYVE  335

Query  522  QSRNTLLFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLV  701
            Q+RNTLLFA+CAK+V+T A+VNVV+SDK+LVKQLQ+ELA+LESEL+   S      S+ +
Sbjct  336  QTRNTLLFASCAKEVSTNAKVNVVVSDKSLVKQLQRELARLESELKKSGSTQRKPDSAEL  395

Query  702  LKEKEALIEKMEKEMRDLMMQR  767
            L+EK+  IE ++KE+ DL MQR
Sbjct  396  LREKDLQIEMLKKEIMDLAMQR  417



>dbj|BAJ94998.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=873

 Score =   360 bits (923),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 213/255 (84%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS++NT LRL DD E+GT VE L EV+ RD +HL EL+S+CEAQR+ GET LN  SSR
Sbjct  101  DLLSSENTSLRLWDDAEKGTYVENLKEVILRDWNHLKELISVCEAQRRTGETYLNENSSR  160

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++     ++TL+A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  161  SHQILKLTIESSAREFLGKDKSTTLAASVNFVDLAGSERASQALSAGARLKEGCHINRSL  220

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA S++EQSRNTLL
Sbjct  221  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSYMEQSRNTLL  280

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELA+LESELR   + S  E    ++KEK+  
Sbjct  281  FASCAKEVVTNAQVNVVMSDKALVKHLQRELARLESELRCPATYSSLEA---LVKEKDNH  337

Query  723  IEKMEKEMRDLMMQR  767
            I KMEKE+++L +QR
Sbjct  338  IRKMEKEIKELKVQR  352



>ref|XP_006404570.1| hypothetical protein EUTSA_v10000043mg [Eutrema salsugineum]
 gb|ESQ46023.1| hypothetical protein EUTSA_v10000043mg [Eutrema salsugineum]
Length=862

 Score =   359 bits (922),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 177/255 (69%), Positives = 212/255 (83%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRL DDPE+G VVEK +E + RD +HL +L+S+CEAQR+IGET+LN  SSR
Sbjct  159  DLLSPDSTPLRLRDDPEKGAVVEKTTEEILRDWNHLKDLISVCEAQRKIGETSLNERSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI++LT+ESS  ++    N++TL A+VNFIDLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  219  SHQIIKLTVESSAREFLGKENSTTLMASVNFIDLAGSERASQALSAGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GHI YRDSKLTRILQ  LGGNARTAI+CT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSKGRQGHINYRDSKLTRILQPCLGGNARTAIVCTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQ+NVVMSDKALVKQLQ+ELA+LESELR     +      + L++K+  
Sbjct  339  FACCAKEVTTKAQINVVMSDKALVKQLQRELARLESELRNPAPATSSCDCGVALRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEK++ ++  QR
Sbjct  399  IQKMEKQLAEMTKQR  413



>ref|XP_010503800.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=1040

 Score =   363 bits (932),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 209/248 (84%), Gaps = 0/248 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E   RD +H  ELLSIC AQRQIGET LN  SSR
Sbjct  154  DLLSTDISPLRLLDDPEKGTVVEKLTEETVRDWNHFKELLSICIAQRQIGETALNEDSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  +Y      STL+A VNFIDLAGSERASQ+LSAGTRLKEG HINRSL
Sbjct  214  SHQILRLTVESTAREYLANDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGGHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ SLGGNART+IICT+SPA  HVEQSRNTLL
Sbjct  274  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQTSLGGNARTSIICTLSPARIHVEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLESEL + R   V   ++ +LKEK+  
Sbjct  334  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESELSSPRQALVVSDTTALLKEKDLQ  393

Query  723  IEKMEKEM  746
            IEK+ KE+
Sbjct  394  IEKLHKEV  401



>ref|XP_010240186.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Brachypodium 
distachyon]
Length=940

 Score =   361 bits (926),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 213/255 (84%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS++NT LRL DD E+GT VE L EV+ RD +HL EL+S+CEAQR+ GET LN  SSR
Sbjct  168  DLLSSENTSLRLWDDAEKGTYVENLKEVILRDWNHLKELISLCEAQRRTGETYLNENSSR  227

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++     ++TL+A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  228  SHQILKLTIESSAREFLGKDKSTTLAASVNFVDLAGSERASQALSAGARLKEGCHINRSL  287

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA S++EQSRNTLL
Sbjct  288  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSYMEQSRNTLL  347

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELA+LESELR   + S  E    ++KEK+  
Sbjct  348  FASCAKEVVTNAQVNVVMSDKALVKHLQRELARLESELRYPATYSSLEA---LVKEKDNH  404

