BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17748_g2_i1 len=2119 path=[1:0-2118]

Length=2119
                                                                      Score     E

ref|XP_009800804.1|  PREDICTED: homeobox protein BEL1 homolog           573   0.0      
ref|XP_011029331.1|  PREDICTED: homeobox protein BEL1 homolog           554   0.0      
ref|XP_007040322.1|  POX family protein isoform 1                       554   0.0      
gb|KDO76309.1|  hypothetical protein CISIN_1g005058mg                   550   0.0      
gb|KDO76305.1|  hypothetical protein CISIN_1g005058mg                   551   0.0      
gb|KDO76303.1|  hypothetical protein CISIN_1g005058mg                   551   0.0      
ref|XP_006385769.1|  hypothetical protein POPTR_0003s13120g             549   0.0      
ref|XP_006439494.1|  hypothetical protein CICLE_v10019130mg             549   0.0      
ref|XP_006476516.1|  PREDICTED: homeobox protein BEL1 homolog           549   0.0      
ref|XP_011022632.1|  PREDICTED: homeobox protein BEL1 homolog           546   0.0      
ref|XP_002299516.2|  hypothetical protein POPTR_0001s09720g             546   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009604673.1|  PREDICTED: homeobox protein BEL1 homolog           541   2e-180   
ref|XP_002279230.2|  PREDICTED: homeobox protein BEL1 homolog           532   1e-176   Vitis vinifera
gb|KHN35035.1|  Homeobox protein BEL1 like                              530   4e-176   
ref|XP_003517476.1|  PREDICTED: homeobox protein BEL1 homolog iso...    516   1e-170   
gb|KDP25399.1|  hypothetical protein JCGZ_20555                         516   5e-170   
ref|XP_003538310.1|  PREDICTED: homeobox protein BEL1 homolog iso...    513   2e-169   
ref|XP_002509843.1|  bel1 homeotic protein, putative                    514   4e-169   Ricinus communis
ref|XP_007158519.1|  hypothetical protein PHAVU_002G159000g             511   8e-169   
ref|XP_010053224.1|  PREDICTED: homeobox protein BEL1 homolog           512   4e-168   
emb|CBI34373.3|  unnamed protein product                                499   1e-166   
ref|XP_007210325.1|  hypothetical protein PRUPE_ppa002081mg             503   2e-164   
ref|XP_008238940.1|  PREDICTED: homeobox protein BEL1 homolog           503   2e-164   
ref|XP_004298825.1|  PREDICTED: homeobox protein BEL1 homolog           493   1e-161   
ref|XP_008373620.1|  PREDICTED: homeobox protein BEL1 homolog           493   5e-161   
ref|XP_003532909.1|  PREDICTED: homeobox protein BEL1 homolog iso...    484   4e-158   
gb|AAP47023.1|AF375964_1  bell-like homeodomain protein 3               478   2e-157   Solanum lycopersicum
gb|KHN25686.1|  Homeobox protein BEL1 like                              474   4e-157   
ref|XP_010325299.1|  PREDICTED: bell-like homeodomain protein 3 i...    480   1e-156   
ref|NP_001266274.1|  bell-like homeodomain protein 3                    479   1e-156   
ref|XP_006343945.1|  PREDICTED: homeobox protein BEL1 homolog           476   4e-155   
ref|XP_009363416.1|  PREDICTED: homeobox protein BEL1 homolog           477   7e-155   
ref|XP_010275694.1|  PREDICTED: homeobox protein BEL1 homolog           477   8e-155   
ref|XP_009363409.1|  PREDICTED: homeobox protein BEL1 homolog           475   5e-154   
gb|ACD39462.1|  BEL14 protein                                           468   3e-153   Solanum etuberosum
ref|XP_010255251.1|  PREDICTED: homeobox protein BEL1 homolog           472   6e-153   
ref|XP_006580557.1|  PREDICTED: homeobox protein BEL1 homolog iso...    469   2e-152   
gb|KHN16798.1|  Homeobox protein BEL1 like                              461   3e-152   
ref|XP_011073138.1|  PREDICTED: homeobox protein BEL1 homolog           467   4e-152   
gb|ACD39465.1|  BEL14 protein                                           461   1e-150   Solanum palustre
ref|XP_011080922.1|  PREDICTED: homeobox protein BEL1 homolog           464   2e-150   
gb|AAN03624.1|AF406700_1  BEL1-related homeotic protein 14              460   3e-150   Solanum tuberosum [potatoes]
gb|KEH21114.1|  BEL1-related homeotic protein                           458   2e-148   
ref|XP_010089065.1|  Homeobox protein BEL1-like protein                 459   3e-148   
ref|XP_007160096.1|  hypothetical protein PHAVU_002G292000g             457   1e-147   
ref|XP_010934930.1|  PREDICTED: homeobox protein BEL1 homolog           444   1e-143   
ref|XP_008807227.1|  PREDICTED: homeobox protein BEL1 homolog           441   5e-142   
ref|XP_008796900.1|  PREDICTED: homeobox protein BEL1 homolog           436   1e-140   
ref|XP_010933991.1|  PREDICTED: homeobox protein BEL1 homolog           437   1e-140   
ref|XP_004503684.1|  PREDICTED: homeobox protein BEL1 homolog           436   4e-140   
gb|KGN50071.1|  hypothetical protein Csa_5G152860                       435   9e-140   
ref|XP_008437318.1|  PREDICTED: LOW QUALITY PROTEIN: homeobox pro...    427   8e-137   
ref|XP_010919091.1|  PREDICTED: homeobox protein BEL1 homolog           426   4e-136   
ref|XP_008783445.1|  PREDICTED: homeobox protein BEL1 homolog           422   1e-134   
gb|EPS58139.1|  hypothetical protein M569_16677                         412   9e-133   
ref|XP_010941166.1|  PREDICTED: homeobox protein BEL1 homolog           409   3e-130   
ref|XP_009389789.1|  PREDICTED: homeobox protein BEL1 homolog           409   8e-130   
ref|XP_004143976.1|  PREDICTED: homeobox protein BEL1 homolog           405   5e-129   
ref|XP_010676435.1|  PREDICTED: homeobox protein BEL1 homolog           404   4e-126   
ref|XP_009384235.1|  PREDICTED: homeobox protein BEL1 homolog           395   6e-125   
ref|XP_008794767.1|  PREDICTED: homeobox protein BEL1 homolog           391   4e-123   
gb|EYU23458.1|  hypothetical protein MIMGU_mgv1a002357mg                386   9e-120   
ref|XP_002870636.1|  hypothetical protein ARALYDRAFT_493837             378   9e-118   
ref|XP_010545511.1|  PREDICTED: homeobox protein BEL1 homolog           377   2e-117   
ref|NP_198957.1|  homeobox protein BEL1                                 377   4e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283321.1|  hypothetical protein CARUB_v10004359mg             376   1e-116   
ref|XP_010553534.1|  PREDICTED: homeobox protein BEL1 homolog           375   5e-116   
ref|XP_006405354.1|  hypothetical protein EUTSA_v10027690mg             371   3e-115   
gb|KFK33010.1|  hypothetical protein AALP_AA6G318600                    369   2e-114   
ref|XP_010447491.1|  PREDICTED: homeobox protein BEL1 homolog           368   7e-114   
ref|XP_009395309.1|  PREDICTED: homeobox protein BEL1 homolog           364   1e-113   
gb|EPS62339.1|  hypothetical protein M569_12452                         362   1e-113   
ref|XP_009140091.1|  PREDICTED: homeobox protein BEL1 homolog           365   5e-113   
ref|XP_010441306.1|  PREDICTED: homeobox protein BEL1 homolog           366   5e-113   
ref|XP_010436095.1|  PREDICTED: homeobox protein BEL1 homolog           365   9e-113   
ref|XP_009395039.1|  PREDICTED: homeobox protein BEL1 homolog           356   2e-110   
emb|CDY44476.1|  BnaCnng11290D                                          353   1e-108   
ref|XP_009418082.1|  PREDICTED: homeobox protein BEL1 homolog iso...    349   1e-106   
ref|XP_009418083.1|  PREDICTED: homeobox protein BEL1 homolog iso...    348   1e-106   
ref|XP_010533636.1|  PREDICTED: homeobox protein BEL1 homolog           335   1e-101   
gb|KDO76308.1|  hypothetical protein CISIN_1g005058mg                   329   5e-101   
ref|XP_009396189.1|  PREDICTED: homeobox protein BEL1 homolog           331   1e-100   
ref|XP_006385772.1|  hypothetical protein POPTR_0003s13120g             328   3e-100   
ref|XP_006439495.1|  hypothetical protein CICLE_v10019130mg             327   8e-100   
ref|XP_004964302.1|  PREDICTED: homeobox protein BEL1 homolog iso...    323   6e-98    
gb|EEC79849.1|  hypothetical protein OsI_21328                          323   7e-98    Oryza sativa Indica Group [Indian rice]
gb|ACU01963.1|  bell1-like protein                                      316   2e-97    Comandra umbellata [bastard toadflax]
emb|CDP12057.1|  unnamed protein product                                318   1e-96    
gb|EMS65600.1|  Homeobox protein BEL1-like protein                      317   3e-96    
dbj|BAD67687.1|  putative homeotic protein BEL1                         318   6e-96    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056572.1|  Os06g0108900                                       318   7e-96    Oryza sativa Japonica Group [Japonica rice]
gb|AAK96704.1|  homeotic protein BEL1 homolog                           317   1e-95    Arabidopsis thaliana [mouse-ear cress]
gb|EMT21256.1|  Homeobox BEL1-like protein                              314   5e-95    
ref|XP_010228131.1|  PREDICTED: homeobox protein BEL1 homolog iso...    311   5e-95    
ref|XP_003557261.1|  PREDICTED: homeobox protein BEL1 homolog iso...    311   6e-94    
dbj|BAJ91914.1|  predicted protein                                      310   2e-93    
dbj|BAJ85202.1|  predicted protein                                      310   2e-93    
dbj|BAJ89622.1|  predicted protein                                      311   1e-92    
