BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17750_g1_i1 len=1393 path=[1417:0-882 2299:883-891 24:892-947
2363:948-1392]

Length=1393
                                                                      Score     E

ref|XP_009596714.1|  PREDICTED: protein TIFY 10A-like isoform X2        169   8e-46   
ref|XP_009596713.1|  PREDICTED: protein TIFY 10A-like isoform X1        169   1e-45   
ref|XP_009798139.1|  PREDICTED: protein TIFY 10B-like isoform X1        164   2e-43   
ref|XP_009798140.1|  PREDICTED: protein TIFY 10B-like isoform X2        159   6e-42   
gb|AFL46173.1|  jasmonate ZIM domain protein h                          156   9e-40   
ref|XP_009796338.1|  PREDICTED: protein TIFY 10B-like                   156   1e-39   
ref|XP_009595004.1|  PREDICTED: protein TIFY 10B-like                   149   4e-37   
emb|CAN83805.1|  hypothetical protein VITISV_015738                     146   2e-36   Vitis vinifera
ref|XP_002272363.2|  PREDICTED: protein TIFY 10A                        145   3e-36   Vitis vinifera
gb|AEP60133.1|  JAZ2                                                    145   3e-36   
ref|XP_006342934.1|  PREDICTED: protein TIFY 10B-like                   133   1e-31   
gb|KDP40673.1|  hypothetical protein JCGZ_24672                         132   2e-31   
ref|NP_001234223.1|  salt responsive protein 1                          132   2e-31   
ref|XP_004252407.1|  PREDICTED: protein TIFY 10A-like                   129   3e-31   
ref|XP_002529200.1|  conserved hypothetical protein                     129   1e-30   Ricinus communis
emb|CDO97827.1|  unnamed protein product                                129   1e-30   
ref|XP_006361332.1|  PREDICTED: protein TIFY 10A-like                   125   7e-30   
gb|AFK35276.1|  unknown                                                 122   4e-28   
ref|XP_011079529.1|  PREDICTED: protein TIFY 10B-like isoform X1        122   5e-28   
gb|KHG24904.1|  Protein TIFY 10A -like protein                          121   7e-28   
ref|XP_004488102.1|  PREDICTED: protein TIFY 10A-like                   119   5e-27   
ref|NP_001276248.1|  protein TIFY 10A-like                              118   6e-27   
ref|XP_010261778.1|  PREDICTED: protein TIFY 10B                        119   9e-27   
emb|CDP03053.1|  unnamed protein product                                118   9e-27   
gb|KHN12298.1|  Protein TIFY 10A                                        117   1e-26   
gb|AEC12208.1|  JAZ1                                                    116   3e-26   
gb|ACU18981.1|  unknown                                                 116   4e-26   Glycine max [soybeans]
ref|XP_003546514.1|  PREDICTED: protein TIFY 10A-like                   115   6e-26   
ref|XP_009621436.1|  PREDICTED: protein TIFY 10A-like                   114   1e-25   
ref|XP_006587054.1|  PREDICTED: protein TIFY 10A-like isoform X2        114   1e-25   
ref|XP_011036477.1|  PREDICTED: protein TIFY 10A                        115   1e-25   
ref|XP_002304118.1|  hypothetical protein POPTR_0003s06670g             114   2e-25   Populus trichocarpa [western balsam poplar]
gb|KHG00833.1|  Protein TIFY 10A -like protein                          114   2e-25   
ref|XP_003595354.1|  Protein TIFY 10B                                   114   2e-25   
ref|XP_007138635.1|  hypothetical protein PHAVU_009G225300g             114   2e-25   
gb|ACM89457.1|  jasmonate ZIM domain 1                                  114   2e-25   Catharanthus roseus [chatas]
ref|XP_006474700.1|  PREDICTED: protein TIFY 10A-like                   114   3e-25   
emb|CDY46022.1|  BnaA02g17040D                                          112   5e-25   
ref|XP_010099096.1|  Protein TIFY 10A                                   113   5e-25   
ref|NP_001234883.1|  jasmonate ZIM-domain protein 1                     112   6e-25   
gb|AGC26170.1|  TIFY transcription factor                               112   6e-25   
gb|AEP60132.1|  JAZ1                                                    113   6e-25   
ref|XP_002516243.1|  conserved hypothetical protein                     113   6e-25   Ricinus communis
ref|XP_010937308.1|  PREDICTED: protein TIFY 10B-like                   112   1e-24   
ref|XP_002277157.1|  PREDICTED: protein TIFY 10A                        111   2e-24   Vitis vinifera
ref|XP_006452845.1|  hypothetical protein CICLE_v10008653mg             113   2e-24   
gb|AFL46165.1|  jasmonate ZIM domain protein a                          110   2e-24   
ref|XP_009128069.1|  PREDICTED: protein TIFY 10B-like                   110   2e-24   
gb|EYU45898.1|  hypothetical protein MIMGU_mgv1a013086mg                110   3e-24   
ref|XP_009759848.1|  PREDICTED: protein TIFY 10A                        110   4e-24   
gb|ACM89458.1|  jasmonate ZIM domain 2                                  110   4e-24   Catharanthus roseus [chatas]
gb|KDP33940.1|  hypothetical protein JCGZ_07511                         110   4e-24   
emb|CDY37269.1|  BnaCnng08230D                                          110   4e-24   
ref|XP_008782803.1|  PREDICTED: protein TIFY 10B-like                   110   5e-24   
gb|EYU21296.1|  hypothetical protein MIMGU_mgv1a011904mg                110   5e-24   
ref|XP_010273865.1|  PREDICTED: protein TIFY 10A-like                   110   6e-24   
gb|ABP35523.1|  PnFL-2                                                  109   8e-24   Ipomoea batatas [batate]
ref|XP_007024677.1|  Jasmonate-zim-domain protein 6, putative iso...    110   8e-24   
gb|EYU28313.1|  hypothetical protein MIMGU_mgv1a012664mg                109   9e-24   
gb|ABK96213.1|  unknown                                                 109   1e-23   Populus trichocarpa x Populus deltoides
ref|XP_006381595.1|  hypothetical protein POPTR_0006s14160g             108   2e-23   
emb|CBI35842.3|  unnamed protein product                                107   3e-23   
gb|EYU21297.1|  hypothetical protein MIMGU_mgv1a011904mg                108   3e-23   
ref|XP_006367890.1|  PREDICTED: protein TIFY 10A-like                   106   4e-23   
dbj|BAG68655.1|  jasmonate ZIM-domain protein 1                         107   4e-23   Nicotiana tabacum [American tobacco]
ref|XP_009417542.1|  PREDICTED: protein TIFY 10B-like                   107   5e-23   
ref|XP_007215958.1|  hypothetical protein PRUPE_ppa011370mg             105   1e-22   
gb|ADI39634.1|  plastid jasmonates ZIM-domain protein                   107   1e-22   
ref|XP_011039955.1|  PREDICTED: protein TIFY 10A                        106   1e-22   
ref|XP_006369119.1|  hypothetical protein POPTR_0001s16640g             106   2e-22   
ref|XP_008228164.1|  PREDICTED: protein TIFY 10B-like                   103   4e-22   
ref|XP_010049382.1|  PREDICTED: protein TIFY 10A-like                   105   4e-22   
gb|AFL46169.1|  jasmonate ZIM domain protein d                          103   7e-22   
ref|XP_009391222.1|  PREDICTED: protein TIFY 10B-like                   103   7e-22   
ref|XP_004243696.1|  PREDICTED: protein TIFY 10A-like                   102   9e-22   
ref|XP_009793297.1|  PREDICTED: protein TIFY 10A-like                   102   1e-21   
ref|XP_009337185.1|  PREDICTED: protein TIFY 10A                        103   1e-21   
ref|XP_008242268.1|  PREDICTED: protein TIFY 10A                        103   1e-21   
ref|XP_006390367.1|  hypothetical protein EUTSA_v10019039mg             103   2e-21   
ref|XP_010917442.1|  PREDICTED: protein TIFY 10A-like                   103   2e-21   
ref|XP_008337828.1|  PREDICTED: protein TIFY 10A-like                   103   2e-21   
ref|XP_010047457.1|  PREDICTED: protein TIFY 10A                        103   2e-21   
ref|XP_008460319.1|  PREDICTED: protein TIFY 11A-like                   101   2e-21   
ref|XP_011078125.1|  PREDICTED: protein TIFY 10B-like                   101   5e-21   
ref|XP_004144433.1|  PREDICTED: protein TIFY 10B-like                 99.4    2e-20   
gb|KDO73850.1|  hypothetical protein CISIN_1g023369mg                 99.8    2e-20   
ref|XP_009597283.1|  PREDICTED: protein TIFY 10A                      98.6    3e-20   
gb|ACY30445.1|  JAZ1-like protein                                     98.2    3e-20   Nicotiana tabacum [American tobacco]
ref|XP_010685279.1|  PREDICTED: protein TIFY 10A-like                 99.8    3e-20   
gb|AGV54557.1|  protein TIFY 10A-like protein                         99.8    3e-20   
ref|NP_565043.1|  jasmonate-zim-domain protein 6                      99.4    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007202425.1|  hypothetical protein PRUPE_ppa009778mg           99.4    5e-20   
ref|XP_011093865.1|  PREDICTED: protein TIFY 10A-like isoform X2      97.8    8e-20   
gb|AGU37272.1|  jasmonate ZIM-domain protein 3b                       97.1    9e-20   
ref|XP_006302729.1|  hypothetical protein CARUB_v10020844mg           98.2    1e-19   
ref|XP_009406688.1|  PREDICTED: protein TIFY 10A-like                 97.1    1e-19   
ref|XP_010416354.1|  PREDICTED: protein TIFY 10B-like                 97.8    1e-19   
ref|XP_004508014.1|  PREDICTED: protein TIFY 10A-like                 97.4    1e-19   
ref|XP_003523520.1|  PREDICTED: protein TIFY 10A-like                 96.7    2e-19   
ref|XP_011093864.1|  PREDICTED: protein TIFY 10A-like isoform X1      96.7    2e-19   
ref|XP_006452843.1|  hypothetical protein CICLE_v10008653mg           98.2    2e-19   
ref|XP_010428492.1|  PREDICTED: protein TIFY 10B-like                 96.7    3e-19   
ref|XP_011072606.1|  PREDICTED: protein TIFY 10B-like                 97.4    4e-19   
ref|XP_009359716.1|  PREDICTED: protein TIFY 10A-like                 96.7    5e-19   
ref|XP_008792846.1|  PREDICTED: protein TIFY 10B-like                 96.3    6e-19   
ref|XP_011048577.1|  PREDICTED: protein TIFY 10A-like                 96.3    6e-19   
ref|XP_011079536.1|  PREDICTED: protein TIFY 10A-like isoform X2      95.5    1e-18   
gb|AAM64554.1|  unknown                                               94.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007135415.1|  hypothetical protein PHAVU_010G127400g           94.4    2e-18   
ref|NP_565096.1|  protein TIFY 10B                                    94.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011093866.1|  PREDICTED: protein TIFY 10A-like isoform X3      94.0    2e-18   
ref|XP_008462277.1|  PREDICTED: protein TIFY 10B-like                 95.5    2e-18   
emb|CDX73127.1|  BnaC06g35750D                                        94.4    2e-18   
ref|XP_006305530.1|  hypothetical protein CARUB_v10010018mg           94.4    2e-18   
ref|XP_010939885.1|  PREDICTED: protein TIFY 10B-like                 94.4    2e-18   
ref|NP_001050322.1|  Os03g0402800                                     93.6    3e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009391723.1|  PREDICTED: protein TIFY 10B-like                 93.6    3e-18   
ref|XP_004141716.1|  PREDICTED: protein TIFY 10B-like                 94.7    3e-18   
gb|KFK41933.1|  hypothetical protein AALP_AA2G190600                  93.6    3e-18   
ref|XP_009106151.1|  PREDICTED: protein TIFY 10B                      93.6    4e-18   
gb|KHN07885.1|  Protein TIFY 10A                                      93.2    4e-18   
emb|CDY45408.1|  BnaA07g31880D                                        93.2    4e-18   
ref|XP_010932384.1|  PREDICTED: protein TIFY 10B                      93.6    5e-18   
gb|EMT31100.1|  hypothetical protein F775_32173                       92.8    6e-18   
ref|XP_006600152.1|  PREDICTED: uncharacterized protein LOC100527...  92.8    6e-18   
ref|XP_002888878.1|  hypothetical protein ARALYDRAFT_476379           93.2    6e-18   
gb|KHG06931.1|  Protein TIFY 11B -like protein                        92.8    8e-18   
ref|XP_003542368.1|  PREDICTED: protein TIFY 10A-like                 92.4    9e-18   
ref|NP_001276307.1|  protein TIFY 10A-like                            92.0    1e-17   
ref|XP_009401532.1|  PREDICTED: protein TIFY 10B-like                 92.4    1e-17   
ref|NP_001148852.1|  pnFL-2                                           92.0    1e-17   Zea mays [maize]
ref|XP_007024679.1|  Jasmonate-zim-domain protein 6, putative iso...  91.7    1e-17   
gb|EYU45897.1|  hypothetical protein MIMGU_mgv1a013086mg              91.3    1e-17   
ref|XP_003572804.1|  PREDICTED: protein TIFY 10A-like                 91.7    2e-17   
ref|XP_008778980.1|  PREDICTED: protein TIFY 10A-like                 91.7    2e-17   
gb|KFK44057.1|  hypothetical protein AALP_AA1G210400                  91.7    3e-17   
ref|NP_001237073.1|  uncharacterized protein LOC100527510             90.9    3e-17   
gb|ACF88234.1|  unknown                                               90.1    5e-17   Zea mays [maize]
emb|CDX81917.1|  BnaC08g36840D                                        93.2    5e-17   
ref|XP_002889001.1|  hypothetical protein ARALYDRAFT_476633           90.1    6e-17   
ref|XP_009110295.1|  PREDICTED: protein TIFY 10A-like                 90.1    7e-17   
ref|XP_009388200.1|  PREDICTED: protein TIFY 10B-like                 89.7    7e-17   
ref|XP_002462448.1|  hypothetical protein SORBIDRAFT_02g025720        89.4    7e-17   Sorghum bicolor [broomcorn]
emb|CDX96675.1|  BnaA08g22180D                                        90.1    8e-17   
gb|ACF84334.1|  unknown                                               89.4    8e-17   Zea mays [maize]
ref|NP_001239983.1|  uncharacterized protein LOC100778559             89.4    8e-17   
gb|ACG35001.1|  pnFL-2                                                89.4    9e-17   Zea mays [maize]
ref|XP_004958300.1|  PREDICTED: protein TIFY 10B-like                 89.4    1e-16   
ref|XP_008784340.1|  PREDICTED: protein TIFY 10B-like                 89.7    1e-16   
ref|XP_004984081.1|  PREDICTED: protein TIFY 10A-like                 89.0    1e-16   
gb|EAZ04703.1|  hypothetical protein OsI_26864                        89.0    1e-16   Oryza sativa Indica Group [Indian rice]
gb|ABF96481.1|  ZIM motif family protein, expressed                   88.2    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007024678.1|  Jasmonate-zim-domain protein 6, putative iso...  89.0    1e-16   
gb|EMS48227.1|  Protein TIFY 10A                                      86.7    2e-16   
ref|XP_004510528.1|  PREDICTED: protein TIFY 11B-like                 87.8    3e-16   
ref|XP_006657953.1|  PREDICTED: protein TIFY 10A-like                 88.2    3e-16   
gb|EAY90387.1|  hypothetical protein OsI_11965                        88.6    3e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_006345256.1|  PREDICTED: protein TIFY 10A-like                 88.2    3e-16   
ref|NP_001150658.1|  pnFL-2                                           87.4    4e-16   Zea mays [maize]
dbj|BAJ98082.1|  predicted protein                                    87.0    5e-16   
dbj|BAJ89850.1|  predicted protein                                    87.0    5e-16   
ref|XP_009117562.1|  PREDICTED: protein TIFY 10A-like                 87.0    8e-16   
ref|NP_001182812.1|  putative tify domain/CCT motif transcription...  86.3    8e-16   
ref|NP_564075.1|  jasmonate-zim-domain protein 1                      86.7    9e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAG49896.1|  PnFL-2                                                85.9    9e-16   Ipomoea nil [qian niu]
ref|XP_009410257.1|  PREDICTED: protein TIFY 10A-like                 86.3    1e-15   
emb|CDX83781.1|  BnaC08g18640D                                        86.3    1e-15   
emb|CDY71173.1|  BnaC02g45660D                                        86.3    2e-15   
ref|NP_001060268.1|  Os07g0615200                                     85.5    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003562699.1|  PREDICTED: protein TIFY 10A-like isoform X1      85.5    2e-15   
ref|XP_006416530.1|  hypothetical protein EUTSA_v10008419mg           85.9    3e-15   
ref|XP_010471594.1|  PREDICTED: protein TIFY 10B-like                 85.1    3e-15   
ref|XP_007154562.1|  hypothetical protein PHAVU_003G129200g           84.7    3e-15   
ref|XP_002461012.1|  hypothetical protein SORBIDRAFT_02g039190        84.7    3e-15   Sorghum bicolor [broomcorn]
ref|XP_010061832.1|  PREDICTED: protein TIFY 10B-like                 84.3    4e-15   
ref|XP_006390655.1|  hypothetical protein EUTSA_v10018984mg           85.1    5e-15   
emb|CDY21679.1|  BnaA09g44300D                                        87.4    5e-15   
ref|XP_006660660.1|  PREDICTED: protein TIFY 10A-like                 84.0    6e-15   
ref|XP_006650179.1|  PREDICTED: protein TIFY 10B-like                 84.0    6e-15   
ref|XP_008670547.1|  PREDICTED: uncharacterized protein LOC100276...  84.0    7e-15   
gb|EAZ40654.1|  hypothetical protein OsJ_25125                        84.0    7e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010498328.1|  PREDICTED: protein TIFY 10A-like                 84.0    8e-15   
ref|XP_010477122.1|  PREDICTED: protein TIFY 10A-like                 84.3    8e-15   
gb|KCW68864.1|  hypothetical protein EUGRSUZ_F024561                  82.8    8e-15   
ref|XP_009399648.1|  PREDICTED: protein TIFY 10B-like                 83.6    8e-15   
gb|KDO73849.1|  hypothetical protein CISIN_1g023369mg                 83.6    9e-15   
gb|AAM65383.1|  unknown                                               83.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KEH37602.1|  jasmonate zim-domain protein                          83.6    1e-14   
emb|CDX68156.1|  BnaA07g21960D                                        82.0    1e-14   
emb|CBI27776.3|  unnamed protein product                              82.8    1e-14   
ref|XP_002465159.1|  hypothetical protein SORBIDRAFT_01g033020        82.8    2e-14   Sorghum bicolor [broomcorn]
emb|CDX85865.1|  BnaC06g22690D                                        82.4    2e-14   
ref|XP_009105906.1|  PREDICTED: protein TIFY 11B                      82.8    3e-14   
ref|XP_008353511.1|  PREDICTED: protein TIFY 10B-like                 81.6    3e-14   
gb|EYU45899.1|  hypothetical protein MIMGU_mgv1a013086mg              81.3    4e-14   
gb|EMT18709.1|  hypothetical protein F775_32219                       81.3    4e-14   
ref|XP_006452842.1|  hypothetical protein CICLE_v10008653mg           82.8    6e-14   
emb|CDY26697.1|  BnaA06g13250D                                        81.3    7e-14   
ref|XP_009408851.1|  PREDICTED: protein TIFY 10B-like                 81.3    8e-14   
ref|XP_008380785.1|  PREDICTED: protein TIFY 11B-like                 80.1    8e-14   
emb|CDY41023.1|  BnaC05g14810D                                        80.5    1e-13   
gb|KCW68866.1|  hypothetical protein EUGRSUZ_F024561                  79.3    1e-13   
ref|XP_010235620.1|  PREDICTED: protein TIFY 10B-like isoform X2      80.1    1e-13   
ref|NP_001130163.1|  uncharacterized protein LOC100191257             80.1    1e-13   Zea mays [maize]
gb|AGT80155.1|  PnFL-2                                                79.7    2e-13   
dbj|BAG68657.1|  jasmonate ZIM-domain protein 3                       79.3    2e-13   Nicotiana tabacum [American tobacco]
ref|XP_003578176.2|  PREDICTED: protein TIFY 10A                      79.3    2e-13   
gb|KCW79370.1|  hypothetical protein EUGRSUZ_C00785                   79.3    2e-13   
ref|XP_009104735.1|  PREDICTED: protein TIFY 10B-like isoform X2      79.3    2e-13   
gb|KCW79369.1|  hypothetical protein EUGRSUZ_C00785                   79.0    3e-13   
ref|XP_009149390.1|  PREDICTED: protein TIFY 10A-like isoform X2      79.3    3e-13   
ref|XP_009104734.1|  PREDICTED: protein TIFY 10B-like isoform X1      78.6    4e-13   
ref|XP_006581124.1|  PREDICTED: protein TIFY 10B-like isoform X2      76.6    4e-13   
emb|CDX73289.1|  BnaC05g28170D                                        78.2    4e-13   
emb|CDX96772.1|  BnaA08g23150D                                        79.0    5e-13   
ref|XP_009149389.1|  PREDICTED: protein TIFY 10A-like isoform X1      78.6    5e-13   
ref|XP_007012594.1|  Jasmonate-zim-domain protein 1, putative         78.6    5e-13   
emb|CDY48300.1|  BnaC05g13540D                                        79.0    6e-13   
ref|XP_006581123.1|  PREDICTED: protein TIFY 10B-like isoform X1      76.3    9e-13   
ref|XP_009346307.1|  PREDICTED: protein TIFY 10B-like                 77.0    1e-12   
gb|AFU90901.1|  jasmonate ZIM domain-containing protein               76.6    1e-12   
ref|XP_010529816.1|  PREDICTED: protein TIFY 10A-like                 77.8    1e-12   
ref|XP_010459578.1|  PREDICTED: protein TIFY 10A-like                 77.8    1e-12   
emb|CDX72916.1|  BnaC06g33640D                                        77.8    1e-12   
ref|XP_009390323.1|  PREDICTED: protein TIFY 10A-like                 76.6    1e-12   
gb|AFU90899.1|  jasmonate ZIM domain-containing protein               75.9    2e-12   
gb|KHG16464.1|  Protein TIFY 11B -like protein                        77.0    2e-12   
ref|XP_010251469.1|  PREDICTED: protein TIFY 10A-like                 79.0    2e-12   
gb|AFK36192.1|  unknown                                               76.3    2e-12   
ref|XP_009110413.1|  PREDICTED: protein TIFY 11A-like                 76.3    3e-12   
gb|AFK47267.1|  unknown                                               75.9    4e-12   
ref|XP_008388962.1|  PREDICTED: protein TIFY 10A                      76.3    4e-12   
ref|XP_010540100.1|  PREDICTED: protein TIFY 11A                      76.3    4e-12   
ref|XP_004173908.1|  PREDICTED: protein TIFY 10B-like                 74.3    4e-12   
ref|NP_973862.1|  jasmonate-zim-domain protein 1                      75.1    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890323.1|  hypothetical protein ARALYDRAFT_472142           75.1    4e-12   
ref|XP_010687548.1|  PREDICTED: protein TIFY 10A                      74.7    9e-12   
ref|XP_006303246.1|  hypothetical protein CARUB_v10009758mg           75.5    1e-11   
ref|XP_009345358.1|  PREDICTED: protein TIFY 10B-like                 73.9    1e-11   
ref|XP_008450950.1|  PREDICTED: protein TIFY 10A                      73.9    2e-11   
ref|NP_564019.1|  protein TIFY 11A                                    73.9    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65191.1|  unknown                                               73.9    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382972.1|  PREDICTED: protein TIFY 10B-like                 72.8    4e-11   
gb|KFK41663.1|  hypothetical protein AALP_AA2G156800                  73.2    4e-11   
ref|XP_003517395.1|  PREDICTED: protein TIFY 10B-like                 71.6    6e-11   
ref|XP_006452933.1|  hypothetical protein CICLE_v10009025mg           71.2    1e-10   
tpg|DAA40152.1|  TPA: putative tify domain/CCT motif transcriptio...  70.5    1e-10   
ref|XP_006836619.1|  hypothetical protein AMTR_s00131p00119200        71.2    1e-10   
gb|AES94354.2|  jasmonate zim-domain protein                          69.7    1e-10   
ref|XP_003611395.1|  Protein TIFY                                     70.1    2e-10   
gb|AGC73980.1|  jasmonate ZIM-domain protein 1                        70.1    2e-10   
gb|AFU90898.1|  jasmonate ZIM domain-containing protein               69.3    2e-10   
gb|KEH27479.1|  jasmonate zim-domain protein                          68.9    2e-10   
ref|XP_009149320.1|  PREDICTED: protein TIFY 11A-like                 69.3    3e-10   
gb|KDO73702.1|  hypothetical protein CISIN_1g022037mg                 69.3    4e-10   
gb|KDO73698.1|  hypothetical protein CISIN_1g022037mg                 69.3    5e-10   
ref|XP_006474540.1|  PREDICTED: protein TIFY 3B-like                  69.3    5e-10   
ref|NP_001237160.1|  uncharacterized protein LOC100306332             68.6    6e-10   
gb|KHN34890.1|  Protein TIFY 10B                                      68.6    6e-10   
emb|CDY26248.1|  BnaA06g11690D                                        69.3    7e-10   
ref|XP_004511742.1|  PREDICTED: protein TIFY 10A-like                 68.2    8e-10   
ref|XP_010531888.1|  PREDICTED: protein TIFY 11A-like                 69.3    1e-09   
gb|KCW68865.1|  hypothetical protein EUGRSUZ_F024561                  67.4    1e-09   
gb|EAZ09244.1|  hypothetical protein OsI_31517                        68.2    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_007156595.1|  hypothetical protein PHAVU_002G002000g           67.4    1e-09   
ref|NP_001063273.1|  Os09g0439200                                     67.8    2e-09   Oryza sativa Japonica Group [Japonica rice]
gb|KHG27959.1|  Protein TIFY 10A -like protein                        65.5    1e-08   
ref|XP_009390857.1|  PREDICTED: protein TIFY 10A-like                 63.9    2e-08   
ref|XP_010256256.1|  PREDICTED: protein TIFY 10A-like                 63.5    3e-08   
ref|XP_002526460.1|  conserved hypothetical protein                   63.5    3e-08   Ricinus communis
ref|XP_006452932.1|  hypothetical protein CICLE_v10009025mg           64.7    4e-08   
ref|XP_002516176.1|  conserved hypothetical protein                   63.5    4e-08   Ricinus communis
gb|KDO73696.1|  hypothetical protein CISIN_1g022037mg                 62.8    5e-08   
gb|KDO73705.1|  hypothetical protein CISIN_1g022037mg                 62.4    5e-08   
gb|KDO73704.1|  hypothetical protein CISIN_1g022037mg                 62.4    6e-08   
emb|CDY03638.1|  BnaA02g15990D                                        63.5    6e-08   
ref|XP_010498085.1|  PREDICTED: protein TIFY 11A-like                 63.5    8e-08   
gb|ABR26007.1|  pnfl-2                                                61.2    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_002883092.1|  hypothetical protein ARALYDRAFT_479270           63.5    1e-07   
gb|KDO73700.1|  hypothetical protein CISIN_1g022037mg                 62.8    1e-07   
ref|XP_010047416.1|  PREDICTED: protein TIFY 10B-like                 61.6    2e-07   
gb|KDO73701.1|  hypothetical protein CISIN_1g022037mg                 62.8    2e-07   
emb|CDX81823.1|  BnaC08g37780D                                        62.4    3e-07   
gb|KCW79332.1|  hypothetical protein EUGRSUZ_C00753                   61.6    3e-07   
ref|XP_009145964.1|  PREDICTED: protein TIFY 6B                       61.6    5e-07   
emb|CDX92171.1|  BnaA05g22360D                                        60.8    9e-07   
ref|XP_004956892.1|  PREDICTED: protein TIFY 10A-like                 59.3    9e-07   
gb|KCW79334.1|  hypothetical protein EUGRSUZ_C00753                   58.9    1e-06   
gb|KFK43927.1|  hypothetical protein AALP_AA1G192200                  59.7    1e-06   
ref|XP_010537635.1|  PREDICTED: protein TIFY 11B                      60.1    1e-06   
ref|XP_009127935.1|  PREDICTED: protein TIFY 11B-like                 59.7    1e-06   
gb|KHN12055.1|  Protein TIFY 10A                                      60.5    1e-06   
ref|XP_004287655.1|  PREDICTED: protein TIFY 10A-like                 59.7    2e-06   
gb|AFU90897.1|  jasmonate ZIM domain-containing protein               57.8    2e-06   
gb|KDO64957.1|  hypothetical protein CISIN_1g028982mg                 58.2    2e-06   
ref|XP_006426705.1|  hypothetical protein CICLE_v10026527mg           58.2    2e-06   
ref|XP_006465884.1|  PREDICTED: protein TIFY 10A-like                 57.8    2e-06   
ref|XP_006426706.1|  hypothetical protein CICLE_v10026376mg           58.2    2e-06   
ref|XP_006465883.1|  PREDICTED: protein TIFY 10A-like                 58.2    3e-06   
ref|XP_008676908.1|  PREDICTED: putative tify domain/CCT motif tr...  56.2    4e-06   
gb|KEH18500.1|  jasmonate zim-domain protein                          58.2    4e-06   
ref|NP_001142774.1|  putative tify domain/CCT motif transcription...  57.0    5e-06   
ref|XP_008676907.1|  PREDICTED: putative tify domain/CCT motif tr...  57.0    6e-06   
ref|XP_009413475.1|  PREDICTED: protein TIFY 10B-like                 57.4    7e-06   
ref|XP_010246073.1|  PREDICTED: protein TIFY 3B                       56.6    1e-05   
ref|NP_001143811.1|  uncharacterized protein LOC100276585             54.3    2e-05   
gb|AES94352.2|  jasmonate zim-domain protein                          54.3    2e-05   
ref|XP_003611394.1|  Protein TIFY 10A                                 54.3    3e-05   
gb|AAL24250.1|  At1g19180/T29M8_5                                     53.9    4e-05   
ref|NP_001169865.1|  uncharacterized protein LOC100383759             53.5    9e-05   
ref|XP_009359668.1|  PREDICTED: protein TIFY 3B-like                  53.1    9e-05   
ref|XP_006479661.1|  PREDICTED: protein TIFY 4B-like isoform X3       53.5    1e-04   
ref|XP_006443988.1|  hypothetical protein CICLE_v10021137mg           53.5    1e-04   
ref|XP_006302712.1|  hypothetical protein CARUB_v10020824mg           53.5    1e-04   
ref|XP_006443989.1|  hypothetical protein CICLE_v10021137mg           52.4    2e-04   
ref|XP_004303711.1|  PREDICTED: protein TIFY 10B-like                 52.0    2e-04   
ref|XP_002892948.1|  hypothetical protein ARALYDRAFT_312706           53.1    2e-04   
ref|XP_010459325.1|  PREDICTED: protein TIFY 11A isoform X1           53.1    2e-04   
ref|XP_009117662.1|  PREDICTED: protein TIFY 11A-like                 53.1    2e-04   
ref|XP_006416709.1|  hypothetical protein EUTSA_v10008415mg           52.8    3e-04   
ref|NP_001150800.1|  ZIM motif family protein                         51.2    3e-04   
ref|XP_010476887.1|  PREDICTED: protein TIFY 11A-like                 52.8    3e-04   
gb|KDO68636.1|  hypothetical protein CISIN_1g020430mg                 51.6    3e-04   
gb|KDO73851.1|  hypothetical protein CISIN_1g023369mg                 51.2    4e-04   
ref|XP_006443987.1|  hypothetical protein CICLE_v10021137mg           51.2    4e-04   
gb|ACN40858.1|  unknown                                               52.8    4e-04   
ref|XP_006443985.1|  hypothetical protein CICLE_v10021137mg           52.0    4e-04   
ref|XP_009589702.1|  PREDICTED: protein TIFY 10B-like isoform X3      50.4    5e-04   
ref|XP_006443992.1|  hypothetical protein CICLE_v10021137mg           52.0    6e-04   
ref|XP_006652931.1|  PREDICTED: protein TIFY 3B-like                  50.8    6e-04   
ref|XP_006479659.1|  PREDICTED: protein TIFY 4B-like isoform X1       52.0    6e-04   
gb|EMS60846.1|  hypothetical protein TRIUR3_32679                     50.8    6e-04   
ref|XP_006443986.1|  hypothetical protein CICLE_v10021137mg           51.2    7e-04   
ref|XP_009589700.1|  PREDICTED: protein TIFY 10B-like isoform X2      50.4    7e-04   
ref|XP_006443991.1|  hypothetical protein CICLE_v10021137mg           51.2    7e-04   
ref|XP_009589699.1|  PREDICTED: protein TIFY 10B-like isoform X1      50.4    7e-04   
gb|AFW57151.1|  hypothetical protein ZEAMMB73_764442                  52.0    8e-04   
gb|ABK20968.1|  unknown                                               50.1    0.001   



>ref|XP_009596714.1| PREDICTED: protein TIFY 10A-like isoform X2 [Nicotiana tomentosiformis]
Length=217

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 144/250 (58%), Gaps = 55/250 (22%)
 Frame = +2

Query  293   SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKS---TQ  463
             SN +QTCNLLSQ+LKG+ +++DL      +N   +G+ +I    TMDFLTNIE+    T 
Sbjct  2     SNNMQTCNLLSQYLKGKATLKDL------MNLGINGEGEIPETATMDFLTNIEEQSTKTM  55

Query  464   DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEF  643
              Q+   ID  P+N    + R +E   N A++ S +  ++  KAAQL+IFY GKV+VFD+F
Sbjct  56    GQDKKLIDHVPRNATRNSFREMEVSINKASN-SSKETQKELKAAQLSIFYGGKVIVFDDF  114

Query  644   PADKARAVMLLASKSSPQSARGVFQTAGVDK---LDLPADGAAVVATSTPVDppkpmasp  814
             PADKARA+MLLASK SPQ++  VFQTA +DK   L L ++ AA                 
Sbjct  115   PADKARAMMLLASKGSPQNSCAVFQTANIDKTGPLKLGSNSAA-----------------  157

Query  815   pplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPL  994
                                       DLPIARRSSLHRFL +RKDR TARAPYQV  NPL
Sbjct  158   -----------------------NNFDLPIARRSSLHRFLGRRKDRDTARAPYQVQ-NPL  193

Query  995   IPSKSERPSS  1024
              PS S+   S
Sbjct  194   -PSSSKNKES  202



>ref|XP_009596713.1| PREDICTED: protein TIFY 10A-like isoform X1 [Nicotiana tomentosiformis]
Length=226

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 147/254 (58%), Gaps = 54/254 (21%)
 Frame = +2

Query  293   SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNT-EASGKFDISHGT---TMDFLTNIEKS-  457
             SN +QTCNLLSQ+LKG+ +++DL + +G+    E  GK DI   T   TMDFLTNIE+  
Sbjct  2     SNNMQTCNLLSQYLKGKATLKDLMN-LGINGEGEIPGKTDIPQVTETATMDFLTNIEEQS  60

Query  458   --TQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMV  631
               T  Q+   ID  P+N    + R +E   N A++ S +  ++  KAAQL+IFY GKV+V
Sbjct  61    TKTMGQDKKLIDHVPRNATRNSFREMEVSINKASN-SSKETQKELKAAQLSIFYGGKVIV  119

Query  632   FDEFPADKARAVMLLASKSSPQSARGVFQTAGVDK---LDLPADGAAVVATSTPVDppkp  802
             FD+FPADKARA+MLLASK SPQ++  VFQTA +DK   L L ++ AA             
Sbjct  120   FDDFPADKARAMMLLASKGSPQNSCAVFQTANIDKTGPLKLGSNSAA-------------  166

Query  803   masppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVH  982
                                           DLPIARRSSLHRFL +RKDR TARAPYQV 
Sbjct  167   ---------------------------NNFDLPIARRSSLHRFLGRRKDRDTARAPYQVQ  199

Query  983   NNPLIPSKSERPSS  1024
              NPL PS S+   S
Sbjct  200   -NPL-PSSSKNKES  211



>ref|XP_009798139.1| PREDICTED: protein TIFY 10B-like isoform X1 [Nicotiana sylvestris]
Length=242

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 116/259 (45%), Positives = 146/259 (56%), Gaps = 55/259 (21%)
 Frame = +2

Query  290   KSNFVQTCNLLSQFLKGRVSIRDLSH-GIG----VVNTEASGKFDISHGT---TMDFLTN  445
             KS+++QTCNLLSQ+L G+ +++D+ + GI     +     SGK DIS  T   TMDFLTN
Sbjct  11    KSSYMQTCNLLSQYLNGKATLKDIINLGINGDGEIARYTRSGKTDISQVTETATMDFLTN  70

Query  446   IEKS---TQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYS  616
             +E+    T DQ +  ID N   T N  S T  E +   AS S +  ++  KAAQL+IFY 
Sbjct  71    MEEQSTKTMDQ-LQDIDQN--GTTN--SFTEMEASINKASNSSKEIQKELKAAQLSIFYG  125

Query  617   GKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGA---AVVATSTPV  787
             GKV+VFD+FPADKARA+MLLASK SP ++  VF T  +DK   P   A    V+  ST  
Sbjct  126   GKVIVFDDFPADKARAMMLLASKGSPHNSCAVFNTTSMDKTGPPNSAANTFGVLCLST--  183

Query  788   DppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARA  967
                                               SDLPIARRS+LHRFL +RKDR TARA
Sbjct  184   ----------------------------------SDLPIARRSALHRFLGRRKDRDTARA  209

Query  968   PYQVHNNPLIPSKSERPSS  1024
             PYQV N     SK+E P+S
Sbjct  210   PYQVQNLLTTSSKNEEPTS  228



>ref|XP_009798140.1| PREDICTED: protein TIFY 10B-like isoform X2 [Nicotiana sylvestris]
Length=234

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 112/256 (44%), Positives = 141/256 (55%), Gaps = 57/256 (22%)
 Frame = +2

Query  290   KSNFVQTCNLLSQFLKGRVSIRDLSH-GIG----VVNTEASGKFDISHGT---TMDFLTN  445
             KS+++QTCNLLSQ+L G+ +++D+ + GI     +     SGK DIS  T   TMDFLTN
Sbjct  11    KSSYMQTCNLLSQYLNGKATLKDIINLGINGDGEIARYTRSGKTDISQVTETATMDFLTN  70

Query  446   IEKS---TQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYS  616
             +E+    T DQ +  ID N   T N  S T  E +   AS S +  ++  KAAQL+IFY 
Sbjct  71    MEEQSTKTMDQ-LQDIDQN--GTTN--SFTEMEASINKASNSSKEIQKELKAAQLSIFYG  125

Query  617   GKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDpp  796
             GKV+VFD+FPADKARA+MLLASK SP ++  VF T  +DK   P   A            
Sbjct  126   GKVIVFDDFPADKARAMMLLASKGSPHNSCAVFNTTSMDKTGPPNSAANTF---------  176

Query  797   kpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
                                             DLPIARRS+LHRFL +RKDR TARAPYQ
Sbjct  177   --------------------------------DLPIARRSALHRFLGRRKDRDTARAPYQ  204

Query  977   VHNNPLIPSKSERPSS  1024
             V N     SK+E P+S
Sbjct  205   VQNLLTTSSKNEEPTS  220



>gb|AFL46173.1| jasmonate ZIM domain protein h [Nicotiana attenuata]
Length=333

 Score =   156 bits (395),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 6/160 (4%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIE  451
            +G+APE+SNFVQTCNLLSQF+KG+ +IRDL+ GI    +E SGK D++   TMD LT +E
Sbjct  14   AGKAPERSNFVQTCNLLSQFIKGKATIRDLNLGIAG-KSEISGKSDVTEAATMDLLTIME  72

Query  452  K---STQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGK  622
                 T++QE   IDP  Q+ V  +SR +E   N  ++   +   + PKAAQLT+FY GK
Sbjct  73   NPSIETKEQEQKSIDPVRQSAVTESSRDMEVAVNEPST--SKEAPKEPKAAQLTMFYDGK  130

Query  623  VMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLD  742
            V+VFD+FPADKARAVMLLASK  PQS+ G F T  +DK++
Sbjct  131  VIVFDDFPADKARAVMLLASKGCPQSSFGTFHTTTIDKIN  170


 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 51/79 (65%), Gaps = 19/79 (24%)
 Frame = +2

Query  890   SDLPIARRSSLHRFLEKRKDRATARAPYQ-VHNNPLIPSKSERPSSKNeaspsknegsss  1066
             S+LPIARRSSLHRFLEKRKDRATARAPYQ VHNNPL                     S++
Sbjct  273   SELPIARRSSLHRFLEKRKDRATARAPYQVVHNNPL------------------PSSSNN  314

Query  1067  kneassskTRDQIDLNFKL  1123
               E+SS    DQ+DLNFKL
Sbjct  315   NGESSSKDCEDQLDLNFKL  333



>ref|XP_009796338.1| PREDICTED: protein TIFY 10B-like [Nicotiana sylvestris]
 gb|AGU37280.1| jasmonate ZIM-domain protein 10 [Nicotiana tabacum]
Length=331

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 114/166 (69%), Gaps = 6/166 (4%)
 Frame = +2

Query  275  GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEK  454
            G+APE+SNFVQTCNLLSQF+KG+ +IRDL+ GI    +E SGK D++   TMD LT +EK
Sbjct  15   GKAPERSNFVQTCNLLSQFIKGKATIRDLNLGIAG-KSEISGKSDVTEAATMDLLTIMEK  73

Query  455  ---STQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKV  625
                +++QE   IDP  Q+    +SR +E   N  ++   +   + PKAAQLT+FY GKV
Sbjct  74   PSIESKEQEQKSIDPVRQSAATESSRHMEVAVNQPST--SKEAPKEPKAAQLTMFYDGKV  131

Query  626  MVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAA  763
            +VFD+FPADKARAVMLLASK  PQS+ G F T  +DK++  A   A
Sbjct  132  IVFDDFPADKARAVMLLASKGCPQSSFGTFHTTTIDKINTSAAATA  177


 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 51/79 (65%), Gaps = 19/79 (24%)
 Frame = +2

Query  890   SDLPIARRSSLHRFLEKRKDRATARAPYQ-VHNNPLIPSKSERPSSKNeaspsknegsss  1066
             S+LPIARRSSLHRFLEKRKDRATARAPYQ VHNNPL                     S++
Sbjct  271   SELPIARRSSLHRFLEKRKDRATARAPYQVVHNNPL------------------PSSSNN  312

Query  1067  kneassskTRDQIDLNFKL  1123
               E+SS    DQ+DLNFKL
Sbjct  313   NGESSSKDCEDQLDLNFKL  331



>ref|XP_009595004.1| PREDICTED: protein TIFY 10B-like [Nicotiana tomentosiformis]
Length=335

 Score =   149 bits (377),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 109/159 (69%), Gaps = 6/159 (4%)
 Frame = +2

Query  275  GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEK  454
            G+APE+ NFVQTCNLLSQF+KG+ +IRDL+ GI    +E SGK D +   TMD LT +EK
Sbjct  15   GKAPERWNFVQTCNLLSQFIKGKATIRDLNLGIAG-KSEISGKSDGTEAATMDLLTIMEK  73

Query  455  ---STQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKV  625
                T++QE    DP  Q+    +SR +E   N  ++   +   + PKAAQLT+FY GKV
Sbjct  74   PSIETKEQEQKSTDPVLQSAATESSRDMEVAVNEPST--SKEAPKEPKAAQLTMFYDGKV  131

Query  626  MVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLD  742
            +VFD+FPADKARAVMLLASK  PQS+ G F T  +DK++
Sbjct  132  IVFDDFPADKARAVMLLASKGCPQSSFGTFHTTTIDKIN  170


 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 51/79 (65%), Gaps = 19/79 (24%)
 Frame = +2

Query  890   SDLPIARRSSLHRFLEKRKDRATARAPYQ-VHNNPLIPSKSERPSSKNeaspsknegsss  1066
             S+LPIARRSSLHRFLEKRKDRATARAPYQ VHNNPL                     S++
Sbjct  275   SELPIARRSSLHRFLEKRKDRATARAPYQVVHNNPL------------------PLSSNN  316

Query  1067  kneassskTRDQIDLNFKL  1123
               E+SS    DQ+DLNFKL
Sbjct  317   NGESSSKDCEDQLDLNFKL  335



>emb|CAN83805.1| hypothetical protein VITISV_015738 [Vitis vinifera]
Length=286

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 154/267 (58%), Gaps = 18/267 (7%)
 Frame = +2

Query  236   MSGKHLLSDV--KISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFD  409
             MS     SD   + SG+ P++SNF QTCNLLSQFLK +    DLS G+    +E  G+ +
Sbjct  1     MSNSPEFSDFAGRKSGKLPDRSNFSQTCNLLSQFLKEKGGFGDLSLGM-AGKSETKGRPE  59

Query  410   ISHGTTMDF-LTNIEKSTQ--------DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASIS  562
                 +TM F L N +KS++           +   D  PQ    G+  +++E  N A    
Sbjct  60    SFKSSTMSFDLLNKDKSSEASGQNGGGSSNLKSSDFYPQFAGFGSLASIDEAINMADF--  117

Query  563   keapkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLD  742
             +++     + +Q+TIFY+G+V+VF++FPA+KAR VMLLA+K +PQ+  G   T+G +K++
Sbjct  118   RKSATTESETSQMTIFYAGQVLVFNDFPAEKAREVMLLAAKGTPQNTSGFLSTSGPEKIN  177

Query  743   LPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSL  922
                 G++   + +    P    +P  L       P  PAA     AP GS+LPIARR+SL
Sbjct  178   T---GSSTAPSPSIPASPATTPNPQALSSGTFSIPASPAATPNPQAPLGSELPIARRNSL  234

Query  923   HRFLEKRKDRATARAPYQVHNNPLIPS  1003
             HRFLEKRKDR  ++APYQV NNP  PS
Sbjct  235   HRFLEKRKDRVNSKAPYQV-NNPSRPS  260



>ref|XP_002272363.2| PREDICTED: protein TIFY 10A [Vitis vinifera]
Length=286

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 154/267 (58%), Gaps = 18/267 (7%)
 Frame = +2

Query  236   MSGKHLLSDV--KISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFD  409
             MS     SD   + SG+ P++SNF QTCNLLSQFLK +    DLS G+    +E  G+ +
Sbjct  1     MSNSPEFSDFAGRKSGKLPDRSNFSQTCNLLSQFLKEKGRFGDLSLGM-AGKSETKGRPE  59

Query  410   ISHGTTMDF-LTNIEKSTQ--------DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASIS  562
                 +TM F L N +KS++           +   D  PQ    G+  +++E  N A    
Sbjct  60    SFKSSTMSFDLLNKDKSSEASGQNVGGSSNLKSSDFYPQFAGFGSLASIDEAINMADF--  117

Query  563   keapkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLD  742
             +++     + +Q+TIFY+G+V+VF++FPA+KAR VMLLA+K +PQ+  G   T+G +K++
Sbjct  118   RKSATTESETSQMTIFYAGQVLVFNDFPAEKAREVMLLAAKGTPQNTSGFLSTSGPEKIN  177

Query  743   LPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSL  922
                 G++   + +    P    +P  L       P  PAA     AP GS+LPIARR+SL
Sbjct  178   T---GSSTAPSPSIPASPATTPNPQALSSGTFSIPASPAATPNPQAPLGSELPIARRNSL  234

Query  923   HRFLEKRKDRATARAPYQVHNNPLIPS  1003
             HRFLEKRKDR  ++APYQV NNP  PS
Sbjct  235   HRFLEKRKDRVNSKAPYQV-NNPSRPS  260



>gb|AEP60133.1| JAZ2 [Vitis rupestris]
Length=286

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 154/267 (58%), Gaps = 18/267 (7%)
 Frame = +2

Query  236   MSGKHLLSDV--KISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFD  409
             MS     SD   + SG+ P++SNF QTCNLLSQFLK +    DLS G+    +E  G+ +
Sbjct  1     MSNSPEFSDFAGRKSGKLPDRSNFSQTCNLLSQFLKEKGRFGDLSLGM-AGKSETKGRPE  59

Query  410   ISHGTTMDF-LTNIEKSTQ--------DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASIS  562
                 +TM F L N +KS++           +   D  PQ    G+  +++E  N A    
Sbjct  60    SFKSSTMSFDLLNKDKSSEASGQNGGGSSNLKSSDFYPQFAGFGSLASIDEAINMADF--  117

Query  563   keapkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLD  742
             +++     + +Q+TIFY+G+V+VF++FPA+KAR VMLLA+K +PQ+  G   T+G +K++
Sbjct  118   RKSATTESETSQMTIFYAGQVLVFNDFPAEKAREVMLLAAKGTPQNTSGFLSTSGPEKIN  177