Query  723  IEKMEKEMRDLMMQR  767
            I KMEKE++DL +QR
Sbjct  405  IRKMEKEIKDLKVQR  419



>emb|CDX82016.1| BnaC08g35850D [Brassica napus]
Length=862

 Score =   359 bits (921),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 178/255 (70%), Positives = 212/255 (83%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRL DDPE+G VVEK +E + RD +HL +L+S+CEAQR+IGET+LN  SSR
Sbjct  159  DLLSPDSTPLRLRDDPEKGAVVEKTTEEVLRDWNHLKDLISVCEAQRKIGETSLNQKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI++LT+ESS  ++    N++TL A+VNFIDLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  219  SHQIIKLTVESSAREFLGKENSATLIASVNFIDLAGSERASQALSAGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLS GR GHI YRDSKLTRILQ  LGGNARTAI+CT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSMGRQGHINYRDSKLTRILQPCLGGNARTAIVCTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQ+NVVMSDKALVKQLQ+ELA+LESELR     S      +VL++K+  
Sbjct  339  FACCAKEVTTKAQINVVMSDKALVKQLQRELARLESELRNPAPASSSCDCGVVLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEK++ ++  QR
Sbjct  399  IQKMEKQLVEMTKQR  413



>ref|NP_001190049.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE78757.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1054

 Score =   363 bits (932),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 185/251 (74%), Positives = 211/251 (84%), Gaps = 0/251 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLR+LDDPE+GTVVEKL+E   RD +H  ELLSIC AQRQIGET LN +SSR
Sbjct  154  DLLSTDISPLRVLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRQIGETALNEVSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  +Y      STL+A VNFIDLAGSERASQ+LSAGTRLKEG HINRSL
Sbjct  214  SHQILRLTVESTAREYLAKDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGGHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ SLGGNART+IICT+SPA  HVEQSRNTLL
Sbjct  274  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQTSLGGNARTSIICTLSPARVHVEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALV+ LQ+ELAKLESEL + R   V   ++ +LKEK+  
Sbjct  334  FASCAKEVTTNAQVNVVMSDKALVRHLQRELAKLESELSSPRQALVVSDTTALLKEKDLQ  393

Query  723  IEKMEKEMRDL  755
            IEK+ KE+  L
Sbjct  394  IEKLNKEVFQL  404



>ref|NP_190684.3| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE78756.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1052

 Score =   363 bits (932),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 185/251 (74%), Positives = 211/251 (84%), Gaps = 0/251 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLR+LDDPE+GTVVEKL+E   RD +H  ELLSIC AQRQIGET LN +SSR
Sbjct  154  DLLSTDISPLRVLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRQIGETALNEVSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  +Y      STL+A VNFIDLAGSERASQ+LSAGTRLKEG HINRSL
Sbjct  214  SHQILRLTVESTAREYLAKDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGGHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ SLGGNART+IICT+SPA  HVEQSRNTLL
Sbjct  274  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQTSLGGNARTSIICTLSPARVHVEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALV+ LQ+ELAKLESEL + R   V   ++ +LKEK+  
Sbjct  334  FASCAKEVTTNAQVNVVMSDKALVRHLQRELAKLESELSSPRQALVVSDTTALLKEKDLQ  393

Query  723  IEKMEKEMRDL  755
            IEK+ KE+  L
Sbjct  394  IEKLNKEVFQL  404



>ref|XP_009117419.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
 ref|XP_009117420.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=862

 Score =   359 bits (921),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 178/255 (70%), Positives = 212/255 (83%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRL DDPE+G VVEK +E + RD +HL +L+S+CEAQR+IGET+LN  SSR
Sbjct  159  DLLSPDSTPLRLRDDPEKGAVVEKTTEEVLRDWNHLKDLISVCEAQRKIGETSLNQKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI++LT+ESS  ++    N++TL A+VNFIDLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  219  SHQIIKLTVESSAREFLGKENSATLIASVNFIDLAGSERASQALSAGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLS GR GHI YRDSKLTRILQ  LGGNARTAI+CT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSMGRQGHINYRDSKLTRILQPCLGGNARTAIVCTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQ+NVVMSDKALVKQLQ+ELA+LESELR     S      +VL++K+  
Sbjct  339  FACCAKEVTTKAQINVVMSDKALVKQLQRELARLESELRNPAPASSSCDCGVVLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEK++ ++  QR
Sbjct  399  IQKMEKQLVEMTKQR  413



>gb|EYU37862.1| hypothetical protein MIMGU_mgv1a001175mg [Erythranthe guttata]
Length=872

 Score =   359 bits (922),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 214/255 (84%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTDNTPLRL+DDPE+GT++EKL+E   RD++HL ELLSIC AQRQIGET LN  SSR
Sbjct  160  DLLSTDNTPLRLMDDPEKGTIIEKLTEETLRDRNHLKELLSICAAQRQIGETLLNETSSR  219

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N++TL+A+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  220  SHQILRLTIESSAREFLGKGNSTTLAASVNFVDLAGSERASQALSVGQRLKEGCHINRSL  279

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGR GH+ YRDSKLTRILQ +LGGNARTAIIC ++P  SHV+QSRNTLL
Sbjct  280  LTLGTVIRKLSKGRQGHVNYRDSKLTRILQPALGGNARTAIICNLNPTRSHVDQSRNTLL  339