ref|XP_002436343.1|  hypothetical protein SORBIDRAFT_10g000800          308   1e-92    Sorghum bicolor [broomcorn]
ref|NP_001140899.1|  putative POX domain/homeobox DNA-binding dom...    308   2e-92    Zea mays [maize]
gb|AIB05777.1|  HB transcription factor                                 308   2e-92    
ref|XP_006656551.1|  PREDICTED: homeobox protein BEL1 homolog           308   4e-92    
ref|NP_001065164.1|  Os10g0534900                                       304   5e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006829091.1|  hypothetical protein AMTR_s00001p00262320          297   3e-88    
dbj|BAK04286.1|  predicted protein                                      300   4e-88    
dbj|BAJ99003.1|  predicted protein                                      300   6e-88    
ref|XP_004985907.1|  PREDICTED: homeobox protein BEL1 homolog iso...    298   3e-87    
ref|XP_009396457.1|  PREDICTED: BEL1-like homeodomain protein 4         298   1e-86    
ref|XP_009614985.1|  PREDICTED: BEL1-like homeodomain protein 4         297   1e-86    
ref|XP_003538830.1|  PREDICTED: BEL1-like homeodomain protein 2-like    297   5e-86    
gb|KHN42028.1|  BEL1-like homeodomain protein 2                         296   7e-86    
gb|AAN03625.1|AF406701_1  BEL1-related homeotic protein 22              294   9e-86    Solanum tuberosum [potatoes]
gb|AAN03623.1|AF406699_1  BEL1-related homeotic protein 13              292   1e-85    Solanum tuberosum [potatoes]
ref|XP_006385770.1|  hypothetical protein POPTR_0003s13120g             287   3e-85    
gb|ACA61780.1|  BIPINNATA                                               293   5e-85    Solanum lycopersicum
ref|XP_009773433.1|  PREDICTED: BEL1-like homeodomain protein 4         293   5e-85    
ref|XP_007156875.1|  hypothetical protein PHAVU_002G024800g             294   9e-85    
ref|XP_004232087.1|  PREDICTED: BEL1-like homeodomain protein 2         294   1e-84    
gb|KDP31824.1|  hypothetical protein JCGZ_12285                         295   1e-84    
ref|XP_006338267.1|  PREDICTED: BEL1-related homeotic protein 13 ...    294   2e-84    
ref|XP_006344823.1|  PREDICTED: BEL1-related homeotic protein 22        291   4e-84    
ref|XP_007204284.1|  hypothetical protein PRUPE_ppa001286mg             295   4e-84    
ref|XP_008241607.1|  PREDICTED: BEL1-like homeodomain protein 4         295   6e-84    
ref|XP_004238216.1|  PREDICTED: BEL1-like homeodomain protein 4         291   6e-84    
emb|CDX76849.1|  BnaC08g34350D                                          288   7e-84    
dbj|BAJ88032.1|  predicted protein                                      292   7e-84    
ref|XP_010243287.1|  PREDICTED: BEL1-like homeodomain protein 2         293   8e-84    
ref|XP_009419344.1|  PREDICTED: BEL1-like homeodomain protein 4         290   1e-83    
gb|AAK38645.1|AF334758_1  homeodomain protein JUBEL1                    292   1e-83    Hordeum vulgare subsp. vulgare [barley]
ref|XP_003562164.1|  PREDICTED: homeobox protein BEL1 homolog           288   1e-83    
gb|AET04003.2|  BEL1-related homeotic protein                           293   1e-83    
ref|XP_009395654.1|  PREDICTED: BEL1-like homeodomain protein 4         290   2e-83    
dbj|BAJ04685.1|  BEL1-type homeodomain protein                          291   2e-83    
dbj|BAJ04686.1|  BEL1-type homeodomain protein                          291   2e-83    
ref|XP_009109344.1|  PREDICTED: BEL1-like homeodomain protein 2         288   3e-83    
emb|CDY22463.1|  BnaC03g61760D                                          288   3e-83    
dbj|BAJ04684.1|  BEL1-type homeodomain protein                          291   3e-83    
ref|XP_006649302.1|  PREDICTED: homeobox protein BEL1 homolog           286   3e-83    
emb|CDY24765.1|  BnaA08g15450D                                          288   4e-83    
ref|XP_011025689.1|  PREDICTED: BEL1-like homeodomain protein 4         291   5e-83    
ref|XP_006366455.1|  PREDICTED: BEL1-like homeodomain protein 4-like    286   7e-83    
ref|XP_006574714.1|  PREDICTED: BEL1-like homeodomain protein 2-like    290   7e-83    
ref|XP_004300584.1|  PREDICTED: BEL1-like homeodomain protein 4-like    291   8e-83    
ref|NP_001148180.1|  BEL1-related homeotic protein 14                   286   8e-83    Zea mays [maize]
gb|EEC67362.1|  hypothetical protein OsI_34463                          285   9e-83    Oryza sativa Indica Group [Indian rice]
ref|XP_010680937.1|  PREDICTED: BEL1-like homeodomain protein 4         290   1e-82    
ref|XP_008813264.1|  PREDICTED: BEL1-like homeodomain protein 4         289   1e-82    
ref|XP_007156003.1|  hypothetical protein PHAVU_003G250500g             289   2e-82    
ref|XP_011099269.1|  PREDICTED: BEL1-like homeodomain protein 4         289   2e-82    
gb|KHM99953.1|  Zinc finger CCCH domain-containing protein 1            290   2e-82    
gb|EMS53609.1|  BEL1-like homeodomain protein 2                         275   2e-82    
ref|XP_010938938.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...    288   2e-82    
ref|XP_003611874.1|  BEL1-like homeodomain protein                      288   2e-82    
ref|XP_011009913.1|  PREDICTED: BEL1-like homeodomain protein 4         290   3e-82    
ref|XP_009376500.1|  PREDICTED: BEL1-like homeodomain protein 2         288   3e-82    
ref|XP_009376501.1|  PREDICTED: BEL1-like homeodomain protein 4         287   3e-82    
ref|XP_002310774.2|  hypothetical protein POPTR_0007s12170g             289   3e-82    Populus trichocarpa [western balsam poplar]
ref|XP_009379163.1|  PREDICTED: BEL1-like homeodomain protein 2         289   3e-82    
dbj|BAJ95083.1|  predicted protein                                      289   4e-82    
ref|XP_006599397.1|  PREDICTED: BEL1-like homeodomain protein 2-like    288   6e-82    
ref|XP_002466514.1|  hypothetical protein SORBIDRAFT_01g009130          287   6e-82    Sorghum bicolor [broomcorn]
ref|XP_009776283.1|  PREDICTED: BEL1-like homeodomain protein 2         287   6e-82    
ref|XP_010254984.1|  PREDICTED: BEL1-like homeodomain protein 4         288   6e-82    
ref|XP_008675423.1|  PREDICTED: BEL1-related homeotic protein 14 ...    283   9e-82    
ref|XP_007047070.1|  BEL1-like homeodomain protein 2 isoform 1          288   1e-81    
ref|XP_009411323.1|  PREDICTED: BEL1-like homeodomain protein 4         285   1e-81    
gb|EYU44317.1|  hypothetical protein MIMGU_mgv1a001716mg                286   1e-81    
ref|NP_001148063.1|  homeodomain protein JUBEL1                         286   1e-81    Zea mays [maize]
ref|XP_006651784.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...    285   1e-81    
ref|NP_001048808.1|  Os03g0124000                                       282   2e-81    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA51178.1|  TPA: putative POX domain/homeobox DNA-binding do...    286   2e-81    
ref|XP_009400050.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    285   2e-81    
ref|XP_009769608.1|  PREDICTED: BEL1-like homeodomain protein 4         286   2e-81    
ref|XP_008778978.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    285   2e-81    
ref|XP_006283322.1|  hypothetical protein CARUB_v10004359mg             277   3e-81    
gb|EAY88336.1|  hypothetical protein OsI_09793                          281   4e-81    Oryza sativa Indica Group [Indian rice]
ref|XP_006425771.1|  hypothetical protein CICLE_v10024897mg             286   4e-81    
ref|XP_008344278.1|  PREDICTED: BEL1-like homeodomain protein 2         286   4e-81    
gb|AAF43095.1|AF053769_1  homeodomain protein                           286   4e-81    Malus domestica [apple tree]
ref|XP_002306443.2|  hypothetical protein POPTR_0005s13780g             286   4e-81    Populus trichocarpa [western balsam poplar]
ref|XP_006411954.1|  hypothetical protein EUTSA_v10024509mg             283   1e-80    
ref|XP_010531191.1|  PREDICTED: BEL1-like homeodomain protein 4         283   1e-80    
emb|CDY46061.1|  BnaA09g41850D                                          280   1e-80    
ref|XP_009117270.1|  PREDICTED: BEL1-like homeodomain protein 4         280   1e-80    
ref|XP_004233410.1|  PREDICTED: BEL1-like homeodomain protein 2         280   2e-80    
emb|CDX69252.1|  BnaC01g02010D                                          281   2e-80    
ref|XP_002281889.1|  PREDICTED: BEL1-like homeodomain protein 4         281   2e-80    Vitis vinifera
ref|XP_007047071.1|  BEL1-like homeodomain protein 2 isoform 2          283   5e-80    
ref|XP_004148064.1|  PREDICTED: uncharacterized protein LOC101212977    279   6e-80    
ref|XP_004981881.1|  PREDICTED: BEL1-like homeodomain protein 2-l...    281   6e-80    
ref|XP_008457795.1|  PREDICTED: BEL1-like homeodomain protein 4         280   6e-80    
gb|KGN62029.1|  hypothetical protein Csa_2G287110                       279   7e-80    
ref|XP_009629330.1|  PREDICTED: BEL1-like homeodomain protein 4         282   8e-80    
ref|XP_004142028.1|  PREDICTED: homeobox protein BEL1 homolog           278   1e-79    
ref|XP_011074481.1|  PREDICTED: BEL1-like homeodomain protein 4         278   1e-79    
ref|XP_010417119.1|  PREDICTED: BEL1-like homeodomain protein 4         278   2e-79    