Query  743   LPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSL  922
                 G++   + +    P    +P  L       P  PAA     AP GS+LPIARR+SL
Sbjct  178   T---GSSTAPSPSIPASPATTPNPQALSSGTFSIPASPAATPNPQAPLGSELPIARRNSL  234

Query  923   HRFLEKRKDRATARAPYQVHNNPLIPS  1003
             HRFLEKRKDR  ++APYQV NNP  PS
Sbjct  235   HRFLEKRKDRVNSKAPYQV-NNPSRPS  260



>ref|XP_006342934.1| PREDICTED: protein TIFY 10B-like [Solanum tuberosum]
Length=309

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 107/159 (67%), Gaps = 13/159 (8%)
 Frame = +2

Query  275  GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEK  454
            G+APE+S+FVQTCNLLSQF+KG+ +IRDL+ GI    TEA+GK + +   TMD LT +EK
Sbjct  14   GKAPERSSFVQTCNLLSQFIKGKATIRDLNLGIAG-QTEAAGKTETA---TMDLLTVMEK  69

Query  455  STQD---QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKV  625
             + D   +E   +D         +SR  E   N  ++   +   + PKAAQLT+FY GKV
Sbjct  70   PSIDLTKEEHKSVDL----VTTESSREKEAAVNEPST--SKEAPKEPKAAQLTMFYDGKV  123

Query  626  MVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLD  742
            +VFD+FPADKARAVMLLASK   QS+ G FQT  +DK++
Sbjct  124  IVFDDFPADKARAVMLLASKGCHQSSFGTFQTTNIDKIN  162


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 51/82 (62%), Gaps = 24/82 (29%)
 Frame = +2

Query  890   SDLPIARRSSLHRFLEKRKDRATARAPYQ-VHNNPLIPSKSE---RPSSKNeaspskneg  1057
             S+LPIARRSSLHRFLEKRKDRA  RAPYQ VHNNPL+PS S      SSK+         
Sbjct  248   SELPIARRSSLHRFLEKRKDRAIVRAPYQVVHNNPLLPSSSNTNGESSSKD---------  298

Query  1058  ssskneassskTRDQIDLNFKL  1123
                        + DQ+DLNFKL
Sbjct  299   -----------SEDQLDLNFKL  309



>gb|KDP40673.1| hypothetical protein JCGZ_24672 [Jatropha curcas]
Length=261

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 98/272 (36%), Positives = 138/272 (51%), Gaps = 52/272 (19%)
 Frame = +2

Query  263   VKISGRA-PEKSNFVQTCNLLSQFLKGRVSIRDLSHGI-GVVNTEASGKFDISHGTTMDF  436
             V  SG+A PEK NF QTCNLLSQ+LK R    D++ GI G +  + S    +   TT++ 
Sbjct  5     VNKSGKAAPEKPNFTQTCNLLSQYLKERGRFGDINLGINGKIEAKGSESSRLPK-TTLNL  63

Query  437   LTNIEKSTQDQ---------EMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapk--ea  583
             L +IE+++  +         E+   D  P+   +G+   VE+  N +A + K        
Sbjct  64    LPDIEQNSSAENPSRPSLSAEIKTADFFPKFVGSGSPYPVEDSANKSADLRKPPSSIPAD  123

Query  584   pkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQT----AGVDKLDLPA  751
             P  AQ+TIFY G+VMVFD+FPADKA+ +  LA+K S  +  G   +    + +DK   P+
Sbjct  124   PVPAQMTIFYGGRVMVFDDFPADKAKEIFALAAKGSSNTTNGFLTSLPTASAMDKSRTPS  183

Query  752   ---DGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSL  922
                D         P D                                GSDLPIARR+SL
Sbjct  184   VSNDAGGEGLQLRPQD------------------------------TNGSDLPIARRASL  213

Query  923   HRFLEKRKDRATARAPYQVHNNPLIPSKSERP  1018
             HRFLEKRK+RA+++APYQ+H  P  P +  +P
Sbjct  214   HRFLEKRKERASSKAPYQMH-KPSSPPRHPKP  244



>ref|NP_001234223.1| salt responsive protein 1 [Solanum lycopersicum]
 gb|ACG50003.2| salt responsive protein 1 [Solanum lycopersicum]
Length=309

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 106/159 (67%), Gaps = 13/159 (8%)
 Frame = +2

Query  275  GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEK  454
            G+APE+S+FVQTCNLLSQF+KG+ +IRDL+ GI     EA+GK + +   TMD LT +EK
Sbjct  14   GKAPERSSFVQTCNLLSQFIKGKATIRDLNLGIAG-QPEAAGKTETA---TMDLLTVMEK  69

Query  455  STQD---QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKV  625
             + D   +E   +D         +SR  E   N  ++   +   + PKAAQLT+FY GKV
Sbjct  70   PSIDLTKEEHKSVDL----VTTESSREKEAAVNEPST--SKEAPKEPKAAQLTMFYDGKV  123

Query  626  MVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLD  742
            +VFD+FPADKARAVMLLASK  PQS+ G FQ   +DK++
Sbjct  124  IVFDDFPADKARAVMLLASKGCPQSSFGTFQAINIDKIN  162


 Score = 78.6 bits (192),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 51/82 (62%), Gaps = 24/82 (29%)
 Frame = +2

Query  890   SDLPIARRSSLHRFLEKRKDRATARAPYQ-VHNNPLIPSKSE---RPSSKNeaspskneg  1057
             S+LPIARRSSLHRFLEKRKDRAT RAPYQ V NNPL+PS S      SSK+         
Sbjct  248   SELPIARRSSLHRFLEKRKDRATVRAPYQVVRNNPLLPSSSNTNGESSSKD---------  298

Query  1058  ssskneassskTRDQIDLNFKL  1123
                        + DQ+DLNFKL
Sbjct  299   -----------SEDQLDLNFKL  309



>ref|XP_004252407.1| PREDICTED: protein TIFY 10A-like [Solanum lycopersicum]
Length=200

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 100/263 (38%), Positives = 128/263 (49%), Gaps = 80/263 (30%)
 Frame = +2

Query  254   LSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMD  433
             +S+ ++     EKS+ + TCNLL+QF  G+ +I DL+  I   N EA          T D
Sbjct  1     MSNRQLCSLDSEKSHLMNTCNLLTQFFNGKANINDLNLTISN-NGEAKA------SATKD  53

Query  434   FLTNIEK---STQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLT  604
              LTN+E+    T +Q+   ID  P++ +N             AS SKE P +  K AQL+
Sbjct  54    LLTNMEELSTKTTEQDQKLIDHVPKSAIN------------KASGSKEIPHKEQKLAQLS  101

Query  605   IFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVF------QTAGVDKLDLPADGAAV  766
             IFY GKV+VFD+FPA+KARAVMLLASK    ++  +F      QT G +  DLP      
Sbjct  102   IFYGGKVVVFDDFPAEKARAVMLLASKGISNNSCAIFQTPTTTQTNGSNNFDLP------  155

Query  767   VATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRK  946
                                                          IARRSSL+RFLEKRK
Sbjct  156   ---------------------------------------------IARRSSLYRFLEKRK  170

Query  947   DRATARAPYQVHNNPLIPSKSER  1015
             DR TARAPYQ+H NPL  S   R
Sbjct  171   DRDTARAPYQMH-NPLQSSSRTR  192



>ref|XP_002529200.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33214.1| conserved hypothetical protein [Ricinus communis]
Length=269

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 96/254 (38%), Positives = 136/254 (54%), Gaps = 41/254 (16%)
 Frame = +2

Query  263  VKISGRA--PEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISH--GTTM  430
            V+ SG+A   EK+NF QTCNLLSQ+LK R S  ++++GI     EA+   + S    TT+
Sbjct  5    VQRSGKAVATEKTNFAQTCNLLSQYLKERGSFGNITYGI-TSKPEANKGPEASRTPATTL  63

Query  431  DFLTNIEK-----STQDQ----EMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkea  583
            + L ++E      S QD      + P++  PQ     +   VE  TN AA + +++ K  
Sbjct  64   NLLPSMENPAENSSRQDYVPSTNIKPMELFPQLVGFSSQNPVEGSTNKAADL-RKSSKGD  122

Query  584  pkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAA  763
               AQ+TIFY G+VMVFD+FPA+KA+ ++ LASK +  +  G    + V+K    A+ +A
Sbjct  123  STTAQMTIFYGGQVMVFDDFPAEKAKEIIALASKGTSNTTNGFTTASAVEK----ANQSA  178

Query  764  VVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKR  943
            +      V                             P    SDLPIARR+SLHRF EKR
Sbjct  179  IAPPPNKV----------------------REGLQLRPQADDSDLPIARRASLHRFFEKR  216

Query  944  KDRATARAPYQVHN  985
            KDRA A+APYQ++N
Sbjct  217  KDRAAAKAPYQINN  230



>emb|CDO97827.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 102/258 (40%), Positives = 135/258 (52%), Gaps = 25/258 (10%)
 Frame = +2

Query  236  MSGKH---LLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKF  406
            MS  H   + S     G+A EKSNF  TCNLLSQ++K R  +RDL+        EA  K 
Sbjct  1    MSASHNSFVSSKASGKGKALEKSNFAHTCNLLSQYVKERGGLRDLNLAGISCKPEAIAKP  60

Query  407  DI--SHGTTMDFLTNIEKSTQ--DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeap  574
            +   +  +T++ L ++E   Q   ++  P+DP+ +     TS T E+ +   +   +E  
Sbjct  61   EEPETSTSTLNLLNSLEIPEQPSSEQSKPVDPSSRFAPLVTSNTPEDASRNVSP--REEM  118

Query  575  keapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASK--SSPQSARGVFQTAGVDKLDLP  748
               PK AQ+TIFY+G V+VFD+ PA+KA  +MLLAS   S   +A G F T       L 
Sbjct  119  AGEPKRAQMTIFYAGDVIVFDDLPAEKAEEIMLLASSGGSGNANASGRFSTPNNSVEKLC  178

Query  749  ADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHR  928
            + GA    +  P DP    A   P  P P                  S+LPIARRSSLHR
Sbjct  179  SAGAVASGSKAPADPVCTAAQESPKQPQPEANT--------------SELPIARRSSLHR  224

Query  929  FLEKRKDRATARAPYQVH  982
            FL KRKDRA ARAPYQ+H
Sbjct  225  FLAKRKDRAGARAPYQLH  242



>ref|XP_006361332.1| PREDICTED: protein TIFY 10A-like [Solanum tuberosum]
Length=200

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 99/263 (38%), Positives = 130/263 (49%), Gaps = 80/263 (30%)
 Frame = +2

Query  254   LSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMD  433
             +S+  +S    EKS+ ++TCNLL+Q+  G+  +++L+  I   N EA          T D
Sbjct  1     MSNRPLSSLDSEKSHLMKTCNLLTQYFNGKADLKNLNLTISN-NGEAKA------SATKD  53

Query  434   FLTNIEKS---TQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLT  604
              LTN+E+S   T +Q+   ID  P++ +N             AS SKE P +  K AQL+
Sbjct  54    LLTNMEESSTKTTEQDQKLIDHVPKSAIN------------KASSSKEIPNKEQKLAQLS  101

Query  605   IFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTA------GVDKLDLPADGAAV  766
             IFY GKV+VFD+FPA+KARAVMLLASK    ++  +FQT       G +  DLP      
Sbjct  102   IFYGGKVVVFDDFPAEKARAVMLLASKGISNNSCAIFQTTTTTQTNGANNFDLP------  155

Query  767   VATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRK  946
                                                          IARRSSL+RFLEKRK
Sbjct  156   ---------------------------------------------IARRSSLYRFLEKRK  170

Query  947   DRATARAPYQVHNNPLIPSKSER  1015
             DR TARAPYQ+H NPL  S   R
Sbjct  171   DRDTARAPYQMH-NPLQSSSRTR  192



>gb|AFK35276.1| unknown [Lotus japonicus]
Length=257

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 89/252 (35%), Positives = 131/252 (52%), Gaps = 40/252 (16%)
 Frame = +2

Query  266  KISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS--HGTTMDFL  439
            K + ++PEK+ F QTC+LLSQ++K + S  DL+ G+   NTE +G  + S    TTM+  
Sbjct  14   KAAAKSPEKTTFSQTCSLLSQYIKEKGSFGDLTLGMTCNNTEQTGAPETSCQSATTMNLF  73

Query  440  TNIEKSTQDQEMAPIDP-NPQNT---VNGTS--RTVEEGTNAAASISkeapkeapkaaQL  601
               E +   + + P++  +PQ     +N +S  ++V +G  A+               QL
Sbjct  74   PAKESNMTPKNLTPMNLLSPQEIPTLINNSSAIKSVSKGAKAS---------------QL  118

Query  602  TIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT--  775
            TIFY+G+V+V D+FPADKA  +M LA+KS+ QS     Q       + P+   +++ T  
Sbjct  119  TIFYAGQVIVLDDFPADKASELMSLATKSTSQSQNNSVQE------NQPSFAPSLIRTSA  172

Query  776  --STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKD  949
              S PV P   +         P                   DLPIAR++SLHRFLEKRKD
Sbjct  173  DSSAPVIPGVNIIPCTGTNSIPEHAQVSSRPIV-------CDLPIARKASLHRFLEKRKD  225

Query  950  RATARAPYQVHN  985
            R  A+APY+V N
Sbjct  226  RIAAKAPYEVTN  237



>ref|XP_011079529.1| PREDICTED: protein TIFY 10B-like isoform X1 [Sesamum indicum]
Length=286

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 108/277 (39%), Positives = 137/277 (49%), Gaps = 41/277 (15%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIG--VVNTEASGKFD  409
            MS    ++D +  G+APEKSNFVQTCNLLS+++K + S+RDL+  IG  V + EA  K  
Sbjct  1    MSSHRHIADGRRLGKAPEKSNFVQTCNLLSRYIKEKGSLRDLNLEIGGKVESLEAIVKPG  60

Query  410  ISHGTTMDFLTNIEKSTQ---DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapke  580
             S            KS Q   DQ   PI P+  +++N       + T+  A        E
Sbjct  61   TSISPPASATIYKVKSAQPLTDQH-PPITPH-DSSINTAEHAPHKQTSKEA------MTE  112

Query  581  apkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVF-QTAGVDKLDLPADG  757
             PK AQLTIFYSGKV+VFD++ ADKAR +M  A K S + + G+   T G    + P+ G
Sbjct  113  NPKTAQLTIFYSGKVLVFDDYSADKARELMAFARKGSSKMSYGILSNTLG----ERPSPG  168

Query  758  AAV----VATSTPVDppkpmasppplppppvppptqpaaaapapapGGS-----------  892
            A V     +TSTP D   P              P      + A   G             
Sbjct  169  AVVAPTLASTSTPRDGLPPRPQASSYNKGVGISPDTCKDKSNAAFAGSVASNFRAEERVS  228

Query  893  --------DLPIARRSSLHRFLEKRKDRATARAPYQV  979
                    DLPIARRSSLHRFLEKRK+RA    PYQV
Sbjct  229  SQSEANDFDLPIARRSSLHRFLEKRKERAAGGGPYQV  265



>gb|KHG24904.1| Protein TIFY 10A -like protein [Gossypium arboreum]
Length=263

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 96/252 (38%), Positives = 133/252 (53%), Gaps = 32/252 (13%)
 Frame = +2

Query  263  VKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLT  442
            V+   R+PEK++F QTCNLLSQ+LK + S  DLS G+   N EA+   ++   T   F  
Sbjct  11   VQKPARSPEKTSFTQTCNLLSQYLKEKGSFGDLSLGM-TCNDEANETPEMLRPTMNLFPV  69

Query  443  NIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAA-----------SISkeapkeapk  589
            N EKS  D   AP    P   +    R+++   N AA           +++K      P+
Sbjct  70   N-EKSGDDCLAAP----PPRKL----RSMDLFPNQAAFSSPKDDALKSTMNKLGSSVEPQ  120

Query  590  aaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVV  769
             AQ+TIFY G+V+VF++FPADKA+ +MLLA K S QS      +   +   + A   + +
Sbjct  121  TAQMTIFYGGQVIVFNDFPADKAKEIMLLAGKGSSQS-----NSFNTNPPHINAPFTSTI  175

Query  770  ATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKD  949
            ATS P++    +   P           + A           DLPIARR+SLHRFLEKRKD
Sbjct  176  ATS-PIESGIGVPPTPNFSTTVTQECIRSAQRPIP-----GDLPIARRASLHRFLEKRKD  229

Query  950  RATARAPYQVHN  985
            R T RAPY++ N
Sbjct  230  RMTTRAPYEISN  241



>ref|XP_004488102.1| PREDICTED: protein TIFY 10A-like [Cicer arietinum]
Length=255

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 91/248 (37%), Positives = 126/248 (51%), Gaps = 33/248 (13%)
 Frame = +2

Query  266  KISG----RAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISH--GTT  427
            +ISG    R+PEKS F QTC+LLSQ++K + S +DLS G+   NT+  G  + S    TT
Sbjct  9    EISGQKPARSPEKSTFSQTCSLLSQYIKEKGSFKDLSLGM-TCNTDPIGSPETSSHSATT  67

Query  428  MDFLTNIEKSTQDQEMAPIDP-NPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLT  604
            M+F  N E +   + +  +D   PQ  +N ++    +G  AA               QLT
Sbjct  68   MNFFPNKENNLTPKNLTTMDLLTPQAALNNSNAI--KGPKAA---------------QLT  110

Query  605  IFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVA-TST  781
            +FY G+V+VFD+FPAD+A  +M  ASK   QS      T    +   P +     A ++T
Sbjct  111  MFYGGQVIVFDDFPADRAHELMSFASKGISQSHNNSVFTYTQSQPSFPINLVRTSADSTT  170

Query  782  PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATA  961
            P+ P   + +          P                DLPIAR++SLHRFLEKRKDR  A
Sbjct  171  PIVPSVNIVANTGAGSVLEHPQVPSRPIV-------CDLPIARKASLHRFLEKRKDRIAA  223

Query  962  RAPYQVHN  985
            +APYQ  N
Sbjct  224  KAPYQRTN  231



>ref|NP_001276248.1| protein TIFY 10A-like [Glycine max]
 gb|ACU20288.1| unknown [Glycine max]
Length=258

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 86/239 (36%), Positives = 127/239 (53%), Gaps = 20/239 (8%)
 Frame = +2

Query  275  GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEK  454
             R+PEKS+F QTC+LLSQ++K + S  DL+ G+    +  S +      TTM+     E 
Sbjct  16   ARSPEKSSFSQTCSLLSQYIKEKGSFGDLTLGM---TSCGSPETSCQSATTMNLFPTKEN  72

Query  455  STQDQEMAPIDP-NPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMV  631
            +   +++  +D  +PQ +   + R  EE      S + ++  ++ K AQ+TIFY G+V+V
Sbjct  73   NVTPKDLTAMDLFSPQAS---SYRPSEEILTLINSSAIKSVSKSAKTAQMTIFYGGQVVV  129

Query  632  FDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVA-TSTPVDppkpma  808
            FD+FPADKA  +M  A+K  PQS      T    +   PA+     A +S P+ P   + 
Sbjct  130  FDDFPADKASEIMSYATKGIPQSQNNSVFTYTPSQPSFPANLVRTSADSSAPITPSVNIT  189

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHN  985
            +     P     P               DLPIAR++SLHRFLEKRKDR  ++APYQ+ N
Sbjct  190  NSIHEHPQASSRPVV------------CDLPIARKASLHRFLEKRKDRIASKAPYQLAN  236



>ref|XP_010261778.1| PREDICTED: protein TIFY 10B [Nelumbo nucifera]
Length=285

 Score =   119 bits (297),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 89/248 (36%), Positives = 130/248 (52%), Gaps = 37/248 (15%)
 Frame = +2

Query  278  RAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDI----SHGTTMDFL--  439
            + PEKSNF QTC+LLSQ+LK + +  DLS G+   + +  GK +     +  T M FL  
Sbjct  20   KTPEKSNFSQTCSLLSQYLKEKGNFGDLSLGMNC-SLQGKGKPETPSQSTSTTIMTFLPS  78

Query  440  ----TNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTI  607
                ++ E++   + +  +D  PQ+   G S   +  T  A    +    + P+ AQ+TI
Sbjct  79   MGTSSSTEQNASSRNVKSMDLFPQHAGFGPSNPTKNVTKTADF--RAPAIKEPQTAQMTI  136

Query  608  FYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATST--  781
            FY+GKV VFD+FPADKAR +MLLAS+SS Q++     T+G ++ +       ++A+S   
Sbjct  137  FYAGKVHVFDDFPADKAREIMLLASRSSTQNSGSFTSTSGNEQQNF-----GILASSASN  191

Query  782  --PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
              P+            P                     SDLPIAR+ SL RFLEKRKDR 
Sbjct  192  FPPISSNNNSTEERLHPSAQTSV---------------SDLPIARKVSLRRFLEKRKDRI  236

Query  956  TARAPYQV  979
            +++APY V
Sbjct  237  SSKAPYSV  244



>emb|CDP03053.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 95/244 (39%), Positives = 128/244 (52%), Gaps = 23/244 (9%)
 Frame = +2

Query  257  SDVKISGRAP--EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTM  430
            S+V  SGR P  +KSNF  TC+ LSQ+LK + S  DLS G+   N E +G        TM
Sbjct  4    SEVMDSGRFPAAQKSNFAHTCSRLSQYLKEKGSFGDLSLGL-TRNFEPNG----PPTKTM  58

Query  431  DFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIF  610
            + L  IEK+ ++ +       P   VN       +G  A         K  P+ AQ+TIF
Sbjct  59   NLLPMIEKTGKNSDAPAAARTPSMPVNLFGTAFPKG-EAQKKTDDSVVKAEPETAQMTIF  117

Query  611  YSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAV-VATSTPV  787
            Y+G+VMVF++FPADKA+ +MLLA + +  S  GV   A V+ +  PA+ A   + TS+P 
Sbjct  118  YNGQVMVFNDFPADKAKEIMLLAGQGT--SLHGVNTYATVNMVPKPAESATTNLVTSSPT  175

Query  788  DppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARA  967
                          P         +A     P  +D PIAR++SL +FLEKRKDR TARA
Sbjct  176  ------------IVPSFANNLVQESAQKPLQPNFNDFPIARKASLTKFLEKRKDRITARA  223

Query  968  PYQV  979
            PY V
Sbjct  224  PYPV  227



>gb|KHN12298.1| Protein TIFY 10A [Glycine soja]
Length=258

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 85/239 (36%), Positives = 127/239 (53%), Gaps = 20/239 (8%)
 Frame = +2

Query  275  GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEK  454
             R+PEKS+F QTC+LLSQ++K + S  DL+ G+    +  S +      TTM+     E 
Sbjct  16   ARSPEKSSFSQTCSLLSQYIKEKGSFGDLTLGM---TSCGSPETSCQSATTMNLFPTKEN  72

Query  455  STQDQEMAPIDP-NPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMV  631
            +   +++  +D  +PQ +    S  +    N++A    ++  ++ K AQ+TIFY G+V+V
Sbjct  73   NVTPKDLTAMDLFSPQASSYRPSEEIPTLINSSA---IKSVSKSAKTAQMTIFYGGQVVV  129

Query  632  FDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVA-TSTPVDppkpma  808
            FD+FPADKA  +M  A+K  PQS      T    +   PA+     A +S P+ P   + 
Sbjct  130  FDDFPADKASEIMSYATKGIPQSQNNSVFTYTPSQPSFPANLVRTSADSSAPIIPSVNIT  189

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHN  985
            +     P     P               DLPIAR++SLHRFLEKRKDR  ++APYQ+ N
Sbjct  190  NSIHEHPQASSRPVV------------CDLPIARKASLHRFLEKRKDRIASKAPYQLAN  236



>gb|AEC12208.1| JAZ1 [Maesa lanceolata]
Length=272

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 133/263 (51%), Gaps = 37/263 (14%)
 Frame = +2

Query  236  MSGKHLLSD-VKISG-RAPEKS-NFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKF  406
            MS     SD VK +G  AP+KS NF QTC LLSQ+LK + +  DLS G+    T      
Sbjct  1    MSNSSEFSDSVKFAGATAPDKSFNFSQTCTLLSQYLKEKCTFGDLSLGMSFDGTGTPVAA  60

Query  407  DISHGTTMDFLTNIEKSTQD------------QEMAPIDPNPQNTVNGTSRTVEEGTNAA  550
              SH  TM+      KS +             +++  +D  PQ++  G++ + EE     
Sbjct  61   TTSH--TMNLFPMAPKSGESSGFPTRNASPMTRDLMSMDLFPQHSGFGSNLSKEE---IP  115

Query  551  ASISkeapkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGV  730
              +     K  P+ AQ+TIFY GKV VF++FPADKA+ VMLLASK+S ++    F +   
Sbjct  116  KMVDFSVNKPEPETAQMTIFYDGKVCVFNDFPADKAKEVMLLASKASSENP-STFASTPA  174

Query  731  DKLDLPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIAR  910
             K   P + A +V TS  V         P     P    T             +DLPIAR
Sbjct  175  QK---PTEPANLVPTSPNVGLNFGNNMIPERAERPPQHTT-------------ADLPIAR  218

Query  911  RSSLHRFLEKRKDRATARAPYQV  979
            ++SL RFLEKRKDR TARAPYQ 
Sbjct  219  KASLTRFLEKRKDRVTARAPYQT  241



>gb|ACU18981.1| unknown [Glycine max]
Length=258

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 84/248 (34%), Positives = 119/248 (48%), Gaps = 34/248 (14%)
 Frame = +2

Query  275  GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEK  454
             R+PEKS+F QTC+LLSQ++K + S  DL+ G+    +  S +      TTM+     E 
Sbjct  16   ARSPEKSSFSQTCSLLSQYIKEKGSFGDLTLGM---TSCGSPETSCQSATTMNLFPPKEN  72

Query  455  STQDQEMAPIDP-NPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMV  631
            +   + +  +D  +PQ +  G S  +    N++A  S     +     Q+TIFY G+V+V
Sbjct  73   NVAPKNLTAMDLLSPQASSYGPSEEIPTLVNSSAIKSVSKGAKTA---QMTIFYGGQVVV  129

Query  632  FDEFPADKARAVMLLASKSS-PQSARGVFQTAGVDKLDLP-------ADGAAVVATSTPV  787
            FD+FPADKA  +M  A+K   PQS      T    +   P       AD +A +  S  +
Sbjct  130  FDDFPADKASGIMSYATKGGIPQSQNNSVYTYTQSQPSFPPTLIRTSADSSAPIIPSVNI  189

Query  788  DppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARA  967
                         P                      LPIAR++SLHRFLEKRKDR  ++A
Sbjct  190  TNSIREHPQASSRPVVY-------------------LPIARKASLHRFLEKRKDRIASKA  230

Query  968  PYQVHNNP  991
            PYQV N P
Sbjct  231  PYQVANGP  238



>ref|XP_003546514.1| PREDICTED: protein TIFY 10A-like [Glycine max]
 gb|KHN42787.1| Protein TIFY 10A [Glycine soja]
Length=258

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 84/248 (34%), Positives = 119/248 (48%), Gaps = 34/248 (14%)
 Frame = +2

Query  275  GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEK  454
             R+PEKS+F QTC+LLSQ++K + S  DL+ G+    +  S +      TTM+     E 
Sbjct  16   ARSPEKSSFSQTCSLLSQYIKEKGSFGDLTLGM---TSCGSPETSCQSATTMNLFPPKEN  72

Query  455  STQDQEMAPIDP-NPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMV  631
            +   + +  +D  +PQ +  G S  +    N++A  S     +     Q+TIFY G+V+V
Sbjct  73   NVAPKNLTAMDLLSPQASSYGPSEEIPTLVNSSAIKSVSKGAKTA---QMTIFYGGQVVV  129

Query  632  FDEFPADKARAVMLLASKSS-PQSARGVFQTAGVDKLDLP-------ADGAAVVATSTPV  787
            FD+FPADKA  +M  A+K   PQS      T    +   P       AD +A +  S  +
Sbjct  130  FDDFPADKASEIMSYATKGGIPQSQNNSVYTYTQSQPSFPPTLIRTSADSSAPIIPSVNI  189

Query  788  DppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARA  967
                         P                      LPIAR++SLHRFLEKRKDR  ++A
Sbjct  190  TNSIREHPQASSRPVVY-------------------LPIARKASLHRFLEKRKDRIASKA  230

Query  968  PYQVHNNP  991
            PYQV N P
Sbjct  231  PYQVANGP  238



>ref|XP_009621436.1| PREDICTED: protein TIFY 10A-like [Nicotiana tomentosiformis]
Length=238

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 91/266 (34%), Positives = 126/266 (47%), Gaps = 56/266 (21%)
 Frame = +2

Query  236   MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNT-EASGKFDI  412
             M    ++   K++G   +KS F QTCNLLSQFLK + S  DL++ +G+  + E  G    
Sbjct  1     MGSSEIVDSGKVTG---QKSQFSQTCNLLSQFLKKKGSFGDLNN-LGIYRSFEPIGN---  53

Query  413   SHGTTMDFLTNIEKS---TQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkea  583
                TTM+ L  IEKS    ++    P++  PQ  ++      E+                
Sbjct  54    QTTTTMNLLPMIEKSGDSAENNSQKPMNLFPQEVISTAKSEPEKA---------------  98

Query  584   pkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQS---ARGVFQTAGVDKLDLPAD  754
                 Q+TIFY G+V+VFD+FPADKA  +M LASK +      A  +F  A V+       
Sbjct  99    ----QMTIFYGGQVIVFDDFPADKANEIMKLASKKNNNKQNLASNIFSYAMVNN---KKS  151

Query  755   GAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFL  934
               +V   ST                       +     P      +DLPIARR+SL RFL
Sbjct  152   AESVTINST--------------------QELRTRTQVPISQSSVADLPIARRNSLTRFL  191

Query  935   EKRKDRATARAPYQVHNNPLIPSKSE  1012
             EKRKDR T+ APYQ+ N  +  SK+E
Sbjct  192   EKRKDRITSTAPYQICNKKVADSKNE  217



>ref|XP_006587054.1| PREDICTED: protein TIFY 10A-like isoform X2 [Glycine max]
Length=257

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 84/239 (35%), Positives = 126/239 (53%), Gaps = 21/239 (9%)
 Frame = +2

Query  275  GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEK  454
             R+PEKS+F QTC+LLSQ++K + S  DL+ G+    +  S +      TTM+     E 
Sbjct  16   ARSPEKSSFSQTCSLLSQYIKEKGSFGDLTLGM---TSCGSPETSCQSATTMNLFPTKEN  72

Query  455  STQDQEMAPIDP-NPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMV  631
            +   +++  +D  +PQ +    S  +    N++A    ++  ++ K AQ+TIFY G+V+V
Sbjct  73   NVTPKDLTAMDLFSPQASSYRPSEEIPTLINSSA---IKSVSKSAKTAQMTIFYGGQVVV  129

Query  632  FDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVA-TSTPVDppkpma  808
            FD+FPADKA  +M  A+K  PQS      T    +   PA+     A +S P+ P   + 
Sbjct  130  FDDFPADKASEIMSYATKGIPQSQNNSVFTYTPSQPSFPANLVRTSADSSAPIIPSVNIT  189

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHN  985
            +     P     P                LPIAR++SLHRFLEKRKDR  ++APYQ+ N
Sbjct  190  NSIHEHPQASSRPVVY-------------LPIARKASLHRFLEKRKDRIASKAPYQLAN  235



>ref|XP_011036477.1| PREDICTED: protein TIFY 10A [Populus euphratica]
Length=267

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/243 (35%), Positives = 120/243 (49%), Gaps = 37/243 (15%)
 Frame = +2

Query  293  SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQDQ-  469
            SNF   CNLL Q+LK R S  D+S GI         +  IS  TT++ L N+E S+ DQ 
Sbjct  16   SNFAHKCNLLRQYLKERGSFGDISLGINGKAEIKGLETRISPATTLNLLNNMEISS-DQI  74

Query  470  -----------EMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYS  616
                        M  +D  PQ   +G   + ++  N A  + +++    P+ AQ+TIFY+
Sbjct  75   TSRQNAMASANMMTFMDFIPQFVGSGPPDSTDDAINKADHL-RKSSPVDPETAQMTIFYA  133

Query  617  GKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDpp  796
            GKV+VF++FPADKA+ +M LA+K SP S  G   +A V +     +  A + ++      
Sbjct  134  GKVIVFNDFPADKAKEIMALAAKGSPISTDGCPSSAPVLRKVSSTNSVAALDSN------  187

Query  797  kpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
                                           SD+P ARR+SLHRF  KRKDR  ARAPYQ
Sbjct  188  -----------------KGQERLQLQSQANASDVPHARRASLHRFFSKRKDRVAARAPYQ  230

Query  977  VHN  985
            ++N
Sbjct  231  INN  233



>ref|XP_002304118.1| hypothetical protein POPTR_0003s06670g [Populus trichocarpa]
 gb|EEE79097.1| hypothetical protein POPTR_0003s06670g [Populus trichocarpa]
Length=267

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/250 (36%), Positives = 122/250 (49%), Gaps = 51/250 (20%)
 Frame = +2

Query  293  SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDI-------SHGTTMDFLTNIE  451
            SNF Q CNLLSQ+LK R S  D+S GI       +GK +I       S  TT++ L N+E
Sbjct  16   SNFAQKCNLLSQYLKERGSFGDISLGI-------NGKAEIKGLETPSSPATTLNLLNNME  68

Query  452  KSTQDQ------------EMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaa  595
             S+ DQ             M  +D  PQ   +G   + ++  N A  + +++    P+ A
Sbjct  69   ISS-DQITSRQNAMASANMMKFMDFFPQFVGSGPPDSTDDAINKADHL-RKSSPMDPETA  126

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
            Q+TIFY+GKV VF++FPADKA+ +M LA+K S  S  G            P+   A+   
Sbjct  127  QMTIFYAGKVSVFNDFPADKAKEIMALAAKGSSISTDGC-----------PSSAPAIRKV  175

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
            S+                  +                 SD+P ARR+SLHRF  KRKDR 
Sbjct  176  SS------------TNSVAALDSNKGQERLQLQSQANASDVPHARRASLHRFFSKRKDRV  223

Query  956  TARAPYQVHN  985
            TARAPYQ++N
Sbjct  224  TARAPYQINN  233



>gb|KHG00833.1| Protein TIFY 10A -like protein [Gossypium arboreum]
Length=240

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 96/248 (39%), Positives = 128/248 (52%), Gaps = 37/248 (15%)
 Frame = +2

Query  275   GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEK  454
              R+PEK +F QTCNLLSQ+LK + S  DLS G+   N EA+G   +    TM+     +K
Sbjct  13    ARSPEKPSFAQTCNLLSQYLKEKGSFGDLSLGM-TCNVEANGT-PVVPPPTMNLFPVNDK  70

Query  455   STQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVF  634
             S  D        NP+N    TS  +       AS      K  P+ + +TIFY G+V+VF
Sbjct  71    S--DDVCGRNGGNPKNL---TSMDLFPQQAGLASKDDSPNKLEPQTSPMTIFYGGQVIVF  125

Query  635   DEFPADKARAVMLLASKSSPQSARG---VFQTAGVDKLDLPADGAAVVATSTPVDppkpm  805
             ++FPA+KA+ +MLLAS SS QS      +  T+ + +  +      V  TS PV P +  
Sbjct  126   NDFPANKAKEIMLLASNSSSQSNNSFNPIPFTSSIARSPI-ESSIGVPPTSKPVHPAQRA  184

Query  806   asppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHN  985
                                          DLPIARR+SLHRFLEKRKDR TA+APYQ++N
Sbjct  185   VP--------------------------GDLPIARRASLHRFLEKRKDRITAKAPYQINN  218

Query  986   NPLIPSKS  1009
             +   PS S
Sbjct  219   SAAAPSLS  226



>ref|XP_003595354.1| Protein TIFY 10B [Medicago truncatula]
 gb|AES65605.1| jasmonate zim-domain protein [Medicago truncatula]
Length=253

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 121/245 (49%), Gaps = 28/245 (11%)
 Frame = +2

Query  266  KISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEA----SGKFDISHGTTMD  433
            K   ++PEK+ F QTC+LLSQ++K +   +DLS GI   N       S +      TTM+
Sbjct  14   KPPAKSPEKTTFSQTCSLLSQYIKEKGCFKDLSLGITCNNNNTDPSGSSETSSQSATTMN  73

Query  434  FLTNIEKSTQDQEMAPIDP-NPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIF  610
                +E +   + +  +D   PQ  +N ++    +G  AA               QLT+F
Sbjct  74   LFPTMENNLSQKNLTTMDLLTPQAALNNSNAI--KGPKAA---------------QLTMF  116

Query  611  YSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAV-VATSTPV  787
            Y+G+V+VFD+FPADKA+ +M  A+K   QS      T    +   P +     V T+TP+
Sbjct  117  YNGQVIVFDDFPADKAQELMAFANKGISQSQNNSVYTYTQSQPSFPPNLVRTSVNTTTPI  176

Query  788  DppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARA  967
                 + +   +P       +          P   DLPI R++SLHRFLEKRKDR  A A
Sbjct  177  -----VPTVNIIPSTATGTGSMNEHLQVPSRPNLCDLPIMRKASLHRFLEKRKDRIAANA  231

Query  968  PYQVH  982
            PYQ++
Sbjct  232  PYQIN  236



>ref|XP_007138635.1| hypothetical protein PHAVU_009G225300g [Phaseolus vulgaris]
 gb|ESW10629.1| hypothetical protein PHAVU_009G225300g [Phaseolus vulgaris]
Length=257

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 125/247 (51%), Gaps = 34/247 (14%)
 Frame = +2

Query  275  GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS--HGTTMDFLTNI  448
             ++PEKS+F QTC+LLSQ++K + S  DL+ G+   NTE SG  + S   GTTM+     
Sbjct  16   AKSPEKSSFSQTCSLLSQYIKEKGSFGDLTLGM-TCNTEPSGSPETSCQSGTTMNLFPTK  74

Query  449  EKSTQDQEMAPIDP-NPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKV  625
            E +   + +  +D  +PQ     + R +EE      S + ++  +  K AQ+TIFY G+V
Sbjct  75   ENNVTPKNLTAMDLLSPQ----ASYRPLEEIPTLVNSSAIKSVSKVNKTAQMTIFYGGQV  130

Query  626  MVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLP-------ADGAAVVATSTP  784
            +VFD+FPA+KA  +M  A +  PQS      T    +   P       AD +A +  S  
Sbjct  131  VVFDDFPAEKANEIMSYA-RGKPQSQNNSVFTYTQSQPSFPSNLVRTSADSSAPIIPSVN  189

Query  785  VDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATAR  964
            V       S  P  P                     D PIAR++SLHRFL KRKDR  ++
Sbjct  190  VTNSIHEHSQAPSRPVV------------------CDPPIARKASLHRFLLKRKDRIASK  231

Query  965  APYQVHN  985
            APYQV N
Sbjct  232  APYQVPN  238



>gb|ACM89457.1| jasmonate ZIM domain 1 [Catharanthus roseus]
Length=257

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 91/253 (36%), Positives = 126/253 (50%), Gaps = 34/253 (13%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAP--EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFD  409
            M+   ++ D   SGRA   +KSNF QTC+LLSQ+LK   S  DLS G+   N E +G   
Sbjct  1    MASSEMIMD---SGRASAVQKSNFSQTCSLLSQYLKENGSFGDLSLGLNR-NFEPNG---  53

Query  410  ISHGTTMDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapk  589
                 TM+ L+ ++KS Q+ E   +  N      G       G      IS    +    
Sbjct  54   -VPAKTMNLLSTMDKSGQNLEAPAVKENKP----GNLFPQPAGFYTIPDISVAKSEPDTA  108

Query  590  aaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVV  769
              Q+TIFY G+V+VF++FPA+KAR +MLLAS  SP           ++    PA+ A  +
Sbjct  109  --QMTIFYGGQVLVFNDFPAEKAREIMLLASNGSP-----------LNFTPKPAESATGL  155

Query  770  ATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKD  949
             T  P      + S           P+             +DLP++R++SL RFLEKRKD
Sbjct  156  VTPPPPAASNVVPSFGNGLVQQENVPSPLYPRI-------NDLPLSRKASLTRFLEKRKD  208

Query  950  RATARAPYQVHNN  988
            R TA+APYQ+ NN
Sbjct  209  RITAKAPYQMMNN  221



>ref|XP_006474700.1| PREDICTED: protein TIFY 10A-like [Citrus sinensis]
 gb|KDO73848.1| hypothetical protein CISIN_1g023369mg [Citrus sinensis]
Length=283

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 104/277 (38%), Positives = 137/277 (49%), Gaps = 35/277 (13%)
 Frame = +2

Query  251   LLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISH---G  421
             + S  ++S   PEKS+F QTC+LLSQ+LK   S  DLS GI   N EA+G  +I      
Sbjct  1     MASSSEMSVNLPEKSSFSQTCSLLSQYLKEGGSFGDLSLGISS-NIEANGVPEIPRRPAA  59

Query  422   TTMDFLTNIEKSTQD---QEMAPIDPNPQNTVNGTSRTVEEG----TNAAASISkeapke  580
             TTM+     + S QD   + MA     P+N  +      + G     +    I     K 
Sbjct  60    TTMNLFPVSDNSGQDVSARNMA----APRNWESMNLFPQQAGFAPKNDTPNMIDSSLNKP  115

Query  581   apkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGA  760
             AP+ AQ+TIFY G+V+VF++FPADKA  +M LAS  S      +        + LPA G 
Sbjct  116   APQTAQMTIFYGGQVIVFNDFPADKANEIMQLASNGS-----SLSHGTAYPPMQLPAQGY  170

Query  761   AVVATS---TPVDppkpmasppplppppvppptqpaaaapapapGG------------SD  895
                A S   +PV+   P++  PP  P        P + +                    D
Sbjct  171   NSFAASLPKSPVESTPPVSPGPPKIPTEPSCSVPPRSNSIPNFGNNLIPERAQPPSRPCD  230

Query  896   LPIARRSSLHRFLEKRKDRATARAPYQVHNNPLIPSK  1006
             LPIARR+SLHRFLEKRKDR  ARAPYQV+ +   P K
Sbjct  231   LPIARRNSLHRFLEKRKDRIVARAPYQVNGSAGAPDK  267



>emb|CDY46022.1| BnaA02g17040D [Brassica napus]
Length=240

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 84/239 (35%), Positives = 123/239 (51%), Gaps = 26/239 (11%)
 Frame = +2

Query  266  KISGRAPEKS-NFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLT  442
            + SGR  +K  +F QTC+ LS++LK + S  DLS G+   N + +G F +S   TM  L 
Sbjct  9    EFSGRKLQKKPSFSQTCSRLSRYLKEKGSFGDLSLGM-TCNPDVTGVFAVSRQPTMMNLF  67

Query  443  NIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGK  622
              E+++  Q++ P    P+ +   +S +          I  ++ K   ++AQLTIFY G+
Sbjct  68   PCEEASPTQDVKPTHKVPRQSSFSSSSSAGAKGEVEKIIETKSVKVESQSAQLTIFYGGQ  127

Query  623  VMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkp  802
            VMVFD+FPA+KA+ V+ LA+K             G D     A     +A++TP      
Sbjct  128  VMVFDDFPAEKAKQVIDLANK-------------GSDYAQNIAKNQKEIASTTP------  168

Query  803  masppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
                    P        P       +    +LPIARR+SLHRFLEKRKDR T++APYQ+
Sbjct  169  -----NPVPSLAKTAAAPELVQTNTSSLACELPIARRASLHRFLEKRKDRITSKAPYQI  222



>ref|XP_010099096.1| Protein TIFY 10A [Morus notabilis]
 gb|EXB76744.1| Protein TIFY 10A [Morus notabilis]
Length=273

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 133/251 (53%), Gaps = 16/251 (6%)
 Frame = +2

Query  275   GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISH--GTTMDFLTNI  448
             GR  EK +F Q C++LSQ+LK R S  DL+ G+     E +G  ++    GTTMD    +
Sbjct  16    GRFSEKPSFSQKCSMLSQYLKERGSFGDLTLGM-TCTVEPNGTSEMYRQTGTTMDLFPVV  74

Query  449   EKS-----TQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
             EKS      +D +   + P     ++      E    A  S++K  P   P+ AQ+TIFY
Sbjct  75    EKSRNMATPRDLKFMSLFPQQSGFISSVPEP-EVPKMADYSLNKRVPGGEPERAQMTIFY  133

Query  614   SGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDp  793
              G+V+V ++FPA+KA+ VMLLAS+ S +S     QTA     +  A+        +P++ 
Sbjct  134   GGQVIVLNDFPAEKAKEVMLLASQESSRS-----QTAAAYVSNQAANAFPTHVAKSPIES  188

Query  794   pkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPY  973
                +   P +P        +P      P     DLPIAR++SLHRFLEKRKDR +A+APY
Sbjct  189   SNSVPQSPSVPNFGNKVIQEPIQPPSRPIV--CDLPIARKASLHRFLEKRKDRISAKAPY  246

Query  974   QVHNNPLIPSK  1006
             Q  +  + P+K
Sbjct  247   QTGSPEVAPTK  257



>ref|NP_001234883.1| jasmonate ZIM-domain protein 1 [Solanum lycopersicum]
 gb|ABU88421.1| jasmonate ZIM-domain protein 1 [Solanum lycopersicum]
Length=252

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 90/245 (37%), Positives = 132/245 (54%), Gaps = 32/245 (13%)
 Frame = +2

Query  266  KISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSH-GIGVVNTEASG--KFDISHGTTMDF  436
            K++G   +KS F QTCNLLSQFLK + S+ DL++ GI     E++G  +   +  TTM+ 
Sbjct  11   KVTG---QKSQFSQTCNLLSQFLKKKGSVGDLNNLGIYKTTFESTGSQQTATTTTTTMNL  67

Query  437  LTNIEKSTQDQEMAP-IDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
            L  IEKS+     +  ++ NPQ  +N   +  +     +   ++    + P+ AQ+TIFY
Sbjct  68   LPMIEKSSDSSSSSSSVETNPQKPMNLFPQEFDFSKEQSTKKTESWKPDQPEKAQMTIFY  127

Query  614  SGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDp  793
             G+V+VFD+FPADKA  +M LA+K +P +      T  + K    AD + V   +  +  
Sbjct  128  GGQVIVFDDFPADKANEIMKLANKQNPTNNF----TYPMIKNQKTADQSGVSFGNKLIQE  183

Query  794  pkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPY  973
               ++ P P                       +DLPIARR+SL RFLEKRKDR T+ APY
Sbjct  184  LPKLSMPQPSV---------------------ADLPIARRNSLTRFLEKRKDRVTSIAPY  222

Query  974  QVHNN  988
            Q+ NN
Sbjct  223  QISNN  227



>gb|AGC26170.1| TIFY transcription factor [Phaseolus vulgaris]
Length=257

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 87/247 (35%), Positives = 124/247 (50%), Gaps = 34/247 (14%)
 Frame = +2

Query  275  GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS--HGTTMDFLTNI  448
             ++PEKS+F QTC+LLSQ++K + S  DL+ G+   NTE SG  + S   GTTM+     
Sbjct  16   AKSPEKSSFSQTCSLLSQYIKEKGSFGDLTLGM-TCNTEPSGSPETSCQSGTTMNLFPTK  74

Query  449  EKSTQDQEMAPIDP-NPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKV  625
            E +   + +  +D  +PQ     + R +EE      S + ++  +  K AQ+TIFY G+V
Sbjct  75   ENNVTPKNLTAMDLLSPQ----ASYRPLEEIPTLVNSSAIKSVSKVNKTAQMTIFYGGQV  130

Query  626  MVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLP-------ADGAAVVATSTP  784
            +VFD+FPA+KA  +M  A +  PQS      T    +   P       AD +A +  S  
Sbjct  131  VVFDDFPAEKANEIMSYA-RGKPQSQNNSVFTYTQSQPSFPPNLVRTSADSSAPIIPSVN  189

Query  785  VDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATAR  964
            V       S     P                     D PIA+++SLHRFL KRKDR  ++
Sbjct  190  VTNSIHEHSQASSRPVV------------------CDPPIAKKASLHRFLLKRKDRNASK  231

Query  965  APYQVHN  985
            APYQV N
Sbjct  232  APYQVPN  238



>gb|AEP60132.1| JAZ1 [Vitis rupestris]
Length=268

 Score =   113 bits (282),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 130/255 (51%), Gaps = 35/255 (14%)
 Frame = +2