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V+T AQVNVV+SDKALVK LQKE+A+LE ELR   S       + +L++K+  
Sbjct  340  FASCAKEVSTNAQVNVVLSDKALVKHLQKEVARLEIELRTPGSMC---NHAELLRKKDMQ  396

Query  723  IEKMEKEMRDLMMQR  767
            IEK+EKE+R+L  Q+
Sbjct  397  IEKLEKEVRELKKQQ  411



>emb|CDY13822.1| BnaA09g43240D [Brassica napus]
Length=862

 Score =   359 bits (921),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 178/255 (70%), Positives = 212/255 (83%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRL DDPE+G VVEK +E + RD +HL +L+S+CEAQR+IGET+LN  SSR
Sbjct  159  DLLSPDSTPLRLRDDPEKGAVVEKTTEEVLRDWNHLKDLISVCEAQRKIGETSLNQKSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI++LT+ESS  ++    N++TL A+VNFIDLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  219  SHQIIKLTVESSAREFLGKENSATLIASVNFIDLAGSERASQALSAGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLS GR GHI YRDSKLTRILQ  LGGNARTAI+CT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSMGRQGHINYRDSKLTRILQPCLGGNARTAIVCTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQ+NVVMSDKALVKQLQ+ELA+LESELR     S      +VL++K+  
Sbjct  339  FACCAKEVTTKAQINVVMSDKALVKQLQRELARLESELRNPAPASSSCDCGVVLRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEK++ ++  QR
Sbjct  399  IQKMEKQLVEMTKQR  413



>ref|XP_004958729.1| PREDICTED: kinesin-like protein NACK1-like [Setaria italica]
Length=913

 Score =   360 bits (924),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 211/255 (83%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D T LRLLDDPE+GTVVEKL+E   RD+ HL ELL++CEAQRQIGET LN  SSR
Sbjct  141  DLLSPDATQLRLLDDPEKGTVVEKLTEETLRDKGHLLELLAVCEAQRQIGETALNETSSR  200

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  Q+    N+STL A VNF+DLAGSERASQT SAG RLKEG HINRSL
Sbjct  201  SHQILRLTIESSAKQFMGRGNSSTLIACVNFVDLAGSERASQTQSAGMRLKEGSHINRSL  260

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG VIR+LSKG NGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA  H+EQSRNTLL
Sbjct  261  LTLGKVIRQLSKGGNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPAQCHIEQSRNTLL  320

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK V T AQVN VMSDK LVK LQ+ELA+LE+EL++  S S   T + VL+EK+ L
Sbjct  321  FANCAKNVVTNAQVNAVMSDKVLVKHLQRELARLENELKSPGSASC-STHAEVLREKDEL  379

Query  723  IEKMEKEMRDLMMQR  767
            I+++E+++++LM QR
Sbjct  380  IKQLEEQLKELMEQR  394



>gb|KHG01762.1| Kinesin-related 11 [Gossypium arboreum]
Length=909

 Score =   360 bits (923),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 179/255 (70%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL++ NT LRL DDPERGT+VEK++E   +D +HL ELL+ICEAQR+IGET+LN  SSR
Sbjct  162  DLLTSGNTQLRLRDDPERGTIVEKVTEEPLKDWNHLKELLAICEAQRRIGETSLNERSSR  221

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIESS  ++    N+++L+A+VNFIDLAGSERASQ LS G RLKEGCHINRSL
Sbjct  222  SHQIIRLTIESSAREFLGKENSTSLAASVNFIDLAGSERASQALSTGARLKEGCHINRSL  281

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTL TV+RKLSKGR GHI YRDSKLTR+LQ  LGGNARTAIICT+SPA SHVEQ+RNTLL
Sbjct  282  LTLSTVVRKLSKGRQGHINYRDSKLTRLLQPCLGGNARTAIICTLSPARSHVEQTRNTLL  341

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQVNVVMSDKALVK LQ+E+A+LESELR+    S +   + +L++K+  
Sbjct  342  FACCAKEVTTKAQVNVVMSDKALVKHLQREVARLESELRSPVPPSSNSDYATLLRKKDLQ  401

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEKE+R+L MQR
Sbjct  402  IQKMEKEIRELTMQR  416



>gb|KCW53111.1| hypothetical protein EUGRSUZ_J02403 [Eucalyptus grandis]
Length=875

 Score =   359 bits (921),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRLLDDPERGTVVEKL+E   +D SH  ELLS+CEAQRQ+GET LN  SS 
Sbjct  132  DLLSADSTPLRLLDDPERGTVVEKLTEETLKDWSHFQELLSVCEAQRQVGETCLNEASSG  191

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+STLSA VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  192  SHQILRLTIESSAREFLGTNNSSTLSATVNFVDLAGSERASQSLSAGARLKEGCHINRSL  251