ref|XP_010230386.1|  PREDICTED: BEL1-like homeodomain protein 4         281   2e-79    
ref|XP_010029855.1|  PREDICTED: BEL1-like homeodomain protein 4         282   2e-79    
ref|XP_010472371.1|  PREDICTED: BEL1-like homeodomain protein 4         278   2e-79    
ref|XP_010429329.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    278   2e-79    
gb|ABF98709.1|  homeodomain protein JUBEL1, putative, expressed         281   2e-79    Oryza sativa Japonica Group [Japonica rice]
gb|AAD51349.1|  bel1-like homeodomain 2                                 280   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283200.1|  hypothetical protein CARUB_v10004235mg             278   2e-79    
ref|XP_002269670.2|  PREDICTED: BEL1-like homeodomain protein 2         281   3e-79    Vitis vinifera
gb|ACU01957.1|  aintegumenta-like protein                               266   4e-79    Santalum album
ref|XP_003572007.1|  PREDICTED: BEL1-like homeodomain protein 4         276   5e-79    
emb|CDY62523.1|  BnaC04g56300D                                          276   5e-79    
ref|XP_006283201.1|  hypothetical protein CARUB_v10004235mg             278   6e-79    
ref|XP_008440170.1|  PREDICTED: BEL1-like homeodomain protein 4         277   7e-79    
ref|XP_010548375.1|  PREDICTED: BEL1-like homeodomain protein 4         279   7e-79    
gb|KHN36166.1|  BEL1-like homeodomain protein 2                         278   8e-79    
ref|XP_011085539.1|  PREDICTED: BEL1-like homeodomain protein 4         278   9e-79    
ref|XP_006293804.1|  hypothetical protein CARUB_v10022787mg             276   9e-79    
ref|NP_195405.4|  BEL1-like homeodomain protein 2                       278   1e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404859.1|  hypothetical protein EUTSA_v10000076mg             275   2e-78    
ref|XP_002880524.1|  hypothetical protein ARALYDRAFT_900861             274   2e-78    
ref|XP_004509227.1|  PREDICTED: BEL1-like homeodomain protein 2-like    278   2e-78    
emb|CDX75604.1|  BnaA01g00980D                                          275   2e-78    
ref|XP_004511995.1|  PREDICTED: BEL1-like homeodomain protein 2-like    276   4e-78    
gb|KGN48456.1|  hypothetical protein Csa_6G487770                       275   4e-78    
gb|KHN44516.1|  BEL1-like homeodomain protein 2                         273   5e-78    
ref|XP_002522396.1|  bel1 homeotic protein, putative                    272   5e-78    Ricinus communis
ref|XP_009141155.1|  PREDICTED: BEL1-like homeodomain protein 2         275   5e-78    
gb|AAK43834.1|AF353092_1  BEL1-like homeobox 4                          273   6e-78    Arabidopsis thaliana [mouse-ear cress]
gb|KHG13966.1|  BEL1-like homeodomain protein 2                         274   7e-78    
ref|NP_179956.1|  BEL1-like homeodomain 4                               273   1e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083914.1|  PREDICTED: BEL1-like homeodomain protein 4         272   1e-77    
gb|EEE51314.1|  hypothetical protein OsJ_32275                          271   1e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465020.1|  hypothetical protein SORBIDRAFT_01g030620          272   1e-77    Sorghum bicolor [broomcorn]
emb|CDY39669.1|  BnaA04g13860D                                          273   2e-77    
ref|XP_009140492.1|  PREDICTED: BEL1-like homeodomain protein 4         272   2e-77    
ref|XP_002869016.1|  hypothetical protein ARALYDRAFT_328081             274   3e-77    
ref|XP_010446733.1|  PREDICTED: BEL1-like homeodomain protein 2         274   4e-77    
ref|XP_010936123.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    263   5e-77    
emb|CAB16801.2|  BEL1-like homeobox 2 protein (BLH2)                    270   8e-77    Arabidopsis thaliana [mouse-ear cress]
gb|KHG00531.1|  Homeobox BEL1 -like protein                             265   9e-77    
emb|CBI17588.3|  unnamed protein product                                270   3e-76    
ref|XP_006425770.1|  hypothetical protein CICLE_v10024897mg             272   5e-76    
ref|XP_009404911.1|  PREDICTED: BEL1-like homeodomain protein 1         269   8e-76    
ref|XP_010936122.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    259   8e-76    
ref|XP_004160487.1|  PREDICTED: BEL1-like homeodomain protein 2-like    262   1e-75    
gb|KHG14356.1|  BEL1-like homeodomain protein 2                         270   1e-75    
ref|XP_002306123.2|  hypothetical protein POPTR_0004s16660g             266   2e-75    Populus trichocarpa [western balsam poplar]
ref|XP_009605853.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    268   3e-75    
ref|XP_009605852.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    269   3e-75    
ref|XP_009420594.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...    267   3e-75    
gb|KHG11905.1|  BEL1-like homeodomain protein 1                         266   6e-75    
gb|EMT28215.1|  BEL1-like homeodomain protein 2                         264   8e-75    
gb|EEE59870.1|  hypothetical protein OsJ_12461                          269   9e-75    Oryza sativa Japonica Group [Japonica rice]
gb|KHG11906.1|  BEL1-like homeodomain protein 1                         265   1e-74    
ref|XP_002313027.2|  hypothetical protein POPTR_0009s12360g             263   2e-74    Populus trichocarpa [western balsam poplar]
gb|KHG01894.1|  BEL1-like homeodomain protein 1                         264   2e-74    
ref|XP_008808897.1|  PREDICTED: BEL1-like homeodomain protein 4         262   2e-74    
ref|XP_010097899.1|  BEL1-like homeodomain protein 2                    270   2e-74    
ref|XP_007145789.1|  hypothetical protein PHAVU_007G267900g             264   3e-74    
ref|XP_010941926.1|  PREDICTED: BEL1-like homeodomain protein 4         261   4e-74    
ref|XP_003539486.1|  PREDICTED: BEL1-like homeodomain protein 1-like    259   7e-74    
gb|EMT07957.1|  BEL1-like homeodomain protein 4                         258   9e-74    
ref|XP_007027982.1|  BEL1-like homeodomain protein 1 isoform 1          262   1e-73    
gb|KHN17979.1|  BEL1-like homeodomain protein 1                         258   1e-73    
ref|XP_010059079.1|  PREDICTED: BEL1-like homeodomain protein 1         263   1e-73    
gb|KHG11012.1|  Homeobox BEL1 -like protein                             256   2e-73    
ref|XP_002464081.1|  hypothetical protein SORBIDRAFT_01g011960          261   2e-73    Sorghum bicolor [broomcorn]
ref|XP_008784116.1|  PREDICTED: BEL1-like homeodomain protein 1         261   4e-73    
ref|XP_011037163.1|  PREDICTED: BEL1-like homeodomain protein 6         261   4e-73    
gb|ACU01965.1|  bell1-like protein                                      250   4e-73    Santalum album
ref|XP_003535815.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    261   4e-73    
ref|XP_007150022.1|  hypothetical protein PHAVU_005G119300g             261   5e-73    
gb|EAY91758.1|  hypothetical protein OsI_13400                          263   8e-73    Oryza sativa Indica Group [Indian rice]
dbj|BAE71188.1|  BEL1-like homeodomain transcription factor             260   9e-73    Trifolium pratense [peavine clover]
ref|XP_007150021.1|  hypothetical protein PHAVU_005G119300g             261   9e-73    
dbj|BAJ98782.1|  predicted protein                                      258   1e-72    
ref|XP_009619241.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    257   1e-72    
ref|XP_003543416.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    260   1e-72    
ref|XP_008797003.1|  PREDICTED: BEL1-like homeodomain protein 4         256   1e-72    
gb|EEE64958.1|  hypothetical protein OsJ_19849                          250   2e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004230877.1|  PREDICTED: BEL1-like homeodomain protein 7         259   2e-72    
ref|XP_009347845.1|  PREDICTED: BEL1-like homeodomain protein 7         259   2e-72    
gb|KHN48417.1|  BEL1-like homeodomain protein 1                         254   2e-72    
ref|XP_010931060.1|  PREDICTED: BEL1-like homeodomain protein 1         258   2e-72    
emb|CDP02423.1|  unnamed protein product                                251   2e-72    
ref|XP_004983819.1|  PREDICTED: homeobox protein BEL1 homolog iso...    257   2e-72    
ref|XP_006664239.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    258   3e-72    
ref|XP_004982177.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    258   3e-72    
ref|XP_011042587.1|  PREDICTED: BEL1-like homeodomain protein 1         259   3e-72    
ref|XP_004963319.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    258   3e-72    
ref|XP_008442920.1|  PREDICTED: BEL1-like homeodomain protein 1         259   3e-72    
emb|CBI19630.3|  unnamed protein product                                249   4e-72    
gb|EPS62050.1|  hypothetical protein M569_12744                         243   6e-72    
ref|XP_008338177.1|  PREDICTED: BEL1-like homeodomain protein 2         249   7e-72    
ref|XP_003519115.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    257   9e-72    
ref|XP_009619240.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    257   9e-72    