Query  278   RAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFD----ISHGTTMDFLTN  445
             R PEKS+F QTC+LLSQ++K +    DLS G+   + E +G  +     +  TTM+    
Sbjct  21    RGPEKSSFSQTCSLLSQYIKEKGKFGDLSLGM-TCSLEGNGTPESLRQTATTTTMNLFPM  79

Query  446   IEKST-------QDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLT  604
              E+S        ++  +  ++  PQ    G+S + ++      S  K++    P+ AQ+T
Sbjct  80    TERSAGVSGIPARNMNLKSMNLFPQQAGFGSSVSKDDAPKIVNSSVKKSGNVEPQTAQMT  139

Query  605   IFYSGKVMVFDEFPADKARAVMLLASK-SSPQSARGVFQTAGVDKLDLPADGAAVVATST  781
             IFY G+V+VF++FPADKA+ VM LA   SSP     V  T   + +D     A  +A ST
Sbjct  140   IFYGGQVIVFNDFPADKAKEVMRLAGMGSSP-----VPSTTVKNPID-----AGGMAPST  189

Query  782   PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATA  961
             P               P                P   +LPIAR++SLHRFLEKRKDR TA
Sbjct  190   P------------NVVPNFANSLIQERIQRPAQPVACELPIARKASLHRFLEKRKDRITA  237

Query  962   RAPYQVHNNPLIPSK  1006
             RAPY + N+P  P K
Sbjct  238   RAPYNISNSPAGPHK  252



>ref|XP_002516243.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46245.1| conserved hypothetical protein [Ricinus communis]
Length=289

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 100/265 (38%), Positives = 134/265 (51%), Gaps = 27/265 (10%)
 Frame = +2

Query  272   SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTE--ASGKFDISHG--------  421
             + R  EK++F Q C+LLSQ+LK + S  DLS GI   N+   A  K +  +G        
Sbjct  15    TARLSEKNSFSQKCSLLSQYLKEKGSFGDLSLGITCNNSNNNADAKINTGNGNGASDMIK  74

Query  422   --TTMDFLTNIEKSTQ--DQEMA----PIDPNPQNT--VNGTSRTVEEGTNAAASISkea  571
               TTM+     EK     ++ M      +D  PQ +  V  T    E+    A S   + 
Sbjct  75    QTTTMNLFPMSEKHVDVPNRNMVTNCRSMDLFPQQSGFVTTTPEPKEDMQKRADSSVHKP  134

Query  572   pkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPA  751
                  + AQLTIFY+G+V+VF++FPADKA+ VMLLA+K    ++   F +  V K   PA
Sbjct  135   ASPESQNAQLTIFYAGQVIVFNDFPADKAKEVMLLATKG---NSLNRFPSVPV-KSHPPA  190

Query  752   DGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRF  931
                +V  +  P +    ++S             Q     P P   GSDLPIARR+SLHRF
Sbjct  191   FAPSV--SKAPAESNSSLSSASNAVLNFSNNLIQERKLTPPPTI-GSDLPIARRASLHRF  247

Query  932   LEKRKDRATARAPYQVHNNPLIPSK  1006
             LEKRK+R TA APYQ    P IP K
Sbjct  248   LEKRKERITASAPYQTSGLPAIPPK  272



>ref|XP_010937308.1| PREDICTED: protein TIFY 10B-like [Elaeis guineensis]
Length=271

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 93/253 (37%), Positives = 125/253 (49%), Gaps = 39/253 (15%)
 Frame = +2

Query  266  KISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTE-ASGKFD-ISHGTTMDFL  439
            K++GR+ EKSNF  TC+LLSQ++K + SI DL  G+     E A G  +     TTM FL
Sbjct  7    KLAGRSGEKSNFAVTCSLLSQYIKEKGSIADLGLGMAPRPQETAKGNTETFRPRTTMSFL  66

Query  440  TNIEKST-QDQEMA---------PIDPNPQNTVNG--TSRTVEEGTNAAASISkeapkea  583
               + S  +++E A          +D  PQ    G  T +T + G    A          
Sbjct  67   PGADVSGGEERERAGDDDGSRGNAMDLFPQRAGFGDETGKTSDVGEREKA----------  116

Query  584  pkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAA  763
                QLTIFY GKV+VFD FPA+KA+ +M +ASK +  +A+ +       K     D + 
Sbjct  117  ----QLTIFYGGKVLVFDNFPAEKAKDLMQIASKGT-SNAQNLGYVPSSSKATAAVDHSN  171

Query  764  VVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKR  943
             ++  TPV    P             P    A          S+LPIARR+SLHRFLEKR
Sbjct  172  GLSNETPVSVSTPANPSVTAQGQVQKPAQPNA----------SNLPIARRASLHRFLEKR  221

Query  944  KDRATARAPYQVH  982
            KDR   +APYQV+
Sbjct  222  KDRINTKAPYQVN  234



>ref|XP_002277157.1| PREDICTED: protein TIFY 10A [Vitis vinifera]
Length=268

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 91/255 (36%), Positives = 130/255 (51%), Gaps = 35/255 (14%)
 Frame = +2

Query  278   RAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFD----ISHGTTMDFLTN  445
             R PEKS+F QTC+LLSQ++K + +  DLS G+   + E +G  +     +  TTM+    
Sbjct  21    RGPEKSSFSQTCSLLSQYIKEKGTFGDLSLGM-TCSLEGNGTPESLRQTATTTTMNLFPM  79

Query  446   IEKST-------QDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLT  604
              E+S        ++  +  ++  PQ    G+S + ++      S  K++    P+ AQ+T
Sbjct  80    TERSAGVSGIPARNMNLKSMNLFPQQAGFGSSVSKDDAPKIVNSSVKKSGNVEPQTAQMT  139

Query  605   IFYSGKVMVFDEFPADKARAVMLLASK-SSPQSARGVFQTAGVDKLDLPADGAAVVATST  781
             IFY G+V+VF++FPADKA+ VM LA   SSP     V  T   + +D     A  +A S 
Sbjct  140   IFYGGQVIVFNDFPADKAKEVMRLAGMGSSP-----VPSTTVKNPID-----AGGMAPSN  189

Query  782   PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATA  961
             P               P                P   +LPIAR++SLHRFLEKRKDR TA
Sbjct  190   P------------NVVPNFANSLIQERIQRPAQPVACELPIARKASLHRFLEKRKDRITA  237

Query  962   RAPYQVHNNPLIPSK  1006
             RAPY + N+P  P K
Sbjct  238   RAPYNISNSPAGPHK  252



>ref|XP_006452845.1| hypothetical protein CICLE_v10008653mg [Citrus clementina]
 gb|ESR66085.1| hypothetical protein CICLE_v10008653mg [Citrus clementina]
Length=379

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 110/314 (35%), Positives = 146/314 (46%), Gaps = 52/314 (17%)
 Frame = +2

Query  158   ISRKLQSLPAILAFG*HPVSLLRRPNMSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLK  337
             + R+LQ    I A G   +S L   +M+     S  ++S   PEKS+F QTC+LLSQ+LK
Sbjct  71    LQRQLQRTSFIFARGFPLLSWLNTTSMA-----SSSEMSVNLPEKSSFSQTCSLLSQYLK  125

Query  338   GRVSIRDLSHGIGVVNTEASGKFDISH---GTTMDFLTNIEKSTQD----QEMAPIDPNP  496
                S  DLS GI   N EA+G  +I      TTM+     + S QD      +AP +   
Sbjct  126   EGGSFGDLSLGISS-NIEANGVPEIPRRPAATTMNLFPVSDNSGQDVSVRNMVAPRNWES  184

Query  497   QNTV---------NGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPA  649
              N           N T   ++   N  A          P+ AQ+TIFY G+V+ F++FPA
Sbjct  185   MNLFPQQAGFAPKNDTPNMIDSSLNKPA----------PQTAQMTIFYGGQVIAFNDFPA  234

Query  650   DKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATS---TPVDppkpmasppp  820
             DKA  +M LAS  S      +        + LPA G    A S   +PV+   P++  PP
Sbjct  235   DKANEIMQLASNGS-----SLSHGTAYPPMQLPAQGYNSFAASLPKSPVESTPPVSPGPP  289

Query  821   lppppvppptqpaaaapapapGG------------SDLPIARRSSLHRFLEKRKDRATAR  964
                        P + +                    DLPIARR+SLHRFLEKRKDR  AR
Sbjct  290   KILTEPSCSVPPRSNSIPNFGNNLIPECAQPPSRPCDLPIARRNSLHRFLEKRKDRIVAR  349

Query  965   APYQVHNNPLIPSK  1006
             APYQV+ +   P K
Sbjct  350   APYQVNGSAGAPDK  363



>gb|AFL46165.1| jasmonate ZIM domain protein a [Nicotiana attenuata]
Length=205

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 86/253 (34%), Positives = 111/253 (44%), Gaps = 78/253 (31%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRV-SIRDLSHGIGVVNTEASGKFDI  412
            M+   ++   K S    +KS+F QTCNLLSQ+LK +  S  DLS GI    T        
Sbjct  1    MASSEIVDSGKFSAGGGQKSHFSQTCNLLSQYLKEKKGSFGDLSLGIHRAGT--------  52

Query  413  SHGTTMDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapka  592
               TTMD    IEKS +     P++  PQ      S                        
Sbjct  53   ---TTMDLFPMIEKSGESNPQKPMNLFPQTEAKSESEKA---------------------  88

Query  593  aQLTIFYSGKVMVFDEFPADKARAVMLLAS--KSSPQSARGVFQTAGVDKLDLPADGAAV  766
             Q+TIFY G+V+VF++FPADKA+ +ML+AS  K +  S   + +TA    LDL       
Sbjct  89   -QMTIFYGGQVIVFNDFPADKAKEIMLMASCAKGNNNSTTQIQKTA-ESALDL-------  139

Query  767  VATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRK  946
                 P+                                   DLPIARR+SL RFLEKRK
Sbjct  140  --VPQPIIS--------------------------------GDLPIARRASLTRFLEKRK  165

Query  947  DRATARAPYQVHN  985
            DR  A+APYQ+ N
Sbjct  166  DRLIAKAPYQLSN  178



>ref|XP_009128069.1| PREDICTED: protein TIFY 10B-like [Brassica rapa]
Length=240

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 83/239 (35%), Positives = 122/239 (51%), Gaps = 26/239 (11%)
 Frame = +2

Query  266  KISGRAPEKS-NFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLT  442
            + SGR  +K  +F QTC+ LS++LK + S  DLS G+   N + +G F +S   TM  L 
Sbjct  9    EFSGRKLQKKPSFSQTCSRLSRYLKEKGSFGDLSLGM-TCNPDVTGVFAVSRQPTMMNLF  67

Query  443  NIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGK  622
              E+++  Q++ P    P+ +   +S +          I  ++ K   ++AQLTIFY G+
Sbjct  68   PCEEASPTQDVKPTHKVPRQSSFSSSSSAGAKGEVEKIIETKSVKVESQSAQLTIFYGGQ  127

Query  623  VMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkp  802
            VMVFD+FPA+K + V+ LA+K             G D     A     +A++TP      
Sbjct  128  VMVFDDFPAEKVKQVIDLANK-------------GSDYAQNIAKNQKEIASTTP------  168

Query  803  masppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
                    P        P       +    +LPIARR+SLHRFLEKRKDR T++APYQ+
Sbjct  169  -----NPVPSLAKTAAAPELVQTNTSSLACELPIARRASLHRFLEKRKDRITSKAPYQI  222



>gb|EYU45898.1| hypothetical protein MIMGU_mgv1a013086mg [Erythranthe guttata]
Length=231

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 95/272 (35%), Positives = 122/272 (45%), Gaps = 61/272 (22%)
 Frame = +2

Query  236   MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS  415
             MSG   LS  +  G+ PEKSNF QTCNLLSQ++K + S+RDL       N E  GK    
Sbjct  1     MSGFRHLSGDRRRGKLPEKSNFAQTCNLLSQYIKDKGSLRDL-------NLEIGGK----  49

Query  416   HGTTMDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGT--NAAASISkeapkeapk  589
                 ++ L NI                          V++G+  +   S    AP ++  
Sbjct  50    ----IESLENI--------------------------VKQGSFCHEFTSKDAAAPTDSAA  79

Query  590   aaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVV  769
             A QLTIFYSG V+VFD++PA+KA  ++  A+        G+       K   P+ G A  
Sbjct  80    AGQLTIFYSGGVLVFDDYPAEKAEELVAFAANG---GGSGILSNTSWAK---PSSGGA-A  132

Query  770   ATSTPVDppkpmasppplppppvppptqpaaaapap-----------apGGSDLPIARRS  916
              TSTP +   P                  +  A                  SDLPIARRS
Sbjct  133   ETSTPGESQLPPRPGSRKAAGVGITSNTASGGAAEVPPVENRGSTLPEANDSDLPIARRS  192

Query  917   SLHRFLEKRKDRATARAPYQVHNNPLIPSKSE  1012
             SLHRFL KRKDRA AR PYQ+   P   SK +
Sbjct  193   SLHRFLGKRKDRAAARGPYQLQEQPASSSKGD  224



>ref|XP_009759848.1| PREDICTED: protein TIFY 10A [Nicotiana sylvestris]
Length=239

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 90/266 (34%), Positives = 129/266 (48%), Gaps = 55/266 (21%)
 Frame = +2

Query  236   MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNT-EASGKFDI  412
             M    ++   K++G   +KS F QTCNLLSQFLK + S  DL++ +G+  + E +G  + 
Sbjct  1     MGSSEIVDSGKVTG---QKSQFSQTCNLLSQFLKKKGSFGDLNN-LGIYRSFEPTG--NQ  54

Query  413   SHGTTMDFLTNIEKSTQDQE---MAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkea  583
             +  TTM+ L  IEKS    E     P++  PQ  ++      E+                
Sbjct  55    TTTTTMNLLPMIEKSGDSAEKNSQKPMNLFPQEVISTAKSEPEKA---------------  99

Query  584   pkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQS---ARGVFQTAGVDKLDLPAD  754
                 Q+TIFY G+V+VFD+FPADKA  +M LA+K +      A  +F    V+       
Sbjct  100   ----QMTIFYGGQVVVFDDFPADKANEIMKLATKKTNNKQNLASNIFSYPMVNN----QK  151

Query  755   GAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFL  934
              A  V T+   +    +  P                         +DLPIARR+SL RFL
Sbjct  152   SAESVTTNLTQELRTRIHVPISQSSV-------------------ADLPIARRNSLTRFL  192

Query  935   EKRKDRATARAPYQVHNNPLIPSKSE  1012
             EKRKDR T+ APYQ++N  +  SK+E
Sbjct  193   EKRKDRITSTAPYQIYNKKIADSKTE  218



>gb|ACM89458.1| jasmonate ZIM domain 2 [Catharanthus roseus]
Length=243

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 91/242 (38%), Positives = 122/242 (50%), Gaps = 39/242 (16%)
 Frame = +2

Query  278  RAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVV-NTEASGKFDISHGTTMDFLTNIEK  454
            + PEKSNFV TCNLLSQ++K +  ++DL+  +G+   T  SGK +++  TTM+ L+NI  
Sbjct  12   KKPEKSNFVHTCNLLSQYVKEKGGLKDLNL-VGISGKTGVSGKSNVTIPTTMNLLSNIG-  69

Query  455  STQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVF  634
                       P P +++   S  V E       +   A  E  K +Q+TIFY G+V+VF
Sbjct  70   ----------HPCPVDSLPRLSTVVPE-------LDAAAAAEEIKRSQMTIFYGGEVLVF  112

Query  635  DEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATS--TPVDppkpma  808
            D+ PADKAR                V Q A      + ++ A   A    +P       +
Sbjct  113  DDLPADKARE---------------VMQLASNGTSSIGSNSALTKAEKHHSPDASLPSSS  157

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNN  988
              PP PP   P          A     S+LPIARRSSLHRFLEKRKDRA AR PY  H+ 
Sbjct  158  KAPPPPPVSSPERPPHPQVPQAVEANSSELPIARRSSLHRFLEKRKDRAVARGPY--HHQ  215

Query  989  PL  994
            P+
Sbjct  216  PV  217



>gb|KDP33940.1| hypothetical protein JCGZ_07511 [Jatropha curcas]
Length=281

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 94/250 (38%), Positives = 126/250 (50%), Gaps = 25/250 (10%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGK-------FDISHGTTM  430
            + R+PEKSNF QTC+LLSQ+LK R S  DLS G+   N E SG           +  TTM
Sbjct  15   ASRSPEKSNFSQTCSLLSQYLKERGSFGDLSLGM-TCNGEGSGNGSTPETLHQTAAATTM  73

Query  431  DF--LTNIEKSTQDQEMAP-------IDPNPQNTVNGTSRTVEEGTNAAASISkeapkea  583
            +   + + +     ++MA        +D  PQ          ++  ++ A+  +      
Sbjct  74   NLFPMNDKQDDISSRKMAASRTNFRSMDLFPQQAGFAPKEETQKKVDSRAATPEPQTA--  131

Query  584  pkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAA  763
                Q+TIFY+GKV+VF++FPADKA+ +M LASK S Q+    F +A V  +  P     
Sbjct  132  ----QMTIFYAGKVIVFNDFPADKAKEIMQLASKGSSQNFTR-FPSAPVKSVS-PVFAPN  185

Query  764  VVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKR  943
              A  T        +SP P   P            P+P    SDLPIARR+SL RFLEKR
Sbjct  186  AAARPTIESSSSRPSSPGPNSVPNFSNNLIQDHIQPSPQTITSDLPIARRASLQRFLEKR  245

Query  944  KDRATARAPY  973
            KDR  ARAPY
Sbjct  246  KDRVIARAPY  255



>emb|CDY37269.1| BnaCnng08230D [Brassica napus]
Length=240

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 83/239 (35%), Positives = 122/239 (51%), Gaps = 26/239 (11%)
 Frame = +2

Query  266  KISGRAPEKS-NFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLT  442
            + SGR  +K  +F QTC+ LS++LK + S  DLS G+   N + +G F +S   TM  L 
Sbjct  9    EFSGRKLQKKPSFSQTCSRLSRYLKEKGSFGDLSLGM-TCNPDVTGVFAVSRQPTMMNLF  67

Query  443  NIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGK  622
              E+++  Q++ P    P+ +   +S +          I  ++ K   +++ LTIFY G+
Sbjct  68   PCEEASPTQDVKPTHKVPRQSSFSSSSSSGAKGEVEKIIEIKSVKVESQSSPLTIFYGGQ  127

Query  623  VMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkp  802
            VMVFD+FPA+KA+ V+ LA+K             G D     A     +A+STP      
Sbjct  128  VMVFDDFPAEKAKQVIDLANK-------------GSDYTQNIAKNQKEIASSTP------  168

Query  803  masppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
                    P P              +    +LPIARR+SLHRFLEKRKDR T++APYQ+
Sbjct  169  -----NPVPSPAKTAAASELVQTNTSSLACELPIARRASLHRFLEKRKDRITSKAPYQL  222



>ref|XP_008782803.1| PREDICTED: protein TIFY 10B-like [Phoenix dactylifera]
Length=269

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 95/260 (37%), Positives = 124/260 (48%), Gaps = 60/260 (23%)
 Frame = +2

Query  266  KISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTE-ASGKFD-ISHGTTMDFL  439
            K++GR+ EKSNF  TC+LL Q++K + SI DL  GI     E A G  +     TTM FL
Sbjct  7    KLAGRSGEKSNFAVTCSLLRQYIKEKGSIADLGLGIAPRPQETAKGNTETFRPPTTMSFL  66

Query  440  TNIEKSTQDQEMA---PIDPNPQNTVNG----TSRTVEEGTNAAASISkeapkeapkaaQ  598
               + S  D +++    +D  PQ  V G     +  V E   A                Q
Sbjct  67   PGADVSAGDDDVSRGNAMDLFPQRAVFGDEPRKTSDVREREKA----------------Q  110

Query  599  LTIFYSGKVMVFDEFPADKARAVMLLASK------------SSPQSARGVFQTAGVDKLD  742
            LTIFY GKV+VF+ FPA+KA+ +M +ASK            SS ++A  V  T G+   +
Sbjct  111  LTIFYGGKVLVFNNFPAEKAKDLMQIASKGTSNAQNSAHVPSSTKAAAAVEHTNGLSN-E  169

Query  743  LPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSL  922
             P      V+ STP +                P             P  S+LPIARR+SL
Sbjct  170  TP------VSASTPAN----------------PSVMAQGHVQKPAQPNASNLPIARRASL  207

Query  923  HRFLEKRKDRATARAPYQVH  982
            HRFLEKRKDR  A  PYQV+
Sbjct  208  HRFLEKRKDRIHANVPYQVN  227



>gb|EYU21296.1| hypothetical protein MIMGU_mgv1a011904mg [Erythranthe guttata]
Length=267

 Score =   110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 120/245 (49%), Gaps = 27/245 (11%)
 Frame = +2

Query  281  APEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFD----------ISHGTTM  430
            APEK+NF QTCNL+S+++K + S+RDL+  IG       GK +           +  +T 
Sbjct  17   APEKTNFAQTCNLVSRYIKEKGSLRDLNFEIG-------GKVESLEDLVSVKPAASASTT  69

Query  431  DFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIF  610
            + L N  KS Q         + ++T   +S  + E  +  AS S+E  ++  K AQLTIF
Sbjct  70   NVLPNKGKSAQPS-------SEKHTSLRSSIIIVEDDSNEASTSREETRKVAKNAQLTIF  122

Query  611  YSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPA---DGAAVVATST  781
            YSGKV+VFD++  D  R ++ +A K S + + G+  T  + +   P    +G      + 
Sbjct  123  YSGKVLVFDDYSVDNIRELVSVAKKGSSKMSYGILSTNTLQQKPNPGSLREGLPPRPQAG  182

Query  782  PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATA  961
                                        +      GSDLPIARRSS+HRF+EKRK+RA  
Sbjct  183  NSLNICKEKINSTADRDVASTSISNEQLSTQSDANGSDLPIARRSSVHRFMEKRKERAVM  242

Query  962  RAPYQ  976
            R PYQ
Sbjct  243  RGPYQ  247



>ref|XP_010273865.1| PREDICTED: protein TIFY 10A-like [Nelumbo nucifera]
Length=258

 Score =   110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 122/244 (50%), Gaps = 53/244 (22%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDI-----SHGTTMDFLTNI-  448
            E+SNF+QTC+LLSQ++K +  + DL  GI   + +  GK ++     S  TTM+    + 
Sbjct  22   ERSNFLQTCSLLSQYIKEKGGLADLGLGIS-SSLDGKGKPNMFNQKASMTTTMNLFPQLA  80

Query  449  ---EKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSG  619
                 S++DQ   P D  P    N                         + AQ+TIFY+G
Sbjct  81   GFGNSSSEDQPKTP-DFRPAAKEN-------------------------EKAQMTIFYAG  114

Query  620  KVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppk  799
            KV+VFD+FPA+KA+ VML ASK+S   +  +  T+G D+   P  G    + S  V    
Sbjct  115  KVLVFDDFPAEKAKEVMLFASKASSLDSSSLASTSGGDQ---PNSGGFASSCSNVV----  167

Query  800  pmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
                      P              P P GSDLPIARR+SLHRFLEKRKDR   +APYQV
Sbjct  168  ----------PISAKNPNQDRVQLPPQPNGSDLPIARRASLHRFLEKRKDRINTKAPYQV  217

Query  980  HNNP  991
             +NP
Sbjct  218  SSNP  221



>gb|ABP35523.1| PnFL-2 [Ipomoea batatas]
Length=248

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 92/245 (38%), Positives = 123/245 (50%), Gaps = 33/245 (13%)
 Frame = +2

Query  257  SDVKISGR-APEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMD  433
            S++  SGR + +KSNF  TC LLSQ+LK + S  DLS GI   N E SG    +   TM+
Sbjct  4    SEIVDSGRPSGQKSNFSHTCTLLSQYLKEKGSFGDLSLGISR-NFEGSG----TAAQTMN  58

Query  434  FLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
             L  IEKS Q+       P P N +   + T EE T    S      K   + +Q+TIFY
Sbjct  59   LLPMIEKSGQNS-----GPKPGNLL--PNFTKEEATKKTDS---SVAKAETEKSQMTIFY  108

Query  614  SGKVMVFDEFPADKARAVMLLASKSSP-QSARGVFQTAGVDKLDLPADGAAVVATSTPVD  790
             G+V+VF++FPA+K + +M+LA   +P Q+   +F            +    +    PV+
Sbjct  109  GGQVLVFNDFPAEKVKEIMVLAKGGNPTQNPPNIFSY---------NNNTPPLVFPKPVE  159

Query  791  ppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAP  970
                    PP  P  VP                 DLPIARR SL RFLEKRKDR T++AP
Sbjct  160  FSATNMVTPPAVPKVVPTLGNQKPITF-------DLPIARRHSLARFLEKRKDRVTSKAP  212

Query  971  YQVHN  985
            Y + N
Sbjct  213  YPIGN  217



>ref|XP_007024677.1| Jasmonate-zim-domain protein 6, putative isoform 1 [Theobroma 
cacao]
 gb|EOY27299.1| Jasmonate-zim-domain protein 6, putative isoform 1 [Theobroma 
cacao]
Length=273

 Score =   110 bits (274),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 84/248 (34%), Positives = 127/248 (51%), Gaps = 26/248 (10%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASG-KFDISHGTTMDFLTNI  448
            SG+A E+++FV   NLLSQ+LK + +I D+S G+     EA G +        M+F  N+
Sbjct  8    SGKATERASFV---NLLSQYLKEKRNIGDISVGM-TSKPEAKGLEASRQQAMPMNFFPNM  63

Query  449  EKSTQDQE---------MAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQL  601
            +  +             + P D  P+    G S + E+ TN   +  ++     PK+AQL
Sbjct  64   DNPSDSSRPNLVASTSNVKPSDFFPEIANFGASSSKEDSTNK--TDFRKPATVEPKSAQL  121

Query  602  TIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATST  781
            TIF+ G+V+V+++FPA+K + +M LAS+    +  GV   +G++K++   D      +  
Sbjct  122  TIFFGGQVLVYNDFPAEKVKEIMALASQGCSTACAGVVTDSGMEKVNSNMDKINSSNSDI  181

Query  782  PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATA  961
            P                          +      GGSDL IARR+SLH+F EKRKDRA A
Sbjct  182  P----------DLNIASTTGNSPDQDPSVERRQYGGSDLRIARRNSLHKFFEKRKDRAAA  231

Query  962  RAPYQVHN  985
            RAPYQV+N
Sbjct  232  RAPYQVNN  239



>gb|EYU28313.1| hypothetical protein MIMGU_mgv1a012664mg [Erythranthe guttata]
Length=244

 Score =   109 bits (272),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 91/248 (37%), Positives = 119/248 (48%), Gaps = 37/248 (15%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS  415
            MS   +L+  K +G    +SNF QTCNLLSQ+LK   S  DL  G+   + E  G     
Sbjct  1    MSSSEILNSGKFAG---GRSNFSQTCNLLSQYLKENGSFGDLRLGLTPESAEPKG-----  52

Query  416  HGTTMDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaa  595
               TM+ L  IEKS Q+           N +N   + V  G       S    +   +  
Sbjct  53   ---TMNLLPMIEKSDQNSGAG-------NFMNMLPQLVAGGVETLDK-SDSGTRSENETG  101

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
            Q+TIFY+G+V+VF+ FPA+KA+ +M LA+KSS  +A+ +   A    +  P +     AT
Sbjct  102  QMTIFYAGQVIVFNNFPAEKAKEIMSLATKSS-AAAQKLHPAAFAPAIQKPTES----AT  156

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
            STP                P             PA G   LPIAR+ SL RFLEKRKDR 
Sbjct  157  STP-------------NLSPTFGIQDLTRRPTQPAVGSDYLPIARKKSLARFLEKRKDRI  203

Query  956  TARAPYQV  979
            TA APYQ 
Sbjct  204  TANAPYQA  211



>gb|ABK96213.1| unknown [Populus trichocarpa x Populus deltoides]
Length=273

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 89/255 (35%), Positives = 127/255 (50%), Gaps = 29/255 (11%)
 Frame = +2

Query  263  VKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIG-----VVNTEASGKFDISHGTT  427
            V+  G+  EK +F QTC+LLSQ+LK R S  DL+ G+        N     +      +T
Sbjct  8    VEKMGKMCEKPSFSQTCSLLSQYLKERGSFGDLNLGMASNSESTTNKNGPSEMLRRSPST  67

Query  428  MDFLTNIEK----STQD---QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeap  586
            M+     EK    S Q+   +    +D  PQ         V    +++ S + E      
Sbjct  68   MNLFPVSEKPGHISCQNMGARNFTSMDLFPQQAGFAPKEDVPMKLDSSKSATAEPQTA--  125

Query  587  kaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAV  766
               Q+TIFY+G+V+VF++FPADKA+ VMLLASK S Q  +  F +       +PA+    
Sbjct  126  ---QMTIFYAGRVIVFNDFPADKAKEVMLLASKGSSQ-IQNAFPS-------IPANSHPA  174

Query  767  VA---TSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLE  937
            +A   + TP++    + S     P       Q            +DLPIARR+SLHRFLE
Sbjct  175  LAPNISKTPIESTITIPSSSNALPNFGSNLIQEGMQPAPQPI-ANDLPIARRASLHRFLE  233

Query  938  KRKDRATARAPYQVH  982
            KRKDR  A+APYQ++
Sbjct  234  KRKDRIIAKAPYQIN  248



>ref|XP_006381595.1| hypothetical protein POPTR_0006s14160g [Populus trichocarpa]
 gb|ERP59392.1| hypothetical protein POPTR_0006s14160g [Populus trichocarpa]
Length=274

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 90/256 (35%), Positives = 129/256 (50%), Gaps = 30/256 (12%)
 Frame = +2

Query  263  VKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISH-----GTT  427
            V+  G+  EK +F QTC+LLSQ+LK R S  DL+ G+   +     K   S       +T
Sbjct  8    VENMGKMCEKPSFSQTCSLLSQYLKERGSFGDLNLGMASNSESTPNKNGPSEMLRRSPST  67

Query  428  MDFLTNIEK----STQD----QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkea  583
            M+     EK    S Q+    +    +D  PQ         V    +++ S + E     
Sbjct  68   MNLFPVSEKPGHISCQNMGAPRNFTSMDLFPQQAGFAPKEDVPMKLDSSKSATAEPQTA-  126

Query  584  pkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAA  763
                Q+TIFY+G+V+VF++FPADKA+ VMLLASK S Q  +  F +       +PA+   
Sbjct  127  ----QMTIFYAGRVIVFNDFPADKAKEVMLLASKGSSQ-IQNAFPS-------IPANSHP  174

Query  764  VVA---TSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFL  934
             +A   + TP++    + S     P       Q +          +DLPIARR+SLHRFL
Sbjct  175  ALAPNISKTPIESTISIPSSSNALPNFGNNLIQESMQPAPQPI-ANDLPIARRASLHRFL  233

Query  935  EKRKDRATARAPYQVH  982
            EKRKDR  A+APYQ++
Sbjct  234  EKRKDRIIAKAPYQIN  249



>emb|CBI35842.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 123/215 (57%), Gaps = 15/215 (7%)
 Frame = +2

Query  386   TEASGKFDISHGTTMDF-LTNIEKSTQ--------DQEMAPIDPNPQNTVNGTSRTVEEG  538
             +E  G+ +    +TM F L N +KS++           +   D  PQ    G+  +++E 
Sbjct  5     SETKGRPESFKSSTMSFDLLNKDKSSEASGQNVGGSSNLKSSDFYPQFAGFGSLASIDEA  64

Query  539   TNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQ  718
              N A    +++     + +Q+TIFY+G+V+VF++FPA+KAR VMLLA+K +PQ+  G   
Sbjct  65    INMADF--RKSATTESETSQMTIFYAGQVLVFNDFPAEKAREVMLLAAKGTPQNTSGFLS  122

Query  719   TAGVDKLDLPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDL  898
             T+G +K++    G++   + +    P    +P  L       P  PAA     AP GS+L
Sbjct  123   TSGPEKINT---GSSTAPSPSIPASPATTPNPQALSSGTFSIPASPAATPNPQAPLGSEL  179

Query  899   PIARRSSLHRFLEKRKDRATARAPYQVHNNPLIPS  1003
             PIARR+SLHRFLEKRKDR  ++APYQV NNP  PS
Sbjct  180   PIARRNSLHRFLEKRKDRVNSKAPYQV-NNPSRPS  213



>gb|EYU21297.1| hypothetical protein MIMGU_mgv1a011904mg [Erythranthe guttata]
Length=266

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 82/249 (33%), Positives = 122/249 (49%), Gaps = 36/249 (14%)
 Frame = +2

Query  281  APEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFD----------ISHGTTM  430
            APEK+NF QTCNL+S+++K + S+RDL+  IG       GK +           +  +T 
Sbjct  17   APEKTNFAQTCNLVSRYIKEKGSLRDLNFEIG-------GKVESLEDLVSVKPAASASTT  69

Query  431  DFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRT----VEEGTNAAASISkeapkeapkaaQ  598
            + L N  KS Q          P +  + + R+    VE+ +N A++  +E  ++  K AQ
Sbjct  70   NVLPNKGKSAQ----------PSSEKHTSLRSSIIIVEDDSNEAST--REETRKVAKNAQ  117

Query  599  LTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPA---DGAAVV  769
            LTIFYSGKV+VFD++  D  R ++ +A K S + + G+  T  + +   P    +G    
Sbjct  118  LTIFYSGKVLVFDDYSVDNIRELVSVAKKGSSKMSYGILSTNTLQQKPNPGSLREGLPPR  177

Query  770  ATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKD  949
              +                             +      GSDLPIARRSS+HRF+EKRK+
Sbjct  178  PQAGNSLNICKEKINSTADRDVASTSISNEQLSTQSDANGSDLPIARRSSVHRFMEKRKE  237

Query  950  RATARAPYQ  976
            RA  R PYQ
Sbjct  238  RAVMRGPYQ  246



>ref|XP_006367890.1| PREDICTED: protein TIFY 10A-like [Solanum tuberosum]
Length=215

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 91/254 (36%), Positives = 124/254 (49%), Gaps = 63/254 (25%)
 Frame = +2

Query  257   SDVKISGR-APEKSNFVQTCNLLSQFLKGRV-SIRDLSHGIGVVNTEASGKFDISHGTTM  430
             S++  SGR A +KS+F  TCNLLSQ+LK +  S+ DLS  I          FD +  TTM
Sbjct  4     SEIVDSGRHAGQKSHFSHTCNLLSQYLKEKKGSLGDLSLDI-------HRNFDSTGSTTM  56

Query  431   DFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIF  610
             D L  IEKS +             +V  +     +G   A S         P+ AQ+TIF
Sbjct  57    DLLPMIEKSGE-------------SVQKSMNLFRQGAMKAES--------EPEKAQMTIF  95

Query  611   YSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVD  790
             Y+G+V+VF++FPADKA+ +ML+AS S   +     ++ G D L +P+ G   +  +   +
Sbjct  96    YAGQVIVFNDFPADKAKEIMLMASTSKGNNTHKQLES-GAD-LVVPSFGKTSIQENQMPN  153

Query  791   ppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAP  970
              P                               SDLPIARR+SL RFLEKRKDR TA+ P
Sbjct  154   QPIV-----------------------------SDLPIARRASLTRFLEKRKDRLTAKVP  184

Query  971   YQVHNNPLIPSKSE  1012
             Y  +     P K E
Sbjct  185   Y--YREEAAPKKEE  196



>dbj|BAG68655.1| jasmonate ZIM-domain protein 1 [Nicotiana tabacum]
Length=239

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 90/266 (34%), Positives = 127/266 (48%), Gaps = 55/266 (21%)
 Frame = +2

Query  236   MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNT-EASGKFDI  412
             M    ++   K+SG   +KS F QTCNL SQFLK + S  DL++ +G+  + E +G  + 
Sbjct  1     MGSSEIVDSGKVSG---QKSQFSQTCNLSSQFLKKKGSFGDLNN-LGIYRSFEPTG--NQ  54

Query  413   SHGTTMDFLTNIEKSTQDQE---MAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkea  583
             +  TTM+ L  IEKS    E     P++  PQ  ++      E+                
Sbjct  55    TTTTTMNLLPMIEKSGDSAEKNSQKPMNLFPQEVISTAKSEPEKA---------------  99

Query  584   pkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQS---ARGVFQTAGVDKLDLPAD  754
                 Q+TIFY G+V+VFD+FPADKA  +M LA+K +      A  +F    V+      +
Sbjct  100   ----QMTIFYGGQVIVFDDFPADKANEIMKLATKKTNNKQNLASNIFSYPMVNN----QN  151

Query  755   GAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFL  934
              A  V T+   +       P                         +DLPIARR+SL RFL
Sbjct  152   SAESVTTNFSQELRTRTHVPISQSSV-------------------ADLPIARRNSLTRFL  192

Query  935   EKRKDRATARAPYQVHNNPLIPSKSE  1012
             EKRKDR T+ APYQ+ N  +  SK+E
Sbjct  193   EKRKDRITSTAPYQICNKKIADSKNE  218



>ref|XP_009417542.1| PREDICTED: protein TIFY 10B-like [Musa acuminata subsp. malaccensis]
Length=265

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 90/259 (35%), Positives = 119/259 (46%), Gaps = 56/259 (22%)
 Frame = +2

Query  254  LSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGV---VNTEASGKFDISHGT  424
            ++D K+     EKSNF  TC LLSQ+LK +     L   +     ++ +A GK      T
Sbjct  1    MADQKMGNNKGEKSNFSLTCRLLSQYLKEKNGFGGLGLEMAAAKPLDQQAKGKSRAP--T  58

Query  425  TMDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAA-----ASISkeapkeapk  589
            TM  L   + S  DQ     D NP  +++   R    G ++       S      K   +
Sbjct  59   TMSLLPGADVSGDDQTQNNEDENPLKSMDLFPRN--SGFDSGLLPKEESGKTPEIKRQTE  116

Query  590  aaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQT-----AGVD---KLDL  745
              QLTIFY GKV+VFD+FPA+KA+ +M +ASK +  S    F T     AG D   K D 
Sbjct  117  KGQLTIFYGGKVLVFDDFPAEKAKDLMRMASKENISSQNFSFSTPHPAAAGADCPPKPD-  175

Query  746  PADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLH  925
            P   A  +A +T                                    SD+PIAR++SLH
Sbjct  176  PISPADSLAKAT-----------------------------------ASDMPIARKNSLH  200

Query  926  RFLEKRKDRATARAPYQVH  982
            RFLEKRKDR   +APYQVH
Sbjct  201  RFLEKRKDRINTKAPYQVH  219



>ref|XP_007215958.1| hypothetical protein PRUPE_ppa011370mg [Prunus persica]
 gb|EMJ17157.1| hypothetical protein PRUPE_ppa011370mg [Prunus persica]
Length=213

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 87/249 (35%), Positives = 116/249 (47%), Gaps = 59/249 (24%)
 Frame = +2

Query  287   EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEK--ST  460
             EK NF QTCNLLSQ+LK + S++                      TTMD LTN+E   + 
Sbjct  3     EKVNFAQTCNLLSQYLKEKRSLQV--------------------PTTMDLLTNMETGPAA  42

Query  461   QDQEMAP-IDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFD  637
             +     P ID  PQ   N  +    +  +A                Q+TIFY G+V+VF+
Sbjct  43    ETPSSKPSIDLFPQFAKNPEAVFSNQPGSA----------------QMTIFYGGQVLVFN  86

Query  638   EFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmaspp  817
             +  A+KAR +M  A+K S + + G F + G+DK      G+A V      +P     S  
Sbjct  87    DLQAEKAREIMNFATKGSSKISSG-FVSNGIDKF-----GSASVTKMVASEPNIAANSQD  140

Query  818   plppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPLI  997
                                    GSDLPIARR+SLH+FL KRK+R  A APYQV++    
Sbjct  141   IQKVHSQVI--------------GSDLPIARRASLHKFLAKRKERVAAIAPYQVNHQRAS  186

Query  998   PSKSERPSS  1024
             PSKSE   S
Sbjct  187   PSKSEEEMS  195



>gb|ADI39634.1| plastid jasmonates ZIM-domain protein [Hevea brasiliensis]
Length=284

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 133/255 (52%), Gaps = 30/255 (12%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS---HGTTMDFLT  442
            + ++ EKS+F QTC+LLSQ++K + S  DLS G+   + E +G          TTM+   
Sbjct  15   AAKSAEKSSFSQTCSLLSQYIKEKGSFGDLSLGM-TCSAEGNGNGTTELRQAATTMNLFP  73

Query  443  NIEK----STQDQEMAP------IDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapka  592
              EK    S+++    P      +D  PQ      S   E+   +  S   +A    P+ 
Sbjct  74   MSEKQVDVSSRNMATPPRTNFRSMDLFPQQAGFSPSAPKEDVQKSLDSSVNKAATPEPQT  133

Query  593  aQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDK---LDLPADGAA  763
            A +TIFY+G+V+VF++FPADK + VMLLASK S QS  G F +  V      D     A 
Sbjct  134  APMTIFYAGQVIVFNDFPADKVKEVMLLASKGSSQSLTG-FPSVPVKSHPVFDPNVAKAP  192

Query  764  VVATST-PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEK  940
            V +TS+ P +     +    L    V  P+Q            SDLPIARR+SLHRFLEK
Sbjct  193  VESTSSIPPNSNPVPSFGNNLNQERVQSPSQTI---------ASDLPIARRASLHRFLEK  243

Query  941  RKDR--ATARAPYQV  979
            RKDR  A+ARAPYQ 
Sbjct  244  RKDRITASARAPYQT  258



>ref|XP_011039955.1| PREDICTED: protein TIFY 10A [Populus euphratica]
Length=273

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 89/256 (35%), Positives = 128/256 (50%), Gaps = 30/256 (12%)
 Frame = +2

Query  263  VKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISH-----GTT  427
            V+  G+  EK +F QTC+LLSQ+LK   S  DL+ G+   +     K   S       +T
Sbjct  8    VEKMGKMCEKPSFSQTCSLLSQYLKEGGSFGDLNLGMASNSESTPNKNGPSEMLRRSPST  67

Query  428  MDFLTNIEK----STQD----QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkea  583
            M+     EK    S Q+    +    +D  PQ         V +  +++ S + E     
Sbjct  68   MNLFPVSEKPGHISCQNMGAPRNFTSMDLFPQQAGFAPKEDVPKKLDSSKSATAEPQTA-  126

Query  584  pkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAA  763
                Q+TIFY+G+V+VF++FPADKA+ VMLLASK S Q  +  F +       +PA+   
Sbjct  127  ----QMTIFYAGRVIVFNDFPADKAKEVMLLASKGSSQ-IQNAFPS-------IPANSHP  174

Query  764  VVA---TSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFL  934
             +A   + TP++    + S     P       Q            +DLPIARR+SLHRFL
Sbjct  175  ALAPNISKTPIESNVSIPSSSNALPNFGNNLIQDCMQPAPQPI-ANDLPIARRASLHRFL  233

Query  935  EKRKDRATARAPYQVH  982
            EKRKDR  A+APYQ++
Sbjct  234  EKRKDRIIAKAPYQIN  249



>ref|XP_006369119.1| hypothetical protein POPTR_0001s16640g [Populus trichocarpa]
 gb|ERP65688.1| hypothetical protein POPTR_0001s16640g [Populus trichocarpa]
Length=269

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 126/263 (48%), Gaps = 38/263 (14%)
 Frame = +2

Query  272   SGRAPEK-SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASG--KFDISHGTTMDFLT  442
             S ++P++ S+F + CNLLSQ+LK + S  D+S GI     E  G    D+   TT++ LT
Sbjct  8     SCKSPDQISSFAKKCNLLSQYLKEKGSFGDISLGINGKAPEVKGPETSDLP-ATTLNLLT  66

Query  443   NIEKSTQ-----------DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapk  589
             N+E S++              M  +D  PQ      S   E+  N A +  +++    P 
Sbjct  67    NMENSSEHITFRQKPVASSNMMKYMDFFPQFVGFSPSNYTEDAINKADNHLRKSSTMDPG  126

Query  590   aaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVV  769
               Q+TIFY+GK+ VF++ PA KA  +M LA+K S  S  G      + K++     AA+ 
Sbjct  127   PTQMTIFYAGKLTVFNDIPAGKAEEIMALATKGSSISPNGFPSDPSIIKVNSANSVAALD  186

Query  770   ATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKD  949
             + +                        Q      + AP GSD+P A R+SLHRF  KRK+
Sbjct  187   SNNA-----------------------QQRLHLQSEAPNGSDVPHATRASLHRFFSKRKE  223

Query  950   RATARAPYQVHNNPLIPSKSERP  1018
             R  ARAPYQ HN       S RP
Sbjct  224   RVAARAPYQTHNPTHYLPSSSRP  246



>ref|XP_008228164.1| PREDICTED: protein TIFY 10B-like [Prunus mume]
Length=212

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 84/251 (33%), Positives = 116/251 (46%), Gaps = 71/251 (28%)
 Frame = +2

Query  287   EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQD  466
             EK NF QTCN LSQ+LK + S++                      TTM+ LTN+E S   
Sbjct  3     EKVNFAQTCNRLSQYLKEKRSLQ--------------------VPTTMNLLTNMETSPAA  42

Query  467   Q---EMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFD  637
             +       ID  PQ   N  +    +  +A                Q+TIFY G+V+VF+
Sbjct  43    ETPSSKPSIDLFPQFAKNPEAVVASQPGSA----------------QMTIFYGGQVLVFN  86

Query  638   EFPADKARAVMLLASKSSPQSARGVFQTAGVDKL------DLPADGAAVVATSTPVDppk  799
             +  A+KAR +M LA+K S +   G F + G+DKL      ++ A    + A S  +   +
Sbjct  87    DLQAEKAREIMGLATKGSSKIYSG-FVSNGIDKLGSASMTNMVASEPNIAANSRDIQKVQ  145

Query  800   pmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
             P                            GSDLPIARR+SLH+FL KRK+R  A APY+V
Sbjct  146   PQVI-------------------------GSDLPIARRASLHKFLAKRKERVAAIAPYEV  180

Query  980   HNNPLIPSKSE  1012
             ++    PSKSE
Sbjct  181   NHQRASPSKSE  191



>ref|XP_010049382.1| PREDICTED: protein TIFY 10A-like [Eucalyptus grandis]
 gb|KCW81934.1| hypothetical protein EUGRSUZ_C03301 [Eucalyptus grandis]
Length=266

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 96/243 (40%), Positives = 121/243 (50%), Gaps = 23/243 (9%)
 Frame = +2

Query  254  LSDVKISGRAPEKS--NFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTT  427
            LSD     R+PEK   NF QTC+LLSQ+LK +  + DL  G   +   A+          
Sbjct  10   LSDSGRLARSPEKPAINFSQTCSLLSQYLKEKGPLGDLPLGAPEMFRRAAA------ANP  63

Query  428  MDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAA----ASISkeapkeapkaa  595
            M F          + M      PQ    G S T E+ T AA    ++ +K    + P+ A
Sbjct  64   MSFAAAAAPRPPVKSMNLF---PQQAGFGGSSTKEDVTKAAAAADSTEAKPPAAKEPETA  120

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
            Q+TIFY G+V+VF++FPADKA+ VML+ASK S +S        G   L  PA+  A    
Sbjct  121  QMTIFYGGQVIVFNDFPADKAKEVMLVASKGSSRSC----SPPGTPNLAHPANAYAPETV  176

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
               VDP      PP  P   +          P     GSDLPIARR+SLHRFLEKRKDR 
Sbjct  177  KNRVDPGPSRGLPPHHPANNIIQACIAGLPEPT----GSDLPIARRNSLHRFLEKRKDRI  232

Query  956  TAR  964
            TAR
Sbjct  233  TAR  235



>gb|AFL46169.1| jasmonate ZIM domain protein d [Nicotiana attenuata]
Length=241

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 90/263 (34%), Positives = 129/263 (49%), Gaps = 55/263 (21%)
 Frame = +2

Query  254   LSDVKISGRAP-EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNT-EASGKFDISHGTT  427
             LS++  SG+   +KS F QTCNLLSQFLK + S  DL++ +G+  + E +G  + +  TT
Sbjct  3     LSEIVDSGKVTGQKSQFSQTCNLLSQFLKKKGSFGDLNN-LGIYRSFEPTG--NQTTTTT  59

Query  428   MDFLTNIEKS---TQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQ  598
             M+ L  IEKS    + +   P++  PQ  ++ T    E+                    Q
Sbjct  60    MNLLPMIEKSGDSAEKKSQKPMNLFPQEVISTTKSEPEKA-------------------Q  100