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKGRNGHIP+RDSKLTRILQ SLGGNART+IICTMSPA  HVEQSRNTLL
Sbjct  252  LTLGTVIRKLSKGRNGHIPFRDSKLTRILQSSLGGNARTSIICTMSPACGHVEQSRNTLL  311

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELR  659
            FA+CAK+ AT AQV VVMSDKALVK LQ+ELA+LESELR
Sbjct  312  FASCAKEAATNAQVIVVMSDKALVKHLQRELARLESELR  350



>ref|XP_008796871.1| PREDICTED: kinesin-like protein NACK1 [Phoenix dactylifera]
Length=962

 Score =   361 bits (926),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 217/255 (85%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD+   RLLDDPE+GT+VEKL+E + RD +HL EL+S+CEAQR+IGET+LN  SSR
Sbjct  171  DLLSTDSATSRLLDDPEKGTIVEKLTEEILRDWNHLKELISVCEAQRKIGETSLNETSSR  230

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N+STL A+VNF+DLAGSERASQ  SAG RLKEGCHINRSL
Sbjct  231  SHQILRLTIESSAREFLGKENSSTLVASVNFVDLAGSERASQASSAGARLKEGCHINRSL  290

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTV+RKLSKGRNGHIPYRDSKLTRILQ  LGGN+RTAIICTMSPA SH+EQSRNTLL
Sbjct  291  LTLGTVVRKLSKGRNGHIPYRDSKLTRILQPFLGGNSRTAIICTMSPARSHIEQSRNTLL  350

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVV SDKALVK LQKELA+LESELR  RS S   TS  V+KEK+A 
Sbjct  351  FASCAKEVVTSAQVNVVTSDKALVKHLQKELARLESELRYPRSSS---TSEGVMKEKDAQ  407

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEKE++ L  QR
Sbjct  408  IKKMEKEIKKLTQQR  422



>ref|XP_002876073.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52332.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=1008

 Score =   362 bits (928),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 185/251 (74%), Positives = 210/251 (84%), Gaps = 0/251 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E   RD +H  ELLSIC AQR IGET LN +SSR
Sbjct  154  DLLSTDISPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRHIGETALNEVSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  +Y      STL+A VNFIDLAGSERASQ+LSAGTRLKEG HINRSL
Sbjct  214  SHQILRLTVESTAREYLAKDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGGHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ SLGGNART+IICT+SPA  HVEQSRNTLL
Sbjct  274  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQTSLGGNARTSIICTLSPARIHVEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLESEL + R   V   ++ +LK+K+  
Sbjct  334  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESELSSPRQALVVSDTTALLKDKDLQ  393

Query  723  IEKMEKEMRDL  755
            IEK+ KE+  L
Sbjct  394  IEKLNKEVFQL  404



>ref|XP_003578490.1| PREDICTED: kinesin-like protein NACK1 [Brachypodium distachyon]
 ref|XP_010238416.1| PREDICTED: kinesin-like protein NACK1 [Brachypodium distachyon]
Length=880

 Score =   358 bits (920),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 181/255 (71%), Positives = 213/255 (84%), Gaps = 1/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D TPLRLLDDPE+GTVVEKL+E   RD+ HL ELL++CEAQRQIGET LN  SSR
Sbjct  142  DLLSSDATPLRLLDDPEKGTVVEKLTEETLRDKGHLLELLAVCEAQRQIGETALNETSSR  201

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  Q+    N++TL A VNF+DLAGSERASQT ++G RLKEG HIN+SL
Sbjct  202  SHQILRLTVESSARQFLGRGNSNTLLACVNFVDLAGSERASQTAASGMRLKEGSHINKSL  261

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLG VIR+LS GRNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPAH HVEQSRNTLL
Sbjct  262  LTLGKVIRQLSGGRNGHIPYRDSKLTRILQSSLGGNARTAIICTMSPAHCHVEQSRNTLL  321

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK V T AQVN+V+SDKALVK LQ+ELAKLE+EL+   S S   + +  LKEK+  
Sbjct  322  FANCAKNVVTNAQVNLVLSDKALVKHLQRELAKLENELKFPGSASCS-SHAEALKEKDEQ  380

Query  723  IEKMEKEMRDLMMQR  767
            I+K+E+++++LM ++
Sbjct  381  IKKLEEQLKELMEEK  395



>ref|XP_009597015.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana tomentosiformis]
Length=1007

 Score =   361 bits (927),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 208/255 (82%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+ PLRLLDDPERGTVVEKL+E   RD  H+ +LLSICEAQRQIGET  N  SSR
Sbjct  156  DLLSEDSAPLRLLDDPERGTVVEKLTEETLRDWGHVIQLLSICEAQRQIGETAFNETSSR  215

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI+RLTIESS  ++    N  TL A VNF+DLAGSERASQ+LSAG RLKEGCHINRSL
Sbjct  216  SHQIIRLTIESSAREHLGGDNLGTLLATVNFVDLAGSERASQSLSAGARLKEGCHINRSL  275