ref|XP_010066189.1|  PREDICTED: BEL1-like homeodomain protein 6         257   9e-72    
emb|CAC82981.1|  putative BEL1-like protein                             261   1e-71    
gb|EYU45099.1|  hypothetical protein MIMGU_mgv1a003541mg                255   1e-71    
ref|XP_009628712.1|  PREDICTED: BEL1-like homeodomain protein 1         257   2e-71    
ref|XP_008799712.1|  PREDICTED: BEL1-like homeodomain protein 1         257   2e-71    
ref|XP_011046419.1|  PREDICTED: BEL1-like homeodomain protein 1         257   2e-71    
ref|XP_008377277.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    257   2e-71    
ref|XP_009372989.1|  PREDICTED: BEL1-like homeodomain protein 6         257   2e-71    
ref|XP_010932911.1|  PREDICTED: BEL1-like homeodomain protein 7         256   2e-71    
ref|XP_007162972.1|  hypothetical protein PHAVU_001G195800g             256   2e-71    
ref|XP_008674921.1|  PREDICTED: bell-like homeodomain protein 3 i...    255   3e-71    
emb|CAD89693.1|  BEL1-like homeodomain protein HB2                      254   3e-71    
ref|XP_009629592.1|  PREDICTED: BEL1-like homeodomain protein 1         257   3e-71    
ref|XP_006650407.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    255   3e-71    
ref|XP_009773899.1|  PREDICTED: BEL1-like homeodomain protein 1         255   3e-71    
emb|CDY32069.1|  BnaC04g44970D                                          255   3e-71    
ref|XP_010941766.1|  PREDICTED: BEL1-like homeodomain protein 4         253   3e-71    
ref|XP_006481599.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    256   4e-71    
gb|KDP36113.1|  hypothetical protein JCGZ_08757                         256   4e-71    
ref|XP_006430060.1|  hypothetical protein CICLE_v10011201mg             256   4e-71    
gb|EYU37829.1|  hypothetical protein MIMGU_mgv1a003764mg                253   4e-71    
ref|NP_001067363.1|  Os12g0636200                                       255   4e-71    
ref|XP_009403681.1|  PREDICTED: BEL1-like homeodomain protein 1         253   4e-71    
gb|EAY84030.1|  hypothetical protein OsI_39262                          255   4e-71    
ref|NP_001147936.1|  bell-like homeodomain protein 3                    254   5e-71    
ref|XP_009778869.1|  PREDICTED: BEL1-like homeodomain protein 1         257   5e-71    
ref|XP_002974618.1|  hypothetical protein SELMODRAFT_414952             261   5e-71    
gb|AAK00972.1|AC079736_12  putative homeodomain protein                 255   5e-71    
gb|EMS47188.1|  BEL1-like homeodomain protein 6                         254   5e-71    
ref|XP_010521016.1|  PREDICTED: BEL1-like homeodomain protein 1         255   5e-71    
gb|KDO70617.1|  hypothetical protein CISIN_1g005514mg                   256   5e-71    
gb|AAS18416.1|  benzothiadiazole-induced homeodomain protein 1          254   6e-71    
gb|KHN10043.1|  BEL1-like homeodomain protein 1                         249   7e-71    
ref|XP_010516766.1|  PREDICTED: BEL1-like homeodomain protein 7         250   7e-71    
ref|XP_008382306.1|  PREDICTED: BEL1-like homeodomain protein 6         255   7e-71    
gb|KHG12221.1|  BEL1-like homeodomain protein 6                         254   8e-71    
ref|XP_006373820.1|  hypothetical protein POPTR_0016s07040g             255   8e-71    
ref|XP_004136516.1|  PREDICTED: BEL1-like homeodomain protein 1-like    256   8e-71    
ref|XP_006381943.1|  hypothetical protein POPTR_0006s21950g             255   8e-71    
ref|XP_010932672.1|  PREDICTED: BEL1-like homeodomain protein 7         255   9e-71    
ref|XP_009787672.1|  PREDICTED: BEL1-like homeodomain protein 1         255   9e-71    
emb|CDX89711.1|  BnaC03g46250D                                          249   9e-71    
ref|XP_009757871.1|  PREDICTED: BEL1-like homeodomain protein 7         254   1e-70    
ref|XP_004171976.1|  PREDICTED: BEL1-like homeodomain protein 1-like    256   1e-70    
ref|XP_009137061.1|  PREDICTED: BEL1-like homeodomain protein 7         248   1e-70    
ref|XP_009136305.1|  PREDICTED: BEL1-like homeodomain protein 7         249   1e-70    
ref|XP_007208166.1|  hypothetical protein PRUPE_ppa002583mg             254   1e-70    
ref|XP_009613053.1|  PREDICTED: BEL1-like homeodomain protein 1         254   1e-70    
ref|XP_002443654.1|  hypothetical protein SORBIDRAFT_08g022960          254   1e-70    
ref|XP_010505121.1|  PREDICTED: BEL1-like homeodomain protein 1         254   2e-70    
ref|XP_010467364.1|  PREDICTED: BEL1-like homeodomain protein 7         249   2e-70    
ref|XP_004300564.1|  PREDICTED: BEL1-like homeodomain protein 2-like    240   2e-70    
ref|XP_008230296.1|  PREDICTED: BEL1-like homeodomain protein 1         253   2e-70    
ref|XP_008812787.1|  PREDICTED: BEL1-like homeodomain protein 7         254   2e-70    
gb|EMS60062.1|  BEL1-like homeodomain protein 6                         250   2e-70    
ref|XP_006362026.1|  PREDICTED: BEL1-related homeotic protein 30        253   2e-70    
gb|ACU01959.1|  bell1-like protein                                      238   2e-70    
ref|NP_001275368.1|  BEL1-related homeotic protein 30                   253   2e-70    
ref|XP_010489213.1|  PREDICTED: BEL1-like homeodomain protein 7         249   2e-70    
gb|AAN03622.1|AF406698_1  BEL1-related homeotic protein 11              250   3e-70    
emb|CDY40420.1|  BnaA04g20970D                                          253   3e-70    
gb|EEC75936.1|  hypothetical protein OsI_13031                          253   3e-70    
ref|NP_001050904.1|  Os03g0680800                                       253   3e-70    
ref|XP_010089795.1|  BEL1-like homeodomain protein 1                    253   4e-70    
dbj|BAJ96483.1|  predicted protein                                      252   5e-70    
ref|NP_179233.1|  BEL1-like homeodomain 7                               248   5e-70    
gb|AAL10487.1|  At2g16400/F16F14.10                                     248   5e-70    
emb|CDY02261.1|  BnaA03g39060D                                          247   6e-70    
ref|XP_003561342.1|  PREDICTED: BEL1-like homeodomain protein 7         252   6e-70    
ref|XP_006409439.1|  hypothetical protein EUTSA_v10022660mg             248   6e-70    
ref|XP_008644604.1|  PREDICTED: BEL1-like homeodomain protein 7         251   8e-70    
ref|XP_008675002.1|  PREDICTED: BEL1-related homeotic protein 30 ...    251   9e-70    
ref|NP_001147963.1|  BEL1-related homeotic protein 30                   251   9e-70    
ref|XP_008391977.1|  PREDICTED: BEL1-like homeodomain protein 1         253   1e-69    
ref|XP_007136630.1|  hypothetical protein PHAVU_009G060400g             248   1e-69    
emb|CDX84585.1|  BnaA03g16450D                                          252   1e-69    
ref|XP_008360598.1|  PREDICTED: BEL1-like homeodomain protein 1         253   1e-69    
emb|CDX79646.1|  BnaC03g19820D                                          252   1e-69    
ref|XP_002465808.1|  hypothetical protein SORBIDRAFT_01g046170          249   2e-69    
ref|XP_010031566.1|  PREDICTED: BEL1-like homeodomain protein 1         252   2e-69    
ref|XP_002886224.1|  hypothetical protein ARALYDRAFT_480804             246   2e-69    
ref|NP_001131173.1|  uncharacterized protein LOC100192481               251   2e-69    
gb|ACD39464.1|  BEL5 protein                                            251   2e-69    
gb|ACD39468.1|  BEL5 protein                                            251   2e-69    
ref|XP_010107001.1|  BEL1-like homeodomain protein 1                    245   3e-69    
ref|XP_009141535.1|  PREDICTED: BEL1-like homeodomain protein 1         251   3e-69    
ref|XP_006297524.1|  hypothetical protein CARUB_v10013548mg             246   4e-69    
ref|XP_009396357.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    249   4e-69    
ref|XP_010313381.1|  PREDICTED: BEL1-like homeodomain protein 1         251   4e-69    
ref|XP_002867111.1|  hypothetical protein ARALYDRAFT_912924             247   4e-69    
ref|XP_009358787.1|  PREDICTED: BEL1-like homeodomain protein 9         249   4e-69    
ref|XP_008387112.1|  PREDICTED: BEL1-like homeodomain protein 1         251   4e-69    
ref|XP_002524053.1|  bel1 homeotic protein, putative                    250   5e-69    
ref|XP_006362847.1|  PREDICTED: BEL1-like homeodomain protein 1-like    251   5e-69    
gb|EMT16587.1|  BEL1-like homeodomain protein 6                         251   5e-69    
ref|XP_009396355.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    249   6e-69    
ref|XP_009138307.1|  PREDICTED: BEL1-like homeodomain protein 6         246   6e-69    
ref|XP_003575568.1|  PREDICTED: BEL1-like homeodomain protein 7         249   6e-69    
gb|AFW75231.1|  putative POX domain/homeobox DNA-binding domain f...    238   7e-69    
ref|XP_008241058.1|  PREDICTED: BEL1-like homeodomain protein 1         250   7e-69    
ref|XP_009348973.1|  PREDICTED: BEL1-like homeodomain protein 1         250   9e-69    
ref|XP_003521496.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    249   9e-69    
ref|XP_006424091.1|  hypothetical protein CICLE_v10027955mg             249   1e-68    
ref|XP_004506223.1|  PREDICTED: BEL1-like homeodomain protein 1-like    248   1e-68    