Query  599   LTIFYSGKVMVFDEFPADKARAVMLLASKSSPQS-----ARGVFQTAGVDKLDLPADGAA  763
             +TIFY G+V+VFD+FPA KA  +M LASK +  +     A  +F    V+      + A 
Sbjct  101   MTIFYGGQVIVFDDFPAAKANEIMKLASKKNNNNNKQNLATNIFSYPMVNN----QNSAE  156

Query  764   VVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKR  943
              V T+   +       P                         +DLPIARR+SL RFLEKR
Sbjct  157   SVTTNLTQELRSRTHVPISQSSV-------------------ADLPIARRNSLTRFLEKR  197

Query  944   KDRATARAPYQVHNNPLIPSKSE  1012
             KDR T+ APYQ+ N     +K+E
Sbjct  198   KDRITSTAPYQICNKNAASAKNE  220



>ref|XP_009391222.1| PREDICTED: protein TIFY 10B-like [Musa acuminata subsp. malaccensis]
Length=251

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 115/239 (48%), Gaps = 39/239 (16%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQD  466
            EKSNF +TC LLSQ+LK +  +  L   +     +  GK       TM  L  ++   +D
Sbjct  7    EKSNFNETCRLLSQYLKEKGGLGGLGLEMTPKALDQQGKGKSPAPATMSLLPGVDVPGED  66

Query  467  QEMAP--IDPNPQNT-VNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFD  637
            Q  +P  +D  P  + ++  +  +EE     + I      +  +  QLTIFY GKV+VFD
Sbjct  67   Q-TSPKSMDLFPHKSGLDSGALAMEEPGKKTSDI------KKMEKGQLTIFYGGKVLVFD  119

Query  638  EFPADKARAVMLLASKSS--PQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmas  811
            +FPA+KA  +M +A+K S  PQ+       +   + D P   A   AT  P D       
Sbjct  120  DFPAEKAEDLMQMAAKESVAPQNLSFSTHHSSTARADGPRS-AGSPATPAPAD-------  171

Query  812  ppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNN  988
                                      SD+PIARR+SLHRFLEKRKDR + +APYQVH +
Sbjct  172  -------------------SLSKANASDMPIARRNSLHRFLEKRKDRISTKAPYQVHGS  211



>ref|XP_004243696.1| PREDICTED: protein TIFY 10A-like [Solanum lycopersicum]
Length=216

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 116/241 (48%), Gaps = 59/241 (24%)
 Frame = +2

Query  257  SDVKISGR-APEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMD  433
            S++  SGR A +KS+F  TCNLLSQ+LK +         +G ++ +    FD +  TTMD
Sbjct  4    SEIVDSGRFAGQKSHFSHTCNLLSQYLKEKKG------SLGDLSLDMHRNFDSAGSTTMD  57

Query  434  FLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
             L  IEKS +              V  +     +G   A S         P+ AQ+TIFY
Sbjct  58   LLPMIEKSGE-------------LVQKSMNLFPQGGMKAES--------EPEKAQMTIFY  96

Query  614  SGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDp  793
             G+V+VF++FPADKA+ +ML+AS S   +     ++A    L +P+ G   +  +   + 
Sbjct  97   GGQVIVFNDFPADKAKEIMLMASTSKGNNPAKPLESAA--DLVVPSFGKTSIQENQMPNQ  154

Query  794  pkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPY  973
            P                               SDLPIARR+SL RFLEKRKDR TA+ PY
Sbjct  155  PIV-----------------------------SDLPIARRASLTRFLEKRKDRLTAKVPY  185

Query  974  Q  976
             
Sbjct  186  H  186



>ref|XP_009793297.1| PREDICTED: protein TIFY 10A-like [Nicotiana sylvestris]
Length=207

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 83/238 (35%), Positives = 110/238 (46%), Gaps = 82/238 (34%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRV-SIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQ  463
            +KSNF QTCNLLSQ+LK +  S  DLS GI    T           TTMD L  IEKS +
Sbjct  20   QKSNFSQTCNLLSQYLKEKKGSFGDLSLGIHRAGT-----------TTMDLLPMIEKSGE  68

Query  464  DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEF  643
                     NPQ ++N   +T  +     A              Q+TIFY G+V+VF++F
Sbjct  69   S--------NPQKSMNLFPQTEAKSEPEKA--------------QMTIFYGGQVIVFNDF  106

Query  644  PADKARAVMLLAS--KSSPQSARGVFQTA--GVDKLDLPADGAAVVATSTPVDppkpmas  811
            PADKA+ +ML+AS  K +   A  + +TA    D +  P     +++   P+        
Sbjct  107  PADKAKEIMLMASCTKGNNNCATQIQKTAESASDLVPQP-----IISGDLPI--------  153

Query  812  ppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHN  985
                                           ARR+SL RFLEKRKDR TA+APYQ+ N
Sbjct  154  -------------------------------ARRASLTRFLEKRKDRLTAKAPYQLSN  180



>ref|XP_009337185.1| PREDICTED: protein TIFY 10A [Pyrus x bretschneideri]
Length=280

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 119/246 (48%), Gaps = 19/246 (8%)
 Frame = +2

Query  278  RAPEK-SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGK----FDISHGTTMDFLT  442
            RA EK SNF QTC++L Q++K + S  DL+  +   N + S +            M+F  
Sbjct  17   RAAEKPSNFTQTCSMLCQYIKEKASFGDLNLDMACNNMQQSNRGTPEMFRPKAPPMNFFP  76

Query  443  NIEKS----TQDQEMAPIDPNPQNTVNGTSRTV--EEGTNAAASISkeapkeapkaaQLT  604
             +E S    T   +   +D  PQ    G S     EE    A S  K++    P+ AQ+T
Sbjct  77   FMENSRNMPTAATDFKSMDLFPQQAGFGPSAPTPREEVPKMADSSVKKSAPGEPQKAQMT  136

Query  605  IFYSGKVMVFDEFPADKARAVMLLASKSSPQSARG-VFQTAGVDKLDLPADGAAVVATST  781
            IFY G+V+V+++FPADKA+ VMLLASK S QS        A  +       G + + +S+
Sbjct  137  IFYGGQVIVYNDFPADKAKEVMLLASKESSQSHTAPASPPANTNNAFASHLGKSPINSSS  196

Query  782  PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATA  961
            PV P   M                P            DLPIAR++SLHRFLEKRKDR   
Sbjct  197  PVPPSANMFPNHGNQAIQEGVKPPPRPVV-------CDLPIARKASLHRFLEKRKDRLNT  249

Query  962  RAPYQV  979
             APYQ 
Sbjct  250  LAPYQT  255



>ref|XP_008242268.1| PREDICTED: protein TIFY 10A [Prunus mume]
Length=279

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 90/255 (35%), Positives = 129/255 (51%), Gaps = 25/255 (10%)
 Frame = +2

Query  263  VKISGR-----APEKSNFVQTCNLLSQFLKGRVSIRDLS--HGIGVVNTEASGKFDISH-  418
            +++SG+     A + S+F QTC++L Q+LK + S  DLS      +  +  +G  ++ H 
Sbjct  8    LEVSGQRGLRMAEKPSSFTQTCSMLCQYLKEKGSFGDLSLDMACNMQQSNGTGTPEMFHQ  67

Query  419  -GTTMDFLTNIEKS----TQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkea  583
                M+F   +E S        +   +D  PQ    G+S   E+    A S  K++    
Sbjct  68   KAPPMNFFPFMENSRNLPATPGDFKSMDLFPQQAGFGSSVPREDVPKMADSSVKKSAPGE  127

Query  584  pkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAA  763
            P+ AQ+TIFY G+V+VFD+FPADKA+ VMLLASK   +S+ G    A V     PA    
Sbjct  128  PQKAQMTIFYGGQVIVFDDFPADKAKEVMLLASK---ESSHGQAAQASV-----PAKSNN  179

Query  764  VVAT---STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFL  934
            V A+     P++    +     + P       Q A           DLPIAR++SLHRFL
Sbjct  180  VFASHLGKNPMNSSSSVPPSANMFPKFGNQVIQEAPKPSPQPI-VCDLPIARKASLHRFL  238

Query  935  EKRKDRATARAPYQV  979
            EKRKDR   +APYQ 
Sbjct  239  EKRKDRINNKAPYQT  253



>ref|XP_006390367.1| hypothetical protein EUTSA_v10019039mg [Eutrema salsugineum]
 dbj|BAJ33919.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ27653.1| hypothetical protein EUTSA_v10019039mg [Eutrema salsugineum]
Length=251

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 88/245 (36%), Positives = 124/245 (51%), Gaps = 30/245 (12%)
 Frame = +2

Query  269  ISGRAPEKS-NFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTN  445
            ++ R PEK  +F QTC+ LS++LK + S  DLS G+     + +G F +SH   M  L  
Sbjct  11   VARRLPEKKPSFSQTCSRLSRYLKEKGSFGDLSLGM-TCKPDVNGGFAVSHQPKMMNLFP  69

Query  446  IEKSTQD----QEMAP--IDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTI  607
             E S  D    Q++ P  + P   +  + +S  ++E            P+       LTI
Sbjct  70   CEASRMDSSGAQDVKPKILFPRQSSFSSSSSSGIKEEVEMVKETKSVKPESQSAP--LTI  127

Query  608  FYSGKVMVFDEFPADKARAVMLLASKSSPQS-ARGVFQTAGVDKLDLPADGAAVVATSTP  784
            FY G+VMVFD+FP DKA+ V+ LA+K S +S A  V  T  + K     +     +T  P
Sbjct  128  FYGGQVMVFDDFPTDKAKEVIDLANKGSAKSFAAEVNYTQSLAK-----NQKETASTPNP  182

Query  785  VDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATAR  964
            V  P    +  P+ P P                   +LPIARR+SLHRFLEKRKDR T++
Sbjct  183  VPSPAKPTAQEPIQPNPSSL--------------ACELPIARRASLHRFLEKRKDRITSK  228

Query  965  APYQV  979
            APYQ+
Sbjct  229  APYQI  233



>ref|XP_010917442.1| PREDICTED: protein TIFY 10A-like [Elaeis guineensis]
Length=274

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 121/245 (49%), Gaps = 38/245 (16%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQD  466
            EKS+F  TC+ LSQFLKG+ S  DL   I     E +     +  TTM  +  ++ S +D
Sbjct  14   EKSSFSVTCSRLSQFLKGKGSFGDLGLEIAPRPIEQARGIIRAPTTTMKLMPGVDVSEED  73

Query  467  Q------EMAP--IDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGK  622
                   + AP  +D  PQ+T  G    +     A    S  +  + P+  QLTIFY+GK
Sbjct  74   HSENGAGQTAPKSMDLFPQHT--GFDSVL---APAKVESSMSSHNKEPEKNQLTIFYAGK  128

Query  623  VMVFDEFPADKARAVMLLASKSSPQSARGVFQT--AGVDKLDLPADGAAVVATST---PV  787
            V+VFD FPA+K + +M +A K S  +    F T  +   ++D     +  +A++T   PV
Sbjct  129  VLVFDNFPAEKVKDLMQMAMKESLTAQNLGFTTPSSTAARVDFSHQTSPNIASTTGSQPV  188

Query  788  DppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARA  967
                                    +    P    SD+PIARR+SLHRFLEKRKDR + +A
Sbjct  189  --------------------VLQNSMPKPPQANASDMPIARRNSLHRFLEKRKDRISTKA  228

Query  968  PYQVH  982
            PYQV+
Sbjct  229  PYQVN  233



>ref|XP_008337828.1| PREDICTED: protein TIFY 10A-like [Malus domestica]
Length=278

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 128/257 (50%), Gaps = 23/257 (9%)
 Frame = +2

Query  257  SDVKISG----RAPEK-SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEAS--GKFDIS  415
            S  K SG    R  EK S+F QTC++L Q+LK   S  DL+  +   N + S  G  ++ 
Sbjct  4    SSEKFSGQRGMRTAEKPSSFTQTCSMLCQYLKEEGSFGDLNLDMACNNMQQSNGGAPEMF  63

Query  416  H--GTTMDFLTNIEKS----TQDQEMAPIDPNPQNTVNGTSRTV--EEGTNAAASISkea  571
            H     M+F   +E S    T  ++   +D  PQ    G S     EE    A S  K++
Sbjct  64   HQKAPPMNFFPFMETSRNMPTAARDFKSMDLFPQQAGFGPSAPTPREEVPMMADSSVKKS  123

Query  572  pkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQT-AGVDKLDLP  748
                P+ AQ+TIFY G+V+VF++FPADKA+ VMLLASK S Q       T A ++     
Sbjct  124  APGEPQKAQMTIFYDGQVIVFNDFPADKAKEVMLLASKESSQRHTTPASTPANINNAFAS  183

Query  749  ADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHR  928
              G + + +S+ V P   M                P           SDLP+AR++SLHR
Sbjct  184  HLGKSPINSSSSVPPSTNMLPKFDNQAIQEGDKPSPRPIV-------SDLPLARKASLHR  236

Query  929  FLEKRKDRATARAPYQV  979
            FLEKRKDR + RAPYQ 
Sbjct  237  FLEKRKDRLSTRAPYQT  253



>ref|XP_010047457.1| PREDICTED: protein TIFY 10A [Eucalyptus grandis]
 gb|KCW79368.1| hypothetical protein EUGRSUZ_C00785 [Eucalyptus grandis]
Length=276

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 130/256 (51%), Gaps = 20/256 (8%)
 Frame = +2

Query  233  NMSGKHLLSDVKISGRAP-----EKSNFVQTCNLLSQFLKGRV-SIRDLSHGIGVVNTEA  394
            ++S +H  S     GR+P     EKS F  TC+LLSQ+LK +  S  DL+ GI     +A
Sbjct  2    SISSEHSESGSFAGGRSPPARPLEKSTFSHTCSLLSQYLKEKKGSFGDLNLGIPPA-ADA  60

Query  395  SGKFDISH--GTTMDFLTNIEK-STQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISk  565
            +G   +S    TTM+     E  S + + +  +D  PQ    G+++      N ++SI K
Sbjct  61   TGAPGMSRHAATTMNLFPVCEGGSAEARNVKFMDLFPQQAGFGSTKEDVSKMNNSSSIKK  120

Query  566  eapkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDL  745
            E         Q+TIFY+G+V+V ++FPA+KA+ VML ASK S  S       A    L  
Sbjct  121  EPETA-----QMTIFYAGQVIVLNDFPAEKAKEVMLAASKGSSLSQ----HAAAAPNLAK  171

Query  746  PADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLH  925
                 A     +PV+    ++S P   P       Q      A      DLPIARR+SLH
Sbjct  172  SKPAFAPNYAKSPVESGGVVSSSPVPVPSLGANAIQEHGGRLAEPL-ACDLPIARRASLH  230

Query  926  RFLEKRKDRATARAPY  973
            RFLEKRKDR TA+APY
Sbjct  231  RFLEKRKDRLTAKAPY  246



>ref|XP_008460319.1| PREDICTED: protein TIFY 11A-like [Cucumis melo]
Length=209

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/238 (34%), Positives = 106/238 (45%), Gaps = 72/238 (30%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISH-GTTMDFLTNI  448
            SG+ PEKS+F QTCNLLSQ+LK + S+            E   +F  +     M+FLTN+
Sbjct  14   SGKVPEKSSFAQTCNLLSQYLKEKRSL------AITPRIEPKDEFPTTRPPVVMNFLTNM  67

Query  449  EKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVM  628
            E                          E+  + AA+ S     E P A Q+TIFY GKV+
Sbjct  68   EIPD-----------------------EKSASVAAADSIPPAAEPPSATQMTIFYDGKVL  104

Query  629  VFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpma  808
            VF++ P+++A  +M +A K    S+R +  TA  D      +G     T           
Sbjct  105  VFNDLPSERAEEIMAMAGKGIAPSSRSI-ATAVSD------NGGEQPLTKV---------  148

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVH  982
                                       SDLPIARR+SLHRF EKRKDR  AR PYQV+
Sbjct  149  --------------------------SSDLPIARRASLHRFFEKRKDRVAARGPYQVN  180



>ref|XP_011078125.1| PREDICTED: protein TIFY 10B-like [Sesamum indicum]
Length=235

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 93/252 (37%), Positives = 114/252 (45%), Gaps = 49/252 (19%)
 Frame = +2

Query  272   SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIE  451
             SGR   +S+F QTC+LLSQ+LK + S  DLS G+           D   GT M+ L  IE
Sbjct  9     SGRG--RSSFSQTCSLLSQYLKVKGSFGDLSLGL------TPNLADQPKGT-MNLLPMIE  59

Query  452   KSTQDQEMAPIDPN------PQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
             KS         + N      PQ  V G    + E   A                Q+TIFY
Sbjct  60    KSGHSAGAGAGNLNVQLNKLPQLAVAGEKTPMTEAETA----------------QMTIFY  103

Query  614   SGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDp  793
              G+V+VF++FPA+KA+ +M LASK S  +       A       PA+     ATSTP   
Sbjct  104   GGQVIVFNDFPANKAKEIMTLASKCSAATNLHPAAFAPPLAAQSPAES----ATSTP---  156

Query  794   pkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPY  973
                                Q  A  P   P GSDLPI R+ SL RFLEKRKDR TA APY
Sbjct  157   -----------NIAPACGIQECARRPPQPPLGSDLPIMRQKSLARFLEKRKDRITANAPY  205

Query  974   QVHNNPLIPSKS  1009
             Q       P K+
Sbjct  206   QTSKPATAPPKT  217



>ref|XP_004144433.1| PREDICTED: protein TIFY 10B-like [Cucumis sativus]
 gb|KGN58456.1| hypothetical protein Csa_3G645940 [Cucumis sativus]
Length=209

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 108/238 (45%), Gaps = 72/238 (30%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHG-TTMDFLTNI  448
            S + PEKS+F QTCNLLSQ+LK +   R L+    +   E   +F  +     M+F TN+
Sbjct  14   SAKLPEKSSFAQTCNLLSQYLKEK---RTLAITPRI---EPKDEFPTTRPPVVMNFFTNM  67

Query  449  EKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVM  628
            E             NP           E+  + AA+ S     E P A Q+TIFY GKV+
Sbjct  68   E-------------NPD----------EKSASVAAADSIPPGAEPPSATQMTIFYDGKVL  104

Query  629  VFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpma  808
            VF++ P+++A  +M +A K    S+R +  TA  D      +G     T           
Sbjct  105  VFNDLPSERAEEIMAMAGKGIAPSSRSI-TTAVSD------NGGEQPLTKV---------  148

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVH  982
                                       SDLPIARR+SLHRF EKRKDR  AR PYQV+
Sbjct  149  --------------------------SSDLPIARRASLHRFFEKRKDRVAARGPYQVN  180



>gb|KDO73850.1| hypothetical protein CISIN_1g023369mg [Citrus sinensis]
Length=249

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 95/259 (37%), Positives = 126/259 (49%), Gaps = 35/259 (14%)
 Frame = +2

Query  251  LLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISH---G  421
            + S  ++S   PEKS+F QTC+LLSQ+LK   S  DLS GI   N EA+G  +I      
Sbjct  1    MASSSEMSVNLPEKSSFSQTCSLLSQYLKEGGSFGDLSLGISS-NIEANGVPEIPRRPAA  59

Query  422  TTMDFLTNIEKSTQD---QEMAPIDPNPQNTVNGTSRTVEEG----TNAAASISkeapke  580
            TTM+     + S QD   + MA     P+N  +      + G     +    I     K 
Sbjct  60   TTMNLFPVSDNSGQDVSARNMA----APRNWESMNLFPQQAGFAPKNDTPNMIDSSLNKP  115

Query  581  apkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGA  760
            AP+ AQ+TIFY G+V+VF++FPADKA  +M LAS  S      +        + LPA G 
Sbjct  116  APQTAQMTIFYGGQVIVFNDFPADKANEIMQLASNGS-----SLSHGTAYPPMQLPAQGY  170

Query  761  AVVATS---TPVDppkpmasppplppppvppptqpaaaapapapGG------------SD  895
               A S   +PV+   P++  PP  P        P + +                    D
Sbjct  171  NSFAASLPKSPVESTPPVSPGPPKIPTEPSCSVPPRSNSIPNFGNNLIPERAQPPSRPCD  230

Query  896  LPIARRSSLHRFLEKRKDR  952
            LPIARR+SLHRFLEKRKDR
Sbjct  231  LPIARRNSLHRFLEKRKDR  249



>ref|XP_009597283.1| PREDICTED: protein TIFY 10A [Nicotiana tomentosiformis]
Length=205

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 115/255 (45%), Gaps = 82/255 (32%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRV-SIRDLSHGIGVVNTEASGKFDI  412
            M+   ++   + +    +KS+F QTCNLLSQ+LK +  S  DLS GI    T        
Sbjct  1    MASSEMVDSGRFAAAVGQKSHFSQTCNLLSQYLKEKKGSFGDLSLGIHRAGT--------  52

Query  413  SHGTTMDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapka  592
               TTMD L  IEKS +         NPQ ++    +T  +     A             
Sbjct  53   ---TTMDLLPMIEKSGES--------NPQKSMYLFPQTEAKSEPEKA-------------  88

Query  593  aQLTIFYSGKVMVFDEFPADKARAVMLLAS--KSSPQSARGVFQTA--GVDKLDLPADGA  760
             Q+TIFY G+V+VF++FPADKA+ +ML+AS  K +  S   + +TA    D +  P    
Sbjct  89   -QMTIFYGGQVIVFNDFPADKAKEIMLMASCTKGNNNSTTQIQKTAESASDLVPQP----  143

Query  761  AVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEK  940
             +++   P+                                       ARR+SL RFLEK
Sbjct  144  -IISGDLPI---------------------------------------ARRASLTRFLEK  163

Query  941  RKDRATARAPYQVHN  985
            RKDR TA+APYQ+ N
Sbjct  164  RKDRLTAKAPYQLSN  178



>gb|ACY30445.1| JAZ1-like protein [Nicotiana tabacum]
Length=200

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 113/241 (47%), Gaps = 56/241 (23%)
 Frame = +2

Query  266  KISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNT-EASGKFDISHGTTMDFLT  442
            K++G   +KS F QTCNLLSQFLK + S  DL++ +G+  + E  G       TTM+ L 
Sbjct  7    KVTG---QKSQFSQTCNLLSQFLKKKGSFGDLNN-LGIYRSFEPIGN---QTTTTMNLLP  59

Query  443  NIEKS---TQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
             IEKS    ++    P++  PQ  ++      E+                    Q+TIFY
Sbjct  60   MIEKSGDSAENNSQKPMNFFPQEVISTAKSEPEKA-------------------QMTIFY  100

Query  614  SGKVMVFDEFPADKARAVMLLASKSSPQS---ARGVFQTAGVDKLDLPADGAAVVATSTP  784
             G+V+VFD+FPADKA  +M LASK +      A  +F  A V+         +V   ST 
Sbjct  101  GGQVIVFDDFPADKANEIMKLASKKNNNKQNLASNIFSYAMVNN---KKSAESVTINST-  156

Query  785  VDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATAR  964
                                  +     P      +DLPIARR+SL RFLEKRKDR T+ 
Sbjct  157  -------------------QELRTRTQVPISQSSVADLPIARRNSLTRFLEKRKDRITST  197

Query  965  A  967
            A
Sbjct  198  A  198



>ref|XP_010685279.1| PREDICTED: protein TIFY 10A-like [Beta vulgaris subsp. vulgaris]
Length=258

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 108/246 (44%), Gaps = 49/246 (20%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS--------HGTTMD-FLT  442
            KSNF QTCN  SQFLK R   R L H      T A  +F+            T ++ F  
Sbjct  21   KSNFTQTCNRFSQFLKER---RSLGHLDAFKTTLAPSEFEFKGVKELSGPKNTAINLFPR  77

Query  443  NIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAA-----SISkeapkeapkaaQLTI  607
            N+EK     E+ P+        + T+  V+E T   A     SIS+    +      +TI
Sbjct  78   NLEKEKLSLELFPL------MSSLTAAGVKETTKTMADCRELSISENDEPKNTTTPSMTI  131

Query  608  FYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPV  787
            FY G+V+VF+E P DKAR +M LA   +  S+     +   ++ + P      + T T  
Sbjct  132  FYGGRVLVFNELPEDKAREIMSLARCQTMNSS-----SHTQNQTETPTQTLRSINTLT--  184

Query  788  DppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARA  967
                                       P      SDLPIARR SLHRF+EKRK R  A A
Sbjct  185  -------------------SYLAQNVVPQGVSSLSDLPIARRVSLHRFMEKRKHRIAANA  225

Query  968  PYQVHN  985
            PYQ+HN
Sbjct  226  PYQLHN  231



>gb|AGV54557.1| protein TIFY 10A-like protein [Phaseolus vulgaris]
Length=264

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 118/239 (49%), Gaps = 20/239 (8%)
 Frame = +2

Query  278  RAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS--HGTTMDFLTNIE  451
            ++PEKS+F QTC+LLSQ++K + S  DL+ G+   NTE SG  + S   GTTM+     E
Sbjct  17   KSPEKSSFSQTCSLLSQYIKEKGSFGDLTLGM-TCNTEPSGSPETSCQSGTTMNLFPTKE  75

Query  452  KSTQDQEMAPIDP-NPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVM  628
             +   + +  +D  +PQ     + R +EE      S + ++  +  K AQ+TIFY G+V+
Sbjct  76   NNVTPKNLTAMDLLSPQ----ASYRPLEEIPTLVNSSAIKSVSKVNKTAQMTIFYGGQVV  131

Query  629  VFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpma  808
            VFD+FPA+KA  +M  A +  PQS      T        P++     A S+  +      
Sbjct  132  VFDDFPAEKANEIMSYA-RGKPQSQNNSVFTYTQSPPSFPSNLVRNSADSSAPNYSLGNV  190

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHN  985
            S     P                     D P AR++SL RF  KRK+R  ++ PYQV N
Sbjct  191  SNSLPEPFQALSRPVV-----------CDPPNARKTSLPRFFLKRKERIASKTPYQVPN  238



>ref|NP_565043.1| jasmonate-zim-domain protein 6 [Arabidopsis thaliana]
 sp|Q9C9E3.1|TI11B_ARATH RecName: Full=Protein TIFY 11B; AltName: Full=Jasmonate ZIM domain-containing 
protein 6 [Arabidopsis thaliana]
 gb|AAG52575.1|AC016529_6 unknown protein; 37093-38893 [Arabidopsis thaliana]
 gb|AAK43962.1|AF370147_1 unknown protein [Arabidopsis thaliana]
 gb|AAL15195.1| unknown protein [Arabidopsis thaliana]
 gb|AAM65581.1| unknown [Arabidopsis thaliana]
 gb|AEE35326.1| protein TIFY 11B [Arabidopsis thaliana]
Length=269

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 76/246 (31%), Positives = 111/246 (45%), Gaps = 31/246 (13%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIG-VVNTEASGKFDISHGTTMDFLTNI  448
            +G+APEKSNF Q C+LLS++LK + S  +++ G+    + E +GKFD+          N+
Sbjct  3    TGQAPEKSNFSQRCSLLSRYLKEKGSFGNINMGLARKSDLELAGKFDLKGQQ------NV  56

Query  449  EKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVM  628
             K  +  E  P     + ++   S + E+                   +QLTIF+ GKVM
Sbjct  57   IKKVETSETRPFKLIQKFSIGEASTSTEDKAIYIDLSEPAKVAPESGNSQLTIFFGGKVM  116

Query  629  VFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpma  808
            VF+EFP DKA+ +M +A ++   +   V        ++L      +   + P        
Sbjct  117  VFNEFPEDKAKEIMEVAKEA---NHVAVDSKNSQSHMNLDKSNVVIPDLNEPTSSGNNED  173

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV--H  982
                     V                     IARR+SLHRF  KRKDRA ARAPYQV  H
Sbjct  174  QETGQQHQVVER-------------------IARRASLHRFFAKRKDRAVARAPYQVNQH  214

Query  983  NNPLIP  1000
             + L P
Sbjct  215  GSHLPP  220



>ref|XP_007202425.1| hypothetical protein PRUPE_ppa009778mg [Prunus persica]
 gb|ADU76348.1| jasmonate-zim-domain protein 1 [Prunus persica]
 gb|EMJ03624.1| hypothetical protein PRUPE_ppa009778mg [Prunus persica]
Length=278

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 132/264 (50%), Gaps = 25/264 (9%)
 Frame = +2

Query  263   VKISGR-----APEKSNFVQTCNLLSQFLKGRVSIRDLS--HGIGVVNTEASGKFDISH-  418
             +++SG+     A + S+F QTC++L Q+LK + S  DLS      +  +  +G  ++ H 
Sbjct  8     LEVSGQRGLRMAEKPSSFTQTCSMLCQYLKEKGSFGDLSLDMACNMQQSNGTGTPEMFHQ  67

Query  419   -GTTMDFLTNIEKS----TQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkea  583
                 ++F   +E S        +   +D  PQ    G+S    +    A S  K++    
Sbjct  68    KAPPVNFFPFMENSRNLPATPGDFKSMDLFPQQAGFGSSVPRGDVPKMADSSVKKSVPGE  127

Query  584   pkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAA  763
             P+ AQ+TIFY G+V+VFD+FPADKA+ VMLLASK S  S     Q A   +  +PA    
Sbjct  128   PQKAQMTIFYGGQVIVFDDFPADKAKEVMLLASKESSHS-----QAA---QASIPAKSNN  179

Query  764   VVAT---STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFL  934
             V A+     P++    +     + P       Q A           DLPIAR++SLHRFL
Sbjct  180   VFASHLGKNPMNSSSSVPPSANMFPKFGNQVIQEAPKPSPQPI-VCDLPIARKASLHRFL  238

Query  935   EKRKDRATARAPYQVHNNPLIPSK  1006
             EKRKDR   +APYQ  +    P+K
Sbjct  239   EKRKDRINNKAPYQTSSPAAGPAK  262



>ref|XP_011093865.1| PREDICTED: protein TIFY 10A-like isoform X2 [Sesamum indicum]
Length=225

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 83/240 (35%), Positives = 116/240 (48%), Gaps = 44/240 (18%)
 Frame = +2

Query  257  SDVKISGR-APEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMD  433
            S++  SGR +  +SNF +TC+LLSQ+LK + S  DL+ G+   N E  G    +   T +
Sbjct  4    SEIVDSGRFSGGRSNFSRTCSLLSQYLKEKGSFGDLTLGL-AHNLETKG----APTETKN  58

Query  434  FLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
             L  IEKS +      ++  P          +  GT   A  +           Q+TIFY
Sbjct  59   LLPMIEKSGRSSGPGNLNSPPTRDEILNKSDLSSGTKPEAETA-----------QMTIFY  107

Query  614  SGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDp  793
            +G+V+VFD+FPA+KAR +M+LAS +             V  L  PA+    V  +  +  
Sbjct  108  AGQVLVFDDFPAEKAREIMMLASSAQNHP------NPTVAPLQSPAESTTNVVPTFAIQE  161

Query  794  pkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPY  973
                ++ PPL                      SDLPIAR++SL RFLEKRKDR TA APY
Sbjct  162  RPLHSARPPLD---------------------SDLPIARKNSLARFLEKRKDRITANAPY  200



>gb|AGU37272.1| jasmonate ZIM-domain protein 3b [Nicotiana tabacum]
Length=200

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 80/236 (34%), Positives = 108/236 (46%), Gaps = 78/236 (33%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRV-SIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQ  463
            +KS+F QTCNLLSQ+LK +  S  DLS GI    T           TTMD L  IEKS +
Sbjct  13   QKSHFSQTCNLLSQYLKEKKGSFGDLSLGIHRAGT-----------TTMDLLPMIEKSGE  61

Query  464  DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEF  643
                     NPQ ++    +T  +     A              Q+TIFY G+V+VF++F
Sbjct  62   S--------NPQKSMYLFPQTEAKSEPEKA--------------QMTIFYGGQVIVFNDF  99

Query  644  PADKARAVMLLAS--KSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmaspp  817
            PADKA+ +ML+AS  K +  S   + +TA      +P     +++   P+          
Sbjct  100  PADKAKEIMLMASCTKGNNNSTTQIQKTAESASDLVP---QPIISGDLPI----------  146

Query  818  plppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHN  985
                                         ARR+SL RFLEKRKDR TA+APYQ+ N
Sbjct  147  -----------------------------ARRASLTRFLEKRKDRLTAKAPYQLSN  173



>ref|XP_006302729.1| hypothetical protein CARUB_v10020844mg [Capsella rubella]
 gb|EOA35627.1| hypothetical protein CARUB_v10020844mg [Capsella rubella]
Length=252

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 84/241 (35%), Positives = 123/241 (51%), Gaps = 20/241 (8%)
 Frame = +2

Query  269  ISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNI  448
             SGR P   +F QTC+ LS++LK + S  DL+ G+     + +G F  S   TM  L   
Sbjct  10   FSGRKP---SFSQTCSRLSRYLKEKGSFGDLTLGM-TCKPDLNGGFAASRQPTMMNLFPC  65

Query  449  EKSTQD----QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYS  616
            E S  D    Q++ P    P+ +   +S +             ++ K   ++A LTIFY 
Sbjct  66   EASKMDSLDGQDIKPKKMFPRQSSFSSSSSTGTKEEVQMIKETKSVKLESESAPLTIFYG  125

Query  617  GKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDpp  796
            G+VMVFDEF A+KA+ V+ LA+K S +S  G   TA V++          +A +  +   
Sbjct  126  GRVMVFDEFSAEKAKEVIDLANKGSAKSFTGF--TAEVNQ----------IAYTQNLAKS  173

Query  797  kpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
            +   +  P           P    P P+    +LPIARR+SLHRFLEKRKDR T++APY+
Sbjct  174  QKEFASIPNLAASPTKTASPEPIQPNPSSLACELPIARRASLHRFLEKRKDRITSKAPYK  233

Query  977  V  979
            +
Sbjct  234  I  234



>ref|XP_009406688.1| PREDICTED: protein TIFY 10A-like [Musa acuminata subsp. malaccensis]
Length=213

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 110/242 (45%), Gaps = 47/242 (19%)
 Frame = +2

Query  266  KISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTN  445
            KI  R+ EK+ F  TC LLSQ+LK + S   +   +         +      TT+  L  
Sbjct  5    KIGTRS-EKTQFSVTCRLLSQYLKEKGSFGSIGLELAPWPIHHQPQEKHQAPTTLSLLPG  63

Query  446  IEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkea---pkeapkaaQLTIFYS  616
            ++ ST+DQ +        NT     +++E     A   S+          + AQLTIFY 
Sbjct  64   VDVSTEDQTI-------NNTDQNAPKSMELFPQHAGIDSESVRIPSNIKTEKAQLTIFYC  116

Query  617  GKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDpp  796
            GKV+VFD+FPADKA  ++ +ASK S  + +  F                  ++ST  D  
Sbjct  117  GKVLVFDDFPADKAEDLLQMASKESIAAQKIAF---------------TAPSSSTGAD--  159

Query  797  kpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
                                ++         SD+PIAR++SLHRFL KRKDR + +APYQ
Sbjct  160  -------------------CSSQLETAHANASDMPIARKNSLHRFLMKRKDRISTKAPYQ  200

Query  977  VH  982
            VH
Sbjct  201  VH  202



>ref|XP_010416354.1| PREDICTED: protein TIFY 10B-like [Camelina sativa]
Length=253

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 86/250 (34%), Positives = 126/250 (50%), Gaps = 31/250 (12%)
 Frame = +2

Query  269  ISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGV---VNTEASGKFDISHGTTMDFL  439
             SGR P   +F QTC+ LS++LK + S  DL+ G+     +N    G F  S   TM  L
Sbjct  10   FSGRKP---SFSQTCSRLSRYLKEKGSFGDLTLGMTCKPDLNG-GGGGFAASRQPTMMNL  65

Query  440  TNIEKSTQD----QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTI  607
               E S  D    Q++ P D  P+ +   +S +             ++ K   ++A LTI
Sbjct  66   FPCEASGMDSLAGQDIKPKDMFPRQSSFSSSSSSGTKEEVQMITETKSVKLESQSAPLTI  125

Query  608  FYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAV---VATS  778
            FY G+VMVFD+F ADKA+ V+ LA+K+SP+       TA V+++    + A     +A+S
Sbjct  126  FYGGRVMVFDDFSADKAKEVIDLANKASPKPF-----TAEVNQIAYTQNFAKTQKEIASS  180

Query  779  TPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRAT  958
              +       +    P  P P                 +LPI RR+SLHRFLEKRKDR T
Sbjct  181  PKLAGSSTKTAAQQEPIQPNPSSL------------ACELPIVRRASLHRFLEKRKDRIT  228

Query  959  ARAPYQVHNN  988
            ++APYQ++ +
Sbjct  229  SKAPYQINGS  238



>ref|XP_004508014.1| PREDICTED: protein TIFY 10A-like [Cicer arietinum]
Length=224

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 113/253 (45%), Gaps = 65/253 (26%)
 Frame = +2

Query  275   GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHG-IGVVNTEASGKFDISHGTTMD-FLTNI  448
              + PEKSNF  TCNLLSQ++K   S   L+ G    V T  S +   + GTTM+ F TN+
Sbjct  16    AKLPEKSNFSHTCNLLSQYIKENGSFGGLTLGKPCTVETNGSPETSCNSGTTMELFPTNM  75

Query  449   EKSTQD-QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKV  625
                TQ+ + +  + PN    +  +S   E  T                 AQLT+FY GK+
Sbjct  76    TPQTQNLKTLNLLSPNDVPALENSSVFKEPKT-----------------AQLTMFYGGKI  118

Query  626   MVFDEFPADKARAVMLLA--SKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppk  799
             +V DEFPA+K   ++  A  +K S  ++    Q + +  L   A    +V          
Sbjct  119   IVLDEFPANKVEELISFARTTKWSTYASYNQTQPSVIPNLFPQAPSRLIVC---------  169

Query  800   pmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
                                            + PIAR++SLHRFLEKRKDR  A+APYQ 
Sbjct  170   -------------------------------EQPIARKASLHRFLEKRKDRIAAKAPYQK  198

Query  980   HN---NPLIPSKS  1009
              N    P+ P KS
Sbjct  199   SNPISAPVKPVKS  211



>ref|XP_003523520.1| PREDICTED: protein TIFY 10A-like [Glycine max]
 gb|KHN33765.1| Protein TIFY 10B [Glycine soja]
Length=201

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 112/250 (45%), Gaps = 73/250 (29%)
 Frame = +2

Query  269  ISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMD--FLT  442
            +S    EKS F +TC LL Q+LK + S  DL+ GI +  T  S        TTM   +  
Sbjct  1    MSSSLAEKSTFSRTCTLLRQYLKEKGSFGDLTLGIALPCTNGSPDTSCHSATTMQSVYPR  60

Query  443  NIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGK  622
            ++E         P   NP +T        E+   AA               QLTIFY G+
Sbjct  61   HLE--------IPTFINPSST--------EKEAKAA---------------QLTIFYDGQ  89

Query  623  VMVFDEFPADKARAVMLLA----SKSSPQSARGVFQTAGVDKLDLPADGAAVV--ATSTP  784
            V+VFD+FPADK + +M LA      S  Q++    QT      + P+    ++  A STP
Sbjct  90   VVVFDDFPADKVQEMMSLALATKGISQSQNSSAYAQTHNQQGNNHPSSIPNIIPQAPSTP  149

Query  785  VDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATAR  964
            +                                  +D+PIAR++SLHRFLEKRKDR  A+
Sbjct  150  I---------------------------------VNDMPIARKASLHRFLEKRKDRIAAK  176

Query  965  APYQVHNNPL  994
            +PYQ  N+P+
Sbjct  177  SPYQT-NSPI  185



>ref|XP_011093864.1| PREDICTED: protein TIFY 10A-like isoform X1 [Sesamum indicum]
Length=226

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 117/241 (49%), Gaps = 45/241 (19%)
 Frame = +2

Query  257  SDVKISGR-APEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGV-VNTEASGKFDISHGTTM  430
            S++  SGR +  +SNF +TC+LLSQ+LK + S  DL+ G+   + T+A    +     T 
Sbjct  4    SEIVDSGRFSGGRSNFSRTCSLLSQYLKEKGSFGDLTLGLAHNLETKAGAPTE-----TK  58

Query  431  DFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIF  610
            + L  IEKS +      ++  P          +  GT   A  +           Q+TIF
Sbjct  59   NLLPMIEKSGRSSGPGNLNSPPTRDEILNKSDLSSGTKPEAETA-----------QMTIF  107

Query  611  YSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVD  790
            Y+G+V+VFD+FPA+KAR +M+LAS +             V  L  PA+    V  +  + 
Sbjct  108  YAGQVLVFDDFPAEKAREIMMLASSAQNHP------NPTVAPLQSPAESTTNVVPTFAIQ  161

Query  791  ppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAP  970
                 ++ PPL                      SDLPIAR++SL RFLEKRKDR TA AP
Sbjct  162  ERPLHSARPPLD---------------------SDLPIARKNSLARFLEKRKDRITANAP  200

Query  971  Y  973
            Y
Sbjct  201  Y  201



>ref|XP_006452843.1| hypothetical protein CICLE_v10008653mg [Citrus clementina]
 gb|ESR66083.1| hypothetical protein CICLE_v10008653mg [Citrus clementina]
Length=345

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 100/296 (34%), Positives = 134/296 (45%), Gaps = 52/296 (18%)
 Frame = +2

Query  158  ISRKLQSLPAILAFG*HPVSLLRRPNMSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLK  337
            + R+LQ    I A G   +S L   +M+     S  ++S   PEKS+F QTC+LLSQ+LK
Sbjct  71   LQRQLQRTSFIFARGFPLLSWLNTTSMA-----SSSEMSVNLPEKSSFSQTCSLLSQYLK  125

Query  338  GRVSIRDLSHGIGVVNTEASGKFDISH---GTTMDFLTNIEKSTQD----QEMAPIDPNP  496
               S  DLS GI   N EA+G  +I      TTM+     + S QD      +AP +   
Sbjct  126  EGGSFGDLSLGISS-NIEANGVPEIPRRPAATTMNLFPVSDNSGQDVSVRNMVAPRNWES  184

Query  497  QNTV---------NGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPA  649
             N           N T   ++   N  A           + AQ+TIFY G+V+ F++FPA
Sbjct  185  MNLFPQQAGFAPKNDTPNMIDSSLNKPAP----------QTAQMTIFYGGQVIAFNDFPA  234

Query  650  DKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATS---TPVDppkpmasppp  820
            DKA  +M LAS  S      +        + LPA G    A S   +PV+   P++  PP
Sbjct  235  DKANEIMQLASNGS-----SLSHGTAYPPMQLPAQGYNSFAASLPKSPVESTPPVSPGPP  289

Query  821  lppppvppptqpaaaapapapGG------------SDLPIARRSSLHRFLEKRKDR  952
                       P + +                    DLPIARR+SLHRFLEKRKDR
Sbjct  290  KILTEPSCSVPPRSNSIPNFGNNLIPECAQPPSRPCDLPIARRNSLHRFLEKRKDR  345



>ref|XP_010428492.1| PREDICTED: protein TIFY 10B-like [Camelina sativa]
 ref|XP_010428493.1| PREDICTED: protein TIFY 10B-like [Camelina sativa]
Length=253

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 118/249 (47%), Gaps = 35/249 (14%)
 Frame = +2

Query  269  ISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVV-NTEASGKFDISHGTTMDFLTN  445
             SGR P   +F QTC+ LS++LK + +  DL+ G+    +    G F  S   TM  L  
Sbjct  10   FSGRKP---SFSQTCSRLSRYLKEKGTFGDLTLGMTCKPDLNGGGGFAASRQPTMMNLFP  66

Query  446  IEKSTQD----QEMAPIDPNPQNTVN------GTSRTVEEGTNAAASISkeapkeapkaa  595
             E S  D    Q++ P D  P+ +        GT   V+       S+  E+        
Sbjct  67   CEVSGMDSLAGQDIKPKDMFPRQSSFSSSSSSGTKEEVQMIKEETKSVKLESQSAP----  122

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQS-ARGVFQTAGVDKLDLPADGAAVVA  772
             LTIFY G+VMVFD+F ADKA+ V+ LA+K S +S    V Q A        A     +A
Sbjct  123  -LTIFYGGRVMVFDDFSADKAKEVIDLANKGSAKSFTHEVNQIAYTQNF---AKTQTEIA  178

Query  773  TSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDR  952
             ST +       +    P  P P                 +LPIARR+SLHRFLEKRKDR
Sbjct  179  ASTNLAGSPIKTAAQLEPIQPNPSSL------------ACELPIARRASLHRFLEKRKDR  226

Query  953  ATARAPYQV  979
             T++APYQ+
Sbjct  227  ITSKAPYQI  235



>ref|XP_011072606.1| PREDICTED: protein TIFY 10B-like [Sesamum indicum]
 ref|XP_011072607.1| PREDICTED: protein TIFY 10B-like [Sesamum indicum]
Length=328

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 93/168 (55%), Gaps = 8/168 (5%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIG--VVNTEASGKFD  409
            MS    LSD +  G+ PEK+NFVQTCNLLSQ++KG+ S+RDL+  IG  V + EA  K  
Sbjct  1    MSSSRQLSDGRRQGKEPEKTNFVQTCNLLSQYIKGKGSLRDLNLEIGGKVESLEAIVKPG  60

Query  410  ISHGTTMDFLTNIEKST------QDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkea  571
             S   +      + ++         ++    +P P      +S  + E     AS SKE 
Sbjct  61   SSLAASASTAVGLPRNNGKFAEYSSEQQPSKNPVPHVARPDSSIVIVEDAPNKASTSKEG  120

Query  572  pkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVF  715
                 K AQLTIFYSG+V+VFD++P DK R ++ +A KSS Q + G+ 
Sbjct  121  TTTDSKTAQLTIFYSGRVLVFDDYPTDKVRDLVSMAKKSSSQMSYGIL  168


 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  887  GSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNP  991
            GSDLPIARRSSLHRFL KRKDRA  R PY    +P
Sbjct  279  GSDLPIARRSSLHRFLAKRKDRAAVRGPYHNQEHP  313



>ref|XP_009359716.1| PREDICTED: protein TIFY 10A-like [Pyrus x bretschneideri]
Length=278

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 123/257 (48%), Gaps = 23/257 (9%)
 Frame = +2

Query  257  SDVKISG----RAPEK-SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEAS--GKFDI-  412
            S  K SG    R  EK S+F QTC++L Q+LK   S  DL+  +   N + S  G  ++ 
Sbjct  4    SSEKFSGQRGMRTAEKPSSFTQTCSMLCQYLKEEGSFGDLNLDMACNNMQQSNGGAPEMF  63

Query  413  -SHGTTMDFLTNIEKS----TQDQEMAPIDPNPQNTVNGTSRTV--EEGTNAAASISkea  571
                  M+F   +E S    T   +   +D  PQ    G S     EE    A S  K++
Sbjct  64   NQKAPPMNFFPFMETSRNMPTAAGDFKSMDLFPQQAGFGPSAPTPREEVPKMADSSVKKS  123

Query  572  pkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPA  751
                P+ AQ+TIFY G+V+VF++FP DKA+ VMLLASK   QS   +  T    K    +
Sbjct  124  ASGEPQKAQMTIFYGGQVIVFNDFPVDKAKEVMLLASKERSQSHTTLASTPAKIKNAFAS  183

Query  752  D-GAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHR  928
              G + + +S+ V P   M                P            DLP+AR++SLHR
Sbjct  184  HLGKSPMNSSSSVPPSTNMFPKFDNQAIQEGDKPSPRPIV-------CDLPLARKASLHR  236

Query  929  FLEKRKDRATARAPYQV  979
            FLEKRKDR   RAPYQ 
Sbjct  237  FLEKRKDRLNTRAPYQT  253



>ref|XP_008792846.1| PREDICTED: protein TIFY 10B-like [Phoenix dactylifera]
Length=270

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 84/248 (34%), Positives = 109/248 (44%), Gaps = 47/248 (19%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRVSIRDLSHGI---------GVVNTEASGKFDISHGTTMDFL  439
            EKSNF  TC LL Q+LK + S RDL   I         G++   A+ K        +D  
Sbjct  14   EKSNFSVTCGLLRQYLKEKGSFRDLGLEIAPRPVEQVRGIIRAPATMKL----MPVVDVW  69

Query  440  TNIEKSTQDQEMAP--IDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
              +       + AP  +D  PQ+   G    V     A    S  +  + P   QLTIFY
Sbjct  70   EELHSENGADQPAPKSMDLFPQHA--GVDSLV---APAKGESSMSSHTKEPAKNQLTIFY  124

Query  614  SGKVMVFDEFPADKARAVMLLASKSS--PQSARGVFQT-----AGVDKLDLPADGAAVVA  772
             GKV+VFD+FPA+K + +M +A K S   Q+    F T     A VD     +   A + 
Sbjct  125  GGKVLVFDKFPAEKVKDLMQMAMKESLAAQTQNLGFTTPSSTAARVDFSHQNSSNIASIP  184