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK R GHIP+RDSKLTRILQ SL  N RTA+ICTMSPA SHVEQSRNTLL
Sbjct  276  LTLGTVIRKLSKDRTGHIPFRDSKLTRILQPSLSDNGRTAVICTMSPARSHVEQSRNTLL  335

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNV MSDKALVK LQ+ELA+LESELR  R+         +L+EK+  
Sbjct  336  FASCAKEVTTNAQVNVAMSDKALVKHLQRELARLESELRYPRACIFPSDYEALLQEKDLQ  395

Query  723  IEKMEKEMRDLMMQR  767
            I+++EKE++DL++QR
Sbjct  396  IQQLEKEIKDLILQR  410



>ref|XP_009137750.1| PREDICTED: kinesin-like protein NACK2 [Brassica rapa]
Length=1183

 Score =   364 bits (935),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/261 (72%), Positives = 222/261 (85%), Gaps = 8/261 (3%)
 Frame = +3

Query  3    DLLSTDNT-PLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSS  179
            DLL  DN  PLRLLDDPERGTVVEKL E    D++HL EL+SICE QR+IGET+LN  SS
Sbjct  142  DLLCEDNNNPLRLLDDPERGTVVEKLKEETITDRNHLEELISICETQRKIGETSLNETSS  201

Query  180  RSHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRS  359
            RSHQILRLTIESS  + S P +++ L+A+V F+DLAGSERASQTLSAG+RLKEGCHINRS
Sbjct  202  RSHQILRLTIESSNREVS-PESSAILAASVCFVDLAGSERASQTLSAGSRLKEGCHINRS  260

Query  360  LLTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTL  539
            LLTLGTVIRKLSKG++GHIPYRDSKLTRILQ+SLGGNARTAIICTMSPA SH+EQSRNTL
Sbjct  261  LLTLGTVIRKLSKGKHGHIPYRDSKLTRILQNSLGGNARTAIICTMSPARSHLEQSRNTL  320

Query  540  LFATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRAL-----RSRSVDETSSLVL  704
            LFATCAK+V T AQVN+V+S+KALVKQLQ+EL ++E+EL+ L      S + DE  SL L
Sbjct  321  LFATCAKEVTTNAQVNMVVSEKALVKQLQRELMRMENELKNLGLGSSSSSTSDEFHSL-L  379

Query  705  KEKEALIEKMEKEMRDLMMQR  767
            K+KE +IEKME+++++L  QR
Sbjct  380  KQKEEVIEKMEEQIQELKWQR  400



>dbj|BAJ95863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=936

 Score =   360 bits (923),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 213/255 (84%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS++NT LRL DD E+GT VE L EV+ RD +HL EL+S+CEAQR+ GET LN  SSR
Sbjct  164  DLLSSENTSLRLWDDAEKGTYVENLKEVILRDWNHLKELISVCEAQRRTGETYLNENSSR  223

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++     ++TL+A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  224  SHQILKLTIESSAREFLGKDKSTTLAASVNFVDLAGSERASQALSAGARLKEGCHINRSL  283

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA S++EQSRNTLL
Sbjct  284  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSYMEQSRNTLL  343

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELA+LESELR   + S  E    ++KEK+  
Sbjct  344  FASCAKEVVTNAQVNVVMSDKALVKHLQRELARLESELRCPATYSSLEA---LVKEKDNH  400

Query  723  IEKMEKEMRDLMMQR  767
            I KMEKE+++L +QR
Sbjct  401  IRKMEKEIKELKVQR  415



>ref|XP_010426656.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010426657.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010426658.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010426659.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=1040

 Score =   362 bits (928),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 210/251 (84%), Gaps = 0/251 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLRLLDDPE+GTVVEKL+E   RD +H  ELLSIC AQRQIGET LN  SSR
Sbjct  154  DLLSTDISPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRQIGETALNEDSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  +Y      STL+A VNFIDLAGSERASQ+LSAGTRLKEG HINRSL
Sbjct  214  SHQILRLTVESTAREYLANDKFSTLTATVNFIDLAGSERASQSLSAGTRLKEGGHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+NGHIP+RDSKLTRILQ SLGGNART+IICT+SPA  HVEQSRNTLL
Sbjct  274  LTLGTVIRKLSKGKNGHIPFRDSKLTRILQTSLGGNARTSIICTLSPARIHVEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELAKLES+L + R   V   ++ +LKEK+  
Sbjct  334  FASCAKEVTTNAQVNVVMSDKALVKHLQRELAKLESQLSSPRQALVVSDTTALLKEKDLQ  393

Query  723  IEKMEKEMRDL  755
            IEK+ KE+  L
Sbjct  394  IEKLHKEVYRL  404



>ref|XP_008663419.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Zea mays]
 ref|XP_008663420.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Zea mays]
 gb|ACN34614.1| unknown [Zea mays]
 gb|AFW59004.1| kinesin heavy chain [Zea mays]
Length=939