ref|XP_007204250.1|  hypothetical protein PRUPE_ppa002158mg             250   1e-68    
emb|CBI22785.3|  unnamed protein product                                244   1e-68    
dbj|BAJ34230.1|  unnamed protein product                                243   1e-68    
ref|XP_006361091.1|  PREDICTED: BEL1-related homeotic protein 5         249   1e-68    
ref|XP_008812200.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    248   1e-68    
ref|XP_008449596.1|  PREDICTED: BEL1-like homeodomain protein 1         249   1e-68    
ref|XP_006494895.1|  PREDICTED: BEL1-like homeodomain protein 1-like    249   1e-68    
tpg|DAA43547.1|  TPA: putative POX domain/homeobox DNA-binding do...    247   1e-68    
dbj|BAK01775.1|  predicted protein                                      248   1e-68    
ref|XP_010247184.1|  PREDICTED: BEL1-like homeodomain protein 1         250   2e-68    
emb|CDP15553.1|  unnamed protein product                                249   2e-68    
ref|XP_010557975.1|  PREDICTED: BEL1-like homeodomain protein 1         248   2e-68    
ref|XP_004140170.1|  PREDICTED: BEL1-like homeodomain protein 1-like    249   2e-68    
ref|NP_001234599.1|  bell-like homeodomain protein 2                    249   2e-68    
ref|XP_008679683.1|  PREDICTED: BEL1-like homeodomain protein 1         248   2e-68    
ref|XP_008812195.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    248   2e-68    
ref|XP_006649449.1|  PREDICTED: BEL1-like homeodomain protein 7-like    246   2e-68    
ref|XP_008812196.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    248   3e-68    
gb|KHN33154.1|  BEL1-like homeodomain protein 1                         241   3e-68    
ref|XP_002266838.1|  PREDICTED: BEL1-like homeodomain protein 1         248   3e-68    
ref|XP_004985591.1|  PREDICTED: BEL1-like homeodomain protein 7-l...    245   3e-68    
ref|XP_007160715.1|  hypothetical protein PHAVU_001G011000g             247   3e-68    
ref|XP_006595918.1|  PREDICTED: BEL1-like homeodomain protein 3-l...    247   4e-68    
ref|XP_006412205.1|  hypothetical protein EUTSA_v10024906mg             244   4e-68    
ref|NP_001274921.1|  BEL1-related homeotic protein 5                    248   5e-68    
ref|XP_010917677.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    247   5e-68    
gb|KDO46590.1|  hypothetical protein CISIN_1g005901mg                   247   5e-68    
ref|XP_009418396.1|  PREDICTED: BEL1-like homeodomain protein 7         247   5e-68    
gb|KDP38560.1|  hypothetical protein JCGZ_04485                         248   6e-68    
ref|XP_002275098.1|  PREDICTED: BEL1-like homeodomain protein 1         248   7e-68    
ref|XP_010917673.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    247   8e-68    
ref|XP_006838675.1|  hypothetical protein AMTR_s00002p00243900          247   8e-68    
gb|EMS62949.1|  BEL1-like homeodomain protein 6                         246   8e-68    
ref|XP_011083613.1|  PREDICTED: BEL1-like homeodomain protein 7         246   8e-68    
ref|XP_010254698.1|  PREDICTED: BEL1-like homeodomain protein 6         248   9e-68    
gb|KDO49465.1|  hypothetical protein CISIN_1g038021mg                   246   9e-68    
ref|NP_195187.1|  BEL1-like homeodomain 6                               243   9e-68    
gb|EMT29295.1|  BEL1-like homeodomain protein 6                         246   9e-68    
ref|XP_006423388.1|  hypothetical protein CICLE_v10027952mg             246   1e-67    
ref|XP_010028619.1|  PREDICTED: BEL1-like homeodomain protein 7         246   1e-67    
ref|XP_006487350.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    246   1e-67    
ref|XP_006283499.1|  hypothetical protein CARUB_v10004551mg             243   1e-67    
ref|XP_006856142.1|  hypothetical protein AMTR_s00059p00164750          238   2e-67    
emb|CBI24428.3|  unnamed protein product                                243   2e-67    
ref|XP_008794017.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    246   2e-67    
ref|XP_006487349.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    246   2e-67    
ref|XP_010917672.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    246   2e-67    
gb|ABF98710.1|  homeodomain protein JUBEL1, putative, expressed         236   2e-67    
ref|XP_004978737.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    245   3e-67    
ref|XP_010917671.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    246   3e-67    
gb|ACN29213.1|  unknown                                                 234   4e-67    
ref|XP_006663234.1|  PREDICTED: BEL1-like homeodomain protein 1-like    243   4e-67    
ref|XP_007160717.1|  hypothetical protein PHAVU_001G011100g             244   4e-67    
gb|KHN22224.1|  BEL1-like homeodomain protein 3                         242   4e-67    
ref|XP_008794014.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    245   4e-67    
ref|XP_004303380.1|  PREDICTED: BEL1-like homeodomain protein 1-like    245   5e-67    
ref|XP_002963328.1|  hypothetical protein SELMODRAFT_80869              234   5e-67    
emb|CAN69527.1|  hypothetical protein VITISV_027380                     245   6e-67    
ref|XP_003549446.2|  PREDICTED: BEL1-like homeodomain protein 3-like    243   6e-67    
dbj|BAE98691.1|  putative homeodomain protein BELL1                     238   6e-67    
ref|XP_003527678.1|  PREDICTED: BEL1-like homeodomain protein 3-l...    243   8e-67    
ref|XP_007226414.1|  hypothetical protein PRUPE_ppa023311mg             240   8e-67    
ref|XP_010088560.1|  BEL1-like homeodomain protein 9                    242   9e-67    
ref|XP_009121216.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...    239   9e-67    
emb|CBI38029.3|  unnamed protein product                                242   9e-67    
ref|XP_010263012.1|  PREDICTED: BEL1-like homeodomain protein 1         245   1e-66    
ref|XP_010447052.1|  PREDICTED: BEL1-like homeodomain protein 6         240   1e-66    
ref|XP_007015671.1|  BEL1 homeodomain 1, putative                       244   1e-66    
gb|ACD39463.1|  BEL30 protein                                           243   2e-66    
gb|ACD39467.1|  BEL30 protein                                           243   2e-66    
emb|CDY45321.1|  BnaA03g52940D                                          243   2e-66    
gb|KHN12676.1|  BEL1-like homeodomain protein 7                         241   2e-66    
ref|NP_001065808.2|  Os11g0158600                                       243   2e-66    
ref|XP_003523566.1|  PREDICTED: BEL1-like homeodomain protein 10-...    242   2e-66    
emb|CDO97015.1|  unnamed protein product                                243   2e-66    
ref|XP_008221346.1|  PREDICTED: BEL1-like homeodomain protein 3         241   3e-66    
ref|XP_007132496.1|  hypothetical protein PHAVU_011G099100g             243   3e-66    
ref|XP_009128099.1|  PREDICTED: BEL1-like homeodomain protein 3         238   3e-66    
emb|CDY39031.1|  BnaA02g17200D                                          237   4e-66    
ref|NP_001049067.1|  Os03g0165300                                       240   4e-66    
ref|XP_002450321.1|  hypothetical protein SORBIDRAFT_05g003750          242   4e-66    
ref|XP_010912386.1|  PREDICTED: BEL1-like homeodomain protein 1         242   4e-66    
ref|XP_002969077.1|  hypothetical protein SELMODRAFT_68227              227   4e-66    
ref|XP_008388082.1|  PREDICTED: BEL1-like homeodomain protein 9         241   4e-66    
gb|KHG00573.1|  BEL1-like homeodomain protein 6                         242   5e-66    
ref|XP_008787379.1|  PREDICTED: BEL1-like homeodomain protein 9         243   5e-66    
ref|XP_007199727.1|  hypothetical protein PRUPE_ppa002499mg             241   5e-66    
ref|XP_010437584.1|  PREDICTED: BEL1-like homeodomain protein 6         238   6e-66    
ref|XP_010107836.1|  BEL1-like homeodomain protein 6                    241   6e-66    
ref|NP_177674.1|  BEL1-like homeodomain 3                               238   6e-66    
gb|AAL32623.1|  Similar to homeodomain proteins                         238   6e-66    
ref|XP_007135942.1|  hypothetical protein PHAVU_009G004800g             241   7e-66    
ref|XP_003589334.1|  BEL1-like homeodomain protein                      240   7e-66    
ref|XP_002992851.1|  hypothetical protein SELMODRAFT_48157              226   7e-66    
ref|XP_004291834.1|  PREDICTED: BEL1-like homeodomain protein 3-like    240   8e-66    
ref|XP_008236952.1|  PREDICTED: BEL1-like homeodomain protein 7         241   9e-66    
ref|XP_002512955.1|  bel1 homeotic protein, putative                    241   1e-65    
ref|XP_010110017.1|  BEL1-like homeodomain protein 6                    239   1e-65    
emb|CDY45383.1|  BnaC06g42380D                                          229   1e-65    
gb|KHG12855.1|  BEL1-like homeodomain protein 1                         240   1e-65    
gb|KDP41749.1|  hypothetical protein JCGZ_26767                         241   1e-65    
emb|CAN73410.1|  hypothetical protein VITISV_024375                     240   1e-65    
ref|XP_010654234.1|  PREDICTED: BEL1-like homeodomain protein 9         239   2e-65    
emb|CDX73170.1|  BnaC06g36180D                                          236   2e-65    