Query  773  TSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDR  952
             S PV                        +         SD+PIARR+SLHRFLEKRKDR
Sbjct  185  GSQPV--------------------VLQNSMPKPAEANASDMPIARRNSLHRFLEKRKDR  224

Query  953  ATARAPYQ  976
               +APYQ
Sbjct  225  INTKAPYQ  232



>ref|XP_011048577.1| PREDICTED: protein TIFY 10A-like [Populus euphratica]
Length=269

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 79/243 (33%), Positives = 114/243 (47%), Gaps = 35/243 (14%)
 Frame = +2

Query  293  SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGK-FDISHGTTMDFLTNIEKSTQ--  463
            S+F + CNLLS++LK + S  D+S GI     E  G     S  TT++ LTN+E S++  
Sbjct  16   SSFAKKCNLLSRYLKEKGSFGDISLGINGKAPEVKGTGTSSSPATTLNLLTNMENSSEHI  75

Query  464  ---------DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYS  616
                        M  +D  P       S   E+  N A +  +++    P  A +TIFY+
Sbjct  76   TSRQKPVASSNMMRSMDFFPHFVGFSPSNYTEDAINKADNHLRKSSTMDPGTAPMTIFYA  135

Query  617  GKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDpp  796
            GK+ VF + PA KA+ +M LA+K S  S  G      + K++     AA+ + +      
Sbjct  136  GKLTVFSDIPAAKAKEIMALATKGSSISPNGFPSDPSIIKVNSANSVAALDSNNA-----  190

Query  797  kpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
                              Q        AP GS +P A R+SLHRF  KRK+R  ARAPYQ
Sbjct  191  ------------------QQRLHLQPEAPNGSGVPHATRASLHRFFSKRKERVAARAPYQ  232

Query  977  VHN  985
            +H+
Sbjct  233  IHH  235



>ref|XP_011079536.1| PREDICTED: protein TIFY 10A-like isoform X2 [Sesamum indicum]
Length=278

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 107/195 (55%), Gaps = 22/195 (11%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIG--VVNTEASGKFD  409
            MS    ++D +  G+APEKSNFVQTCNLLS+++K + S+RDL+  IG  V + EA  K  
Sbjct  1    MSSHRHIADGRRLGKAPEKSNFVQTCNLLSRYIKEKGSLRDLNLEIGGKVESLEAIVKPG  60

Query  410  ISHGTTMDFLTNIEKSTQ---DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapke  580
             S            KS Q   DQ   PI P+  +++N       + T+  A        E
Sbjct  61   TSISPPASATIYKVKSAQPLTDQH-PPITPH-DSSINTAEHAPHKQTSKEA------MTE  112

Query  581  apkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVF-QTAGVDKLDLPADG  757
             PK AQLTIFYSGKV+VFD++ ADKAR +M  A K S + + G+   T G    + P+ G
Sbjct  113  NPKTAQLTIFYSGKVLVFDDYSADKARELMAFARKGSSKMSYGILSNTLG----ERPSPG  168

Query  758  AAV----VATSTPVD  790
            A V     +TSTP D
Sbjct  169  AVVAPTLASTSTPRD  183



>gb|AAM64554.1| unknown [Arabidopsis thaliana]
Length=249

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 90/265 (34%), Positives = 124/265 (47%), Gaps = 45/265 (17%)
 Frame = +2

Query  269   ISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGT---TMDFL  439
              SGR P   +F QTC  LS++LK + S  DLS G+       + K D++ G+   TM  L
Sbjct  11    FSGRKP---SFSQTCTRLSRYLKDKGSFGDLSLGM-------TCKPDVNGGSRQPTMMNL  60

Query  440   TNIEKSTQDQEMAPIDPNPQNTV-----------NGTSRTVEEGTNAAASISkeapkeap  586
                E S  D      D  P+              +GT   V+       S+  E+     
Sbjct  61    FPCEASGMDSSAGQEDIKPKTMFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAP-  119

Query  587   kaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAV  766
                 LTIFY G+VMVFD+F A+KA+ V+ LA+K S +S      TA V+          +
Sbjct  120   ----LTIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKSFTCF--TAEVNNNHSAYSQKEI  173

Query  767   VATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRK  946
              ++  PV  P   A+  P+ P P                   +LPIARR+SLHRFLEKRK
Sbjct  174   ASSPNPVCSPAKTAAQEPIQPKPASL--------------ACELPIARRASLHRFLEKRK  219

Query  947   DRATARAPYQVHNNPLIPSKSERPS  1021
             DR T++APYQ+  +    SK   P+
Sbjct  220   DRITSKAPYQIDGSAEASSKPTNPA  244



>ref|XP_007135415.1| hypothetical protein PHAVU_010G127400g [Phaseolus vulgaris]
 gb|ESW07409.1| hypothetical protein PHAVU_010G127400g [Phaseolus vulgaris]
Length=234

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 84/260 (32%), Positives = 117/260 (45%), Gaps = 67/260 (26%)
 Frame = +2

Query  248  HLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHG-IGVVNTEAS-----GKFD  409
            + +S+ + SG+APEKS+F QTC+LLSQFLK + +  D + G +G +  +AS     G   
Sbjct  6    NTVSEARRSGKAPEKSSFSQTCSLLSQFLKEKRASGDSTLGMVGKMEPKASTKDLFGSLQ  65

Query  410  ISHG------TTMDFLTNIEKSTQDQEMAPIDPNPQ-NTVNGTSRTVEEGTNAAASISke  568
             S G      + MDFL  + +            NP     N +S +V E           
Sbjct  66   NSDGALKLSASAMDFLPQLVE------------NPCIKKSNLSSSSVPE-----------  102

Query  569  apkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLP  748
                   + Q+TIFY+GK++VFD FP +KA  VM LA+                 KL   
Sbjct  103  -------SPQMTIFYAGKMLVFDAFPPEKATEVMELAT-----------------KLASD  138

Query  749  ADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHR  928
              GA     S PV   +   +  P       P              GSD+   RR+SL +
Sbjct  139  TSGAEETPPSGPVTTKELAEAKVPQTNTSETPKLGSQGV-------GSDMRYPRRASLLK  191

Query  929  FLEKRKDRATARAPYQVHNN  988
            FLEKRK+R  AR PYQ++N 
Sbjct  192  FLEKRKERVIARGPYQMNNQ  211



>ref|NP_565096.1| protein TIFY 10B [Arabidopsis thaliana]
 sp|Q9S7M2.1|TI10B_ARATH RecName: Full=Protein TIFY 10B; AltName: Full=Jasmonate ZIM domain-containing 
protein 2 [Arabidopsis thaliana]
 gb|AAD55281.1|AC008263_12 ESTs gb|T75898, gb|R65457, gb|AA597517 and gb|AA597420 come from 
this gene [Arabidopsis thaliana]
 gb|AAG51928.1|AC013258_22 unknown protein; 53109-54448 [Arabidopsis thaliana]
 gb|AAK06870.1|AF344319_1 unknown protein [Arabidopsis thaliana]
 gb|AAK62404.1|AF386959_1 Unknown protein [Arabidopsis thaliana]
 gb|AAP13409.1| At1g74950 [Arabidopsis thaliana]
 gb|AEE35654.1| protein TIFY 10B [Arabidopsis thaliana]
Length=249

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 126/260 (48%), Gaps = 35/260 (13%)
 Frame = +2

Query  269   ISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGT---TMDFL  439
              SGR P   +F QTC  LS++LK + S  DLS G+       + K D++ G+   TM  L
Sbjct  11    FSGRKP---SFSQTCTRLSRYLKEKGSFGDLSLGM-------TCKPDVNGGSRQPTMMNL  60

Query  440   TNIEKSTQDQEMAPIDPNPQNTV---NGTSRTVEEGTNAAASISkeapkeapkaaQ---L  601
                E S  D      D  P+      +  S +   GT     + KE  K     +Q   L
Sbjct  61    FPCEASGMDSSAGQEDIKPKTMFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAPL  120

Query  602   TIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATST  781
             TIFY G+VMVFD+F A+KA+ V+ LA+K S +S      TA V+          + ++  
Sbjct  121   TIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKSFTCF--TAEVNNNHSAYSQKEIASSPN  178

Query  782   PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATA  961
             PV  P   A+  P+ P P                   +LPIARR+SLHRFLEKRKDR T+
Sbjct  179   PVCSPAKTAAQEPIQPNPASL--------------ACELPIARRASLHRFLEKRKDRITS  224

Query  962   RAPYQVHNNPLIPSKSERPS  1021
             +APYQ+  +    SK   P+
Sbjct  225   KAPYQIDGSAEASSKPTNPA  244



>ref|XP_011093866.1| PREDICTED: protein TIFY 10A-like isoform X3 [Sesamum indicum]
Length=225

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 120/241 (50%), Gaps = 46/241 (19%)
 Frame = +2

Query  257  SDVKISGR-APEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGV-VNTEASGKFDISHGTTM  430
            S++  SGR +  +SNF +TC+LLSQ+LK + S  DL+ G+   + T+A    +     T 
Sbjct  4    SEIVDSGRFSGGRSNFSRTCSLLSQYLKEKGSFGDLTLGLAHNLETKAGAPTE-----TK  58

Query  431  DFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIF  610
            + L  IEKS +      ++ +P       +++   GT   A  +           Q+TIF
Sbjct  59   NLLPMIEKSGRSSGPGNLN-SPPTRDEILNKSDLSGTKPEAETA-----------QMTIF  106

Query  611  YSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVD  790
            Y+G+V+VFD+FPA+KAR +M+LAS +             V  L  PA+    V  +  + 
Sbjct  107  YAGQVLVFDDFPAEKAREIMMLASSAQNHP------NPTVAPLQSPAESTTNVVPTFAIQ  160

Query  791  ppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAP  970
                 ++ PPL                      SDLPIAR++SL RFLEKRKDR TA AP
Sbjct  161  ERPLHSARPPLD---------------------SDLPIARKNSLARFLEKRKDRITANAP  199

Query  971  Y  973
            Y
Sbjct  200  Y  200



>ref|XP_008462277.1| PREDICTED: protein TIFY 10B-like [Cucumis melo]
Length=300

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 118/263 (45%), Gaps = 59/263 (22%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQDQ  469
            KSNF QTCNLLSQFLK + ++ DLS  +     +A  + + +          +  ST   
Sbjct  25   KSNFAQTCNLLSQFLKEKRTLVDLSSDMAP-RKKARDELEKAKPPPPPPSLPLPPSTT--  81

Query  470  EMAPIDPNPQNTVNGT--SRTVEEG------------TNAAASISk--eapkeapkaaQL  601
                      NT N +  SR  ++G            +N A + S+  +     P  AQ+
Sbjct  82   ----------NTDNSSDASRQQKDGLPKFVGFPSSGFSNNAINKSEFRKPATPEPTTAQM  131

Query  602  TIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARG------------VFQTAGVDKLDL  745
            TIFY+GKV+V+D+FP ++A+ +M LA K S  S               +F        + 
Sbjct  132  TIFYAGKVLVYDDFPNERAKEIMALADKGSRGSTTTAAAPPAAVAPNRLFSALEKPNSNS  191

Query  746  PADGAAVVA-TSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSL  922
            P     VV+ T  PV P       P                        SDLPIARR+SL
Sbjct  192  PTGEPNVVSKTPAPVKPAPEQQLKPQTEVKK-----------------SSDLPIARRASL  234

Query  923  HRFLEKRKDRATARAPYQVHNNP  991
            HRFLEKRKDRA  RAPYQV+  P
Sbjct  235  HRFLEKRKDRAVIRAPYQVNQQP  257



>emb|CDX73127.1| BnaC06g35750D [Brassica napus]
Length=245

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 82/237 (35%), Positives = 126/237 (53%), Gaps = 35/237 (15%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGT-TMDFLTNIEKSTQ  463
            +K +F QTC+ LS++LK + S  DLS G+       +G F ++    TM  L  +E S+ 
Sbjct  20   KKPSFSQTCSRLSRYLKEKGSFGDLSLGMT-----CNGVFGVTRQQPTMMNLFPVEDSSD  74

Query  464  DQEMAPIDPN----PQNTVNGTSRTVEEGT-NAAASISkeapkeapkaaQLTIFYSGKVM  628
             ++   + P       ++ +G    VE+ T N +  +  ++         LTIFY G+VM
Sbjct  75   VKQKNDVFPRQSSFSSSSSSGAKEEVEKITENESVKVESQSSAP------LTIFYGGQVM  128

Query  629  VFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpma  808
            VFD+FPA+KA+ V+ LA K S +S      TA +++ +  A     +A++TPV  P P+ 
Sbjct  129  VFDDFPAEKAKQVIDLAHKVSAKSF-----TAEMNR-NQSAYTHKEIASTTPVPVPSPVK  182

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
            +  P P                      +LPIARR+SLHRFLEKRKDR +++APYQ+
Sbjct  183  TAAPEPIQTHKSSL------------ACELPIARRASLHRFLEKRKDRISSKAPYQI  227



>ref|XP_006305530.1| hypothetical protein CARUB_v10010018mg [Capsella rubella]
 gb|EOA38428.1| hypothetical protein CARUB_v10010018mg [Capsella rubella]
Length=268

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 118/267 (44%), Gaps = 76/267 (28%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS-HGTTMDFLTNIEKSTQD  466
            K++F QTC+ LSQ+LK   S  DL+ G+     + +G    S   TT   L   E S  D
Sbjct  16   KASFSQTCSRLSQYLKENGSFGDLTLGMAC-KPDVNGTLGNSRQPTTTMSLFPCEASNMD  74

Query  467  QEMAPIDPNPQNTV-----------NGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
              MA  D  P+N             +   + V + T A  S+  E+         LTIFY
Sbjct  75   SSMAAQDVKPKNMFPRQSSFSSSSTSVPKQDVLKTTQATRSVKPESQTAP-----LTIFY  129

Query  614  SGKVMVFDEFPADKARAVMLLASKSSPQSARG----------------VFQTAGVDKLDL  745
            +G+V+VF++F ADKA+ VM LASK +  S  G                  QT+ V    +
Sbjct  130  AGQVIVFNDFSADKAKEVMNLASKGTANSFTGFTSNLNNNNNSQSLAKTTQTSNVVVATI  189

Query  746  P---------ADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDL  898
            P         A    V+++STP+                                   +L
Sbjct  190  PSQIPHPKKTATQEPVLSSSTPMT---------------------------------CEL  216

Query  899  PIARRSSLHRFLEKRKDRATARAPYQV  979
            PIARR+SLHRFLEKRKDR T++APYQ+
Sbjct  217  PIARRASLHRFLEKRKDRVTSKAPYQL  243



>ref|XP_010939885.1| PREDICTED: protein TIFY 10B-like [Elaeis guineensis]
Length=257

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 81/241 (34%), Positives = 112/241 (46%), Gaps = 33/241 (14%)
 Frame = +2

Query  278  RAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTE-ASGKFD-ISHGTTMDFL--TN  445
            R+  KSNF   C+LLSQ++K +  I DL  G+     E A GK +     TT+ FL   +
Sbjct  11   RSGAKSNFAVACSLLSQYVKEKGRIADLGLGMAPRPQETAIGKAEPFRPPTTISFLPGAD  70

Query  446  IEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKV  625
            I    + +     D +P N   G      +                P+ AQLTIFY GKV
Sbjct  71   ISGDGEGEMTGNNDVSPGNQRAGFGDVARKAP----------VVREPEKAQLTIFYGGKV  120

Query  626  MVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpm  805
            +VFD FPA+KA+ ++ +A K S  +A+       + K       +  +    P+      
Sbjct  121  LVFDNFPAEKAKDLLQMAGKGS-TNAQSFGYVPSITKATAALAQSNGLCKENPMSVVAQG  179

Query  806  asppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHN  985
             +  P  P                    SDLPIARR+SLHRFLEKRKDR  A+APYQV+ 
Sbjct  180  HAQKPAQPYA------------------SDLPIARRASLHRFLEKRKDRINAKAPYQVNG  221

Query  986  N  988
            +
Sbjct  222  S  222



>ref|NP_001050322.1| Os03g0402800 [Oryza sativa Japonica Group]
 gb|AAP03360.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF96480.1| ZIM motif family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF12236.1| Os03g0402800 [Oryza sativa Japonica Group]
 gb|EAZ27256.1| hypothetical protein OsJ_11194 [Oryza sativa Japonica Group]
 dbj|BAG88142.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94191.1| unnamed protein product [Oryza sativa Japonica Group]
Length=228

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 81/241 (34%), Positives = 111/241 (46%), Gaps = 52/241 (22%)
 Frame = +2

Query  293   SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGT-TMDFLTNIEKSTQDQ  469
             S+F   C+LLS++      +R      G +     G+ D + G  TM+            
Sbjct  12    SSFAMACSLLSRY------VRQNGAAAGELGLGIRGEADANKGKETMELF----------  55

Query  470   EMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPA  649
                     PQN+  G+          AA++ +       +  QLTIFY GKV+VFD+FPA
Sbjct  56    --------PQNSGFGSE---------AAAVKETPDAREQEKRQLTIFYGGKVLVFDDFPA  98

Query  650   DKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasppplpp  829
             +KA+ +M +ASKSS  +   V          LP+   A VA +T V           +P 
Sbjct  99    EKAKDLMQMASKSSSTAQNCVL---------LPSSATATVADNTKV---------SAVPA  140

Query  830   ppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPLIPSKS  1009
             P    P   A A     P  +DLP AR++SLHRFLEKRKDR  A+APYQ   +   P K 
Sbjct  141   PASALPVAQANAPKPVRPNAADLPQARKASLHRFLEKRKDRLQAKAPYQGSPSDASPVKK  200

Query  1010  E  1012
             E
Sbjct  201   E  201



>ref|XP_009391723.1| PREDICTED: protein TIFY 10B-like [Musa acuminata subsp. malaccensis]
Length=230

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 72/250 (29%), Positives = 106/250 (42%), Gaps = 57/250 (23%)
 Frame = +2

Query  266  KISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTE-ASGKFDIS-------HG  421
            K+  R  + S F  TCNLLSQ+LK +        G G +  + AS   D+        + 
Sbjct  4    KMGKRWEKGSQFSVTCNLLSQYLKEK-------GGFGSIGLDIASRPLDLHRPKDKHRNP  56

Query  422  TTMDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQL  601
            TT+  +  ++   +D ++   +  P++  +              S+      +  + +QL
Sbjct  57   TTLSLMPGVDVPPEDDDVTDHETAPKSMED--------------SLKTPPVIKEVEKSQL  102

Query  602  TIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATST  781
            TIFY GKV+VFD+FP DK R +M +A            + A    L  PA     +  S 
Sbjct  103  TIFYGGKVLVFDDFPGDKVRDLMQMAGN----------EIAATKNLSFPAPPPTSILASA  152

Query  782  PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATA  961
                                    P           SD+PIAR++SLHRFLEKRKDR + 
Sbjct  153  ------------------SSWQEPPPGLPTPAQANASDMPIARKNSLHRFLEKRKDRIST  194

Query  962  RAPYQVHNNP  991
            +APYQ H  P
Sbjct  195  KAPYQAHGAP  204



>ref|XP_004141716.1| PREDICTED: protein TIFY 10B-like [Cucumis sativus]
 gb|KGN45470.1| hypothetical protein Csa_7G448810 [Cucumis sativus]
Length=295

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 84/254 (33%), Positives = 112/254 (44%), Gaps = 34/254 (13%)
 Frame = +2

Query  290   KSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNT-----EASGKFDISHGTTMDFLTNIEK  454
             KSNF QTCNLLSQFLK + ++ DLS  +          E +        +T +   + + 
Sbjct  25    KSNFAQTCNLLSQFLKEKRTLVDLSADMAPRKKPRDELEKAKPPLPLPPSTANTDNSSDA  84

Query  455   STQDQEMAP---------IDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTI  607
             S Q ++  P            N  N          E T A                Q+TI
Sbjct  85    SRQQKDTLPKFVGFPSSGFFSNAINKGEFRKPATPEPTTA----------------QMTI  128

Query  608   FYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPV  787
             FY+GKV+V+D+FP  +A+ +M LA K S    RG   TA      +  +        +  
Sbjct  129   FYAGKVLVYDDFPNQRAKEIMALADKGS----RGSTTTAAASPAAVTPNRFFSALEKSNS  184

Query  788   DppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARA  967
             + P    +     P PV    +            SDLPIARR+SLHRFLEKRKDRA  RA
Sbjct  185   NSPTCEPNVVSKTPAPVKAAPEQQLKPQTEVKKSSDLPIARRASLHRFLEKRKDRAVIRA  244

Query  968   PYQVHNNPLIPSKS  1009
             PYQV+  P   SK+
Sbjct  245   PYQVNQQPESASKA  258



>gb|KFK41933.1| hypothetical protein AALP_AA2G190600 [Arabis alpina]
Length=242

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 86/248 (35%), Positives = 122/248 (49%), Gaps = 31/248 (13%)
 Frame = +2

Query  242  GKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHG  421
            GK LL          +K +F QTC+ LS++LK   S  DLS G+       +G   +S  
Sbjct  12   GKRLLE---------KKPSFSQTCSRLSRYLKENGSFGDLSLGMTCKPDVTTGGVAVSRQ  62

Query  422  TTMDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASI--Skeapkeapkaa  595
             TM  L   E +  D  +A  D  P+   + +S +         +I  +K   K   ++A
Sbjct  63   PTMMNLFPCEATAMDS-LAVQDVKPKRESSFSSSSSSGTKEEVVTIKETKSVVKMESQSA  121

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
             LTIFY G+VMVF+EF A+KA+ ++ LA+K S +S       A V+          +V+ 
Sbjct  122  PLTIFYGGQVMVFNEFSAEKAKEIIDLANKGSVKSF-----AAEVNNNQPAYTQKEIVSC  176

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
            + PV  P   A   P+ P P                   +LPIARR+SLHRFLEKRKDR 
Sbjct  177  ANPVRSPAKTAVQEPIKPNPSSL--------------ACELPIARRASLHRFLEKRKDRI  222

Query  956  TARAPYQV  979
            T++APYQ+
Sbjct  223  TSKAPYQI  230



>ref|XP_009106151.1| PREDICTED: protein TIFY 10B [Brassica rapa]
Length=245

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 123/235 (52%), Gaps = 31/235 (13%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQD  466
            +K +F QTC+ LS++LK + S  DLS G+    T   G        TM  L  +E S+  
Sbjct  20   KKPSFSQTCSRLSRYLKEKGSFGDLSLGM----TCNGGLAVTRQQPTMMNLFPVEDSSDV  75

Query  467  QEMAPIDPN----PQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVF  634
            ++   + P       ++ +G    VE+ T      +K    E+  +  LTIFY G+VMVF
Sbjct  76   KQKNDVIPRQLSFSSSSSSGAKEEVEKITE-----TKSVKVESQSSVPLTIFYGGQVMVF  130

Query  635  DEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasp  814
            D+FPA+KA+ V+ LA K S +S      TA +++ +  A     +A++TPV  P P+ + 
Sbjct  131  DDFPAEKAKQVIDLAHKGSAKSF-----TAELNR-NQSAYTQKEIASTTPVPVPSPVKTT  184

Query  815  pplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
             P P                      +LPIARR+SLHRFLEKRKDR +++APYQ+
Sbjct  185  APEPTQTNKSSL------------ACELPIARRASLHRFLEKRKDRISSKAPYQI  227



>gb|KHN07885.1| Protein TIFY 10A [Glycine soja]
Length=242

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 117/253 (46%), Gaps = 55/253 (22%)
 Frame = +2

Query  269  ISGRAP-----EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVV-NTEASGKFDISHGTTM  430
             SG  P     EKS F QTC+LLSQ++K + +  DL+ G+     T  S +      TTM
Sbjct  10   FSGHHPANSPAEKSTFSQTCSLLSQYIKEKGTFGDLTLGMTCTAETNGSPETSCHSATTM  69

Query  431  DFLTNI---EKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQL  601
            +    I      T    ++P    P ++         E      S + ++ ++ PKAAQL
Sbjct  70   ELFPTIITQRNPTTVDFLSPQTAYPHHS---------EVPTMVKSSAFKSMEKEPKAAQL  120

Query  602  TIFYSGKVMVFDEFPADKARAVMLLASKSSPQSAR-GVFQTAGVDKLDLPA--DGAAVVA  772
            TIFY+G+V+VFD+FPA+K   +  LA K   QS     +      +++ P+     +  A
Sbjct  121  TIFYAGQVVVFDDFPAEKLEEITSLAGKGISQSQNTSAYAHTHNQQVNHPSFVPNISPQA  180

Query  773  TSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDR  952
             S P+                                   DLPIAR++SLHRFL KRKDR
Sbjct  181  PSRPL---------------------------------VCDLPIARKASLHRFLSKRKDR  207

Query  953  ATARAPYQVHNNP  991
              A+APYQ+ NNP
Sbjct  208  IAAKAPYQI-NNP  219



>emb|CDY45408.1| BnaA07g31880D [Brassica napus]
Length=245

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 123/235 (52%), Gaps = 31/235 (13%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQD  466
            +K +F QTC+ LS++LK + S  DLS G+    T   G        TM  L  +E S+  
Sbjct  20   KKPSFSQTCSRLSRYLKEKGSFGDLSLGM----TCNGGLAVTRQQPTMMNLFPVEDSSDV  75

Query  467  QEMAPIDPN----PQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVF  634
            ++   + P       ++ +G    VE+ T      +K    E+  +  LTIFY G+VMVF
Sbjct  76   KQKNDVIPRQSSFSSSSSSGAKEEVEKITE-----TKSVKVESQSSVPLTIFYGGQVMVF  130

Query  635  DEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasp  814
            D+FPA+KA+ V+ LA K S +S      TA +++ +  A     +A++TPV  P P+ + 
Sbjct  131  DDFPAEKAKQVIDLAHKGSAKSF-----TAELNR-NQSAYTQKEIASTTPVPVPSPVKTT  184

Query  815  pplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
             P P                      +LPIARR+SLHRFLEKRKDR +++APYQ+
Sbjct  185  APEPTQTNKSSL------------ACELPIARRASLHRFLEKRKDRISSKAPYQI  227



>ref|XP_010932384.1| PREDICTED: protein TIFY 10B [Elaeis guineensis]
Length=272

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 79/240 (33%), Positives = 111/240 (46%), Gaps = 29/240 (12%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQDQ  469
            KS+F  TC+ LSQ+LK   S   +S  I     E + K  I   TTM  +  +  S +D 
Sbjct  15   KSSFSVTCSRLSQYLKENGSFGGISLSITPRPLEQA-KGIILAPTTMSLMPGVAMSAEDH  73

Query  470  EMAPIDPNPQNTVN------GTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMV  631
                 D NP  +++      G    V      ++  S    +      QLTIFYSGKV+V
Sbjct  74   SQNGSDQNPPKSMDLFPQHAGFDSPVAPAKKESSVASHNNKEPEKN--QLTIFYSGKVLV  131

Query  632  FDEFPADKARAVMLLASKSS--PQSARGVF-QTAGVDKLDLPADGAAVVATSTPVDppkp  802
            FD FPA+K   +M +A K S  P++   +   T     +DL     + +A+++       
Sbjct  132  FDNFPAEKVEDLMQMAGKESLVPENLGFITPSTTTAATVDLSHQHRSNIASTS-------  184

Query  803  masppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVH  982
                         P     +         SD+PIARR+SLHRFLEKRKDR T +APYQV+
Sbjct  185  ----------DSQPLMLQNSIPKPTQANASDMPIARRNSLHRFLEKRKDRITTKAPYQVN  234



>gb|EMT31100.1| hypothetical protein F775_32173 [Aegilops tauschii]
Length=231

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 72/141 (51%), Gaps = 26/141 (18%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLASKSSP--QSARGVFQTAGVDKLDLPADGAAVV  769
             QLTIFY GKV+VF++FPADKA+ +M LA K SP  Q+       A  DK+       A  
Sbjct  96    QLTIFYGGKVLVFNDFPADKAKGLMQLAGKGSPVVQNVSATTTAADTDKVQTAVLAPASS  155

Query  770   ATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKD  949
               + PVD                        A     P  SDLPIAR++SLHRFLEKRKD
Sbjct  156   LPTGPVD------------------------APKPARPNASDLPIARKASLHRFLEKRKD  191

Query  950   RATARAPYQVHNNPLIPSKSE  1012
             R  A+APYQ   +   P K E
Sbjct  192   RLHAKAPYQAPPSDATPVKKE  212



>ref|XP_006600152.1| PREDICTED: uncharacterized protein LOC100527510 isoform X1 [Glycine 
max]
 gb|KHN17738.1| Protein TIFY 10A [Glycine soja]
Length=242

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 111/245 (45%), Gaps = 56/245 (23%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRVSIRDLSHGIG-VVNTEASGKFDISHGTTMDFLTNIEKSTQ  463
            EKS F QTC+LLSQ++K + +  DL+ G+    +T  S +      TTM+    I K   
Sbjct  21   EKSTFSQTCSLLSQYIKEKGAFGDLTLGMTRTPDTYGSPETSCHSATTMELFPTIIKQRN  80

Query  464  DQEMAPIDPN---------PQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYS  616
               +  + P          P    +   +++E+   AA               QLTIFY+
Sbjct  81   PTTVDFLSPQSAYPHHSEVPTMVKSSAFKSIEKEPKAA---------------QLTIFYA  125

Query  617  GKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDpp  796
            G+V+VFD+FPA+K   +M LA K   QS      +A     +   +  + V   +P  P 
Sbjct  126  GQVVVFDDFPAEKLEEIMSLAGKGISQSQN---TSACAHTHNQQGNHPSFVPNVSPQAPS  182

Query  797  kpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
            +P+                             +LPIAR+ SLHRFL KRKDR  ++APYQ
Sbjct  183  RPIV---------------------------CELPIARKVSLHRFLSKRKDRIASKAPYQ  215

Query  977  VHNNP  991
            + NNP
Sbjct  216  I-NNP  219



>ref|XP_002888878.1| hypothetical protein ARALYDRAFT_476379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65137.1| hypothetical protein ARALYDRAFT_476379 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 113/244 (46%), Gaps = 33/244 (14%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIG-VVNTEASGKFDISHGTTMDFLTNI  448
            +G+  EKSNF Q C+LLS++LK + S  +++ G+  + + E +GKFD+          N+
Sbjct  4    TGQGQEKSNFSQRCSLLSRYLKEKGSFGNINMGLARISDLELAGKFDLKG------QQNV  57

Query  449  EKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeap---kaaQLTIFYSG  619
             K  + +    I    + +V   S +     N A  +    P++       +QLTIF+ G
Sbjct  58   IKKAETRPFEVIQKLSERSVCEASTS---SGNKAIYVDLSEPEKVVPKPGNSQLTIFFGG  114

Query  620  KVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVA-TSTPVDpp  796
            KVMVF+EFP DKA  +M +A +++  +      T     LD+      V+   + P    
Sbjct  115  KVMVFNEFPEDKANEIMEVAKEANHVAVDSKKNTQSHMNLDMNNKSNVVIPDLNEPTSSG  174

Query  797  kpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
                         V                     IARR+SLHRF  KRKDRA ARAPYQ
Sbjct  175  NNEDQETGQQHQLVER-------------------IARRASLHRFFAKRKDRAVARAPYQ  215

Query  977  VHNN  988
            V+ N
Sbjct  216  VNQN  219



>gb|KHG06931.1| Protein TIFY 11B -like protein [Gossypium arboreum]
Length=270

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 117/245 (48%), Gaps = 24/245 (10%)
 Frame = +2

Query  278  RAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKS  457
            ++P++++FV   NLLSQ+LK + ++ D S G+         +        M+FL+N+   
Sbjct  7    KSPDRASFV---NLLSQYLKEKRNLGDFSLGMTSKPDAKGLETSRQQAKNMNFLSNMPNC  63

Query  458  TQDQE---------MAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIF  610
            ++            +   D  PQ      S + E+  N    +  ++    PK AQLTIF
Sbjct  64   SESSRPNLVASTSNVKSSDFFPQIGSFCASSSKEDTINKTDFM--KSAAVEPKNAQLTIF  121

Query  611  YSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVD  790
            + G+V+V+++FPADK + +M +A++    +  GV   + ++KL+   D     +   P  
Sbjct  122  FGGQVLVYNDFPADKVKEIMAVANRGWSTACSGVVADSSMEKLNANLDKIDYSSPHIP--  179

Query  791  ppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAP  970
                               +    +       GSDL IARR+SLH+F EKRKDRA  RAP
Sbjct  180  --------DLNITSATVNSSAQDPSVERHQYVGSDLRIARRNSLHKFFEKRKDRAAMRAP  231

Query  971  YQVHN  985
            YQ+ N
Sbjct  232  YQLIN  236



>ref|XP_003542368.1| PREDICTED: protein TIFY 10A-like [Glycine max]
Length=242

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 80/259 (31%), Positives = 116/259 (45%), Gaps = 67/259 (26%)
 Frame = +2

Query  269  ISGRAP-----EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVV-NTEASGKFDISHGTTM  430
             SG  P     EKS F QTC+LLSQ++K + +  DL+ G+     T  S +      TTM
Sbjct  10   FSGHHPANSPAEKSTFSQTCSLLSQYIKEKGTFGDLTLGMTCTAETNGSPETSCHSATTM  69

Query  431  DFLTNI---EKSTQDQEMAPIDPNPQNT-----VNGTS-RTVEEGTNAAASISkeapkea  583
            +    I      T    ++P    P ++     V  ++ +++E+   AA           
Sbjct  70   ELFPTIITQRNPTTVDFLSPQTAYPHHSEVPIMVKSSAFKSMEKEPKAA-----------  118

Query  584  pkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSAR-GVFQTAGVDKLDLPA--D  754
                QLTIFY+G+V+VFD+FPA+K   +  LA K   QS     +      +++ P+   
Sbjct  119  ----QLTIFYAGQVVVFDDFPAEKLEEITSLAGKGISQSQNTSAYAHTHNQQVNHPSFVP  174

Query  755  GAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFL  934
              +  A S P+                                   DLPIAR++SLHRFL
Sbjct  175  NISPQAPSRPL---------------------------------VCDLPIARKASLHRFL  201

Query  935  EKRKDRATARAPYQVHNNP  991
             KRKDR  A+APYQ+ NNP
Sbjct  202  SKRKDRIAAKAPYQI-NNP  219



>ref|NP_001276307.1| protein TIFY 10A-like [Glycine max]
 gb|ACU19759.1| unknown [Glycine max]
Length=240

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 113/248 (46%), Gaps = 62/248 (25%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVV-NTEASGKFDISHGTTMDFLTNI---EK  454
            EKS F QTC+LLSQ++K + +  DL+ G+     T  S +      TTM+    I     
Sbjct  21   EKSTFSQTCSLLSQYIKEKGTFGDLTLGMTCTAETNGSPETSCHSATTMELFPTIITQRN  80

Query  455  STQDQEMAPIDPNPQNT-----VNGTS-RTVEEGTNAAASISkeapkeapkaaQLTIFYS  616
             T    ++P    P ++     V  ++ +++E+   AA               QLTIFY+
Sbjct  81   PTTVDFLSPQTAYPHHSEVPIMVKSSAFKSMEKEPKAA---------------QLTIFYA  125

Query  617  GKVMVFDEFPADKARAVMLLASKSSPQSAR-GVFQTAGVDKLDLPA--DGAAVVATSTPV  787
            G+V+VFD+FPA+K   +  LA K   QS     +      +++ P+     +  A S P+
Sbjct  126  GQVVVFDDFPAEKLEEITSLAGKGISQSQNTSAYAHTHNQQVNHPSFVPNISPQAPSRPL  185

Query  788  DppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARA  967
                                               DLPIAR++SLHRFL KRKDR  A+A
Sbjct  186  ---------------------------------VCDLPIARKASLHRFLSKRKDRIAAKA  212

Query  968  PYQVHNNP  991
            PYQ+ NNP
Sbjct  213  PYQI-NNP  219



>ref|XP_009401532.1| PREDICTED: protein TIFY 10B-like [Musa acuminata subsp. malaccensis]
Length=250

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 115/253 (45%), Gaps = 51/253 (20%)
 Frame = +2

Query  263  VKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGV---VNTEASGKFDISHGTTMD  433
             ++ G+  EK+ F  T  LL Q+LK + S   +   I     ++ +   ++     TT+ 
Sbjct  2    AEMRGKRGEKTQFSITYGLLRQYLKEKGSFGSIGLDIMAPRPLHHQPHERYQSP--TTLS  59

Query  434  FLTNIEKSTQDQ------EMAP--IDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapk  589
             L  ++ ST+D       + AP  ++  PQ+     S  +     +A+SI     K   K
Sbjct  60   LLPGVDVSTEDHTNDGTHQTAPKSMELFPQHAAGFGSSVLPLKEESASSI-----KHTEK  114

Query  590  aaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVV  769
            ++QLTIFY GKV+VFD+FPADKA  ++ +A K S          +   K  LP   +   
Sbjct  115  SSQLTIFYGGKVLVFDDFPADKAIDLLQMAGKES----------SAAPKRGLPVPSSTNA  164

Query  770  ATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKD  949
            A S+                                    SD+PIAR++SLHRFLEKRKD
Sbjct  165  AESS-----------------------TQNGMPKPTQASASDMPIARKNSLHRFLEKRKD  201

Query  950  RATARAPYQVHNN  988
            R + +APYQ H  
Sbjct  202  RISTKAPYQAHGG  214



>ref|NP_001148852.1| pnFL-2 [Zea mays]
 gb|ACG33139.1| pnFL-2 [Zea mays]
Length=237

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 75/139 (54%), Gaps = 21/139 (15%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
             QLTIFY GKV+VFD+FPADKA+ +M LASK SP     V Q   + +   PA  AAV   
Sbjct  99    QLTIFYGGKVLVFDDFPADKAKDLMQLASKGSP-----VVQNVVLPQPSAPA--AAVTDK  151

Query  776   STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
             + PV              P +  P   A A        SD+PI R++SLHRFLEKRKDR 
Sbjct  152   AVPV--------------PVISLPAAQADAKKPTRTNASDMPIMRKASLHRFLEKRKDRL  197

Query  956   TARAPYQVHNNPLIPSKSE  1012
              A APYQ   +   P K E
Sbjct  198   NANAPYQTSPSDAAPVKKE  216



>ref|XP_007024679.1| Jasmonate-zim-domain protein 6, putative isoform 3 [Theobroma 
cacao]
 gb|EOY27301.1| Jasmonate-zim-domain protein 6, putative isoform 3 [Theobroma 
cacao]
Length=230

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 71/130 (55%), Gaps = 10/130 (8%)
 Frame = +2

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
            QLTIF+ G+V+V+++FPA+K + +M LAS+    +  GV   +G++K++   D      +
Sbjct  77   QLTIFFGGQVLVYNDFPAEKVKEIMALASQGCSTACAGVVTDSGMEKVNSNMDKINSSNS  136

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
              P                          +      GGSDL IARR+SLH+F EKRKDRA
Sbjct  137  DIP----------DLNIASTTGNSPDQDPSVERRQYGGSDLRIARRNSLHKFFEKRKDRA  186

Query  956  TARAPYQVHN  985
             ARAPYQV+N
Sbjct  187  AARAPYQVNN  196



>gb|EYU45897.1| hypothetical protein MIMGU_mgv1a013086mg [Erythranthe guttata]
Length=213

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 86/252 (34%), Positives = 111/252 (44%), Gaps = 61/252 (24%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS  415
            MSG   LS  +  G+ PEKSNF QTCNLLSQ++K + S+RDL       N E  GK    
Sbjct  1    MSGFRHLSGDRRRGKLPEKSNFAQTCNLLSQYIKDKGSLRDL-------NLEIGGK----  49

Query  416  HGTTMDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGT--NAAASISkeapkeapk  589
                ++ L NI                          V++G+  +   S    AP ++  
Sbjct  50   ----IESLENI--------------------------VKQGSFCHEFTSKDAAAPTDSAA  79

Query  590  aaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVV  769
            A QLTIFYSG V+VFD++PA+KA  ++  A+        G+       K   P+ G A  
Sbjct  80   AGQLTIFYSGGVLVFDDYPAEKAEELVAFAANG---GGSGILSNTSWAK---PSSGGA-A  132

Query  770  ATSTPVDppkpmasppplppppvppptqpaaaapap-----------apGGSDLPIARRS  916
             TSTP +   P                  +  A                  SDLPIARRS
Sbjct  133  ETSTPGESQLPPRPGSRKAAGVGITSNTASGGAAEVPPVENRGSTLPEANDSDLPIARRS  192

Query  917  SLHRFLEKRKDR  952
            SLHRFL KRKDR
Sbjct  193  SLHRFLGKRKDR  204



>ref|XP_003572804.1| PREDICTED: protein TIFY 10A-like [Brachypodium distachyon]
Length=235

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 83/252 (33%), Positives = 111/252 (44%), Gaps = 55/252 (22%)
 Frame = +2

Query  272   SGRAPEK-SNFVQTCNLLSQFLKGR-VSIRDLSHGI-GVVNTE--ASGKFDISHGTTMDF  436
             S RA E+ ++F   C+LLS+F++    +  +L  GI G   T+  A  + ++    TM+ 
Sbjct  4     SARAGERATSFTTACSLLSRFVRQNGAAAAELGLGIKGEAETQKAAGTEEEVGRKETMEL  63

Query  437   LTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYS  616
                          AP         + T+R  E+                    QLTIFY+
Sbjct  64    FPQSAGLGVQDAAAP---------DATTREQEKN-------------------QLTIFYN  95

Query  617   GKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDpp  796
             GKV+VF++FPADKA+ +M LASK SP                       V   STP    
Sbjct  96    GKVLVFNDFPADKAKGLMQLASKGSP----------------------IVPNVSTPTPVT  133

Query  797   kpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
                    P+  P    P     A     P  SDLPIAR++SLHRFLEKRKDR  A+APYQ
Sbjct  134   DSTKVQMPVLAPASSLPGAQVDAHKPAGPNASDLPIARKASLHRFLEKRKDRLHAKAPYQ  193

Query  977   VHNNPLIPSKSE  1012
                +   P K E
Sbjct  194   ASPSDATPVKKE  205



>ref|XP_008778980.1| PREDICTED: protein TIFY 10A-like [Phoenix dactylifera]
Length=270

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 86/240 (36%), Positives = 111/240 (46%), Gaps = 32/240 (13%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEAS-GKFD-ISHGTTMDFLTNIEKSTQ  463
            KSNF  TC+ LSQ++KG   I DL  G+     E + GK +     TTM FL   + S  
Sbjct  15   KSNFSLTCSRLSQYIKGNGRIADLGLGMAPRPQETTIGKAEAFRPPTTMCFLPGADISGA  74

Query  464  DQEMAPIDPNPQNTVNGTSR-----TVEEGTNAAASISkeapkeapkaaQLTIFYSGKVM  628
             +    +D       +G SR        +         K +    P+  QLTIFY G+V+
Sbjct  75   AERETAVD-------DGFSRGNAMELFPQSAGFGDVARKTSAVREPEKGQLTIFYGGRVL  127

Query  629  VFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpma  808
            VFD FPA+KA  +M +ASK S  +     Q  G      P    A  A + P    K   
Sbjct  128  VFDHFPAEKAEDLMQMASKGSSNA-----QNFGY----APPSAKATEALAHPNGLRKENP  178

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNN  988
             P  +       P QP           SDLPIAR+ SL RFLEKRKDR  A+APYQV+ +
Sbjct  179  VPSAVARGHAQKPAQPYV---------SDLPIARKESLRRFLEKRKDRVNAKAPYQVNGS  229



>gb|KFK44057.1| hypothetical protein AALP_AA1G210400 [Arabis alpina]
Length=282

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 82/267 (31%), Positives = 126/267 (47%), Gaps = 32/267 (12%)
 Frame = +2

Query  233  NMSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDI  412
            +M    L+ + + SG    K +F  TC  LSQ+LK   S  DLS GI      ++  F I
Sbjct  4    SMECSELMGNRRFSG----KKSFSLTCTRLSQYLKENGSFGDLSLGIACKPESSNATFGI  59

Query  413  SH--GTTMDFL----TNIEKSTQDQEMAPIDPNP-QNTVNGTSRTVEEGTNAAASISkea  571
            S    TTM       +N+E     +++ P +  P Q++ + +S +V +      + +   
Sbjct  60   SRQPTTTMSLFPCEASNVESMAATEDVKPKELFPRQSSFSSSSSSVPKEHVLKMTPTTTT  119

Query  572  pkeapkaaQ---LTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTA------  724
             +     +Q   LTIFY+G+V+VF+EF A+KA+ ++ LASK +  S  G           
Sbjct  120  TRSVKPESQTAPLTIFYAGQVIVFNEFSAEKAKEIINLASKGTANSFTGFTSNLNNNSNN  179

Query  725  --GVDKLDLPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDL  898
               V   +L  +   + ++  P+    P         P     T              +L
Sbjct  180  IQSVYTPNLTKNQTEIRSSIAPIANQVPHFMKNTTQEPIQSTATPM----------SCEL  229

Query  899  PIARRSSLHRFLEKRKDRATARAPYQV  979
            PIARR+SLHRFLEKRKDR T++APYQ+
Sbjct  230  PIARRASLHRFLEKRKDRVTSKAPYQL  256



>ref|NP_001237073.1| uncharacterized protein LOC100527510 [Glycine max]
 gb|ACU16606.1| unknown [Glycine max]
Length=247

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 111/245 (45%), Gaps = 56/245 (23%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRVSIRDLSHGIG-VVNTEASGKFDISHGTTMDFLTNIEKSTQ  463
            EKS F QTC+LLS+++K + +  DL+ G+    +T  S +      TTM+    I K   
Sbjct  21   EKSTFSQTCSLLSRYIKEKGAFGDLTLGMTRTPDTYGSPETSCHSATTMELFPTIIKQRN  80

Query  464  DQEMAPIDPN---------PQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYS  616
               +  + P          P    +   +++E+   AA               QLTIFY+
Sbjct  81   PTTVDFLSPQSAYPHHSEVPTMVKSSAFKSIEKEPKAA---------------QLTIFYA  125

Query  617  GKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDpp  796
            G+V+VFD+FPA+K   +M LA K   QS      +A     +   +  + V   +P  P 
Sbjct  126  GQVVVFDDFPAEKLEEIMSLAGKGISQSQN---TSACAHTHNQQGNHPSFVPNVSPQAPS  182

Query  797  kpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
            +P+                             +LPIAR+ SLHRFL KRKDR  ++APYQ
Sbjct  183  RPIV---------------------------CELPIARKVSLHRFLSKRKDRIASKAPYQ  215

Query  977  VHNNP  991
            + NNP
Sbjct  216  I-NNP  219



>gb|ACF88234.1| unknown [Zea mays]
 gb|ADX60189.1| TIFY transcription factor [Zea mays]
 tpg|DAA41436.1| TPA: putative tify domain/CCT motif transcription factor family 
protein [Zea mays]
Length=237

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 74/139 (53%), Gaps = 21/139 (15%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
             QLTIFY GKV+VFD+FPADKA+ +M LASK  P     V Q   + +   PA  AAV   
Sbjct  99    QLTIFYGGKVLVFDDFPADKAKDLMQLASKGGP-----VVQNVVLPQPSAPA--AAVTDK  151

Query  776   STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
             + PV              P +  P   A A        SD+PI R++SLHRFLEKRKDR 
Sbjct  152   AVPV--------------PVISLPAAQADAKKPTRTNASDMPIMRKASLHRFLEKRKDRL  197

Query  956   TARAPYQVHNNPLIPSKSE  1012
              A APYQ   +   P K E
Sbjct  198   NANAPYQTSPSDAAPVKKE  216



>emb|CDX81917.1| BnaC08g36840D [Brassica napus]
Length=508

 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 124/259 (48%), Gaps = 14/259 (5%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS  415
            MS     SD   + R   K +F QTC+ LSQ+LK   S  DLS G+     E +G     
Sbjct  1    MSSPMESSDFAATRRFSRKPSFSQTCSRLSQYLKENGSFGDLSLGMSC-KPEVNGIISRQ  59

Query  416  HGTTMDFL----TNIEKSTQD---QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeap  574
              TTM       +N+E   QD   + + P  P+  ++ +   +        A + S    
Sbjct  60   PTTTMSLFPCEASNMESIGQDVKPKNLFPRQPSFSSSSSSLPKEDILKMTQATTTSTRPV  119

Query  575  keapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPAD  754
            +  P+ A LTIFY G+V+VF++F A+KA+ VM LASK +  +  G   T+ V+    P  
Sbjct  120  RPEPQTAPLTIFYGGQVIVFNDFSAEKAKEVMDLASKGTANTFTGF--TSNVNNNIQPGY  177