 Score =   359 bits (922),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 210/255 (82%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NT LRL DD E+GT VE L+EV  RD  HL EL+S CEAQR+ GET LN  SSR
Sbjct  169  DLLSAENTSLRLWDDAEKGTYVENLTEVTLRDSDHLKELISTCEAQRRTGETYLNENSSR  228

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++     ++TL A+VNF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  229  SHQILKLTIESSAHEFLGKDKSTTLVASVNFVDLAGSERASQALSAGTRLKEGCHINRSL  288

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  289  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSHMEQSRNTLL  348

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVKQLQKELA+LESELR   S S  E    +++EK+  
Sbjct  349  FASCAKEVVTNAQVNVVMSDKALVKQLQKELARLESELRCPASYSGLEA---LVREKDNQ  405

Query  723  IEKMEKEMRDLMMQR  767
            I KM+KE+++L + R
Sbjct  406  IRKMDKEIKELKLHR  420



>ref|XP_008663418.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Zea mays]
 gb|AFW59005.1| hypothetical protein ZEAMMB73_363128 [Zea mays]
Length=944

 Score =   359 bits (922),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 210/255 (82%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NT LRL DD E+GT VE L+EV  RD  HL EL+S CEAQR+ GET LN  SSR
Sbjct  169  DLLSAENTSLRLWDDAEKGTYVENLTEVTLRDSDHLKELISTCEAQRRTGETYLNENSSR  228

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++     ++TL A+VNF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  229  SHQILKLTIESSAHEFLGKDKSTTLVASVNFVDLAGSERASQALSAGTRLKEGCHINRSL  288

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA SH+EQSRNTLL
Sbjct  289  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSHMEQSRNTLL  348

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVKQLQKELA+LESELR   S S  E    +++EK+  
Sbjct  349  FASCAKEVVTNAQVNVVMSDKALVKQLQKELARLESELRCPASYSGLEA---LVREKDNQ  405

Query  723  IEKMEKEMRDLMMQR  767
            I KM+KE+++L + R
Sbjct  406  IRKMDKEIKELKLHR  420



>emb|CDX99601.1| BnaC04g33580D [Brassica napus]
Length=818

 Score =   356 bits (913),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 176/255 (69%), Positives = 209/255 (82%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRL DDPE+G VVEK  E + RD +H  +L+SICEAQR+IGET+LN  SSR
Sbjct  159  DLLSPDSTPLRLRDDPEKGAVVEKTREEVLRDWNHFKDLISICEAQRKIGETSLNERSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI++LT+ESS  ++    N++TL A+VNFIDLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  219  SHQIIKLTVESSAREFLGKENSTTLLASVNFIDLAGSERASQALSAGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLS GR GHI +RDSKLTRILQ  LGGNARTAI+CT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSNGRQGHINFRDSKLTRILQPCLGGNARTAIVCTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQ+NVVMSDKALVKQLQ+ELA+LESELR     +      + L++K+  
Sbjct  339  FACCAKEVTTKAQINVVMSDKALVKQLQRELARLESELRNPAPATSSCDCGVALRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEK++ D+  QR
Sbjct  399  IQKMEKQLADMTKQR  413



>gb|EMS68002.1| Kinesin-related protein 11 [Triticum urartu]
Length=928

 Score =   358 bits (920),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 213/255 (84%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS++NT LRL DD E+GT VE L EV+ RD +HL EL+S+CEAQR+ GET LN  SSR
Sbjct  161  DLLSSENTSLRLWDDAEKGTYVENLKEVILRDWNHLKELISVCEAQRRTGETYLNENSSR  220

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQIL+LTIESS  ++     ++TL+A+VNF+DLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  221  SHQILKLTIESSAREFLGKDKSTTLAASVNFVDLAGSERASQALSAGARLKEGCHINRSL  280

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK RNGHIPYRDSKLTRILQ SLGGNARTAIICTMSPA S++EQSRNTLL
Sbjct  281  LTLGTVIRKLSKVRNGHIPYRDSKLTRILQPSLGGNARTAIICTMSPARSYMEQSRNTLL  340

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQ+ELA+LESELR   + S  E+   +++EK+  
Sbjct  341  FASCAKEVVTNAQVNVVMSDKALVKHLQRELARLESELRCPATYSSLES---LVREKDNH  397

Query  723  IEKMEKEMRDLMMQR  767
            I KMEKE+++L  QR
Sbjct  398  IRKMEKEIKELKAQR  412



>ref|XP_009777060.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein NACK1 [Nicotiana 
sylvestris]
Length=889

 Score =   357 bits (917),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 181/255 (71%), Positives = 212/255 (83%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS+D+TPLR+LDDPE+GT++EKL+E   R   HL ELLSICEAQRQ GET LN  SSR
Sbjct  160  DLLSSDSTPLRMLDDPEKGTIIEKLTEETLRGWDHLKELLSICEAQRQTGETYLNLASSR  219