>ref|XP_009800804.1| PREDICTED: homeobox protein BEL1 homolog [Nicotiana sylvestris]
 ref|XP_009800805.1| PREDICTED: homeobox protein BEL1 homolog [Nicotiana sylvestris]
 ref|XP_009800806.1| PREDICTED: homeobox protein BEL1 homolog [Nicotiana sylvestris]
Length=644

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/648 (54%), Positives = 420/648 (65%), Gaps = 100/648 (15%)
 Frame = -2

Query  1977  SMVTNTGYWYSDSAMNTQIQSGHMMS-QLQSFEPNPEIYNLSSGMEMMVGFPFKNLQAQS  1801
             SMVT TGYWYSD          ++++ QLQSFE NPEIYNL+SGMEM +GFP  N Q   
Sbjct  18    SMVTTTGYWYSDHTSTPSNNIPNLVNHQLQSFETNPEIYNLTSGMEM-IGFPSNNPQV--  74

Query  1800  DMWKP--VPLSHSENMvaggggapvlggggwaVEGNNNSNE-MKVSITQ-----------  1663
              MWK      + S  +V     +       +   GN  ++E M VS T+           
Sbjct  75    -MWKGNFFNKNSSNTIVGPSSSSSKSTNELFYQHGNFTTSENMLVSPTEDQGWNENNRLL  133

Query  1662  -------------------KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHD  1540
                                +GLSLSL S+NPS+IG  SF+ LR           +  Q  
Sbjct  134   VDDPSLRCVFPCEGNERPSQGLSLSLCSSNPSSIGLQSFE-LR-----------HQQQQI  181

Query  1539  EDDRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSD------EPKRKS  1378
               D FLGK        Q Y+ QI+ SKYLGPAQELL EFC +GT Q+D      + ++ +
Sbjct  182   IQDGFLGKA---AANIQGYYHQIKDSKYLGPAQELLIEFCSLGTKQNDHSTKVLKQQKSN  238

Query  1377  QWQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVA  1198
             QW+ D++ +SS+  +L SL  LELQK KSKLL +L+EVDRRYKHY DQM AVVS+FEAVA
Sbjct  239   QWE-DENASSSKKQTLHSLDLLELQKRKSKLLQMLEEVDRRYKHYCDQMKAVVSTFEAVA  297

Query  1197  GDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKM  1018
             G+GAA VYS LAS+ MSRHFRCLRD I+ Q+KA KKAM EK+S    PG T+GETPRL++
Sbjct  298   GNGAARVYSTLASKAMSRHFRCLRDGIVGQIKATKKAMGEKDSVIV-PGTTRGETPRLRL  356

Query  1017  IDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             +DQTLRQQKA QQ+ MM++HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ
Sbjct  357   LDQTLRQQKAFQQMNMMETHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  416