Query  755  GAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFL  934
               +    T +                +       +++ A      +LPIARR+SLHRFL
Sbjct  178  ATNLANNQTEMRSNIAPIPNQLPRLMKITTQDPVQSSSTAM---ACELPIARRASLHRFL  234

Query  935  EKRKDRATARAPYQVHNNP  991
             KRKDR T++APYQ+ N+P
Sbjct  235  AKRKDRVTSKAPYQL-NDP  252



>ref|XP_002889001.1| hypothetical protein ARALYDRAFT_476633 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65260.1| hypothetical protein ARALYDRAFT_476633 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 117/236 (50%), Gaps = 21/236 (9%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQD-  466
            K +F QTC+ LS++LK + S  DL+ G+     + +G   +S   TM  L   E S  D 
Sbjct  14   KPSFSQTCSRLSRYLKEKGSFGDLTLGM-TCKPDLNGGVAVSRQPTMMNLFPCEASGMDS  72

Query  467  ---QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapke-apkaaQLTIFYSGKVMVF  634
               Q++ P +  P+ +   +S            I +    +   ++A LTIFY+G+VMVF
Sbjct  73   SAAQDIKPKNVFPRQSSFSSSSCSSGAKEDVHMIKETKSVKPESQSAPLTIFYAGRVMVF  132

Query  635  DEFPADKARAVMLLASKSSPQSARG-VFQTAGVDKLDLPADGAAVVATSTPVDppkpmas  811
            D+F A+KA+ V+ LA+K S +     V  +       L      + ++  PV  P   A+
Sbjct  133  DDFSAEKAKQVIDLANKGSSKGFTAEVNNSQSAYSQHLAKTQKEIASSPNPVYSPAKTAA  192

Query  812  ppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
               + P P                   +LPIARR+SLHRFLEKRKDR T++APYQ+
Sbjct  193  QESIQPNPASL--------------ACELPIARRASLHRFLEKRKDRITSKAPYQI  234



>ref|XP_009110295.1| PREDICTED: protein TIFY 10A-like [Brassica rapa]
Length=259

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 120/251 (48%), Gaps = 19/251 (8%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS  415
            MS     SD   + R   K +F  TC+ LSQ+LK   S  DLS G+     E +G     
Sbjct  2    MSSSMECSDSAATRRFSRKPSFSLTCSRLSQYLKENGSFGDLSLGMSC-KPEVNG-ISRQ  59

Query  416  HGTTMD-FLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapka  592
              TTM  F     +  + + + P  P+  ++ +   +  EE      + +  + +  P+ 
Sbjct  60   PTTTMSLFPCEAAQDVKPKNLFPRQPSFSSSSSSLPKK-EEVLKMTQTTTTRSVRPEPQT  118

Query  593  aQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVA  772
            A LTIFY+G+V+VF++F A+KA+ VM LASK +  S  G   T     ++LP     V  
Sbjct  119  APLTIFYNGEVIVFNDFSAEKAKEVMDLASKGTANSFTGFTST-----VNLPKYQTEVRT  173

Query  773  TSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDR  952
              +P                 +  P        + A    +LPIARR+SLHRFL KRKDR
Sbjct  174  NISPT----------LDQVTHLMKPAAQEPILSSSAAMACELPIARRASLHRFLAKRKDR  223

Query  953  ATARAPYQVHN  985
             T++APYQ+ +
Sbjct  224  VTSKAPYQLSD  234



>ref|XP_009388200.1| PREDICTED: protein TIFY 10B-like [Musa acuminata subsp. malaccensis]
Length=247

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 108/253 (43%), Gaps = 61/253 (24%)
 Frame = +2

Query  275  GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEK  454
            G   ++SNF QTC LL Q+LK + S+  L  GI +    A G+   +  TTM  L   + 
Sbjct  2    GSKGDESNFSQTCRLLRQYLKEKRSLSGL--GIDMAPVPAGGRSRTT--TTMSLLPGADV  57

Query  455  STQDQ-----EMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSG  619
              ++Q         +D  PQ++    S  + E                 +  QLTIFY+G
Sbjct  58   PGEEQTENKGSQKSMDLFPQHSGFEESGKISEAKQ-------------MEKGQLTIFYAG  104

Query  620  KVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGV------------DKLDLPADGAA  763
            K+MVFD+  A KA+ +M +A   S  + +  F                 D +   A G+ 
Sbjct  105  KMMVFDDILAAKAKDLMQMARNESIAAQKFRFSAPRAAAAGAASSPSKPDSVLAAASGSQ  164

Query  764  VVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKR  943
             +A  +P                                   SD+PIARR+SLHRFLEKR
Sbjct  165  SMAAPSP---------------------------DSPSKTSASDMPIARRNSLHRFLEKR  197

Query  944  KDRATARAPYQVH  982
            KDR   +APYQV+
Sbjct  198  KDRINTKAPYQVN  210



>ref|XP_002462448.1| hypothetical protein SORBIDRAFT_02g025720 [Sorghum bicolor]
 gb|EER98969.1| hypothetical protein SORBIDRAFT_02g025720 [Sorghum bicolor]
Length=221

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 80/259 (31%), Positives = 118/259 (46%), Gaps = 62/259 (24%)
 Frame = +2

Query  269   ISGRAP----EKSNFVQTCNLLSQFLKGRV--SIRDLSHGIGVVNTEASGKFDISHGTTM  430
             ++GRAP    +K++F  TC+LLSQ+LK +    ++ L          A         TTM
Sbjct  1     MAGRAPATARDKTSFAATCSLLSQYLKEKKDGGLQRLGGLAMAPAAGAGAG-GFRPPTTM  59

Query  431   DFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISke-apkeapkaaQLTI  607
             + L+ ++            P  + T +    TVEE  +   S +         +A QLTI
Sbjct  60    NLLSALDA-----------PAEEPTSDAAKATVEEPKDHHKSTAGNPREAAGDEAQQLTI  108

Query  608   FYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPV  787
             FY GKV+VFD+FP+ K + ++ + +              G D++D     A V   S P 
Sbjct  109   FYGGKVVVFDKFPSTKVKDLLQIMN-------------PGGDRVDRAGATATVPTQSLPT  155

Query  788   DppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARA  967
                  +                            SDLPIARR+SLHRFLEKRKDR TA+A
Sbjct  156   PSHNSL----------------------------SDLPIARRNSLHRFLEKRKDRITAKA  187

Query  968   PYQVHNNPLIPS--KSERP  1018
             PYQV+++  + +  K E+P
Sbjct  188   PYQVNSSAGVEASFKVEKP  206



>emb|CDX96675.1| BnaA08g22180D [Brassica napus]
Length=263

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 122/256 (48%), Gaps = 24/256 (9%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS  415
            MS     SD   + R   K +F  TC+ LSQ+LK   S  DLS G+     E +G  +  
Sbjct  1    MSSSMECSDSAAARRFSRKPSFSLTCSRLSQYLKENGSFGDLSLGMSC-KPEVNG--NSR  57

Query  416  HGTTMDFLTNIEKSTQD--QEMAPIDPNPQNTVNGTSRTV----EEGTNAAASISkeapk  577
              TT   L   E +  +  Q++ P +  P+     +S +     EE      + +  + K
Sbjct  58   QPTTTMSLFPCEAAPMETVQDVKPKNLFPRQPSFSSSSSSLPKKEEVLKMTQTTTTRSVK  117

Query  578  eapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADG  757
              P+ A LTIFY+G+V+VF++F A+KA+ VM LASK +  S  G   T     ++LP + 
Sbjct  118  PEPQTAPLTIFYNGEVIVFNDFSAEKAKEVMDLASKGTANSFTGFTST-----VNLPKNQ  172

Query  758  AAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLE  937
              V     P     P    P    P +                  +LPIARR+SLHRFL 
Sbjct  173  TKVRTNIAPTSNQVPHLMKPAAQEPILSSSAAM----------ACELPIARRASLHRFLA  222

Query  938  KRKDRATARAPYQVHN  985
            KRKDR T++APYQ+ +
Sbjct  223  KRKDRVTSKAPYQLSD  238



>gb|ACF84334.1| unknown [Zea mays]
 gb|ACF85706.1| unknown [Zea mays]
 tpg|DAA63594.1| TPA: putative tify domain/CCT motif transcription factor family 
protein [Zea mays]
Length=233

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 72/139 (52%), Gaps = 25/139 (18%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
             QLTIFY GKV+VFD+FPADKA+ +M LASK SP     V Q      L  P+  AAV   
Sbjct  99    QLTIFYGGKVLVFDDFPADKAKDLMQLASKGSP-----VVQNVA---LPQPSAAAAVTTD  150

Query  776   STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
                +D                 P    AAA        SD+PI R++SLHRFLEKRKDR 
Sbjct  151   KAVLD-----------------PVISLAAAKKPARTNASDMPIMRKASLHRFLEKRKDRL  193

Query  956   TARAPYQVHNNPLIPSKSE  1012
              A+ PYQ   +   P K E
Sbjct  194   NAKTPYQTAPSDAAPVKKE  212



>ref|NP_001239983.1| uncharacterized protein LOC100778559 [Glycine max]
 gb|ACU19697.1| unknown [Glycine max]
 gb|KHN01432.1| Protein TIFY 11B [Glycine soja]
Length=232

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 114/259 (44%), Gaps = 69/259 (27%)
 Frame = +2

Query  248  HLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIG-----VVNTEA-SGKFD  409
            + +++ + SG+APEKS F QTC+LLSQFLK + +  D + GIG       NT+A  G   
Sbjct  6    NTVAEGRRSGKAPEKSTFSQTCSLLSQFLKEKRASADSTLGIGGKMEPKANTKALLGSLQ  65

Query  410  ISHG------TTMDFLTN-IEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISke  568
             S G      + M+FL   +E     +  +P   +P                        
Sbjct  66   NSDGALKLSASAMEFLPQLVENPCIKKSRSPGPESP------------------------  101

Query  569  apkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLP  748
                     QLTIFY+GK++VFD FP +KA  VM +A+K +  ++ G  ++       LP
Sbjct  102  ---------QLTIFYAGKMLVFDAFPPEKATEVMEMATKLASNNS-GTEESPP----SLP  147

Query  749  ADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHR  928
                 +  +  P          P                       GSD+   RR+SL +
Sbjct  148  VTTEKLAVSKMPQTNTSSETPKPGNQGV------------------GSDMRYPRRASLLK  189

Query  929  FLEKRKDRATARAPYQVHN  985
            FLEKRK+R  AR PYQ++N
Sbjct  190  FLEKRKERVNARGPYQMNN  208



>gb|ACG35001.1| pnFL-2 [Zea mays]
Length=230

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 78/247 (32%), Positives = 116/247 (47%), Gaps = 52/247 (21%)
 Frame = +2

Query  269  ISGRAP----EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDF  436
            ++G AP    +K++F  TC+LLSQ++K +        G   +   A G+      TTM+ 
Sbjct  1    MAGSAPATAMDKTSFATTCSLLSQYVKEKKGGLLQGLGALAMAPAAGGEGAFRPPTTMNL  60

Query  437  LTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYS  616
            L+ ++        AP +   +    G  +  ++ T    S  + A +E  +A +LTIFY 
Sbjct  61   LSALDD-------APAEERSEKATAGEPKHQDKCTGGN-SREEAAGEEEEEAQRLTIFYG  112

Query  617  GKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDpp  796
            G+V+VFD FP+ K + ++ + S              G D +D  A GAAV   S P    
Sbjct  113  GRVVVFDMFPSAKVKDLLQIMSP-------------GGDGVDTAA-GAAVPTRSLPRPSA  158

Query  797  kpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
               +                           SDLPIARR+SLHRFLEKRKDR TA+APYQ
Sbjct  159  SHGSL--------------------------SDLPIARRNSLHRFLEKRKDRITAKAPYQ  192

Query  977  VHNNPLI  997
              N+ ++
Sbjct  193  QVNSSVV  199



>ref|XP_004958300.1| PREDICTED: protein TIFY 10B-like [Setaria italica]
Length=237

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 84/258 (33%), Positives = 110/258 (43%), Gaps = 54/258 (21%)
 Frame = +2

Query  272   SGRAPEK-SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHG-TTMDFLTN  445
             S R  EK ++F   C+LLS+F      +R        +     G+ +      TM  L  
Sbjct  4     SARPGEKATSFAMACSLLSRF------VRQNGPAAAELGLGMKGEAEPQRAPATMSLLPT  57

Query  446   IEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKV  625
              E    +++   ++  PQ+   G      E      S             QLTIFY GKV
Sbjct  58    AEAEEAERKKETMELFPQSAGFGVQDAAREPEKKDKS------------QQLTIFYGGKV  105

Query  626   MVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPA---DGAAV------VATS  778
             +VF++FPADKA+ +M LASK SP     V Q  G+ +   PA   D A V        +S
Sbjct  106   LVFNDFPADKAKDLMQLASKGSP-----VVQNVGLPQPSAPATVTDNAKVHKVMPAPVSS  160

Query  779   TPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRAT  958
              PV                     Q A A        SD+PIAR++SLHRFLEKRKDR  
Sbjct  161   LPV--------------------AQAADAQKPARTNASDMPIARKASLHRFLEKRKDRLN  200

Query  959   ARAPYQVHNNPLIPSKSE  1012
             A+ PYQ       P K E
Sbjct  201   AKTPYQTSPADAAPVKKE  218



>ref|XP_008784340.1| PREDICTED: protein TIFY 10B-like [Phoenix dactylifera]
Length=269

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 111/238 (47%), Gaps = 24/238 (10%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQD  466
            EKSNF  TC+ LS++LK + S  D+  G+     E   K  I   TTM  +  +  S + 
Sbjct  14   EKSNFSVTCSRLSRYLKEKGSFGDIGLGVAPRPLE-QAKGIIQAPTTMSLMPGVAVSAEG  72

Query  467  QEMAPID-PNPQNTVNGTSRTVEE--GTNAAASISkeapkeapkaaQLTIFYSGKVMVFD  637
                  D P+P++          +    +A    S  +  + P+  QLTIFY+GKV+V D
Sbjct  73   HAHNGSDQPSPKSMELFPQHAGFDSLAVSAKKESSVISHNKEPEKNQLTIFYAGKVLVLD  132

Query  638  EFPADKARAVMLLASKSSPQSARGVFQTAG---VDKLDLPADGAAVVATSTPVDppkpma  808
             FPA+K   +M +ASK S  +    F T       +L+     ++ +A ++         
Sbjct  133  NFPAEKVGDLMQMASKESLAAKNLSFTTPSSTTAARLEFSHQHSSNIACNS---------  183

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVH  982
                             +         SD+PIAR++SLHRFLEKRKDR + +APYQV+
Sbjct  184  --------GSQTLMLQDSMPKPAQANASDMPIARKNSLHRFLEKRKDRISTKAPYQVN  233



>ref|XP_004984081.1| PREDICTED: protein TIFY 10A-like [Setaria italica]
Length=229

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/251 (29%), Positives = 107/251 (43%), Gaps = 60/251 (24%)
 Frame = +2

Query  293   SNFVQTCNLLSQFLK------GRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEK  454
             S+F   C+LLS++++      G + +   +       T A  +   +   TMD       
Sbjct  11    SSFAMACSLLSRYVRENGAAAGELGLGIRAEAADAQRTPADAEKGDARKQTMDLF-----  65

Query  455   STQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVF  634
                          PQ+   GT    +E  +A             +  QLTIFY+GKV+VF
Sbjct  66    -------------PQDAGFGTEAAAQEAPDA----------REKEKHQLTIFYAGKVLVF  102

Query  635   DEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasp  814
             D+FPA+KA+ +M +A + +      V Q++G     LP+   A V  ST V         
Sbjct  103   DDFPAEKAKDLMQMAGRGA-----SVAQSSG----SLPSPAVATVTDSTKV---------  144

Query  815   pplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPL  994
                                +     +D+P A ++SL RFLEKRKDR TA+APYQ   +  
Sbjct  145   --------AAVPAAPIPVVSAQKNAADIPQAPKASLRRFLEKRKDRLTAKAPYQGSPSDA  196

Query  995   IPSKSERPSSK  1027
              P K E P S+
Sbjct  197   TPVKKEMPESQ  207



>gb|EAZ04703.1| hypothetical protein OsI_26864 [Oryza sativa Indica Group]
Length=244

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 78/245 (32%), Positives = 111/245 (45%), Gaps = 43/245 (18%)
 Frame = +2

Query  293   SNFVQTCNLLSQFLKGR-VSIRDLSHGIGVVNTEASGKFDISHGTTMDFLT-NIEKSTQD  466
             ++F   C+LLS++++    +  +L  GI        G+   +   TM  L    E+  + 
Sbjct  16    TSFAMACSLLSRYVRQNGAAAAELGLGI-----RGEGEAPRAAPGTMSLLPGEAERKKET  70

Query  467   QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFP  646
              E+      PQ+   G    +   + A A       ++ P+  QLTIFY GKV+VF++FP
Sbjct  71    MEL-----FPQSAGFGQQDAITADSAADA------REQEPEKRQLTIFYGGKVLVFNDFP  119

Query  647   ADKARAVMLLASKSS---PQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmaspp  817
             ADKA+ +M LASK S   PQ+A      A  D    P      +A   PV       +  
Sbjct  120   ADKAKGLMQLASKGSTVAPQNAVAPAPAAVTDNTKAP------MAVPAPVSSLPTAQADA  173

Query  818   plppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPLI  997
               P                     SD+PIAR++SLHRFLEKRKDR  A+ PYQ   +   
Sbjct  174   QKPARAN----------------ASDMPIARKASLHRFLEKRKDRLNAKTPYQASPSDAT  217

Query  998   PSKSE  1012
             P K E
Sbjct  218   PVKKE  222



>gb|ABF96481.1| ZIM motif family protein, expressed [Oryza sativa Japonica Group]
Length=194

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 89/173 (51%), Gaps = 27/173 (16%)
 Frame = +2

Query  494   PQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPADKARAVML  673
             PQN+  G+          AA++ +       +  QLTIFY GKV+VFD+FPA+KA+ +M 
Sbjct  22    PQNSGFGSE---------AAAVKETPDAREQEKRQLTIFYGGKVLVFDDFPAEKAKDLMQ  72

Query  674   LASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasppplppppvppptq  853
             +ASKSS  +   V          LP+   A VA +T V           +P P    P  
Sbjct  73    MASKSSSTAQNCVL---------LPSSATATVADNTKV---------SAVPAPASALPVA  114

Query  854   paaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPLIPSKSE  1012
              A A     P  +DLP AR++SLHRFLEKRKDR  A+APYQ   +   P K E
Sbjct  115   QANAPKPVRPNAADLPQARKASLHRFLEKRKDRLQAKAPYQGSPSDASPVKKE  167



>ref|XP_007024678.1| Jasmonate-zim-domain protein 6, putative isoform 2 [Theobroma 
cacao]
 gb|EOY27300.1| Jasmonate-zim-domain protein 6, putative isoform 2 [Theobroma 
cacao]
Length=235

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 118/243 (49%), Gaps = 26/243 (11%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASG-KFDISHGTTMDFLTNI  448
            SG+A E+++FV   NLLSQ+LK + +I D+S G+     EA G +        M+F  N+
Sbjct  8    SGKATERASFV---NLLSQYLKEKRNIGDISVGM-TSKPEAKGLEASRQQAMPMNFFPNM  63

Query  449  EKSTQDQE---------MAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQL  601
            +  +             + P D  P+    G S + E+ TN   +  ++     PK+AQL
Sbjct  64   DNPSDSSRPNLVASTSNVKPSDFFPEIANFGASSSKEDSTNK--TDFRKPATVEPKSAQL  121

Query  602  TIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATST  781
            TIF+ G+V+V+++FPA+K + +M LAS+    +  GV   +G++K++   D      +  
Sbjct  122  TIFFGGQVLVYNDFPAEKVKEIMALASQGCSTACAGVVTDSGMEKVNSNMDKINSSNSDI  181

Query  782  PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATA  961
            P                          +      GGSDL IARR+SLH+F EKRKD   +
Sbjct  182  P----------DLNIASTTGNSPDQDPSVERRQYGGSDLRIARRNSLHKFFEKRKDSRKS  231

Query  962  RAP  970
              P
Sbjct  232  TIP  234



>gb|EMS48227.1| Protein TIFY 10A [Triticum urartu]
Length=161

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 70/141 (50%), Gaps = 26/141 (18%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLASKSSP--QSARGVFQTAGVDKLDLPADGAAVV  769
             QLTIFY GKV+VF++FPADKA+ +M LA K SP  Q+       A   K+       A  
Sbjct  26    QLTIFYGGKVLVFNDFPADKAKGLMQLAGKGSPVVQNVSATTTAADTAKVQTAVLAPASS  85

Query  770   ATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKD  949
               S PV+  K                              SDLPIAR++SLHRFLEKRKD
Sbjct  86    LPSDPVNAHKSARP------------------------NASDLPIARKASLHRFLEKRKD  121

Query  950   RATARAPYQVHNNPLIPSKSE  1012
             R  A+APYQ   +   P K E
Sbjct  122   RLHAKAPYQASPSDATPVKKE  142



>ref|XP_004510528.1| PREDICTED: protein TIFY 11B-like [Cicer arietinum]
Length=233

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 81/254 (32%), Positives = 117/254 (46%), Gaps = 56/254 (22%)
 Frame = +2

Query  254  LSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGI-GVVNTEASGKFDISHGTTM  430
            +SD + SG+APEK  F QTC+LLSQFLK +    D + G+ G +  +AS         T 
Sbjct  8    VSDSQRSGKAPEKFKFSQTCSLLSQFLKEKRISGDSTPGLFGKIKPKAS---------TK  58

Query  431  DFLTNIEKSTQDQEM--APIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLT  604
            D L N + S     +  + +D  PQ         VE      ++I         +  QLT
Sbjct  59   DLLGNKQNSDGGLRLNASAMDSLPQ--------LVENPCIKKSNI----RSTNSETPQLT  106

Query  605  IFYSGKVMVFDEFPADKARAVMLLASK-SSPQSARGVFQTAG---VDKLDLPADGAAVVA  772
            IFY+GK++VFD F  +KA  +M LA+K +S  S+R    T+     +KL          A
Sbjct  107  IFYAGKMLVFDAFRPEKATEIMELATKLASENSSREENPTSAPITSEKLKDSKVPQPKTA  166

Query  773  TSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDR  952
              TP +                                GSD+   RR+SL +FLEKRK+R
Sbjct  167  LETPRENQVI----------------------------GSDMRYPRRASLLKFLEKRKER  198

Query  953  ATARAPYQVHNNPL  994
              +R PYQ++N+ +
Sbjct  199  VISRGPYQINNHKI  212



>ref|XP_006657953.1| PREDICTED: protein TIFY 10A-like [Oryza brachyantha]
Length=238

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 79/249 (32%), Positives = 111/249 (45%), Gaps = 54/249 (22%)
 Frame = +2

Query  293   SNFVQTCNLLSQFLKGR-VSIRDLSHGI-GVVNTE-ASGKFDISHGTTMDFLTNIEKSTQ  463
             ++F   C+LLS++++    +  +L  GI G    + A     +  G   D +   +K T 
Sbjct  14    TSFAMACSLLSRYVRQNGAAAAELGLGIRGEAEPQRAPATMSLLPGAEADEVAEKKKET-  72

Query  464   DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEF  643
                   ++  PQ+T  G           AA+  ++  +   +  QLTIFY GKV+VF++F
Sbjct  73    ------MELFPQSTGFGQQD--------AAAAREQEQEPEQEKRQLTIFYGGKVLVFNDF  118

Query  644   PADKARAVMLLASKSSP--QSARGVFQTAGVD--KLDLPADG--AAVVATSTPVDppkpm  805
             PADKA+ +M LASK SP  Q+      T   D  K+  P     AA V    P       
Sbjct  119   PADKAKGLMQLASKGSPVAQNVTAPAPTTVTDNTKVHAPLSSLPAAQVEAQKPA------  172

Query  806   asppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHN  985
                                         SDLPIAR++SLHRFLEKRKDR  A+ PYQ   
Sbjct  173   ------------------------RANASDLPIARKASLHRFLEKRKDRLNAKTPYQASP  208

Query  986   NPLIPSKSE  1012
             +   P K E
Sbjct  209   SDATPVKKE  217



>gb|EAY90387.1| hypothetical protein OsI_11965 [Oryza sativa Indica Group]
Length=288

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 89/173 (51%), Gaps = 27/173 (16%)
 Frame = +2

Query  494   PQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPADKARAVML  673
             PQN+  G+          AA++ +       +  QLTIFY GKV+VFD+FPA+KA+ +M 
Sbjct  116   PQNSGFGSE---------AAAVKETPDAREQEKRQLTIFYGGKVLVFDDFPAEKAKDLMQ  166

Query  674   LASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasppplppppvppptq  853
             +ASKSS  +   V          LP+   A VA +T V           +P P    P  
Sbjct  167   MASKSSSTAQNCVL---------LPSSATAAVADNTKV---------SAVPAPASALPVA  208

Query  854   paaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPLIPSKSE  1012
              A A     P  +DLP AR++SLHRFLEKRKDR  A+APYQ   +   P K E
Sbjct  209   QANAPKPVRPNAADLPQARKASLHRFLEKRKDRLQAKAPYQGSPSDASPVKKE  261



>ref|XP_006345256.1| PREDICTED: protein TIFY 10A-like [Solanum tuberosum]
Length=254

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 83/263 (32%), Positives = 122/263 (46%), Gaps = 66/263 (25%)
 Frame = +2

Query  266  KISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSH-GIGVVNTEASG--KFDISHGTTMDF  436
            K++G   +KS F QTCNLLSQFLK + S+ DL++ GI     E +G  +   +  TTM+ 
Sbjct  11   KVTG---QKSQFSQTCNLLSQFLKKKGSVGDLNNLGIYKTTFEPTGSQQTATTTTTTMNL  67

Query  437  LTNIEKSTQDQEMAP-IDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
            L  IEKS+     +  ++ NPQ  +N   +  +     +   ++    + P+ AQ+TIFY
Sbjct  68   LPMIEKSSDSSSSSSSVETNPQKPMNLFPQEFDFSKEQSTKKTESWKFDQPEKAQMTIFY  127

Query  614  SGKVMVFDEF----------------PADKARAVMLLASKSSPQSARGVFQTAGVDKL--  739
             G+V+VFD+F                P +     M+   K+S QS          +KL  
Sbjct  128  GGQVIVFDDFPADKANEIMKLANKQNPTNNFTYTMMKNQKTSDQSGANF-----GNKLIQ  182

Query  740  DLPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSS  919
            +LP    ++   S                                     +DLPIARR+S
Sbjct  183  ELPKCQVSMPQPSV------------------------------------ADLPIARRNS  206

Query  920  LHRFLEKRKDRATARAPYQVHNN  988
            L RFLEKRKDR T+ APYQ+ +N
Sbjct  207  LTRFLEKRKDRVTSIAPYQISSN  229



>ref|NP_001150658.1| pnFL-2 [Zea mays]
 gb|ACG32642.1| pnFL-2 [Zea mays]
 gb|ACG39917.1| pnFL-2 [Zea mays]
Length=233

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 72/139 (52%), Gaps = 25/139 (18%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
             QLTIFY GKV+VFD+FPADKA+ +M LASK SP     V Q      L  P+  AAV   
Sbjct  99    QLTIFYGGKVLVFDDFPADKAKDLMQLASKGSP-----VVQNV---VLPQPSAVAAVTTD  150

Query  776   STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
                +D                 P    AAA        SD+PI R++SLHRFLEKRKDR 
Sbjct  151   KAVLD-----------------PVISLAAAKKPARTNASDMPIMRKASLHRFLEKRKDRL  193

Query  956   TARAPYQVHNNPLIPSKSE  1012
              A+ PYQ   +   P K E
Sbjct  194   NAKTPYQTAPSDAAPVKKE  212



>dbj|BAJ98082.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=232

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 73/146 (50%), Gaps = 36/146 (25%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQ--TAGVDKLDLPADGAAVV  769
             QLTIFY GKV+VF++FPADKA+ +M LA K  P     V Q  +A     D P    AV+
Sbjct  97    QLTIFYGGKVIVFNDFPADKAKGLMQLAGKGIP-----VVQNVSATTPVADSPKVQPAVL  151

Query  770   AT-----STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFL  934
             A      S PVD  K                              SDLPIAR++SLHRFL
Sbjct  152   APASSLPSDPVDAHKSARP------------------------NASDLPIARKASLHRFL  187

Query  935   EKRKDRATARAPYQVHNNPLIPSKSE  1012
             EKRKDR  A+APYQ   +   P K E
Sbjct  188   EKRKDRLHAKAPYQASPSDATPVKKE  213



>dbj|BAJ89850.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90251.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=232

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 73/146 (50%), Gaps = 36/146 (25%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQ--TAGVDKLDLPADGAAVV  769
             QLTIFY GKV+VF++FPADKA+ +M LA K  P     V Q  +A     D P    AV+
Sbjct  97    QLTIFYGGKVIVFNDFPADKAKGLMQLAGKGIP-----VVQNVSATTPVADSPKVQPAVL  151

Query  770   AT-----STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFL  934
             A      S PVD  K                              SDLPIAR++SLHRFL
Sbjct  152   APASSLPSDPVDAHKSARP------------------------NASDLPIARKASLHRFL  187

Query  935   EKRKDRATARAPYQVHNNPLIPSKSE  1012
             EKRKDR  A+APYQ   +   P K E
Sbjct  188   EKRKDRLHAKAPYQASPSDATPVKKE  213



>ref|XP_009117562.1| PREDICTED: protein TIFY 10A-like [Brassica rapa]
Length=273

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 85/261 (33%), Positives = 122/261 (47%), Gaps = 23/261 (9%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS  415
            MS     SD   + R   K +F QTC+ LSQ+LK   S  DLS G+     E +G     
Sbjct  1    MSSPMESSDFAATRRFSRKPSFSQTCSRLSQYLKENGSFGDLSLGMAC-KPEVNG-ISRQ  58

Query  416  HGTTMDFL----TNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGT--NAAASISkeapk  577
              TTM       +N+E   QD +   + P   +  + +S   +E       A+ S  + K
Sbjct  59   PTTTMSLFPCEASNMEPIGQDVKPKNLFPRQPSFSSSSSSLPKEDILKMTQATSSTRSVK  118

Query  578  eapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAG-----VDKLD  742
              P+ A LTIFY G+V+VF++F A+KA+ VM LASK +  +  G           V   +
Sbjct  119  PEPQTAPLTIFYGGQVIVFNDFSAEKAKEVMDLASKGTANTFTGFTSNVNNNIQSVYTTN  178

Query  743  LPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSL  922
            L  +   + +   P+    P         P     T              +LPIARR+SL
Sbjct  179  LANNQTEMRSNIAPIPNQLPHLMKTTTQNPVQSSSTAM----------ACELPIARRASL  228

Query  923  HRFLEKRKDRATARAPYQVHN  985
            HRFL KRKDR T++APYQ+++
Sbjct  229  HRFLAKRKDRVTSKAPYQLND  249



>ref|NP_001182812.1| putative tify domain/CCT motif transcription factor family protein 
[Zea mays]
 gb|ACN33947.1| unknown [Zea mays]
 tpg|DAA61643.1| TPA: putative tify domain/CCT motif transcription factor family 
protein [Zea mays]
 gb|AIB05448.1| ZIM transcription factor, partial [Zea mays]
Length=218

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 114/256 (45%), Gaps = 64/256 (25%)
 Frame = +2

Query  269   ISGRAPEK----SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDF  436
             ++G AP +    + F  TC+LLSQFLK +        G+ +    A+G       TTM+ 
Sbjct  1     MAGHAPARDKTTTGFAATCSLLSQFLKEKKGGLQGLGGLAMAPAPAAGAGAFRPPTTMNL  60

Query  437   LTNIEKSTQDQEMAPI-DPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
             L+ +     D   A + +P       G +     G  A                QLTIFY
Sbjct  61    LSAL-----DAAKATVGEPEGHGQRTGGNPREAAGEEA---------------QQLTIFY  100

Query  614   SGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDp  793
              GKV+VFD FP+ K + ++ + S   P  A  V   AG         GAAV   + P   
Sbjct  101   GGKVVVFDRFPSAKVKDLLQIVS---PPGADAVVDGAGA--------GAAVPTQNLPRPS  149

Query  794   pkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPY  973
                ++                           +DLPIARR+SLHRFLEKRKDR TA+APY
Sbjct  150   HDSLS---------------------------ADLPIARRNSLHRFLEKRKDRITAKAPY  182

Query  974   QVHNN-PLIPSKSERP  1018
             QV+++     SK+E+P
Sbjct  183   QVNSSVGAEASKAEKP  198



>ref|NP_564075.1| jasmonate-zim-domain protein 1  [Arabidopsis thaliana]
 sp|Q9LMA8.1|TI10A_ARATH RecName: Full=Protein TIFY 10A; AltName: Full=Jasmonate ZIM domain-containing 
protein 1 [Arabidopsis thaliana]
 gb|AAF82229.1|AC069143_5 Contains similarity to an unknown protein T10D10.8 gi|6730756 
from Arabidopsis thaliana BAC T10D10 gb|AC016529. ESTs gb|T14209, 
gb|BE038503, gb|AA650871, gb|AA597384, gb|H76606, gb|AI996806, 
gb|AI100291 come from this gene [Arabidopsis thaliana]
 gb|AAG48784.1|AF332421_1 unknown protein [Arabidopsis thaliana]
 gb|AAK63998.1| At1g19180/T29M8_5 [Arabidopsis thaliana]
 gb|AAL38322.1| unknown protein [Arabidopsis thaliana]
 gb|AAL87391.1| At1g19180/T29M8_5 [Arabidopsis thaliana]
 gb|AAM10195.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29814.1| protein TIFY 10A [Arabidopsis thaliana]
Length=253

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 82/269 (30%), Positives = 125/269 (46%), Gaps = 64/269 (24%)
 Frame = +2

Query  233  NMSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDI  412
            +M     +   + +G+ P   +F QTC+ LSQ+LK   S  DLS G+     + +G    
Sbjct  4    SMECSEFVGSRRFTGKKP---SFSQTCSRLSQYLKENGSFGDLSLGMAC-KPDVNGTLGN  59

Query  413  SH--GTTMDFL----TNIEKSTQD---QEMAPIDPN--------PQNTV---NGTSRTVE  532
            S    TTM       +N++   QD     + P  P+        P+  V     T+R+V+
Sbjct  60   SRQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVK  119

Query  533  EGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGV  712
              +  A                LTIFY+G+V+VF++F A+KA+ V+ LASK       G 
Sbjct  120  PESQTAP---------------LTIFYAGQVIVFNDFSAEKAKEVINLASK-------GT  157

Query  713  FQTAGVDKLDLPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGS  892
              +   ++ D+ ++  A +A   P         P    P P+                 +
Sbjct  158  ANSLAKNQTDIRSN-IATIANQVPHPRKTTTQEPIQSSPTPL-----------------T  199

Query  893  DLPIARRSSLHRFLEKRKDRATARAPYQV  979
            +LPIARR+SLHRFLEKRKDR T++APYQ+
Sbjct  200  ELPIARRASLHRFLEKRKDRVTSKAPYQL  228



>gb|AAG49896.1| PnFL-2 [Ipomoea nil]
Length=206

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 113/247 (46%), Gaps = 70/247 (28%)
 Frame = +2

Query  257  SDVKISGR-APEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMD  433
            S+   SGR + ++SNF  TC LLSQ+LK + S  DLS G                  TM+
Sbjct  4    SETMDSGRFSGQRSNFSHTCALLSQYLKEKGSFGDLSLGT----------------PTMN  47

Query  434  FLTNIEKSTQDQEMAPIDPNP-QNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIF  610
             L   EK  Q+ ++ P++  P QN ++ +    +                 P+ A +TIF
Sbjct  48   LLPTFEKPAQNSDLKPLNLFPTQNKIDSSLGKAD-----------------PERAPMTIF  90

Query  611  YSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVD  790
            Y+G++++F+EFP +KA+ ++ +A+ +       +   A V+ + +P    + V  S    
Sbjct  91   YNGQMIMFNEFPVEKAKELIAMATNT---QTPNILPCADVNSV-VPRPAVSKVVPS----  142

Query  791  ppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATAR-A  967
                                             SDLPIARRSSL RFLEKRKDR T++ A
Sbjct  143  --------------------------FGNQRAYSDLPIARRSSLARFLEKRKDRITSKAA  176

Query  968  PYQVHNN  988
            PYQ   N
Sbjct  177  PYQKGKN  183



>ref|XP_009410257.1| PREDICTED: protein TIFY 10A-like [Musa acuminata subsp. malaccensis]
Length=242

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 108/240 (45%), Gaps = 49/240 (20%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSIRDLSHGIGV--VNTEASGKFDISHGTTMDFLTNIEKSTQ  463
            +S+F  TC LLSQ+LK   S  DL   +    ++ +A G F + +  T+ F    E S  
Sbjct  11   RSHFSLTCRLLSQYLKKNGSFGDLGLLLAPRPIDHQAKGNFWVPN--TICFKPGNEVSGM  68

Query  464  DQEMA--PIDPNPQNTVNGTSRTVEEGTNAAA-----SISkeapkeapkaaQLTIFYSGK  622
            D   A    D N  N+            N++A       +K +  +     QLTIFY G+
Sbjct  69   DHHHADKSTDKNASNSPELMVSQHSISLNSSAIPRTEESTKPSDAKEIGKDQLTIFYGGQ  128

Query  623  VMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkp  802
            ++VFD FPADKA+ ++L+ASK S                   AD AA   ++ P      
Sbjct  129  ILVFDNFPADKAKDLLLMASKES------------------IADPAADCTSNEPA-----  165

Query  803  masppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVH  982
                              ++         SD+PIARR+SL+RFL KRKDR   +APYQVH
Sbjct  166  --------------VALQSSLPEPGQANSSDMPIARRNSLNRFLGKRKDR-MGQAPYQVH  210



>emb|CDX83781.1| BnaC08g18640D [Brassica napus]
Length=264

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 81/255 (32%), Positives = 113/255 (44%), Gaps = 48/255 (19%)
 Frame = +2

Query  278  RAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKS  457
            R   K +F  TC+ LSQ+LK   S  DLS G+     E +G              N  + 
Sbjct  16   RFSRKPSFSLTCSRLSQYLKENGSFGDLSLGMSC-KPEVNG--------------NSRQP  60

Query  458  TQDQEMAPIDPNPQNTV------NGTSR------------TVEEGTNAAASISkeapkea  583
            T    + P +  P  TV      N  SR              E+      + +  + +  
Sbjct  61   TTTMSLFPCEAAPMATVQEVKPKNLFSRQPSFSSSSSSLPKKEDVLKMTQTTTTRSVRPE  120

Query  584  pkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAA  763
            P+ A LTIFY+G+V+VF++F A+KA+ VM LASK +  S  G   T     L+LP +   
Sbjct  121  PQTAPLTIFYNGEVIVFNDFSAEKAKEVMYLASKGTANSFTGFTST-----LNLPKNQTE  175

Query  764  VVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKR  943
            V     P     P    P    P +                  +LPIARR+SLHRFL KR
Sbjct  176  VRTNIAPTSNQVPHLMKPAAQEPILSSSAAM----------ACELPIARRASLHRFLAKR  225

Query  944  KDRATARAPYQVHNN  988
            KDR T++APYQ+ ++
Sbjct  226  KDRVTSKAPYQLSDS  240



>emb|CDY71173.1| BnaC02g45660D [Brassica napus]
Length=272

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 112/239 (47%), Gaps = 27/239 (11%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIG-VVNTEASGKFDISHGTTMDFLTNI  448
            +G+APEKS+F   C+L S++LK + S  ++  G+   ++ E +GK D+S         N 
Sbjct  3    NGKAPEKSSFSLRCSLFSRYLKEKGSFGNIDIGLARKLDLELAGKSDLSG------QQNE  56

Query  449  EKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeap-kaaQLTIFYSGKV  625
             K     E  P D + + +V G   T   G      +S+ A        +QLTIF+ GKV
Sbjct  57   IKKADISETRPFDLSQKVSV-GEVSTSSGGNPRFVDLSEPASVVPEPGNSQLTIFFRGKV  115

Query  626  MVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpm  805
            MV+DEFP DKA+ +M  A +++   +     +     LD+  +  + V      +P    
Sbjct  116  MVYDEFPEDKAKEIMEAAREAAHHVST---DSKNTQNLDMNVNNKSNVVIPDLNEPSTSG  172

Query  806  asppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVH  982
             +             +                IARR+SLHRF  KRKDRA ARAPYQV+
Sbjct  173  TNNDDHQTGQQHQVVER---------------IARRASLHRFFAKRKDRAVARAPYQVN  216



>ref|NP_001060268.1| Os07g0615200 [Oryza sativa Japonica Group]
 dbj|BAC16504.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22182.1| Os07g0615200 [Oryza sativa Japonica Group]
 dbj|BAG90968.1| unnamed protein product [Oryza sativa Japonica Group]
Length=244

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 79/242 (33%), Positives = 113/242 (47%), Gaps = 37/242 (15%)
 Frame = +2

Query  293   SNFVQTCNLLSQFLKGR-VSIRDLSHGIGVVNTEASGKFDISHGTTMDFLT-NIEKSTQD  466
             ++F   C+LLS++++    +  +L  GI        G+   +   TM  L    E+  + 
Sbjct  16    TSFAMACSLLSRYVRQNGAAAAELGLGI-----RGEGEAPRAAPATMSLLPGEAERKKET  70

Query  467   QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFP  646
              E+      PQ+   G    +   + A A       ++ P+  QLTIFY GKV+VF++FP
Sbjct  71    MEL-----FPQSAGFGQQDAITADSAADA------REQEPEKRQLTIFYGGKVLVFNDFP  119

Query  647   ADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasppplp  826
             ADKA+ +M LASK SP + +     A     D   +  A +A   PV             
Sbjct  120   ADKAKGLMQLASKGSPVAPQNAAAPAPAAVTD---NTKAPMAVPAPVS------------  164

Query  827   pppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPLIPSK  1006
                   PT  A A        SD+PIAR++SLHRFLEKRKDR  A+ PYQ   +   P K
Sbjct  165   ----SLPTAQADAQKPARANASDMPIARKASLHRFLEKRKDRLNAKTPYQASPSDATPVK  220

Query  1007  SE  1012
              E
Sbjct  221   KE  222



>ref|XP_003562699.1| PREDICTED: protein TIFY 10A-like isoform X1 [Brachypodium distachyon]
Length=237

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 111/241 (46%), Gaps = 35/241 (15%)
 Frame = +2

Query  293   SNFVQTCNLLSQFLKGR-VSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQDQ  469
             S+F   C+LLS++++    +  +LS G   V+ EA  + + +  +++  +   E   + +
Sbjct  12    SSFAVACSLLSRYVRQNGAAAAELSLGFNKVSGEAETQKEAATKSSLPVVDGEESGRKKE  71

Query  470   EMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPA  649
              M      PQ+   G       G   AA+   +A     +  QLTIFY GKV+VF++FPA
Sbjct  72    TMELF---PQSAGLG-------GVQDAAT--PDAIAREQEKRQLTIFYGGKVLVFNDFPA  119

Query  650   DKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasppplpp  829
             D A+ ++ LASK +P                       V  T+ P        +   +  
Sbjct  120   DMAKNLIQLASKGNP----------------------VVQNTTVPTPVIDSNKAETVVQA  157

Query  830   ppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPLIPSKS  1009
             P    P     A     P  +DLPIAR++SLHRFLEKRKDR  A APYQ   +   P K 
Sbjct  158   PASSLPGAQNDAPKPARPNAADLPIARKASLHRFLEKRKDRLHASAPYQASPSDATPVKK  217

Query  1010  E  1012
             E
Sbjct  218   E  218



>ref|XP_006416530.1| hypothetical protein EUTSA_v10008419mg [Eutrema salsugineum]
 gb|ESQ34883.1| hypothetical protein EUTSA_v10008419mg [Eutrema salsugineum]
Length=281

 Score = 85.9 bits (211),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 92/282 (33%), Positives = 133/282 (47%), Gaps = 32/282 (11%)
 Frame = +2

Query  236   MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS  415
             MS     SD     R   K +F  TC+ LSQ+LK   S  DLS G+     E +G F  S
Sbjct  2     MSSSMECSDFAAGRRFSGKPSFSLTCSRLSQYLKENGSFGDLSLGMAC-KPEVNGNFGTS  60

Query  416   H--GTTMDFLTNIEKSTQD------QEMAPIDPNPQNTVNGTSRTVEEGTNA--------  547
                 TTM      E S  D      Q++ P +  P+ +   +S +     +A        
Sbjct  61    RQPTTTMSLFP-CEASNMDSMAAAHQDVKPKNLFPRQSSFSSSSSSLPKEDALKITQTTT  119

Query  548   AASISkeapkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAG  727
               + +  + K  P+ A LTIFY G+V+VF++F A+KAR VM LASK +  S  G   T+ 
Sbjct  120   TTTTTARSVKPEPQTAPLTIFYGGQVIVFNDFSAEKARQVMNLASKGTAHSFTGF--TSN  177

Query  728   VDKLDLPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIA  907
             V+  ++        +  TP    K  +         +           +  P   +LPIA
Sbjct  178   VNNNNIHQ------SVYTP-HLAKNQSEITSNIVSHLKKTATQDPIHSSSTPMACELPIA  230

Query  908   RRSSLHRFLEKRKDRATARAPYQVHNNPLIPSK-SERPSSKN  1030
             RR+SLHRFL KRKDR T++APYQ+ +    P+K S +P S++
Sbjct  231   RRASLHRFLAKRKDRVTSKAPYQLCD----PAKASSKPQSRD  268



>ref|XP_010471594.1| PREDICTED: protein TIFY 10B-like [Camelina sativa]
 ref|XP_010471595.1| PREDICTED: protein TIFY 10B-like [Camelina sativa]
Length=253

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 79/255 (31%), Positives = 112/255 (44%), Gaps = 47/255 (18%)
 Frame = +2

Query  269  ISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVV-NTEASGKFDISHGTTMDFLTN  445
             SGR P   +F QTC+ LS++LK + S  DL+ G+    +    G F  S   TM  L  
Sbjct  10   FSGRKP---SFSQTCSRLSRYLKEKGSFGDLTLGMTCKPDLNGGGGFAASRQPTMMNLFP  66

Query  446  IEKSTQD----QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
             E S  D    Q++ P D  P+ +   +S +             ++ K   ++A LTIFY
Sbjct  67   CEASGIDSLAGQDIKPKDMFPRQSSFSSSSSSGTKEEVQMITETKSEKLESQSAPLTIFY  126

Query  614  SGKVMVFDEFPADKARAVMLLASKSSPQSARGVF-------------QTAGVDKLDLPAD  754
             G+VMVFD+F A +A+ V+ LA+  + +S                  QT      +L A 
Sbjct  127  GGRVMVFDDFSAHRAKEVIDLANIGNAKSFTHEVNQKIAYTQNFAKNQTEIASSTNLAAS  186

Query  755  GAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFL  934
                 A   P+ P                                 +LPI RR+SLHRFL
Sbjct  187  PTKTAAPLEPIQPNPSSL--------------------------ACELPIVRRASLHRFL  220

Query  935  EKRKDRATARAPYQV  979
            EKRKDR T++APYQ+
Sbjct  221  EKRKDRITSKAPYQI  235



>ref|XP_007154562.1| hypothetical protein PHAVU_003G129200g [Phaseolus vulgaris]
 gb|ESW26556.1| hypothetical protein PHAVU_003G129200g [Phaseolus vulgaris]
Length=228

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 105/242 (43%), Gaps = 54/242 (22%)
 Frame = +2

Query  287   EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGV-VNTEASGKFDISH-GTTMDFLTNIEKST  460
             EKS F QTC+LLSQ+LK   +  DL+ G+   V   AS      H  TTM+    I   T
Sbjct  21    EKSTFSQTCSLLSQYLKENGTFGDLTLGMTCTVEANASPSETSCHPATTMELFPTIL--T  78

Query  461   QDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDE  640
             Q    A +D          SR     +    S   +  ++ PKA+Q+TIFY+G+V+VF++
Sbjct  79    QRNPSAAVD------FLSPSRAYPHYSELNKSSGFKPVEKEPKASQMTIFYAGQVVVFND  132

Query  641   FPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasppp  820
             FP +K   +M LA K   QS       A     + P+  A V                  
Sbjct  133   FPPEKMEEIMSLARKGMSQSPN---YHAYAHTRNQPSSMAIV------------------  171

Query  821   lppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPLIP  1000
                                      LPIAR+ SLHRF EKRK R +A APYQ++     P
Sbjct  172   -----------------------RGLPIARKVSLHRFFEKRKHRISANAPYQINKPNSAP  208