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIESS  ++    N +TL+A+VNF+DLAGSERASQ LS G RLKEGCHINRSL
Sbjct  220  SHQILRLTIESSAREFIGKENKTTLAASVNFVDLAGSERASQALSVGQRLKEGCHINRSL  279

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLS  R+GH+ YRDSKLTRILQ +LGGNARTAIICT+SPA SHVEQSRNTLL
Sbjct  280  LTLGTVIRKLSMARHGHVNYRDSKLTRILQPALGGNARTAIICTLSPAQSHVEQSRNTLL  339

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T AQVNVVMSDKALVK LQKELA+LESE++   + + D  +  +L++K+  
Sbjct  340  FASCAKEVTTNAQVNVVMSDKALVKHLQKELARLESEIKTPIT-TCDHVA--LLRKKDQQ  396

Query  723  IEKMEKEMRDLMMQR  767
            IEK+E EMR+L  QR
Sbjct  397  IEKLENEMRELTKQR  411



>ref|XP_010429028.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010429029.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010429030.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=862

 Score =   357 bits (916),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/255 (69%), Positives = 211/255 (83%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRL DDPE+G VVEK +E   RD +HL +L+S+CEAQR+IGET+LN  SSR
Sbjct  159  DLLSPDSTPLRLRDDPEKGAVVEKATEETLRDWNHLKDLISVCEAQRKIGETSLNERSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI++LT+ESS  ++    N++TL A+VNFIDLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  219  SHQIIKLTVESSAREFLGKENSTTLMASVNFIDLAGSERASQALSAGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLS GR GHI YRDSKLTRILQ  LGGNARTAI+CT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSNGRQGHINYRDSKLTRILQPCLGGNARTAIVCTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQ+NVVMSDKALVKQLQ+ELA+LESELR     ++     + L++K+  
Sbjct  339  FACCAKEVTTKAQINVVMSDKALVKQLQRELARLESELRNPAPATLSCDCGVALRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEK++ ++  QR
Sbjct  399  IQKMEKQLAEMTKQR  413



>ref|XP_010416871.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010416872.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010416873.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=862

 Score =   357 bits (915),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/255 (69%), Positives = 211/255 (83%), Gaps = 0/255 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS D+TPLRL DDPE+G VVEK +E   RD +HL +L+S+CEAQR+IGET+LN  SSR
Sbjct  159  DLLSPDSTPLRLRDDPEKGAVVEKATEETLRDWNHLKDLISVCEAQRKIGETSLNERSSR  218

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQI++LT+ESS  ++    N++TL A+VNFIDLAGSERASQ LSAG RLKEGCHINRSL
Sbjct  219  SHQIIKLTVESSAREFLGKENSTTLMASVNFIDLAGSERASQALSAGARLKEGCHINRSL  278

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLS GR GHI YRDSKLTRILQ  LGGNARTAI+CT+SPA SHVEQ+RNTLL
Sbjct  279  LTLGTVIRKLSNGRQGHINYRDSKLTRILQPCLGGNARTAIVCTLSPARSHVEQTRNTLL  338

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA CAK+V TKAQ+NVVMSDKALVKQLQ+ELA+LESELR     ++     + L++K+  
Sbjct  339  FACCAKEVTTKAQINVVMSDKALVKQLQRELARLESELRNPAPATLSCDCGVALRKKDLQ  398

Query  723  IEKMEKEMRDLMMQR  767
            I+KMEK++ ++  QR
Sbjct  399  IQKMEKQLAEMTKQR  413



>gb|EEC73693.1| hypothetical protein OsI_08272 [Oryza sativa Indica Group]
Length=854

 Score =   356 bits (913),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 207/255 (81%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NTPLRL DD E+GT VE L+EV+ RD +HL  L+S+CEAQR+ GET LN  SSR
Sbjct  138  DLLSAENTPLRLWDDAEKGTYVENLTEVVLRDWNHLKGLISVCEAQRRTGETFLNEKSSR  197

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++     ++TL A+ NF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  198  SHQILRLTVESSAREFLGKDKSTTLVASANFVDLAGSERASQALSAGTRLKEGCHINRSL  257

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            L LGTVIRKLS G N HIPYRDSKLTRILQ SLGGNARTAIICT+SPA SH+EQSRNTLL
Sbjct  258  LALGTVIRKLSMGSNAHIPYRDSKLTRILQPSLGGNARTAIICTLSPATSHIEQSRNTLL  317

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            F +CAK+V T AQVNVVMSDKALVK LQKELA+LESELR     S  ET   +LKEK+  
Sbjct  318  FGSCAKEVVTNAQVNVVMSDKALVKHLQKELARLESELRHPVQSSSLET---LLKEKDNQ  374

Query  723  IEKMEKEMRDLMMQR  767
            I KMEKE+++L  QR
Sbjct  375  IRKMEKEIKELKSQR  389



>gb|EEE57470.1| hypothetical protein OsJ_07710 [Oryza sativa Japonica Group]
Length=850