Query  837   TGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAA---VDGGSGRER  667
             TGLSRSQVSNWFINARVRLWKPMVEEMYLEE K+Q   + S DGS+     ++G S   +
Sbjct  417   TGLSRSQVSNWFINARVRLWKPMVEEMYLEETKDQQENLESPDGSKGLDHDMNGISVGRQ  476

Query  666   L---------DKKPNVVRLDSECISSLINIPAKAGG----------DHHQ----------  574
             +         D+KPN++R+DSECISS+IN P K             DHHQ          
Sbjct  477   INQNPQLHIEDQKPNLIRIDSECISSIINHPEKNDTTNNNNKNCLQDHHQAHNFHSFGRG  536

Query  573   ----FGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQHGGSGIGLA-FSPT  409
                 FGA+ELDFS Y HNS GA+ Y     +   GGGVSLTLGL Q+GGSG+GL+ FS  
Sbjct  537   GDHSFGAIELDFSSYNHNSTGAIAYGNENVQHNVGGGVSLTLGLNQNGGSGMGLSTFSQA  596

Query  408   SQNSLFYPRDQ--IGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             SQ+SLFYPRD     DC  V YSLLD E QNLPYRNLMG+QLLHDLAG
Sbjct  597   SQSSLFYPRDDHIDQDCQQVPYSLLDSENQNLPYRNLMGAQLLHDLAG  644



>ref|XP_011029331.1| PREDICTED: homeobox protein BEL1 homolog [Populus euphratica]
Length=658

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/506 (61%), Positives = 361/506 (71%), Gaps = 53/506 (10%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDEDDRFLGK-----------  1516
             +GLSLSL S+NPS IG   F+ LR      +S+  N     E+ RF GK           
Sbjct  164   QGLSLSLCSSNPSTIGLQPFE-LR-----HTSTHQNQDSPQEEMRFFGKSPANIHQQMMQ  217

Query  1515  PENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRK----SQWQQDDHTTS  1348
               NL H  Q   FQ+R+SKY+GPAQ+LL EFC +GT Q D  K+K     QW  D + +S
Sbjct  218   AANLHHQGQ---FQLRNSKYMGPAQDLLNEFCSLGTKQGDALKQKLHKPKQWDDDQNGSS  274

Query  1347  SQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSA  1168
             S+  SL SL F+ELQK K+KLL +L+EVDRRY+HY DQM  VVSSFEAVAG GAA+VYSA
Sbjct  275   SRKQSLQSLEFIELQKRKTKLLSMLEEVDRRYRHYCDQMKDVVSSFEAVAGTGAASVYSA  334

Query  1167  LASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKA  988
             LAS+ MSRHFRCLRD I+AQL A KKAM +K+  +  PG T+GETPRLK++DQTLRQQ+A
Sbjct  335   LASKAMSRHFRCLRDGIVAQLHATKKAMGDKDPVA--PGTTRGETPRLKILDQTLRQQRA  392

Query  987   IQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN  808
              Q ++MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN
Sbjct  393   FQHMSMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN  452

Query  807   WFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGR-----ERLDKKPN--  649
             WFINARVRLWKPMVE+MYLEE KEQDN M SSDG     +  +GR        D+KP   
Sbjct  453   WFINARVRLWKPMVEDMYLEETKEQDNNMASSDGITDLDENINGRPNQNPSSTDQKPTPD  512

Query  648   -VVRLDSECISSLINIPAKAGGD--------HH---------QFGAVELDFSPYTHNSGG  523
              +VR+DSEC+SS+I+ P K   +        HH          FGA+ELDFS Y H++  
Sbjct  513   QLVRIDSECLSSIISNPDKKDTNKSIKTFQSHHLQPHQQNFGNFGAMELDFSSYNHHTAA  572

Query  522   AVGYR--PGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQY  349
              V Y       +   GGGVSLTLGLQQHGGSG+ LAFSP S +SLFYPRD I DC  VQY
Sbjct  573   GVSYANDSANSQNFNGGGVSLTLGLQQHGGSGVSLAFSPGSHSSLFYPRDHIEDCQQVQY  632

Query  348   SLLDGEGQNLPYRNLMGSQLLHDLAG  271
             S+LDGEGQNLPYRNLMG+QLLHDLAG
Sbjct  633   SILDGEGQNLPYRNLMGAQLLHDLAG  658


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 51/72 (71%), Gaps = 9/72 (13%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSD-SAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQ  1810
             +S SMV++  + Y+D S+ N  IQ+ H+++Q+Q FE NPE++NL++GME M+GF  KNLQ
Sbjct  9     KSRSMVSSGSFCYTDVSSSNPTIQT-HLVNQIQGFESNPEMFNLTTGME-MIGFS-KNLQ  65

Query  1809  AQ-----SDMWK  1789
              Q     S MWK
Sbjct  66    HQKNDSNSAMWK  77



>ref|XP_007040322.1| POX family protein isoform 1 [Theobroma cacao]
 ref|XP_007040323.1| POX family protein isoform 1 [Theobroma cacao]
 ref|XP_007040324.1| POX family protein isoform 1 [Theobroma cacao]
 ref|XP_007040325.1| POX family protein isoform 1 [Theobroma cacao]
 ref|XP_007040326.1| POX family protein isoform 1 [Theobroma cacao]
 gb|EOY24823.1| POX family protein isoform 1 [Theobroma cacao]
 gb|EOY24824.1| POX family protein isoform 1 [Theobroma cacao]
 gb|EOY24825.1| POX family protein isoform 1 [Theobroma cacao]
 gb|EOY24826.1| POX family protein isoform 1 [Theobroma cacao]
 gb|EOY24827.1| POX family protein isoform 1 [Theobroma cacao]
Length=661

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/509 (61%), Positives = 371/509 (73%), Gaps = 50/509 (10%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSF-------------DDLRLMaassssSRLN---NIQHDED-  1534
             +GLSLSLSS+NP++IG  SF             DD+R + +SS         NIQH +  
Sbjct  158   QGLSLSLSSSNPTSIGLQSFELRQTSHSNHDQQDDMRFIGSSSRDGFFGKPVNIQHQQQM  217

Query  1533  --DRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRK-----SQ  1375
               D FLGK  NL H      FQ+RSSKYLGPAQELL EFC +GT Q D  K+K      Q
Sbjct  218   IQDGFLGKAANLHHQG---LFQLRSSKYLGPAQELLNEFCSLGTKQIDASKQKQIHKTKQ  274

Query  1374  WQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAG  1195
             W  ++  +SS+  +L SL F+ELQK K+KLL +L+EVDRRY+HY DQM AVVSSFEAVAG
Sbjct  275   WDDENGASSSRKQALYSLDFIELQKRKTKLLSMLEEVDRRYRHYCDQMKAVVSSFEAVAG  334

Query  1194  DGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMI  1015
              GAA+VYSALAS+ MSRHFRCLRD I++Q++A +KAM EK+  +  PG T+GETPRL+++
Sbjct  335   TGAASVYSALASKAMSRHFRCLRDGIVSQIQATRKAMGEKDPVA--PGTTRGETPRLRVL  392

Query  1014  DQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQT  835
             DQ LRQQKA QQ++MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQT
Sbjct  393   DQALRQQKAFQQMSMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQT  452

Query  834   GLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRER--LD  661
             GLSRSQVSNWFINARVRLWKPMVEEMYLEE+KE +N M SSDG+    D G   +    D
Sbjct  453   GLSRSQVSNWFINARVRLWKPMVEEMYLEEIKEHENNMASSDGATDGDDNGRPNQNPPTD  512

Query  660   KKPN---VVRLDSECISSLINIP-------AKAGGDHHQ--------FGAVELDFSPYTH  535
             +KP    +VR+DSEC+SS++  P       AK   + H         +GA+ELDFS Y+H
Sbjct  513   QKPTPDQLVRVDSECLSSIVTNPDKNDAKSAKTLQNQHSHQPQNFGTYGAMELDFSSYSH  572

Query  534   NSGGAVGY-RPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPP  358
             ++ G V Y      +   GGGVSLTLGLQQHGG+G+ LAFSP SQ+ LFYPRD I DC  
Sbjct  573   HTAGGVSYGSDNANQNFNGGGVSLTLGLQQHGGTGVSLAFSPASQSPLFYPRDHIEDCQQ  632

Query  357   VQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             VQYSLLDGEGQ+LPYRNLMG+QLLHDLAG
Sbjct  633   VQYSLLDGEGQHLPYRNLMGAQLLHDLAG  661