Query  1001  SK  1006
             +K
Sbjct  209   NK  210



>ref|XP_002461012.1| hypothetical protein SORBIDRAFT_02g039190 [Sorghum bicolor]
 gb|EER97533.1| hypothetical protein SORBIDRAFT_02g039190 [Sorghum bicolor]
Length=235

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 70/139 (50%), Gaps = 22/139 (16%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
             QLTIFY GKV+VFD+FPADKA+ +M LASK S      V Q      L  P+  AAV   
Sbjct  98    QLTIFYGGKVLVFDDFPADKAKDLMQLASKGS-----LVVQNV---VLPQPSAPAAVTDK  149

Query  776   STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
             + P       A+      P                   SD+PI R++SLHRFLEKRKDR 
Sbjct  150   AVPAPVISLSAAQADAKKPART--------------NASDMPIMRKASLHRFLEKRKDRL  195

Query  956   TARAPYQVHNNPLIPSKSE  1012
              A+ PYQ   +   P K E
Sbjct  196   NAKTPYQTSPSDAAPVKKE  214



>ref|XP_010061832.1| PREDICTED: protein TIFY 10B-like [Eucalyptus grandis]
Length=223

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 82/258 (32%), Positives = 113/258 (44%), Gaps = 50/258 (19%)
 Frame = +2

Query  287   EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGV---VNTEASGKFDISHG--TTMDFLTNIE  451
             EKS+F    N LS  LK + ++      IG+   +   A+   D +    TTM+ L N+E
Sbjct  2     EKSSFQLMFNRLSHRLKEKRAL------IGIAEKMEDRATKSADSAQPQLTTMNLLKNLE  55

Query  452   KSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMV  631
                    +AP  PN  +  +  +    E  N    + K+   +  K  Q+TIFY+G V V
Sbjct  56    C------LAPGSPNVSDQSSKANSIANENLN---DLRKDVNNKTVKTDQITIFYAGSVHV  106

Query  632   FDEFPADKARAVMLLASKSSPQSARGVFQT-------AGVDKLDLPADGAAVVATSTPVD  790
             FD  P DK + VM  A+K SP    G F +        G +KL      +++ A  +   
Sbjct  107   FDGLPVDKMKEVMNYAAKFSPCHISGHFVSNGGGSSETGHEKLMASTQNSSIGAGRSTYQ  166

Query  791   ppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAP  970
                   +                          SDLPIARR+SL+RFL KRKDRA  RAP
Sbjct  167   ELLQAKTEA----------------------AASDLPIARRASLNRFLSKRKDRALVRAP  204

Query  971   YQVHNNPLIPSKSERPSS  1024
             Y V N+P   S  E  SS
Sbjct  205   Y-VRNSPTAASTHEEGSS  221



>ref|XP_006390655.1| hypothetical protein EUTSA_v10018984mg [Eutrema salsugineum]
 gb|ESQ27941.1| hypothetical protein EUTSA_v10018984mg [Eutrema salsugineum]
Length=278

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 77/243 (32%), Positives = 114/243 (47%), Gaps = 27/243 (11%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDI--SHGTTMDFLTN  445
            +G+APEKS F + C+LLS++LK + S        G ++ E + K D+  +  + +    N
Sbjct  3    TGQAPEKSTFSRRCSLLSRYLKEKGSF-------GNIDIELARKSDLVLAGKSNIRGQQN  55

Query  446  IEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAA--ASISkeapkeapkaaQLTIFYSG  619
              K   + E  P +   + ++ G + T   G       SI + +    PK +QLTIF+ G
Sbjct  56   AIKKADESETRPFEFTQKLSI-GEASTYSGGKARGDDLSIVQASIVPEPKNSQLTIFFGG  114

Query  620  KVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppk  799
            KVMV+DEFP DKA+ + + A+K +   A    +T     LD+        +  + V+ P 
Sbjct  115  KVMVYDEFPEDKAKEI-MEAAKEASLVAVDSKKTQSHMDLDM-----NTTSNKSSVEIPD  168

Query  800  pmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
                                              IARR+SLHRF  KRKDRA ARAPYQV
Sbjct  169  LNEPTSSDNNDDHDQTKHQHQVVER---------IARRASLHRFFAKRKDRAVARAPYQV  219

Query  980  HNN  988
            + N
Sbjct  220  NQN  222



>emb|CDY21679.1| BnaA09g44300D [Brassica napus]
Length=545

 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 87/256 (34%), Positives = 123/256 (48%), Gaps = 42/256 (16%)
 Frame = +2

Query  257  SDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISH--GTTM  430
            SD   + R   K +F QTC+ LSQ+LK   S  DLS G+     E +G   IS    TTM
Sbjct  8    SDFAATRRFSRKPSFSQTCSRLSQYLKENGSFGDLSLGMAC-KPEVNG---ISRQPTTTM  63

Query  431  DFL----TNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGT--NAAASISkeapkeapka  592
                   +N+E   QD +   + P   +  + +S   +E       A+ S  + K  P+ 
Sbjct  64   SLFPCEASNMEPIGQDVKPKNLFPRQPSFSSSSSSLPKEDILKMTQATSSTRSVKPEPQT  123

Query  593  aQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKL-DLPADGAAVV  769
            A LTIFY G+V+VF++F A+KA+ VM LASK +  +     QT     +  +P     ++
Sbjct  124  APLTIFYGGQVIVFNDFSAEKAKEVMDLASKGTANTFTANNQTEMRSNIAPIPNQLPHLM  183

Query  770  ATST--PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKR  943
             T+T  PV                                   +LPIARR+SLHRFL KR
Sbjct  184  KTTTQNPVQSSSTAM--------------------------ACELPIARRASLHRFLAKR  217

Query  944  KDRATARAPYQVHNNP  991
            KDR T++APYQ+ N+P
Sbjct  218  KDRVTSKAPYQL-NDP  232



>ref|XP_006660660.1| PREDICTED: protein TIFY 10A-like [Oryza brachyantha]
Length=219

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 102/244 (42%), Gaps = 62/244 (25%)
 Frame = +2

Query  287   EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEAS--GKFDISHGTTMDFLTNIEKST  460
             +KS+F  TC+LLSQFLK +        G+G     A+     D    TTMD L+ +E   
Sbjct  13    DKSSFAVTCSLLSQFLKEKNKGGLQGLGLGAPPAPATVGAGGDFRPPTTMDLLSGLETPA  72

Query  461   QDQEMAPIDPNPQNTVN--GTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVF  634
                     +PNP +++   GT    +   +  +  +        +A QLTIFY GKV+VF
Sbjct  73    -------AEPNPADSMRQAGTEPPPKPPADRQSDENNAREAAVEQAQQLTIFYGGKVVVF  125

Query  635   DEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasp  814
             D FP+ + + ++ + S              GVDK           AT  P          
Sbjct  126   DNFPSARVKDLLQIVSAGD-----------GVDK------NTGTAATPRPAQNNL-----  163

Query  815   pplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPL  994
                                       DLPIARR+SLHRFLEKRK R  A APYQ     +
Sbjct  164   -------------------------PDLPIARRNSLHRFLEKRKGRINANAPYQA----I  194

Query  995   IPSK  1006
              PSK
Sbjct  195   APSK  198



>ref|XP_006650179.1| PREDICTED: protein TIFY 10B-like [Oryza brachyantha]
Length=227

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 103/230 (45%), Gaps = 54/230 (23%)
 Frame = +2

Query  293  SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGT-TMDFLTNIEKSTQDQ  469
            S+F   C+LLS++      +R      G +      + D   G  TM+            
Sbjct  11   SSFAMACSLLSRY------VRQNGAAAGELGLGVRDEADAQKGKETMELF----------  54

Query  470  EMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPA  649
                    PQN   G+   V+E  +A             +  QLTIFY GKV+VF++FPA
Sbjct  55   --------PQNAGFGSEAAVKEAPDA----------REQEKQQLTIFYGGKVLVFNDFPA  96

Query  650  DKARAVMLLASKSSPQSARGVFQTAGVDKLDLPAD-GAAVVATSTPVDppkpmasppplp  826
            +KA+ +M +ASKS+  +              LP+   AA V  ST V           +P
Sbjct  97   EKAKDLMQMASKSASTTQNSAL---------LPSSTTAATVTDSTKV---------SAVP  138

Query  827  pppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
                P P   A A     P  +DLP AR++SLHRFLEKRKDR  A+APYQ
Sbjct  139  AQANPLPVAQANAQKPVRPNAADLPQARKASLHRFLEKRKDRLQAKAPYQ  188



>ref|XP_008670547.1| PREDICTED: uncharacterized protein LOC100276585 isoform X1 [Zea 
mays]
 gb|ACN26522.1| unknown [Zea mays]
 tpg|DAA45717.1| TPA: putative tify domain/CCT motif transcription factor family 
protein [Zea mays]
 gb|AIB05601.1| ZIM transcription factor, partial [Zea mays]
Length=228

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 108/240 (45%), Gaps = 49/240 (20%)
 Frame = +2

Query  293   SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQDQE  472
             ++F   C+LLS+++  R +    +     +  E+  K            T++EK    +E
Sbjct  11    TSFAMACSLLSRYV--RQNGAAAADLGLAIRAESDAKRTS---------TDMEKGETGKE  59

Query  473   MAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPAD  652
                +D  PQ    G+    +E  +A            P+  QLTIFY GKV+VFD+FPA+
Sbjct  60    T--MDLFPQIAGFGSEAATKEAPDA----------REPEKRQLTIFYGGKVLVFDDFPAE  107

Query  653   KARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasppplppp  832
             KA+ +M +ASK SP     V Q  G+    LP   AA V  ST                 
Sbjct  108   KAKDLMQMASKGSP-----VAQNPGL----LPPSTAATVTDST-----------------  141

Query  833   pvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPLIPSKSE  1012
              +        A        +D+P A ++SL RFLEKRKDR TA+APY    + + P K E
Sbjct  142   KIAAVPAAPIAVANAQKSAADIPQAPKASLRRFLEKRKDRLTAKAPYPGSPSDVTPVKKE  201



>gb|EAZ40654.1| hypothetical protein OsJ_25125 [Oryza sativa Japonica Group]
Length=253

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 76/246 (31%), Positives = 111/246 (45%), Gaps = 36/246 (15%)
 Frame = +2

Query  293   SNFVQTCNLLSQFLK-----GRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLT-NIEK  454
             ++F   C+LLS++++      R +    S   G  +    G+   +   TM  L    E+
Sbjct  16    TSFAMACSLLSRYVRQNGAAARRARPSASEVWGFGSVPGEGEAPRAAPATMSLLPGEAER  75

Query  455   STQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVF  634
               +  E+      PQ+   G    +   + A A       ++ P+  QLTIFY GKV+VF
Sbjct  76    KKETMEL-----FPQSAGFGQQDAITADSAADA------REQEPEKRQLTIFYGGKVLVF  124

Query  635   DEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasp  814
             ++FPADKA+ +M LASK SP + +     A     D   +  A +A   PV       + 
Sbjct  125   NDFPADKAKGLMQLASKGSPVAPQNAAAPAPAAVTD---NTKAPMAVPAPVSSLPTAQAD  181

Query  815   pplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPL  994
                P                     SD+PIAR++SLHRFLEKRKDR  A+ PYQ   +  
Sbjct  182   AQKPARA----------------NASDMPIARKASLHRFLEKRKDRLNAKTPYQASPSDA  225

Query  995   IPSKSE  1012
              P K E
Sbjct  226   TPVKKE  231



>ref|XP_010498328.1| PREDICTED: protein TIFY 10A-like [Camelina sativa]
Length=267

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 116/239 (49%), Gaps = 21/239 (9%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDF-LTNIEKSTQD  466
            K +F  TC+ LSQ+LK   S  DL+ G+     + +G    S   T    L   E S  D
Sbjct  16   KPSFSLTCSRLSQYLKENGSFGDLTLGMAC-RPDVNGTLGNSRQPTATMSLFPCEASNMD  74

Query  467  -------QEMAPIDPNP-QNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGK  622
                   Q++ P +  P Q++   +S +V +      + S  + K   + A LTIFY+G+
Sbjct  75   STAAAAAQDVKPKNLFPRQSSFYSSSSSVPKEDVLKMAQSTRSVKPESQTAPLTIFYAGQ  134

Query  623  VMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkp  802
            V+VF++F A+KA+ VM LASK +  S  G      +++        +V  T+T       
Sbjct  135  VIVFNDFSAEKAKEVMKLASKGTANSFTGFTSNLNINQ--------SVAKTTTQTSNVVA  186

Query  803  masppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
                    P          +++        +LPIARR+SLHRFLEKRKDR T++APYQ+
Sbjct  187  ATPNQVPHPKKTATQEPILSSSTPMT---CELPIARRASLHRFLEKRKDRVTSKAPYQL  242



>ref|XP_010477122.1| PREDICTED: protein TIFY 10A-like [Camelina sativa]
Length=271

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 87/275 (32%), Positives = 119/275 (43%), Gaps = 56/275 (20%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS  415
            MS     S+   S R   K +F  TC+ LSQ+LK   S  DLS G+    ++ +G    S
Sbjct  1    MSSSMECSEFVASRRFTGKPSFSLTCSRLSQYLKENGSFGDLSLGMAC-KSDVNGTLGNS  59

Query  416  HGTTMDF-LTNIEKSTQDQEMAPI--DPNPQN---------------------TVNGTSR  523
               T    L   E S  D   A    D  P+N                      +  T+R
Sbjct  60   RQPTATMSLFPCEASNMDSMAAAAAQDVKPKNLFHRQSSFSSSSSSVLKEDVLKMTQTTR  119

Query  524  TVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSA  703
            +V+  ++ A                LTIFY+G+V+VF++F A+KA+ VM LA K +  S 
Sbjct  120  SVKPESHTAP---------------LTIFYAGQVIVFNDFSAEKAKEVMNLACKGTANSF  164

Query  704  RGV---FQTAGVDKLDLPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapa  874
             G         +  +      + VVAT TP   P P  +    P      P         
Sbjct  165  TGFTSNLNNNNIQSVAKTTQTSNVVAT-TPNQVPHPKKTATQEPILSSSTPMT-------  216

Query  875  papGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
                  +LPIARR+SLHRFLEKRKDR T++APYQ+
Sbjct  217  -----CELPIARRASLHRFLEKRKDRVTSKAPYQL  246



>gb|KCW68864.1| hypothetical protein EUGRSUZ_F024561, partial [Eucalyptus grandis]
Length=189

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 92/208 (44%), Gaps = 39/208 (19%)
 Frame = +2

Query  422   TTMDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQL  601
             TTM+ L N+E       +AP  PN  +  +  +    E  N    + K+   +  K  Q+
Sbjct  12    TTMNLLKNLEC------LAPGSPNVSDQSSKANSIANENLN---DLRKDVNNKTVKTDQI  62

Query  602   TIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQT-------AGVDKLDLPADGA  760
             TIFY+G V VFD  P DK + VM  A+K SP    G F +        G +KL      +
Sbjct  63    TIFYAGSVHVFDGLPVDKMKEVMNYAAKFSPCHISGHFVSNGGGSSETGHEKLMASTQNS  122

Query  761   AVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEK  940
             ++ A  +         +                          SDLPIARR+SL+RFL K
Sbjct  123   SIGAGRSTYQELLQAKTEA----------------------AASDLPIARRASLNRFLSK  160

Query  941   RKDRATARAPYQVHNNPLIPSKSERPSS  1024
             RKDRA  RAPY V N+P   S  E  SS
Sbjct  161   RKDRALVRAPY-VRNSPTAASTHEEGSS  187



>ref|XP_009399648.1| PREDICTED: protein TIFY 10B-like [Musa acuminata subsp. malaccensis]
Length=241

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 102/246 (41%), Gaps = 55/246 (22%)
 Frame = +2

Query  275  GRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHG-TTMDFLTNIE  451
            G   EK+NF   C LLSQ+LK +  +  L   +           D S    TM  L  ++
Sbjct  7    GSKGEKTNFSLACRLLSQYLKEKRGVGGLGLEMAPPKPLDQQAQDQSRAPVTMSLLPGLD  66

Query  452  KSTQDQEMAPIDPNPQNTVNGTSRTV----------EEGTNAAASISkeapkeapkaaQL  601
                D+     + NP  +++   R            EE    A +       +  + +QL
Sbjct  67   VPGDDRAENDHEKNPTKSMDLLPRLSGFDSCFLPEEEESVKTAET-------QKMEKSQL  119

Query  602  TIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATST  781
            TIFY GKV+VFD+FPADKA  +M +A+  S  +    F                   TST
Sbjct  120  TIFYGGKVLVFDKFPADKAMDLMGMATNESMAAQSHSFSEP---------------LTST  164

Query  782  PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATA  961
            P                         +++       SD+PI RR+SL RFLEKRKDR  A
Sbjct  165  P----------------------GADSSSGKLKANTSDMPIPRRNSLRRFLEKRKDRVNA  202

Query  962  RAPYQV  979
            +APYQV
Sbjct  203  KAPYQV  208



>gb|KDO73849.1| hypothetical protein CISIN_1g023369mg [Citrus sinensis]
Length=245

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 75/144 (52%), Gaps = 20/144 (14%)
 Frame = +2

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
            Q+TIFY G+V+VF++FPADKA  +M LAS  S      +        + LPA G    A 
Sbjct  83   QMTIFYGGQVIVFNDFPADKANEIMQLASNGS-----SLSHGTAYPPMQLPAQGYNSFAA  137

Query  776  S---TPVDppkpmasppplppppvppptqpaaaapapapGG------------SDLPIAR  910
            S   +PV+   P++  PP  P        P + +                    DLPIAR
Sbjct  138  SLPKSPVESTPPVSPGPPKIPTEPSCSVPPRSNSIPNFGNNLIPERAQPPSRPCDLPIAR  197

Query  911  RSSLHRFLEKRKDRATARAPYQVH  982
            R+SLHRFLEKRKDR  ARAPYQV+
Sbjct  198  RNSLHRFLEKRKDRIVARAPYQVN  221



>gb|AAM65383.1| unknown [Arabidopsis thaliana]
Length=253

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 122/268 (46%), Gaps = 64/268 (24%)
 Frame = +2

Query  236  MSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDIS  415
            M     +   + +G  P   +F QTC+ L Q+LK   S  DLS G+     + +G    S
Sbjct  5    MECSEFVGSRRFTGNKP---SFSQTCSRLGQYLKENGSFGDLSLGMAC-KPDVNGTLGNS  60

Query  416  H--GTTMDFL----TNIEKSTQD---QEMAPIDPN--------PQNTV---NGTSRTVEE  535
                TTM       +N++   QD     + P  P+        P+  V     T+R+V+ 
Sbjct  61   RQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKP  120

Query  536  GTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVF  715
             +  A                LTIFY+G+V+VF++F A+KA+ V+ LASK       G  
Sbjct  121  ESQTAP---------------LTIFYAGQVIVFNDFSAEKAKEVINLASK-------GTA  158

Query  716  QTAGVDKLDLPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSD  895
             +   ++ D+ ++  A +A   P         P    P P+                 ++
Sbjct  159  NSLAKNQTDIRSN-IATIANQVPHPRKTTTQEPIQSSPTPL-----------------TE  200

Query  896  LPIARRSSLHRFLEKRKDRATARAPYQV  979
            LPIARR+SLHRFLEKRKDR T++APYQ+
Sbjct  201  LPIARRASLHRFLEKRKDRVTSKAPYQL  228



>gb|KEH37602.1| jasmonate zim-domain protein [Medicago truncatula]
Length=256

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 75/260 (29%), Positives = 111/260 (43%), Gaps = 48/260 (18%)
 Frame = +2

Query  266  KISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEA----SGKFDISHGTTMD  433
            K   ++PEK+ F QTC+LLSQ++K +   +DLS GI   N       S +      TTM+
Sbjct  14   KPPAKSPEKTTFSQTCSLLSQYIKEKGCFKDLSLGITCNNNNTDPSGSSETSSQSATTMN  73

Query  434  FLTNIEKSTQDQEMAPIDP-NPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIF  610
                +E +   + +  +D   PQ  +N ++    +G  AA               QLT+F
Sbjct  74   LFPTMENNLSQKNLTTMDLLTPQAALNNSNAI--KGPKAA---------------QLTMF  116

Query  611  YSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAV-VATSTPV  787
            Y+G+V+VFD+FPADKA+ +M  A+K   QS      T    +   P +     V T+TP+
Sbjct  117  YNGQVIVFDDFPADKAQELMAFANKGISQSQNNSVYTYTQSQPSFPPNLVRTSVNTTTPI  176

Query  788  DppkpmasppplppppvppptqpaaaapapapGGSDLPIARR------------------  913
             P   +          +    Q  +           LP+  R                  
Sbjct  177  VPTVNIIPSTATGTGSMNEHLQVPSRPNLCGNFLKPLPLKIRMTRKIGSCFSDHEFSLCA  236

Query  914  -------SSLHRFLEKRKDR  952
                   +SLHRFLEKRKDR
Sbjct  237  DLPIMRKASLHRFLEKRKDR  256



>emb|CDX68156.1| BnaA07g21960D [Brassica napus]
Length=181

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 67/139 (48%), Gaps = 39/139 (28%)
 Frame = +2

Query  599  LTIFYSGKVMVFDEFPADKARAVMLLASKSSP----------QSARGVFQTAG---VDKL  739
            LT+FYSG+VM+FD+FPA+KA+ V+ LA+K SP          QSA   +       +  +
Sbjct  62   LTLFYSGQVMLFDDFPAEKAKQVIDLANKGSPNGFTAELNNNQSAYTKYLAKNQKEIASI  121

Query  740  DLPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSS  919
              P    A  A   P+                                  S+LPIARR+S
Sbjct  122  PRPVPNPAKTAAQEPIQTNTSSL--------------------------ASELPIARRAS  155

Query  920  LHRFLEKRKDRATARAPYQ  976
            LHRFLEKRKDR T++ PYQ
Sbjct  156  LHRFLEKRKDRITSKGPYQ  174



>emb|CBI27776.3| unnamed protein product [Vitis vinifera]
Length=217

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 72/138 (52%), Gaps = 23/138 (17%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLASK-SSPQSARGVFQTAGVDKLDLPADGAAVVA  772
             Q+TIFY G+V+VF++FPADKA+ VM LA   SSP     V  T   + +D     A  +A
Sbjct  86    QMTIFYGGQVIVFNDFPADKAKEVMRLAGMGSSP-----VPSTTVKNPID-----AGGMA  135

Query  773   TSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDR  952
              S P               P                P   +LPIAR++SLHRFLEKRKDR
Sbjct  136   PSNP------------NVVPNFANSLIQERIQRPAQPVACELPIARKASLHRFLEKRKDR  183

Query  953   ATARAPYQVHNNPLIPSK  1006
              TARAPY + N+P  P K
Sbjct  184   ITARAPYNISNSPAGPHK  201



>ref|XP_002465159.1| hypothetical protein SORBIDRAFT_01g033020 [Sorghum bicolor]
 gb|EER92157.1| hypothetical protein SORBIDRAFT_01g033020 [Sorghum bicolor]
Length=228

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 79/250 (32%), Positives = 111/250 (44%), Gaps = 56/250 (22%)
 Frame = +2

Query  281   APEKS-----NFVQTCNLLSQFLKGR-VSIRDLSHGIGVVNTEASGKFDISHGTTMDFLT  442
             AP KS     +F   C+LLS++++    +  DL   I     EA GK   +         
Sbjct  2     APAKSGEKATSFAMACSLLSRYVRQNGAAAGDLGLAI---RAEADGKRASA---------  49

Query  443   NIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGK  622
             + EK    +E   +D  PQN   G+   ++E  +             P+  QLTIFY GK
Sbjct  50    DTEKGDTTKET--MDLFPQNAGFGSEAAMKEAPDV----------REPEKRQLTIFYGGK  97

Query  623   VMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkp  802
             V+VF++FPA+KA+ +M +ASK S      V Q  G+    LP+   A V  ST +     
Sbjct  98    VLVFNDFPAEKAKDLMQMASKGS-----SVAQNPGM----LPSPTVATVTDSTKITAVPA  148

Query  803   masppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVH  982
                                          +D+P A ++SL RFLEKRKDR TA+APYQ  
Sbjct  149   APIAVVNAQKSP-----------------ADIPQAPKASLRRFLEKRKDRLTAKAPYQGS  191

Query  983   NNPLIPSKSE  1012
              +   P K E
Sbjct  192   PSDATPVKKE  201



>emb|CDX85865.1| BnaC06g22690D [Brassica napus]
Length=224

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 78/239 (33%), Positives = 120/239 (50%), Gaps = 49/239 (21%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQDQ  469
            K +F QTC+ LS++LK + S  DLS  +       + K D+ + T ++      K+ QD 
Sbjct  18   KPSFSQTCSRLSRYLKEKGSFGDLSFAM-------TSKPDV-NATGIN-----SKAAQDV  64

Query  470  EMAPIDPNPQNTVNGTSRTVEEGTNAAASI----SkeapkeapkaaQLTIFYSGKVMVFD  637
            ++       QN +  +  +      A   +      +  K  P++A LT+FYSG+VM+FD
Sbjct  65   KL-------QNDMFPSQSSFSSSFGAKEEVVKITETKVVKPEPQSAPLTLFYSGQVMLFD  117

Query  638  EFPADKARAVMLLASKSSPQSARGVFQTAGVDK------LDLPADGAAVVATSTPVDppk  799
            +FPA+KA+ V+ LA+K S   A G   TA ++        ++  +   + +   PV  P 
Sbjct  118  DFPAEKAKQVIDLANKGS---ANGF--TAELNNNQSAYTKNIAKNQKEIASIPRPVPSPV  172

Query  800  pmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
              A+  P+                      S+LPIARR+SLHRFLEKRKDR T++APYQ
Sbjct  173  KTAAQEPIQTNTSSL--------------ASELPIARRASLHRFLEKRKDRITSKAPYQ  217



>ref|XP_009105906.1| PREDICTED: protein TIFY 11B [Brassica rapa]
 emb|CDX96409.1| BnaA07g30200D [Brassica napus]
Length=274

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 113/240 (47%), Gaps = 23/240 (10%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIG-VVNTEASGKFDISHGTTMDFLTNI  448
            +G+APEKSNF + C+LLS++LK + S  D+  G+    + E +GK D  H    +    I
Sbjct  3    TGQAPEKSNFNRRCSLLSRYLKEKGSFGDIVIGLARKSDLELAGKND--HRAQQNA---I  57

Query  449  EKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVM  628
            EK+   +         Q +V  TS +          +S+      PK +QLTIF+  KV+
Sbjct  58   EKANISESRPFKLTQKQLSVGETSISSRGKAIDVVDLSEPRNVPEPKNSQLTIFFGSKVI  117

Query  629  VFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpma  808
            V++EFP DKA+ + + A+K +   A    +T     LD+     + V      +P     
Sbjct  118  VYNEFPEDKAKEI-IEAAKEANPVAVDSKKTQNHMNLDINISNKSNVVIPDLNEPTSSGN  176

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNN  988
            +             +                IARR+SLHRF  KRKDRA ARAPYQV+ N
Sbjct  177  NDDHQTKEQHQVVER----------------IARRASLHRFFAKRKDRAVARAPYQVNQN  220



>ref|XP_008353511.1| PREDICTED: protein TIFY 10B-like [Malus domestica]
Length=213

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 112/241 (46%), Gaps = 64/241 (27%)
 Frame = +2

Query  281  APEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKST  460
            A EK NF QTCNLLSQFL+ + +++                  +   TTM+ LT +E + 
Sbjct  2    AAEKLNFSQTCNLLSQFLREKRTLQ------------------VVPPTTMNLLTTMEAA-  42

Query  461  QDQEMAPIDPNPQNTVNGTSRT------VEEGTNAAASISkeapkeapkaaQLTIFYSGK  622
                    D NP +    T  +       +  T    ++     ++   AA +TIF+ G+
Sbjct  43   --------DSNPAHQAAQTPSSKPNMELFQHFTKGPEAV--LGDQQPGSAAPMTIFFGGQ  92

Query  623  VMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkp  802
            V+VF++  A+KA+ +M LA+  S +S+ G F    V+KL    + + VVA +        
Sbjct  93   VLVFNDLQAEKAKEIMDLATIGSSKSS-GRF----VEKL-ASGNQSNVVAKNN-------  139

Query  803  masppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVH  982
                                    P    SDLPIARR+SLH+FL KRK+R  A APYQ++
Sbjct  140  ----------------YQEIQKVQPQAAASDLPIARRASLHKFLAKRKERVAAIAPYQLN  183

Query  983  N  985
            N
Sbjct  184  N  184



>gb|EYU45899.1| hypothetical protein MIMGU_mgv1a013086mg [Erythranthe guttata]
Length=201

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 70/151 (46%), Gaps = 18/151 (12%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
             QLTIFYSG V+VFD++PA+KA  ++  A+        G+       K   P+ G A   T
Sbjct  52    QLTIFYSGGVLVFDDYPAEKAEELVAFAANGG---GSGILSNTSWAK---PSSGGAA-ET  104

Query  776   STPVDppkpmasppplppppvppptqpaaaapap-----------apGGSDLPIARRSSL  922
             STP +   P                  +  A                  SDLPIARRSSL
Sbjct  105   STPGESQLPPRPGSRKAAGVGITSNTASGGAAEVPPVENRGSTLPEANDSDLPIARRSSL  164

Query  923   HRFLEKRKDRATARAPYQVHNNPLIPSKSER  1015
             HRFL KRKDRA AR PYQ+   P   SK + 
Sbjct  165   HRFLGKRKDRAAARGPYQLQEQPASSSKGDE  195



>gb|EMT18709.1| hypothetical protein F775_32219 [Aegilops tauschii]
Length=221

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 74/249 (30%), Positives = 111/249 (45%), Gaps = 74/249 (30%)
 Frame = +2

Query  287   EKSNFVQTCNLLSQFLK--------GRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLT  442
             EKS F  TC+LLS+++K        G V + D+S    VV  E  G F     TTM+ L+
Sbjct  21    EKSGFAATCSLLSRYMKEKKGGALQGLVGL-DMSPPAAVVVGE--GAFQPP--TTMNLLS  75

Query  443   NIEK-STQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSG  619
              +E+ +  D E+     +    +  T+   + G +A                QLTIFY G
Sbjct  76    GLEEPNAADVELRLEKSSVGQFLKATTDNQDAGEDA---------------HQLTIFYGG  120

Query  620   KVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppk  799
             KV+V D FP+ K + ++ +A  +  ++                  G++ +A  +P  P +
Sbjct  121   KVVVVDNFPSTKVKDLLQMADGAGDKT------------------GSSSLAQQSPPQPAQ  162

Query  800   pmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
                                            DLPIARR+SLHRFLEKRK R  A+APYQ+
Sbjct  163   NAL---------------------------PDLPIARRNSLHRFLEKRKGRIVAKAPYQI  195

Query  980   HNNPLIPSK  1006
             +++   PSK
Sbjct  196   NSSSAAPSK  204



>ref|XP_006452842.1| hypothetical protein CICLE_v10008653mg [Citrus clementina]
 ref|XP_006452844.1| hypothetical protein CICLE_v10008653mg [Citrus clementina]
 gb|ESR66082.1| hypothetical protein CICLE_v10008653mg [Citrus clementina]
 gb|ESR66084.1| hypothetical protein CICLE_v10008653mg [Citrus clementina]
Length=349

 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 103/225 (46%), Gaps = 37/225 (16%)
 Frame = +2

Query  158  ISRKLQSLPAILAFG*HPVSLLRRPNMSGKHLLSDVKISGRAPEKSNFVQTCNLLSQFLK  337
            + R+LQ    I A G   +S L   +M+     S  ++S   PEKS+F QTC+LLSQ+LK
Sbjct  71   LQRQLQRTSFIFARGFPLLSWLNTTSMA-----SSSEMSVNLPEKSSFSQTCSLLSQYLK  125

Query  338  GRVSIRDLSHGIGVVNTEASGKFDISH---GTTMDFLTNIEKSTQD----QEMAPIDPNP  496
               S  DLS GI   N EA+G  +I      TTM+     + S QD      +AP +   
Sbjct  126  EGGSFGDLSLGISS-NIEANGVPEIPRRPAATTMNLFPVSDNSGQDVSVRNMVAPRNWES  184

Query  497  QNTV---------NGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPA  649
             N           N T   ++   N  A           + AQ+TIFY G+V+ F++FPA
Sbjct  185  MNLFPQQAGFAPKNDTPNMIDSSLNKPAP----------QTAQMTIFYGGQVIAFNDFPA  234

Query  650  DKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTP  784
            DKA  +M LAS  S  S            + LPA G    A S P
Sbjct  235  DKANEIMQLASNGSSLS-----HGTAYPPMQLPAQGYNSFAASLP  274



>emb|CDY26697.1| BnaA06g13250D [Brassica napus]
Length=253

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 111/239 (46%), Gaps = 33/239 (14%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFL----TNIEKS  457
            K +F  TC+ LSQ+LK   S  DLS G+     E +G       TTM       +N+   
Sbjct  17   KPSFSLTCSRLSQYLKENGSFGDLSLGMSC-KPETNG-MSRKPTTTMSLFPCEASNVGSM  74

Query  458  TQDQEMAPIDPNPQNTVNGTSRTV---EEGTNAAASISkeapkeapkaaQLTIFYSGKVM  628
               Q++ P +  P+     +S +    E       + +  + K  P+ A LTIFY G+V+
Sbjct  75   AAAQDVKPKNLFPRQPSFSSSSSSIPKEVVPKMTQTTTTRSLKPEPQTAPLTIFYGGQVI  134

Query  629  VFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpma  808
            VF++F A+KA+ VM LASK +  +  G   T   +    P     ++ T++         
Sbjct  135  VFNDFSAEKAKEVMNLASKGTANTFTGFKSTLNNNIAPTPNQVPHLMKTAS---------  185

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHN  985
                                 + A    +LPIARR+SLHRFL KRKDR T++APYQ+ +
Sbjct  186  ---------------QDPKQTSSAAMACELPIARRASLHRFLAKRKDRVTSKAPYQLSD  229



>ref|XP_009408851.1| PREDICTED: protein TIFY 10B-like [Musa acuminata subsp. malaccensis]
Length=268

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 82/244 (34%), Positives = 108/244 (44%), Gaps = 27/244 (11%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSI-RDLSHGIGVVNTEA-SGKFDISHG--TTMDFLTNIEKS  457
            KSNF   C+LLSQ++K + S+  DL  G+     +A  GK +      TTM  L   + S
Sbjct  15   KSNFAVVCSLLSQYIKEKGSVVADLGLGVPPPPLDAPKGKSEAFRPPPTTMMLLPGADVS  74

Query  458  TQDQ----------EMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTI  607
              +            +  ++  PQ    G S        A       +    PK AQLTI
Sbjct  75   GGEGEGERTGEEELRVDTMELFPQRAGFGPSSVT--ALAADGKPGDASDVREPKRAQLTI  132

Query  608  FYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPV  787
            FY  KV+VFD FP+DK + +M LASK +       +          P+  A   A    V
Sbjct  133  FYGDKVLVFDSFPSDKVKNLMQLASKVTSTMQNSCYVE--------PSSSALAAAV---V  181

Query  788  DppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARA  967
            D      S               AA +       SDLPIAR+SSL RFLEKRKDR +A++
Sbjct  182  DHHPTNLSNQETKFTTSSVSNSVAAHSDLERTAQSDLPIARKSSLQRFLEKRKDRISAKS  241

Query  968  PYQV  979
            PYQV
Sbjct  242  PYQV  245



>ref|XP_008380785.1| PREDICTED: protein TIFY 11B-like [Malus domestica]
Length=204

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 114/258 (44%), Gaps = 80/258 (31%)
 Frame = +2

Query  281   APEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIE---  451
             A EK NF QTCNLLSQFLK + +++                  +   TTM+ LT +E   
Sbjct  2     AAEKLNFAQTCNLLSQFLKEKRTLQ------------------VIPPTTMNLLTTMEAAA  43

Query  452   -----KSTQDQEMAP-IDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
                  ++ Q     P ID  PQ T    +   ++   +AA              Q+TIFY
Sbjct  44    SNSVDQTAQTPSSKPSIDLLPQFTKYPEAALGDQQPGSAA--------------QMTIFY  89

Query  614   SGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDp  793
              G+V+VF++  A+KA+ +M LA+  S + + G  +  G +      + + VVA +   + 
Sbjct  90    GGQVLVFNDLQAEKAKEIMGLATTGSSKISAGFVKKLGSE------NQSNVVAENKSQEI  143

Query  794   pkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPY  973
               P                                  ARR+SLH+FL KRK+R TA APY
Sbjct  144   KVPTQ--------------------------------ARRASLHKFLAKRKERVTAVAPY  171

Query  974   QVHNN-PLIPSKSERPSS  1024
             Q++N     P+KS+  +S
Sbjct  172   QLNNQRASSPAKSDEQTS  189



>emb|CDY41023.1| BnaC05g14810D [Brassica napus]
Length=254

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 113/242 (47%), Gaps = 38/242 (16%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFL----TNIEKS  457
            K +F  TC+ LSQ+LK   S  DLS G+     E +G       TTM       TN+   
Sbjct  17   KPSFSLTCSRLSQYLKENGSFGDLSLGMSC-KPETNG-MSRKPTTTMSLFPCEATNVGSM  74

Query  458  TQDQEMAPIDPNPQNTVNGTSRT------VEEGTNAAASISkeapkeapkaaQLTIFYSG  619
               Q++ P +  P+     +S +      V + T+A +S    + K  P+ A LTIFY G
Sbjct  75   AAAQDVKPKNLFPRQPSFSSSSSSIPKDDVLKMTHATSS--SRSVKPEPQTAPLTIFYGG  132

Query  620  KVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppk  799
            +V+VF++F A+KA+ VM LA+K +  +  G   T        P     ++  +T      
Sbjct  133  QVIVFNDFSAEKAKEVMNLANKGTANTFTGFTSTLNNSIAPTPNQVPHLMKAAT------  186

Query  800  pmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQV  979
                                    + A    +LPIARR+SLHRFL KRKDR T++APYQ+
Sbjct  187  ------------------QDPKQTSSAAMACELPIARRASLHRFLAKRKDRVTSKAPYQL  228

Query  980  HN  985
             +
Sbjct  229  SD  230



>gb|KCW68866.1| hypothetical protein EUGRSUZ_F024561 [Eucalyptus grandis]
Length=176

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 87/199 (44%), Gaps = 25/199 (13%)
 Frame = +2

Query  428   MDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTI  607
             M+ L N+E       +AP  PN  +  +  +    E  N    + K+   +  K  Q+TI
Sbjct  1     MNLLKNLEC------LAPGSPNVSDQSSKANSIANENLN---DLRKDVNNKTVKTDQITI  51

Query  608   FYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPV  787
             FY+G V VFD  P DK + VM  A+K SP    G F + G    +    G   +  ST  
Sbjct  52    FYAGSVHVFDGLPVDKMKEVMNYAAKFSPCHISGHFVSNGGGSSET---GHEKLMAST--  106

Query  788   DppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARA  967
                                 T             SDLPIARR+SL+RFL KRKDRA  RA
Sbjct  107   ----------QNSSIGAGRSTYQELLQAKTEAAASDLPIARRASLNRFLSKRKDRALVRA  156

Query  968   PYQVHNNPLIPSKSERPSS  1024
             PY V N+P   S  E  SS
Sbjct  157   PY-VRNSPTAASTHEEGSS  174



>ref|XP_010235620.1| PREDICTED: protein TIFY 10B-like isoform X2 [Brachypodium distachyon]
Length=235

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 68/139 (49%), Gaps = 22/139 (16%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
             QLTIFY GKV+VF++FPAD A+ ++ LASK +P                       V  T
Sbjct  100   QLTIFYGGKVLVFNDFPADMAKNLIQLASKGNP----------------------VVQNT  137

Query  776   STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
             + P        +   +  P    P     A     P  +DLPIAR++SLHRFLEKRKDR 
Sbjct  138   TVPTPVIDSNKAETVVQAPASSLPGAQNDAPKPARPNAADLPIARKASLHRFLEKRKDRL  197

Query  956   TARAPYQVHNNPLIPSKSE  1012
              A APYQ   +   P K E
Sbjct  198   HASAPYQASPSDATPVKKE  216



>ref|NP_001130163.1| uncharacterized protein LOC100191257 [Zea mays]
 gb|ACF78303.1| unknown [Zea mays]
 gb|ADX60203.1| TIFY transcription factor [Zea mays]
 tpg|DAA40153.1| TPA: putative tify domain/CCT motif transcription factor family 
protein [Zea mays]
Length=227

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 112/247 (45%), Gaps = 55/247 (22%)
 Frame = +2

Query  269  ISGRAP----EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDF  436
            ++G AP    +K++F  TC+LLSQ++K +        G   +   A+G+      TTM+ 
Sbjct  1    MAGSAPATAMDKTSFATTCSLLSQYVKEKKGGLLQGLGALAM-APAAGEGAFRPPTTMNL  59

Query  437  LTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYS  616
            L+ ++        AP +   +    G  +  ++ T       + A +E  +A QLTIFY 
Sbjct  60   LSALDD-------APAEERSEKATAGEPKHQDKCTGGNPR-EEAAGEEEEEAQQLTIFYG  111

Query  617  GKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDpp  796
            G+V+VFD FP+ K   ++ + S              GVD+      G A V T +     
Sbjct  112  GRVVVFDMFPSAKVEDLLQIMSPGG----------DGVDRA-----GGATVPTRS-----  151

Query  797  kpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
                                           SDLPIARR+SLHRFLEKRKDR TA+APYQ
Sbjct  152  ----------------------LHRPSHDSLSDLPIARRNSLHRFLEKRKDRITAKAPYQ  189

Query  977  VHNNPLI  997
              N+ ++
Sbjct  190  QVNSSVV  196



>gb|AGT80155.1| PnFL-2 [Ipomoea trifida]
Length=228

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 80/143 (56%), Gaps = 18/143 (13%)
 Frame = +2

Query  257  SDVKISGR-APEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMD  433
            S+V   GR + ++SNF  TCN LSQ+LK   S  DLS G+   N   SG    +   TMD
Sbjct  4    SEVSDYGRFSGQRSNFSHTCNRLSQYLKENGSFGDLSLGLSR-NFVPSG----NPRPTMD  58

Query  434  FLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
             L  IEKS Q+    P++  P         T EE T     +     K  P+ AQ+TIFY
Sbjct  59   LLPMIEKSGQNSVHKPMNLFP---------TREESTKK---MDTSVTKGGPEKAQMTIFY  106

Query  614  SGKVMVFDEFPADKARAVMLLAS  682
             G+V+VF++FPADKA+ +MLLAS
Sbjct  107  GGQVIVFNDFPADKAKEIMLLAS  129



>dbj|BAG68657.1| jasmonate ZIM-domain protein 3 [Nicotiana tabacum]
Length=207

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 70/133 (53%), Gaps = 34/133 (26%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRV-SIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQ  463
            +KSNF QTCNLLSQ+LK +  S  DLS GI    T           TTMD L  IEK  +
Sbjct  20   QKSNFSQTCNLLSQYLKEKKGSFGDLSLGIHRAGT-----------TTMDLLPMIEKFGE  68

Query  464  DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEF  643
                     NPQ ++N   +T  +     A              Q+TIFY G+V+VF++F
Sbjct  69   S--------NPQKSMNLFPQTEAKSEPEKA--------------QMTIFYGGQVIVFNDF  106

Query  644  PADKARAVMLLAS  682
            PADKA+ +ML+AS
Sbjct  107  PADKAKEIMLMAS  119


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  893  DLPIARRSSLHRFLEKRKDRATARAPYQVHN  985
            DLPIARR+SL RFLEKRKDR TA+APYQ+ N
Sbjct  150  DLPIARRASLTRFLEKRKDRLTAKAPYQLSN  180



>ref|XP_003578176.2| PREDICTED: protein TIFY 10A [Brachypodium distachyon]
Length=226

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 73/238 (31%), Positives = 108/238 (45%), Gaps = 54/238 (23%)
 Frame = +2

Query  293  SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHG-----TTMDFLTNIEKS  457
            S+F  TCNLLS++L+ +     +S   G+V+   +   D+  G     TTM+ L+ +E++
Sbjct  10   SSFAVTCNLLSRYLREKKGGLAVS---GIVDMPPAA--DVGGGAFRPPTTMNLLSGLEET  64

Query  458  TQDQEMA-PIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVF  634
            +  +  A  ++ + +    G         N  A  +        +A QLTIFY GKV+V 
Sbjct  65   SAAKTSAVDVELSLEKASTGQLLGAFPTENQDAE-NTRELAAKEEARQLTIFYGGKVVVV  123

Query  635  DEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasp  814
            D FP+ K + ++ +A+             AG   LD    G AV   S P      +   
Sbjct  124  DNFPSAKVKELLQMAN-------------AGDGALDKAGTGNAV-PQSLPQPAQSSL---  166

Query  815  pplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNN  988
                                      DLPIARR+SLHRFLEKRK R  A+APYQVH++
Sbjct  167  -------------------------PDLPIARRNSLHRFLEKRKGRVIAKAPYQVHSS  199



>gb|KCW79370.1| hypothetical protein EUGRSUZ_C00785 [Eucalyptus grandis]
Length=211

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 93/186 (50%), Gaps = 11/186 (6%)
 Frame = +2

Query  419  GTTMDFLTNIEK-STQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaa  595
             TTM+     E  S + + +  +D  PQ    G+++      N ++SI KE         
Sbjct  6    ATTMNLFPVCEGGSAEARNVKFMDLFPQQAGFGSTKEDVSKMNNSSSIKKEPETA-----  60

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
            Q+TIFY+G+V+V ++FPA+KA+ VML ASK S  S       A    L       A    
Sbjct  61   QMTIFYAGQVIVLNDFPAEKAKEVMLAASKGSSLSQ----HAAAAPNLAKSKPAFAPNYA  116

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
             +PV+    ++S P   P       Q      A      DLPIARR+SLHRFLEKRKDR 
Sbjct  117  KSPVESGGVVSSSPVPVPSLGANAIQEHGGRLAEPLA-CDLPIARRASLHRFLEKRKDRL  175

Query  956  TARAPY  973
            TA+APY
Sbjct  176  TAKAPY  181



>ref|XP_009104735.1| PREDICTED: protein TIFY 10B-like isoform X2 [Brassica rapa]
Length=222

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 71/247 (29%), Positives = 111/247 (45%), Gaps = 67/247 (27%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSIRDLSHG------IGVVNTEASGKFDISHG---TTMDFLT  442
            K +F QTC+ LS++LK + S  DLS        +  +N++A+    + +        F +
Sbjct  18   KPSFSQTCSRLSRYLKEKGSCGDLSFSMTSKPDVNGINSKAAQDVKLQNDMFPCQSSFSS  77

Query  443  NI---EKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
            +    E+  +  E  P+ P  Q+                                LT+FY
Sbjct  78   SFGVKEEVVKITETKPVKPESQSA------------------------------PLTLFY  107

Query  614  SGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDK------LDLPADGAAVVAT  775
            SG+VM+FD+FPA+KA+ V+ LA+K +   A G   TA ++        ++  +   + + 
Sbjct  108  SGQVMLFDDFPAEKAKQVIDLANKGN---ANGF--TAELNNNQSAYTKNIAKNQKEIASI  162

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
              PV  P    +  P+                      S+LPIARR+SLHRFLEKRKDR 
Sbjct  163  PRPVPSPAKSPAQEPIQTNTSSL--------------ASELPIARRASLHRFLEKRKDRI  208

Query  956  TARAPYQ  976
            T++ PYQ
Sbjct  209  TSKGPYQ  215



>gb|KCW79369.1| hypothetical protein EUGRSUZ_C00785 [Eucalyptus grandis]
Length=221

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 93/186 (50%), Gaps = 11/186 (6%)
 Frame = +2

Query  419  GTTMDFLTNIEK-STQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaa  595
             TTM+     E  S + + +  +D  PQ    G+++      N ++SI KE         
Sbjct  16   ATTMNLFPVCEGGSAEARNVKFMDLFPQQAGFGSTKEDVSKMNNSSSIKKEPETA-----  70

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
            Q+TIFY+G+V+V ++FPA+KA+ VML ASK S  S       A    L       A    
Sbjct  71   QMTIFYAGQVIVLNDFPAEKAKEVMLAASKGSSLSQ----HAAAAPNLAKSKPAFAPNYA  126

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
             +PV+    ++S P   P       Q      A      DLPIARR+SLHRFLEKRKDR 
Sbjct  127  KSPVESGGVVSSSPVPVPSLGANAIQEHGGRLAEPLA-CDLPIARRASLHRFLEKRKDRL  185