 Score =   356 bits (913),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 207/255 (81%), Gaps = 3/255 (1%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLS +NTPLRL DD E+GT VE L+EV+ RD +HL  L+S+CEAQR+ GET LN  SSR
Sbjct  168  DLLSAENTPLRLWDDAEKGTYVENLTEVVLRDWNHLKGLISVCEAQRRTGETFLNEKSSR  227

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ESS  ++     ++TL A+ NF+DLAGSERASQ LSAGTRLKEGCHINRSL
Sbjct  228  SHQILRLTVESSAREFLGKDKSTTLVASANFVDLAGSERASQALSAGTRLKEGCHINRSL  287

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            L LGTVIRKLS G N HIPYRDSKLTRILQ SLGGNARTAIICT+SPA SH+EQSRNTLL
Sbjct  288  LALGTVIRKLSMGSNAHIPYRDSKLTRILQPSLGGNARTAIICTLSPATSHIEQSRNTLL  347

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            F +CAK+V T AQVNVVMSDKALVK LQKELA+LESELR     S  ET   +LKEK+  
Sbjct  348  FGSCAKEVVTNAQVNVVMSDKALVKHLQKELARLESELRHPVQSSSLET---LLKEKDNQ  404

Query  723  IEKMEKEMRDLMMQR  767
            I KMEKE+++L  QR
Sbjct  405  IRKMEKEIKELKSQR  419



>emb|CDX73746.1| BnaC08g22570D [Brassica napus]
Length=968

 Score =   358 bits (919),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 182/251 (73%), Positives = 208/251 (83%), Gaps = 0/251 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLLSTD +PLR+LDDPE+GT+VEKL+E   RD  H  ELLSIC AQRQIGET LN +SSR
Sbjct  154  DLLSTDTSPLRILDDPEKGTIVEKLTEETLRDWKHFKELLSICIAQRQIGETALNEVSSR  213

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLT+ES+  +Y      STL+A VNF+DLAGSERASQ+LSAGTRLKEG HINRSL
Sbjct  214  SHQILRLTVESTAREYLANEKFSTLTATVNFVDLAGSERASQSLSAGTRLKEGGHINRSL  273

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSK + GHIP+RDSKLTRILQ SLGGNARTAIICT+SPA  HVEQSRNTLL
Sbjct  274  LTLGTVIRKLSKEKTGHIPFRDSKLTRILQTSLGGNARTAIICTLSPAGIHVEQSRNTLL  333

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+VAT AQVNVVMSDK LVK LQ+ELAKLESEL++ R   V   ++ +L EK+  
Sbjct  334  FASCAKEVATNAQVNVVMSDKVLVKHLQRELAKLESELKSPREALVVSDTTALLMEKDLQ  393

Query  723  IEKMEKEMRDL  755
            IEK+ KE+  L
Sbjct  394  IEKLNKEVFQL  404



>ref|XP_010679852.1| PREDICTED: kinesin-like protein NACK1 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=943

 Score =   358 bits (918),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 180/254 (71%), Positives = 213/254 (84%), Gaps = 1/254 (0%)
 Frame = +3

Query  3    DLLSTDNTPLRLLDDPERGTVVEKLSEVMPRDQSHLSELLSICEAQRQIGETTLNGMSSR  182
            DLL++DN+PLRLLDDPERGTVVEKL E   RD +H  ELL++CEAQRQIGET LN  SSR
Sbjct  40   DLLTSDNSPLRLLDDPERGTVVEKLMEETLRDWTHFKELLAVCEAQRQIGETLLNEASSR  99

Query  183  SHQILRLTIESSTTQYSHPRNNSTLSAAVNFIDLAGSERASQTLSAGTRLKEGCHINRSL  362
            SHQILRLTIES+  ++    N STL+A +NFIDLAGSERASQTLSAG+RLKEG HINRSL
Sbjct  100  SHQILRLTIESTAREFIGKNNCSTLAATLNFIDLAGSERASQTLSAGSRLKEGSHINRSL  159

Query  363  LTLGTVIRKLSKGRNGHIPYRDSKLTRILQHSLGGNARTAIICTMSPAHSHVEQSRNTLL  542
            LTLGTVIRKLSKG+ GHIPYRDSKLTRILQ SLGGNA+TA+ICT+SPA S+VEQSRNTLL
Sbjct  160  LTLGTVIRKLSKGQTGHIPYRDSKLTRILQSSLGGNAKTAVICTLSPARSYVEQSRNTLL  219

Query  543  FATCAKQVATKAQVNVVMSDKALVKQLQKELAKLESELRALRSRSVDETSSLVLKEKEAL  722
            FA+CAK+V T A+VNV MSDKALVK LQKELA+LE ELR+    S+    + VL+EK+  
Sbjct  220  FASCAKEVTTNARVNVFMSDKALVKHLQKELARLEIELRSANP-SMRSDPNYVLREKDFK  278

Query  723  IEKMEKEMRDLMMQ  764
            I+++E+ + +L +Q
Sbjct  279  IDELERRVNELTLQ  292



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1352312960240