Query  956  TARAPY  973
            TA+APY
Sbjct  186  TAKAPY  191



>ref|XP_009149390.1| PREDICTED: protein TIFY 10A-like isoform X2 [Brassica rapa]
Length=253

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 108/232 (47%), Gaps = 32/232 (14%)
 Frame = +2

Query  308  TCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFL----TNIEKSTQDQEM  475
            TC+ LSQ+LK   S  DLS G+     E +G       TTM       +N+      Q++
Sbjct  24   TCSRLSQYLKENGSFGDLSLGMSC-KPETNG-MSRKPTTTMSLFPCEASNVGSMAAAQDV  81

Query  476  AP--IDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPA  649
             P  + P   +  + +S   +E        +  + K  P+ A LTIFY G+V+VF++F A
Sbjct  82   KPKNLFPRQPSFSSSSSSIPKEVVPKMTQTTTRSLKPEPQTAPLTIFYGGQVIVFNDFSA  141

Query  650  DKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasppplpp  829
            +KA+ VM LASK +  +  G   T   +    P     ++ T++                
Sbjct  142  EKAKEVMNLASKGTANTFTGFKSTLNNNIAPTPNQVPHLMKTAS----------------  185

Query  830  ppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHN  985
                          + A    +LPIARR+SLHRFL KRKDR T++APYQ+ +
Sbjct  186  --------QDPKQTSSAAMACELPIARRASLHRFLAKRKDRVTSKAPYQLSD  229



>ref|XP_009104734.1| PREDICTED: protein TIFY 10B-like isoform X1 [Brassica rapa]
Length=224

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 116/237 (49%), Gaps = 45/237 (19%)
 Frame = +2

Query  290  KSNFVQTCNLLSQFLKGRVSIRDLSHGI-GVVNTEASGKFDISHGTTMDF-LTNIEKSTQ  463
            K +F QTC+ LS++LK + S  DLS  +    +  ASG   I+     D  L N      
Sbjct  18   KPSFSQTCSRLSRYLKEKGSCGDLSFSMTSKPDVNASG---INSKAAQDVKLQN------  68

Query  464  DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEF  643
              +M P     Q++ + +    EE      +   +  K   ++A LT+FYSG+VM+FD+F
Sbjct  69   --DMFPC----QSSFSSSFGVKEEVVKITET---KPVKPESQSAPLTLFYSGQVMLFDDF  119

Query  644  PADKARAVMLLASKSSPQSARGVFQTAGVDK------LDLPADGAAVVATSTPVDppkpm  805
            PA+KA+ V+ LA+K +   A G   TA ++        ++  +   + +   PV  P   
Sbjct  120  PAEKAKQVIDLANKGN---ANGF--TAELNNNQSAYTKNIAKNQKEIASIPRPVPSPAKS  174

Query  806  asppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQ  976
             +  P+                      S+LPIARR+SLHRFLEKRKDR T++ PYQ
Sbjct  175  PAQEPIQTNTSSL--------------ASELPIARRASLHRFLEKRKDRITSKGPYQ  217



>ref|XP_006581124.1| PREDICTED: protein TIFY 10B-like isoform X2 [Glycine max]
Length=129

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 69/139 (50%), Gaps = 40/139 (29%)
 Frame = +2

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLA----SKSSPQSARGVFQTAGVDKLDLPADGAA  763
            QLTIFY+G+V+VFD+FPADK + +M LA      S  Q++     T      + P+    
Sbjct  9    QLTIFYNGQVVVFDDFPADKVQEMMSLALATKGISQSQNSSAYAHTHNQQGNNHPSTIPN  68

Query  764  VV--ATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLE  937
            ++  A STP+                                  +D+PI R++SLHRFLE
Sbjct  69   IIPQAPSTPI---------------------------------ANDMPIGRKASLHRFLE  95

Query  938  KRKDRATARAPYQVHNNPL  994
            KRKDR  A+APYQ  N P+
Sbjct  96   KRKDRIAAKAPYQT-NRPI  113



>emb|CDX73289.1| BnaC05g28170D [Brassica napus]
Length=188

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 72/138 (52%), Gaps = 5/138 (4%)
 Frame = +2

Query  599   LTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATS  778
             LTI Y+G+V+VF++F A+KA+ VM LASK +  +  G   T     ++LP     V    
Sbjct  41    LTILYNGEVIVFNDFSAEKAKEVMDLASKGTANTFTGFTCT-----VNLPKSQTEVRTNI  95

Query  779   TPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRAT  958
              P     P         P +      A          ++LPIARR+SLHRFL KRKDR T
Sbjct  96    APTSNQVPHLIKTATQEPIMSSSAAMACFLTNILSFLTELPIARRASLHRFLAKRKDRVT  155

Query  959   ARAPYQVHNNPLIPSKSE  1012
             ++APYQ+ +     SK++
Sbjct  156   SKAPYQLSDPAKASSKTQ  173



>emb|CDX96772.1| BnaA08g23150D [Brassica napus]
Length=267

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 104/237 (44%), Gaps = 38/237 (16%)
 Frame = +2

Query  284  PEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQ  463
            PEKSNF + C+LLS++LK + S  ++   +G+V           +    +    + K+  
Sbjct  12   PEKSNFTRRCSLLSRYLKEKGSFGNID--LGLVRKPGPDLGLPGNSDQQEKQKVMHKANS  69

Query  464  DQEMAPIDPNPQNTVNGTSR--TVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFD  637
            + +   +   P ++  G ++   + E +   +S             QLTIF+ GKV+V++
Sbjct  70   ELKALNVLGEPSSSFGGKAKATNLSEPSEPVSS-------------QLTIFFGGKVLVYN  116

Query  638  EFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmaspp  817
            EFP+DKA+ ++ +A ++   +   +     V K D       +   + P D         
Sbjct  117  EFPSDKAKEIIQVAKEAKSVTDINIQTQINVQK-DHNKSNMVLPDLNEPTDTADVKQQQQ  175

Query  818  plppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNN  988
                                        IARR+SLHRF  KRKDRA ARAPYQV+ N
Sbjct  176  QQNQLVER--------------------IARRASLHRFFAKRKDRAVARAPYQVNQN  212



>ref|XP_009149389.1| PREDICTED: protein TIFY 10A-like isoform X1 [Brassica rapa]
Length=254

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 72/233 (31%), Positives = 108/233 (46%), Gaps = 33/233 (14%)
 Frame = +2

Query  308  TCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFL----TNIEKSTQDQEM  475
            TC+ LSQ+LK   S  DLS G+     E +G       TTM       +N+      Q++
Sbjct  24   TCSRLSQYLKENGSFGDLSLGMSC-KPETNG-MSRKPTTTMSLFPCEASNVGSMAAAQDV  81

Query  476  APIDPNPQNTVNGTSRTV---EEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFP  646
             P +  P+     +S +    E       + +  + K  P+ A LTIFY G+V+VF++F 
Sbjct  82   KPKNLFPRQPSFSSSSSSIPKEVVPKMTQTTTTRSLKPEPQTAPLTIFYGGQVIVFNDFS  141

Query  647  ADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasppplp  826
            A+KA+ VM LASK +  +  G   T   +    P     ++ T++               
Sbjct  142  AEKAKEVMNLASKGTANTFTGFKSTLNNNIAPTPNQVPHLMKTAS---------------  186

Query  827  pppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHN  985
                           + A    +LPIARR+SLHRFL KRKDR T++APYQ+ +
Sbjct  187  ---------QDPKQTSSAAMACELPIARRASLHRFLAKRKDRVTSKAPYQLSD  230



>ref|XP_007012594.1| Jasmonate-zim-domain protein 1, putative [Theobroma cacao]
 gb|EOY30213.1| Jasmonate-zim-domain protein 1, putative [Theobroma cacao]
Length=274

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 86/153 (56%), Gaps = 13/153 (8%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIE  451
            S R+P+K +F QTC+LLSQ+LK + S  DL+ G+   N EA+G  +    T   F  N E
Sbjct  12   SARSPDKPSFTQTCSLLSQYLKEKGSFGDLTLGM-TCNVEANGTPETLRPTMNLFPVN-E  69

Query  452  KS--------TQDQEMAPIDPNPQNTVNGTSRTVEEG---TNAAASISkeapkeapkaaQ  598
             S           + +  +D  PQ     +    ++G    +++ +   ++    P+ AQ
Sbjct  70   NSGDVSGRNLAAARNLRSMDLFPQQAGFSSPAAKDDGLKRVDSSVNSMNKSAAGEPQTAQ  129

Query  599  LTIFYSGKVMVFDEFPADKARAVMLLASKSSPQ  697
            +TIFY G+V+VF++FPADKA+ +MLLASK S Q
Sbjct  130  MTIFYGGQVIVFNDFPADKAKEIMLLASKGSSQ  162


 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  893   DLPIARRSSLHRFLEKRKDRATARAPYQVHNNPLIPSK  1006
             DLPIARR+SLHRFLEKRKDR T RAPYQ+ ++   PSK
Sbjct  221   DLPIARRASLHRFLEKRKDRITTRAPYQISSSRASPSK  258



>emb|CDY48300.1| BnaC05g13540D [Brassica napus]
Length=290

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 70/245 (29%), Positives = 112/245 (46%), Gaps = 59/245 (24%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRVSIRDLSHGI-------GVV--NTEASGKFDI--SHGTTMD  433
            EKSNF + C+LLS++LK + S  +++ G+        V+  N++  GK     S   T+D
Sbjct  13   EKSNFTRRCSLLSRYLKEKGSFGNINLGLIRKPNSDRVLSGNSDPPGKQHKADSETKTLD  72

Query  434  FLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
                + K     E +P   N  + ++  S   E G++                 QLTIF+
Sbjct  73   VFQRVLKG----EPSPGKANEDSNLSNPS---EPGSS-----------------QLTIFF  108

Query  614  SGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDp  793
             GKV+V++EFP DKA+ ++ +A ++ P +   +     V+  D  ++   +   + P + 
Sbjct  109  GGKVLVYNEFPTDKAKEILEVAKQAKPATDINIKTQINVENNDKKSN-MVLPDLNEPTNS  167

Query  794  pkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPY  973
               +     +                          IARR+SLHRF  KRKDRA ARAPY
Sbjct  168  VDIVNQQNQVVER-----------------------IARRASLHRFFAKRKDRAVARAPY  204

Query  974  QVHNN  988
            QV+ N
Sbjct  205  QVNQN  209



>ref|XP_006581123.1| PREDICTED: protein TIFY 10B-like isoform X1 [Glycine max]
Length=160

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 71/139 (51%), Gaps = 40/139 (29%)
 Frame = +2

Query  596  QLTIFYSGKVMVFDEFPADKARAVM--LLASK--SSPQSARGVFQTAGVDKLDLPADGAA  763
            QLTIFY+G+V+VFD+FPADK + +M   LA+K  S  Q++     T      + P+    
Sbjct  40   QLTIFYNGQVVVFDDFPADKVQEMMSLALATKGISQSQNSSAYAHTHNQQGNNHPSTIPN  99

Query  764  VV--ATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLE  937
            ++  A STP+                                  +D+PI R++SLHRFLE
Sbjct  100  IIPQAPSTPI---------------------------------ANDMPIGRKASLHRFLE  126

Query  938  KRKDRATARAPYQVHNNPL  994
            KRKDR  A+APYQ  N P+
Sbjct  127  KRKDRIAAKAPYQT-NRPI  144



>ref|XP_009346307.1| PREDICTED: protein TIFY 10B-like [Pyrus x bretschneideri]
Length=213

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 113/252 (45%), Gaps = 65/252 (26%)
 Frame = +2

Query  290   KSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQDQ  469
             K NF QTCNLLSQFL+ + +++                  +   TTM+ LT +E +    
Sbjct  5     KLNFSQTCNLLSQFLREKRTLQ------------------VVPPTTMNLLTTMEAAAS--  44

Query  470   EMAPIDPNPQNTVNGTSRT------VEEGTNAAASISkeapkeapkaaQLTIFYSGKVMV  631
                    NP + V  T  +       +  T    ++     ++    A +T+FY G+V+V
Sbjct  45    -------NPAHQVAQTPSSKPSIDLFQHFTKGPEAV--LGNQQPGSVAPMTVFYGGQVLV  95

Query  632   FDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmas  811
             F+   A+KA+ +M LA   S +S+ G F    V+KL    + + VVA +           
Sbjct  96    FNNLQAEKAKEIMDLAIIGSSKSS-GRF----VEKLA-SGNQSNVVAKNN----------  139

Query  812   ppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNP  991
                                  P    SDLPIARR+SLH+FL KRK+R  A APYQ+ N  
Sbjct  140   -------------YQEIQKVQPQAAASDLPIARRASLHKFLAKRKERVAAIAPYQLKNQK  186

Query  992   L-IPSKSERPSS  1024
                P+KS+  +S
Sbjct  187   ASSPAKSDEQTS  198



>gb|AFU90901.1| jasmonate ZIM domain-containing protein, partial [Sonneratia 
apetala]
Length=172

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 67/141 (48%), Gaps = 29/141 (21%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLA----SKSSPQSARGVFQTAGVDKLDLPADGAA  763
             Q+TIFY+G+VMVF++FPA+K + +M+LA    S + P      F    + +  +      
Sbjct  57    QMTIFYAGQVMVFNDFPAEKVKEIMMLASKASSSTGPNPNLAAFSGPNLVQNQM---KPG  113

Query  764   VVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKR  943
             ++    P+                                  SDLPIARR+SLHRFLEKR
Sbjct  114   LMIPRNPIQDRIQRPVETIT----------------------SDLPIARRASLHRFLEKR  151

Query  944   KDRATARAPYQVHNNPLIPSK  1006
             KDR +AR+PY        PSK
Sbjct  152   KDRISARSPYSAATTEAPPSK  172



>ref|XP_010529816.1| PREDICTED: protein TIFY 10A-like [Tarenaya hassleriana]
 ref|XP_010529824.1| PREDICTED: protein TIFY 10A-like [Tarenaya hassleriana]
Length=253

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 81/264 (31%), Positives = 116/264 (44%), Gaps = 50/264 (19%)
 Frame = +2

Query  278   RAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHG-------TTMDF  436
             R PEKS+F    + LS++LK   +  DLS        E + K D++ G       TTM+ 
Sbjct  14    RLPEKSSFSHKFSRLSRYLKENGTFGDLS-------LEMTCKPDVNGGSVMSRQPTTMN-  65

Query  437   LTNIEKSTQD----QEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLT  604
             L   E  ++D    Q++      P+     +S +     +       ++     + AQ+T
Sbjct  66    LFPCEAPSKDSVAAQDIKTKSLFPRQPSFSSSSSSAPKEDVCKITDSQSVMPESQTAQMT  125

Query  605   IFYSGKVMVFDEFPADKARAVM-LLASKSSPQSARGVFQTAGV-DKLDLPADGAAVVATS  778
             IFY G+VMVF++F A+KA+ VM L  S  S    +   +T         P        T 
Sbjct  126   IFYGGQVMVFNDFSAEKAKEVMKLAGSGKSHMGFKNQTETMSAGHHCPNPVPNTGNSLTQ  185

Query  779   TPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRAT  958
              P  P                               G +LPIARR+SLHRFLEKRKDR T
Sbjct  186   EPCQPFATQI--------------------------GCELPIARRASLHRFLEKRKDRIT  219

Query  959   ARAPYQVH--NNPL-IPSKSERPS  1021
             ++APYQV   + P   PS  ++PS
Sbjct  220   SKAPYQVGGPDEPFDKPSTEDKPS  243



>ref|XP_010459578.1| PREDICTED: protein TIFY 10A-like [Camelina sativa]
Length=266

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 80/251 (32%), Positives = 125/251 (50%), Gaps = 19/251 (8%)
 Frame = +2

Query  254  LSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMD  433
            +S+   S R   K +F  TC+ LSQ+LK   S  DL+ G+     + +G    S   T  
Sbjct  1    MSEFVASRRFTGKPSFSLTCSRLSQYLKENGSFGDLTLGMAC-KPDVNGTLGNSRQPTAT  59

Query  434  F-LTNIEKSTQD-------QEMAPIDPNP-QNTVNGTSRTVEEGTNAAASISkeapkeap  586
              L   E S  D       Q++ P +  P Q++ + +S +V +      + +  + K+  
Sbjct  60   MSLFPCEASNMDSMAAAAAQDVKPKNLFPRQSSFSSSSSSVPKEDVLKMTQTTRSVKQES  119

Query  587  kaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAV  766
            + A LTIFY+G+V+V+++F A+KA+ VM LASK +  +  G       +           
Sbjct  120  QTAPLTIFYAGQVIVYNDFSAEKAKEVMTLASKGTANTFTGFTSNLNNNNNQ-------S  172

Query  767  VATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRK  946
            VA +TP         P  +P P      +P  ++  P     +LPI RR+SLHRFLEKRK
Sbjct  173  VAKTTPQTSNVVATIPNQVPHPKKTATQEPILSSSTPMT--CELPIVRRASLHRFLEKRK  230

Query  947  DRATARAPYQV  979
            +R T++APYQ+
Sbjct  231  NRVTSKAPYQL  241



>emb|CDX72916.1| BnaC06g33640D [Brassica napus]
Length=271

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 104/240 (43%), Gaps = 26/240 (11%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIE  451
            +G+APEKSNF +  +LLS++LK + S  D+  G+            ++         N  
Sbjct  3    TGQAPEKSNFNRRRSLLSRYLKEKGSFGDIDIGLA-----RKSDPQLAGNNNHRAQQNAI  57

Query  452  KSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNA-AASISkeapkeapkaaQLTIFYSGKVM  628
            K     E  P     +    G + T   G       +S+      PK +QLTIF+  KV+
Sbjct  58   KKANISESRPFKLTQKQLSVGETSTSSRGKAIDVVYLSEPRNVPEPKNSQLTIFFGSKVI  117

Query  629  VFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpma  808
            V++EFP DKA+ ++  A +++P     V  +     LD+  +    V      +P     
Sbjct  118  VYNEFPEDKAKEIIEAAKEANP----VVVDSKKTQNLDMNINNERNVVIPDLNEPTSSGN  173

Query  809  sppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNN  988
            +             +                IARR+SLHRF  KRKDRA ARAPYQV+ N
Sbjct  174  NDDRQTKEEHQVVER----------------IARRASLHRFFAKRKDRAVARAPYQVNQN  217



>ref|XP_009390323.1| PREDICTED: protein TIFY 10A-like [Musa acuminata subsp. malaccensis]
Length=223

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 75/263 (29%), Positives = 104/263 (40%), Gaps = 70/263 (27%)
 Frame = +2

Query  263   VKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVV-NTEASGKFDISHG--TTMD  433
             ++++ R   K+NF  TC+LLS+++K + S+ +L   +G      A GK        TTM 
Sbjct  1     MEMAARKQGKTNFAVTCSLLSRYIKEKGSVAELGIEMGQRPEYAAKGKSQAFRPPPTTMS  60

Query  434   FLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASI----SkeapkeapkaaQL  601
              L               D   +  V+     +E     A  +    +        +  QL
Sbjct  61    LLPGA------------DGEKEEDVSSAGNAMELFPQRAGFVPSLAAVAEDASKQERNQL  108

Query  602   TIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATST  781
             TIFY GKVMVFD FPA KA+                       D L L + G++    S 
Sbjct  109   TIFYGGKVMVFDNFPAKKAK-----------------------DLLQLASKGSSTAQKSG  145

Query  782   PVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATA  961
              +                                  S LPIAR +SL RFLEKRKDR +A
Sbjct  146   HLSRTVQPNL--------------------------SYLPIARNASLQRFLEKRKDRISA  179

Query  962   RAPYQVHNNPLI--PSKSERPSS  1024
             RAPY V  +P +  P K E+  S
Sbjct  180   RAPYHVTASPEMVNPVKQEKSGS  202



>gb|AFU90899.1| jasmonate ZIM domain-containing protein, partial [Sonneratia 
ovata]
 gb|AFU90902.1| jasmonate ZIM domain-containing protein, partial [Sonneratia 
griffithii]
Length=172

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 67/141 (48%), Gaps = 29/141 (21%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLA----SKSSPQSARGVFQTAGVDKLDLPADGAA  763
             Q+TIFY+G+VMVF++FPA+K + +M+LA    S + P      F    + +  +      
Sbjct  57    QMTIFYAGQVMVFNDFPAEKVKEIMMLASKASSSTGPNPNLAAFSGPNLVQNQM---KPG  113

Query  764   VVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKR  943
             ++    P+                                  SDLPIARR+SLHRFLEKR
Sbjct  114   LMIPRNPIQDRIQRPVETIT----------------------SDLPIARRASLHRFLEKR  151

Query  944   KDRATARAPYQVHNNPLIPSK  1006
             KDR +AR+PY        PSK
Sbjct  152   KDRISARSPYSAAATEAPPSK  172



>gb|KHG16464.1| Protein TIFY 11B -like protein [Gossypium arboreum]
Length=257

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 71/131 (54%), Gaps = 7/131 (5%)
 Frame = +2

Query  596  QLTIFYSGKVMVFDEFPADKARAVM-LLASKSSPQSARGVFQTAGVDKLDLPADGAAVVA  772
            Q+TIF+  +V VF++FPADK + +M LLAS     ++ GV  T  ++K+      + +V 
Sbjct  99   QMTIFFGSQVAVFNDFPADKFKEIMDLLASHGCSTASGGVVDTV-MEKVK-----SKIVQ  152

Query  773  TSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDR  952
                      +         P PP             G SDL IARR+SLH+F EKRK+R
Sbjct  153  IEPSNHEIPDLNVATATGNSPPPPHDSSVEWHQYGGSGSSDLRIARRNSLHKFFEKRKER  212

Query  953  ATARAPYQVHN  985
            ATARAPYQV+N
Sbjct  213  ATARAPYQVNN  223



>ref|XP_010251469.1| PREDICTED: protein TIFY 10A-like [Nelumbo nucifera]
Length=422

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 82/145 (57%), Gaps = 13/145 (9%)
 Frame = +2

Query  287  EKSNFVQTCNLLSQFLKGRVSIRDLSHGIGV-------VNTEASGKFDISHGTTMDFL--  439
            EKSNF QTC+LLSQ++K + S+ DLS GIG        + T +S K +  +   +  L  
Sbjct  24   EKSNFTQTCSLLSQYIKEKGSLGDLSLGIGSSLDGKGSILTSSSSKPETMNLNLLPVLET  83

Query  440  -TNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYS  616
             ++ +++   +E+  +D  PQ          E+ T            + P+ AQ+TIFY+
Sbjct  84   QSDSDRNAPSREVKSMDLFPQQASFRVPNPPEDTTKKP---DFRPATKEPEKAQMTIFYA  140

Query  617  GKVMVFDEFPADKARAVMLLASKSS  691
            GKV V+D+FPADKA+ +M+LASK S
Sbjct  141  GKVHVYDDFPADKAKELMVLASKGS  165


 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 33/45 (73%), Gaps = 4/45 (9%)
 Frame = +2

Query  890   SDLPIARRSSLHRFLEKRKDRATARAPYQVHNNPLIPSKSERPSS  1024
             SDLPIARR SLHRFLEKRKDR  A+ PYQV N    P + E PSS
Sbjct  277   SDLPIARRVSLHRFLEKRKDRIGAKVPYQVGN----PGEGEAPSS  317



>gb|AFK36192.1| unknown [Lotus japonicus]
Length=235

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 78/144 (54%), Gaps = 17/144 (12%)
 Frame = +2

Query  254  LSDVKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMD  433
            ++D + SG+A EKSNF QTC+LLS+FLK +    D   G+G       GK D     T D
Sbjct  8    VADGRSSGKALEKSNFSQTCSLLSKFLKEKRGSGDSVSGMG-------GKMD-PKACTKD  59

Query  434  FLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFY  613
             L N++KS        + PN  + ++   + VE      +++        PK  QLTIFY
Sbjct  60   LLANLQKSD-----GTLRPNASSAMDILPQLVENPCIKKSNV----RSAGPKTPQLTIFY  110

Query  614  SGKVMVFDEFPADKARAVMLLASK  685
            +GK++VFD F  +KA  VM LA+K
Sbjct  111  AGKLLVFDGFVPEKATEVMELATK  134



>ref|XP_009110413.1| PREDICTED: protein TIFY 11A-like [Brassica rapa]
Length=270

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 104/235 (44%), Gaps = 34/235 (14%)
 Frame = +2

Query  284  PEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQ  463
            PEKSNF + C+LLS++L  + S  ++   +G+V           +    +    + K+  
Sbjct  12   PEKSNFTRRCSLLSRYLNEKGSFGNID--LGLVRKPGPDLGLPGNSDQQEKQNVMHKANS  69

Query  464  DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEF  643
            + +   +   P ++  G ++     TN +           P ++QLTIF+ GKV+V++EF
Sbjct  70   ELKALNVLGEPSSSFGGKAKA----TNLSEP-------SEPISSQLTIFFGGKVLVYNEF  118

Query  644  PADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmaspppl  823
            P+DKA+ ++ +A ++   +   +     V K D       +   + P D           
Sbjct  119  PSDKAKEIIQVAKEAKSVTDINIQTQINVQK-DHNKSNIVLPDLNEPTDTADVNQQQQQQ  177

Query  824  ppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNN  988
                                      IARR+SLHRF  KRKDRA ARAPYQV+ N
Sbjct  178  NQLVER--------------------IARRASLHRFFAKRKDRAVARAPYQVNQN  212



>gb|AFK47267.1| unknown [Medicago truncatula]
 gb|KEH18499.1| jasmonate zim-domain protein [Medicago truncatula]
Length=235

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 76/260 (29%), Positives = 107/260 (41%), Gaps = 77/260 (30%)
 Frame = +2

Query  266  KISGRAPEKSNFVQTCNLLSQFLK-GRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLT  442
            +++ +APEK  F QTC+LLSQFLK  R+S        G +  +AS         T D L 
Sbjct  13   RLTCKAPEKFKFSQTCSLLSQFLKEKRISGDATPSFFGKMEPKAS---------TKDLLA  63

Query  443  NIEKSTQDQEM--APIDPNPQNTVN-----GTSRTVEEGTNAAASISkeapkeapkaaQL  601
            N++ S     +  + I+  PQ   N       +R+ +  T                  QL
Sbjct  64   NMQNSDGGLRLNASAIESLPQLVENPCIKKSNTRSTDPKT-----------------PQL  106

Query  602  TIFYSGKVMVFDEFPADKARAVMLLASK---------SSPQSARGVFQTAGVDKLDLPAD  754
            TIFYSGK++VFD F    A  +M LA+K          +P SA     T  + + ++P  
Sbjct  107  TIFYSGKMLVFDAFSPSNATEIMELATKLASENPSTEENPPSA--PVTTEKLKESEIPQT  164

Query  755  GAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFL  934
              A+  T                                      SD+   RR+SL +FL
Sbjct  165  NTALETTE------------------------------QGNQAKCSDMRYPRRASLLKFL  194

Query  935  EKRKDRATARAPYQV--HNN  988
            EKRK+R  AR PYQ+  H N
Sbjct  195  EKRKERVIARGPYQINGHKN  214



>ref|XP_008388962.1| PREDICTED: protein TIFY 10A [Malus domestica]
Length=280

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 80/152 (53%), Gaps = 11/152 (7%)
 Frame = +2

Query  278  RAPEK-SNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASG----KFDISHGTTMDFLT  442
            R  EK SNF QTC++L Q+LK + S  DL+      N + S     +        M+F  
Sbjct  17   RTAEKPSNFTQTCSMLCQYLKEKGSFGDLNLDTACNNMQQSNGGTPEMFRQKAPPMNFFP  76

Query  443  NIEKS----TQDQEMAPIDPNPQNTVNGTSRTV--EEGTNAAASISkeapkeapkaaQLT  604
             +E S    T  ++   +D  PQ    G S     EE    A S  K++    P  AQ+T
Sbjct  77   FVENSRNMPTAVRDFKSMDLFPQQAGFGPSAPTPREEVPMTADSSVKKSAPGEPXKAQMT  136

Query  605  IFYSGKVMVFDEFPADKARAVMLLASKSSPQS  700
            IFY G+V+VF++FPADKA+ VMLLASK S QS
Sbjct  137  IFYGGQVIVFNDFPADKAKEVMLLASKESSQS  168


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  893   DLPIARRSSLHRFLEKRKDRATARAPYQVHNNPLIPSK  1006
             DLPIAR++SLHRFLEKRKDR    APYQ  +    P+K
Sbjct  227   DLPIARKASLHRFLEKRKDRLNTLAPYQTSSPASSPAK  264



>ref|XP_010540100.1| PREDICTED: protein TIFY 11A [Tarenaya hassleriana]
Length=263

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 67/240 (28%), Positives = 101/240 (42%), Gaps = 29/240 (12%)
 Frame = +2

Query  284  PEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQ  463
            P KSNF + CNLLSQ+LK        +   G ++   + K D   G T       +++  
Sbjct  10   PVKSNFARRCNLLSQYLKK-------NGNFGGIDLGLTRKPDSDIGFTGKLDPAGQQNET  62

Query  464  DQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEF  643
             +  AP +  P   +      V   ++   +      +  P  +QLTIF+ GKV+VF++ 
Sbjct  63   PKSEAP-EIKPTGFIQKLCGAVPSDSSGGEAKDANVSEPEPANSQLTIFFGGKVVVFNKL  121

Query  644  PADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPV-Dppkpmasppp  820
            P DKA+ +M +A +++P              +  P   A V     PV +          
Sbjct  122  PTDKAKEIMEIAKQANP--------------VKFP---AVVAVGPEPVAEDNTKNNLKGD  164

Query  821  lppppvppptqpaaaapapapGGSDLPIAR---RSSLHRFLEKRKDRATARAPYQVHNNP  991
                             +   G +  P+ R   R+SLHRF  KRKDR  ARAPYQV  +P
Sbjct  165  NSNSDSELVIPDLNEPTSSGNGNNQQPVERIAWRASLHRFFAKRKDRVVARAPYQVIASP  224



>ref|XP_004173908.1| PREDICTED: protein TIFY 10B-like [Cucumis sativus]
Length=143

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 71/151 (47%), Gaps = 42/151 (28%)
 Frame = +2

Query  530  EEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARG  709
            E+  + AA+ S     E P A Q+TIFY GKV+VF++ P+++A  +M +A K    S+R 
Sbjct  6    EKSASVAAADSIPPGAEPPSATQMTIFYDGKVLVFNDLPSERAEEIMAMAGKGIAPSSRS  65

Query  710  VFQTAGVDKLDLPADGAAVVATSTPVDppkpmasppplppppvppptqpaaaapapapGG  889
            +  TA  D      +G     T                                      
Sbjct  66   I-TTAVSD------NGGEQPLTKV-----------------------------------S  83

Query  890  SDLPIARRSSLHRFLEKRKDRATARAPYQVH  982
            SDLPIARR+SLHRF EKRKDR  AR PYQV+
Sbjct  84   SDLPIARRASLHRFFEKRKDRVAARGPYQVN  114



>ref|NP_973862.1| jasmonate-zim-domain protein 1  [Arabidopsis thaliana]
 gb|AEE29815.1| protein TIFY 10A [Arabidopsis thaliana]
Length=187

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 68/127 (54%), Gaps = 25/127 (20%)
 Frame = +2

Query  599  LTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATS  778
            LTIFY+G+V+VF++F A+KA+ V+ LASK       G   +   ++ D+     A +A  
Sbjct  61   LTIFYAGQVIVFNDFSAEKAKEVINLASK-------GTANSLAKNQTDI-RSNIATIANQ  112

Query  779  TPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRAT  958
             P                  P  T       +     ++LPIARR+SLHRFLEKRKDR T
Sbjct  113  VP-----------------HPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVT  155

Query  959  ARAPYQV  979
            ++APYQ+
Sbjct  156  SKAPYQL  162



>ref|XP_002890323.1| hypothetical protein ARALYDRAFT_472142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66582.1| hypothetical protein ARALYDRAFT_472142 [Arabidopsis lyrata subsp. 
lyrata]
Length=199

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 72/127 (57%), Gaps = 16/127 (13%)
 Frame = +2

Query  599  LTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATS  778
            LTIFY+G+V+VF++F A+KA+ VM LASK +  S  G   T+ V      ++  + +AT 
Sbjct  64   LTIFYAGQVIVFNDFSAEKAKEVMNLASKGTANSFTGF--TSNVILAKNQSEIRSNIATI  121

Query  779  TPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRAT  958
            T                 P P  T       +     ++LPIARR+SLHRFLEKRKDR T
Sbjct  122  T--------------NQVPHPRKTPTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVT  167

Query  959  ARAPYQV  979
            ++APYQ+
Sbjct  168  SKAPYQL  174



>ref|XP_010687548.1| PREDICTED: protein TIFY 10A [Beta vulgaris subsp. vulgaris]
Length=251

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 105/251 (42%), Gaps = 35/251 (14%)
 Frame = +2

Query  236  MSGKHLLSD-VKISGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDI  412
            MS    +SD  + SG   +K +F  TCNLLSQ++K +         +G+     S   D 
Sbjct  1    MSTSPAISDSARFSG---QKMSFSHTCNLLSQYVKEK-------RALGI-----SANLDS  45

Query  413  SHGTTMDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRT--VEEGTNAAASISkeapkeap  586
                TM+      K   +     +      T+N   +      G N  AS         P
Sbjct  46   RGPATMNLFPVSGKQAAEDTNGCVG----RTINLFPQLSGFNSGVNKRAS-------PEP  94

Query  587  kaaQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAV  766
               Q+TIFY G+V+VF+E PADKA+ VM LAS     S     +   V+           
Sbjct  95   PTPQMTIFYGGQVLVFNELPADKAKEVMDLAS-----SYEANLKKRKVEATSSTPPSPVA  149

Query  767  VATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRK  946
            V  S P +P   +             P        A  P  SDLPIAR++SLHRFLEKRK
Sbjct  150  VPVSAP-NPKPNLVLTKNSTQNVNVAPKFVNNTISAAVPSVSDLPIARKASLHRFLEKRK  208

Query  947  DRATARAPYQV  979
            DR   + P  V
Sbjct  209  DRLVGKLPSDV  219



>ref|XP_006303246.1| hypothetical protein CARUB_v10009758mg, partial [Capsella rubella]
 gb|EOA36144.1| hypothetical protein CARUB_v10009758mg, partial [Capsella rubella]
Length=322

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 117/258 (45%), Gaps = 31/258 (12%)
 Frame = +2

Query  248  HLLSDVKISGR---APEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKF--DI  412
            H   +  +S R    PEKS+F + C+LLS++LK + S  ++   +G+      G     I
Sbjct  24   HTQEEENMSSRNENVPEKSDFTRRCSLLSRYLKEKGSFGNID--LGLFRKPCPGLLLPGI  81

Query  413  SHGTTMDFLTNIEKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapka  592
            SH +        + S   Q++      P N+  G  +  +   +   +            
Sbjct  82   SHPSGPG-----KPSAAAQKVEHFQGEPSNSSGGKVKDADLSESHPGN------------  124

Query  593  aQLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVA  772
            +QLTIF+ GKV+V++EFPADKA+ +M +A  + P +   + QT  ++  +   +  + + 
Sbjct  125  SQLTIFFGGKVLVYNEFPADKAQEIMDVAKLAKPVTEINI-QTQ-INAQENNNNNKSNIQ  182

Query  773  TSTPV-DppkpmasppplppppvppptqpaaaapapapGGSDLPIARR----SSLHRFLE  937
            T T V D      S   LP    P  +                 I  R    +SLHRF  
Sbjct  183  TQTNVEDINNNDTSDMVLPDLNEPTNSAYTDHNHPTKEQQQQNQIVERIARRASLHRFFA  242

Query  938  KRKDRATARAPYQVHNNP  991
            KRKDRA ARAPYQV+ NP
Sbjct  243  KRKDRAVARAPYQVNQNP  260



>ref|XP_009345358.1| PREDICTED: protein TIFY 10B-like [Pyrus x bretschneideri]
Length=213

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 114/252 (45%), Gaps = 65/252 (26%)
 Frame = +2

Query  290   KSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFDISHGTTMDFLTNIEKSTQDQ  469
             K NF QTCNLLSQFL+ + +++                  +   TT++ LT +E +    
Sbjct  5     KLNFSQTCNLLSQFLREKRTLQ------------------VVPPTTINLLTTMEAAAS--  44

Query  470   EMAPIDPNPQNTVNGTSRT------VEEGTNAAASISkeapkeapkaaQLTIFYSGKVMV  631
                    NP + V  T  +       +  T    ++     ++    A +T+FY G+V+V
Sbjct  45    -------NPAHQVAQTPSSKPSIDLFQHFTKGPEAV--LGNQQPGSVAPMTVFYGGQVLV  95

Query  632   FDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmas  811
             F++  A+KA+ +M LA   S +S+ G F    V+KL    + + VVA +           
Sbjct  96    FNDLQAEKAKEIMDLAIIGSSKSS-GRF----VEKLA-SGNQSNVVAKNN----------  139

Query  812   ppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPYQVHNNP  991
                                  P    SDLPIARR+SLH+FL KRK+R  A APYQ+ +  
Sbjct  140   -------------YQEIQKVQPQAAASDLPIARRASLHKFLAKRKERVAAIAPYQLKSQK  186

Query  992   L-IPSKSERPSS  1024
                P+KS+  +S
Sbjct  187   ASSPAKSDEQTS  198



>ref|XP_008450950.1| PREDICTED: protein TIFY 10A [Cucumis melo]
Length=229

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 75/137 (55%), Gaps = 17/137 (12%)
 Frame = +2

Query  596   QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
             Q+TIFY+G+V VF+ FPAD+   VM LAS+ S              +L++P   A+V A 
Sbjct  94    QMTIFYAGQVFVFNNFPADRVGDVMFLASQES-------------SRLNIPTT-ASVAAR  139

Query  776   STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
               P+    P  S     P      T P    P P+  G+ LP+AR++S+ RFLEKRKDR 
Sbjct  140   QPPILVGTPADSLSSTSPVSTRNQTSPPPPPPPPSVPGA-LPMARKASIQRFLEKRKDRL  198

Query  956   TARAPYQVHNNPLIPSK  1006
             T RAPY  HN+  + SK
Sbjct  199   TPRAPY--HNSSPMTSK  213



>ref|NP_564019.1| protein TIFY 11A [Arabidopsis thaliana]
 sp|Q9LDU5.1|TI11A_ARATH RecName: Full=Protein TIFY 11A; AltName: Full=Jasmonate ZIM domain-containing 
protein 5 [Arabidopsis thaliana]
 gb|AAF79491.1|AC022492_35 F1L3.3 [Arabidopsis thaliana]
 gb|AAF97303.1|AC007843_6 Hypothetical protein [Arabidopsis thaliana]
 gb|AAN17407.1| expressed protein [Arabidopsis thaliana]
 gb|AAO00903.1| expressed protein [Arabidopsis thaliana]
 gb|AEE29581.1| protein TIFY 11A [Arabidopsis thaliana]
Length=274

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 63/131 (48%), Gaps = 18/131 (14%)
 Frame = +2

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
            QLTIF+ GKV+V++EFP DKA+ +M +A ++ P +   + QT   D+ +       +   
Sbjct  98   QLTIFFGGKVLVYNEFPVDKAKEIMEVAKQAKPVTEINI-QTPINDENNNNKSSMVLPDL  156

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
            + P D                                     IARR+SLHRF  KRKDRA
Sbjct  157  NEPTDNNHLTKEQQQQQEQNQIVER-----------------IARRASLHRFFAKRKDRA  199

Query  956  TARAPYQVHNN  988
             ARAPYQV+ N
Sbjct  200  VARAPYQVNQN  210



>gb|AAM65191.1| unknown [Arabidopsis thaliana]
Length=274

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 64/131 (49%), Gaps = 18/131 (14%)
 Frame = +2

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
            QLTIF+ GKV+V++EFP DKA+ +M +A ++ P +   + QT   D+ +       +   
Sbjct  98   QLTIFFGGKVLVYNEFPVDKAKEIMEVAKQAKPVTEINI-QTPINDENNNNKSSMVLPDL  156

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
            + P D   P                                 IARR+SLHRF  KRKDRA
Sbjct  157  NEPTDNNHPTKEQQQQQEQNQIVER-----------------IARRASLHRFFAKRKDRA  199

Query  956  TARAPYQVHNN  988
             ARAPYQV+ N
Sbjct  200  VARAPYQVNQN  210



>ref|XP_009382972.1| PREDICTED: protein TIFY 10B-like [Musa acuminata subsp. malaccensis]
Length=236

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 73/139 (53%), Gaps = 19/139 (14%)
 Frame = +2

Query  272  SGRAPEKSNFVQTCNLLSQFLKGRVSIRDLSHGIGVVNTEASGKFD-ISHGTTMDFLTNI  448
            +GR   ++NF  TC LLSQ++K + SI DL  G+G+    A GK + +   TTM  +   
Sbjct  4    AGRKQGRTNFAVTCTLLSQYIKEKGSIADL--GLGIAQDAAIGKSESVRPPTTMSVIPGA  61

Query  449  EKSTQDQEMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVM  628
            +    +     + P    +V+     +E+   AA               QLTIFY GKV+
Sbjct  62   DLCRGEDGAKELFPQ---SVDLGPAVLEDAREAARG-------------QLTIFYGGKVL  105

Query  629  VFDEFPADKARAVMLLASK  685
            VFD+FPA+KA+ +M LA+K
Sbjct  106  VFDKFPAEKAKDLMQLATK  124


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  893  DLPIARRSSLHRFLEKRKDRATARAPYQVHNNP  991
            DLPIAR++SL RFLEKRKDR  AR+PYQV  +P
Sbjct  172  DLPIARKASLQRFLEKRKDRINARSPYQVSASP  204



>gb|KFK41663.1| hypothetical protein AALP_AA2G156800 [Arabis alpina]
Length=277

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 65/131 (50%), Gaps = 15/131 (11%)
 Frame = +2

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
            QLTIF+ GKV+VF+EFP DKA+ +M +A +++      V +      LD+     + ++ 
Sbjct  107  QLTIFFGGKVIVFNEFPEDKAKEIMEVAKQANHVDIVDVKEIQNHRSLDVNVSNKSDISV  166

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
               ++ P    +             +                IARR+SLHRF  KRKDRA
Sbjct  167  IPDLNEPTSSGNNEDQQTGQQHEVVER---------------IARRASLHRFFAKRKDRA  211

Query  956  TARAPYQVHNN  988
             ARAPYQV+ N
Sbjct  212  VARAPYQVNQN  222



>ref|XP_003517395.1| PREDICTED: protein TIFY 10B-like [Glycine max]
 gb|KHN42652.1| Protein TIFY 10B [Glycine soja]
Length=195

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 64/131 (49%), Gaps = 16/131 (12%)
 Frame = +2

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
            Q+TIFY G+V+V D+  ADKA+ +M  A K       G+ Q         PA  +A  + 
Sbjct  44   QMTIFYGGQVLVLDDIQADKAKDIMSFAGK-------GMSQNQNDCAYTFPATTSATPSR  96

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
              P        +           P++P            DLP+AR++SLHRFLEKRKDR 
Sbjct  97   PFPFLMNIIPTTANNSVQDHPQTPSKPVI---------CDLPLARKASLHRFLEKRKDRI  147

Query  956  TARAPYQVHNN  988
             ARAPYQ  N+
Sbjct  148  AARAPYQTSNH  158



>ref|XP_006452933.1| hypothetical protein CICLE_v10009025mg [Citrus clementina]
 gb|ESR66173.1| hypothetical protein CICLE_v10009025mg [Citrus clementina]
Length=224

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 63/130 (48%), Gaps = 12/130 (9%)
 Frame = +2

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
            QLTIFY GKV VFD  PADK R +ML+A+ S+      V  T+ + K D     ++ V T
Sbjct  70   QLTIFYGGKVCVFDAIPADKVREIMLIAASSA-----TVTNTSDMKKDDTNCPASSPVLT  124

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
             +P       +          P                ++LP+ARR SL RF EKR+DR 
Sbjct  125  RSP-------SLQSTASALASPRAQSYPVQRNLLCKLQAELPMARRHSLQRFFEKRRDRL  177

Query  956  TARAPYQVHN  985
             ++ PY V +
Sbjct  178  VSKNPYPVQS  187



>tpg|DAA40152.1| TPA: putative tify domain/CCT motif transcription factor family 
protein [Zea mays]
Length=171

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 62/134 (46%), Gaps = 42/134 (31%)
 Frame = +2

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVAT  775
            QLTIFY G+V+VFD FP+ K   ++ + S              GVD+      G A V T
Sbjct  49   QLTIFYGGRVVVFDMFPSAKVEDLLQIMSPGGD----------GVDRA-----GGATVPT  93

Query  776  STPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRA  955
             +                                    SDLPIARR+SLHRFLEKRKDR 
Sbjct  94   RS---------------------------LHRPSHDSLSDLPIARRNSLHRFLEKRKDRI  126

Query  956  TARAPYQVHNNPLI  997
            TA+APYQ  N+ ++
Sbjct  127  TAKAPYQQVNSSVV  140



>ref|XP_006836619.1| hypothetical protein AMTR_s00131p00119200 [Amborella trichopoda]
 gb|ERM99472.1| hypothetical protein AMTR_s00131p00119200 [Amborella trichopoda]
Length=233

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 108/228 (47%), Gaps = 39/228 (17%)
 Frame = +2

Query  293  SNFVQTCNLLSQFLKGRVSIRDLSHGI-GVVNTEASGKFDISHGTTMDFLTNIEKSTQDQ  469
            S+F  TCN LS++++ + S+ +LS GI G  +  A     ++   T   L+  E S    
Sbjct  12   SSFACTCNRLSKYMREKGSLPELSLGIAGFHDGRAKSNSHLAIFPTYS-LSKKEVSDNFS  70

Query  470  EMAPIDPNPQNTVNGTSRTVEEGTNAAASISkeapkeapkaaQLTIFYSGKVMVFDEFPA  649
             +  +D  PQ +  G +    +  + +++ +        + AQ+TIFY GK+++ D+  A
Sbjct  71   GIKSMDLFPQQSGFGPTLPTNKPNSGSSTSTDFRSIAEQRKAQMTIFYDGKMVLIDDVSA  130

Query  650  DKARAVMLLASKSSPQSARGVFQTAGVDKLDLPADGAAVVATSTPVDppkpmasppplpp  829
            +KA+ +ML+A+  +     G  Q +G   + LPA+ ++    S+                
Sbjct  131  EKAKIIMLMAANGA-----GCPQNSG--SVPLPANTSSSNHRSSVSSKNF----------  173

Query  830  ppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRKDRATARAPY  973
                                SD+P+AR++SL RFLEKRKDR  + AP+
Sbjct  174  --------------------SDMPMARKASLQRFLEKRKDRIKSTAPF  201



>gb|AES94354.2| jasmonate zim-domain protein [Medicago truncatula]
Length=151

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 63/133 (47%), Gaps = 38/133 (29%)
 Frame = +2

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASK---SSPQSARGVFQTAGVDKLDLPADGAAV  766
            Q+TIFY GKV+VFD+ PADKA+ +M  ++K   S+ Q+    +  +     +   D   V
Sbjct  22   QMTIFYDGKVIVFDDVPADKAKDIMDFSTKGIASTSQNHNNNYAYSSFLSRNSLQDYPQV  81

Query  767  VATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRK  946
               S PV                                   DLP+ R++SLHRFLEKRK
Sbjct  82   --PSIPV---------------------------------IYDLPMTRKASLHRFLEKRK  106

Query  947  DRATARAPYQVHN  985
            DR  A+APYQ  N
Sbjct  107  DRIAAKAPYQTSN  119



>ref|XP_003611395.1| Protein TIFY [Medicago truncatula]
 gb|AES94353.1| jasmonate zim-domain protein [Medicago truncatula]
Length=173

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 63/133 (47%), Gaps = 38/133 (29%)
 Frame = +2

Query  596  QLTIFYSGKVMVFDEFPADKARAVMLLASK---SSPQSARGVFQTAGVDKLDLPADGAAV  766
            Q+TIFY GKV+VFD+ PADKA+ +M  ++K   S+ Q+    +  +     +   D   V
Sbjct  44   QMTIFYDGKVIVFDDVPADKAKDIMDFSTKGIASTSQNHNNNYAYSSFLSRNSLQDYPQV  103

Query  767  VATSTPVDppkpmasppplppppvppptqpaaaapapapGGSDLPIARRSSLHRFLEKRK  946
               S PV                                   DLP+ R++SLHRFLEKRK
Sbjct  104  --PSIPV---------------------------------IYDLPMTRKASLHRFLEKRK  128

Query  947  DRATARAPYQVHN  985
            DR  A+APYQ  N
Sbjct  129  DRIAAKAPYQTSN  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3697415815374