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 6/79 (8%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSDSAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQA  1807
             +S +MV++TG+ YSD +        H+++Q+QSFE N EI+NL++GME M+GF  KNLQ 
Sbjct  9     KSRNMVSSTGFCYSDVSSGNATMQTHLVNQIQSFESNSEIFNLTTGME-MIGFS-KNLQQ  66

Query  1806  QSD----MWKPVPLSHSEN  1762
             Q D    MWK     H  N
Sbjct  67    QGDSNTVMWKGFFNKHGTN  85



>gb|KDO76309.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
 gb|KDO76310.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
Length=635

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/457 (66%), Positives = 347/457 (76%), Gaps = 40/457 (9%)
 Frame = -2

Query  1533  DRFLGKPE---NLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS-----  1378
             D FLGKP    N+ H +  + FQ+R+SKYL PAQE+LKEFC +GT Q+D  K KS     
Sbjct  183   DGFLGKPAIPPNIHHQT-GHQFQLRNSKYLAPAQEILKEFCSLGTKQNDATKLKSNKAKQ  241

Query  1377  QWQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVA  1198
             QW  ++  +SS+  SL SL F+ELQK K+KLL +L+EVDRRY+HY DQM AVVSSFEAVA
Sbjct  242   QWDDENAGSSSRKQSLCSLEFMELQKRKTKLLSMLEEVDRRYRHYCDQMKAVVSSFEAVA  301

Query  1197  GDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKM  1018
             G+GAA VYSALAS+ MSRHFRCLRD I+ Q++A KKAM EK+  +  PG ++GETPRLK+
Sbjct  302   GNGAARVYSALASKAMSRHFRCLRDGIVGQIQATKKAMGEKDPVA--PGTSRGETPRLKI  359

Query  1017  IDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             IDQTLRQQ+A QQ++MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ
Sbjct  360   IDQTLRQQRAFQQMSMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  419

Query  837   TGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRER---  667
             TGLSRSQVSNWFINARVRLWKPMVEEMYLEE KEQDN M SSDG+   +D  SGR     
Sbjct  420   TGLSRSQVSNWFINARVRLWKPMVEEMYLEETKEQDNNMASSDGA-TDLDDNSGRPNQTQ  478

Query  666   ---LDKKPN---VVRLDSECISSLIN---------IPAKAGGDHH------QFGAVELDF  550
                 D+KP    +VR+DSEC+SS+IN          P KA   HH       FGA+ELDF
Sbjct  479   NPPADQKPTQDQLVRIDSECLSSIINNHDKNDANKNPNKALPSHHMQQNFGSFGAMELDF  538

Query  549   SPYTHNSGGAVGYRPG----ERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPR  382
             S Y  ++ G V Y       +   GG GGVSLTLGLQQHGGSG+ LAFSP SQ+SLFYPR
Sbjct  539   SSYNQHTVGGVSYANDSANHQNFNGGSGGVSLTLGLQQHGGSGVSLAFSPASQSSLFYPR  598

Query  381   DQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             D I DC  VQYSLLDGEGQNLPYRNLMG+QLLHDLAG
Sbjct  599   DHIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  635



>gb|KDO76305.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
 gb|KDO76306.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
 gb|KDO76307.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
Length=655

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/457 (66%), Positives = 347/457 (76%), Gaps = 40/457 (9%)
 Frame = -2

Query  1533  DRFLGKPE---NLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS-----  1378
             D FLGKP    N+ H +  + FQ+R+SKYL PAQE+LKEFC +GT Q+D  K KS     
Sbjct  203   DGFLGKPAIPPNIHHQT-GHQFQLRNSKYLAPAQEILKEFCSLGTKQNDATKLKSNKAKQ  261

Query  1377  QWQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVA  1198
             QW  ++  +SS+  SL SL F+ELQK K+KLL +L+EVDRRY+HY DQM AVVSSFEAVA
Sbjct  262   QWDDENAGSSSRKQSLCSLEFMELQKRKTKLLSMLEEVDRRYRHYCDQMKAVVSSFEAVA  321

Query  1197  GDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKM  1018
             G+GAA VYSALAS+ MSRHFRCLRD I+ Q++A KKAM EK+  +  PG ++GETPRLK+
Sbjct  322   GNGAARVYSALASKAMSRHFRCLRDGIVGQIQATKKAMGEKDPVA--PGTSRGETPRLKI  379

Query  1017  IDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             IDQTLRQQ+A QQ++MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ
Sbjct  380   IDQTLRQQRAFQQMSMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  439

Query  837   TGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRER---  667
             TGLSRSQVSNWFINARVRLWKPMVEEMYLEE KEQDN M SSDG+   +D  SGR     
Sbjct  440   TGLSRSQVSNWFINARVRLWKPMVEEMYLEETKEQDNNMASSDGA-TDLDDNSGRPNQTQ  498

Query  666   ---LDKKPN---VVRLDSECISSLIN---------IPAKAGGDHH------QFGAVELDF  550
                 D+KP    +VR+DSEC+SS+IN          P KA   HH       FGA+ELDF
Sbjct  499   NPPADQKPTQDQLVRIDSECLSSIINNHDKNDANKNPNKALPSHHMQQNFGSFGAMELDF  558

Query  549   SPYTHNSGGAVGYRPG----ERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPR  382
             S Y  ++ G V Y       +   GG GGVSLTLGLQQHGGSG+ LAFSP SQ+SLFYPR
Sbjct  559   SSYNQHTVGGVSYANDSANHQNFNGGSGGVSLTLGLQQHGGSGVSLAFSPASQSSLFYPR  618

Query  381   DQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             D I DC  VQYSLLDGEGQNLPYRNLMG+QLLHDLAG
Sbjct  619   DHIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  655



>gb|KDO76303.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
 gb|KDO76304.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
Length=716

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/457 (66%), Positives = 347/457 (76%), Gaps = 40/457 (9%)
 Frame = -2

Query  1533  DRFLGKPE---NLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS-----  1378
             D FLGKP    N+ H +  + FQ+R+SKYL PAQE+LKEFC +GT Q+D  K KS     
Sbjct  264   DGFLGKPAIPPNIHHQT-GHQFQLRNSKYLAPAQEILKEFCSLGTKQNDATKLKSNKAKQ  322

Query  1377  QWQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVA  1198
             QW  ++  +SS+  SL SL F+ELQK K+KLL +L+EVDRRY+HY DQM AVVSSFEAVA
Sbjct  323   QWDDENAGSSSRKQSLCSLEFMELQKRKTKLLSMLEEVDRRYRHYCDQMKAVVSSFEAVA  382

Query  1197  GDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKM  1018
             G+GAA VYSALAS+ MSRHFRCLRD I+ Q++A KKAM EK+  +  PG ++GETPRLK+
Sbjct  383   GNGAARVYSALASKAMSRHFRCLRDGIVGQIQATKKAMGEKDPVA--PGTSRGETPRLKI  440

Query  1017  IDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             IDQTLRQQ+A QQ++MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ
Sbjct  441   IDQTLRQQRAFQQMSMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  500

Query  837   TGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRER---  667
             TGLSRSQVSNWFINARVRLWKPMVEEMYLEE KEQDN M SSDG+   +D  SGR     
Sbjct  501   TGLSRSQVSNWFINARVRLWKPMVEEMYLEETKEQDNNMASSDGA-TDLDDNSGRPNQTQ  559

Query  666   ---LDKKPN---VVRLDSECISSLIN---------IPAKAGGDHH------QFGAVELDF  550
                 D+KP    +VR+DSEC+SS+IN          P KA   HH       FGA+ELDF
Sbjct  560   NPPADQKPTQDQLVRIDSECLSSIINNHDKNDANKNPNKALPSHHMQQNFGSFGAMELDF  619

Query  549   SPYTHNSGGAVGYRPG----ERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPR  382
             S Y  ++ G V Y       +   GG GGVSLTLGLQQHGGSG+ LAFSP SQ+SLFYPR
Sbjct  620   SSYNQHTVGGVSYANDSANHQNFNGGSGGVSLTLGLQQHGGSGVSLAFSPASQSSLFYPR  679

Query  381   DQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             D I DC  VQYSLLDGEGQNLPYRNLMG+QLLHDLAG
Sbjct  680   DHIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  716



>ref|XP_006385769.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
 ref|XP_006385771.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
 ref|XP_006385773.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
 gb|ERP63566.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
 gb|ERP63568.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
 gb|ERP63570.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
Length=664

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/509 (60%), Positives = 364/509 (72%), Gaps = 53/509 (10%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDEDDRFLGK-PENLGHPS-Q  1489
             +GLSLSL  +NPS+IG +SF+ LR      + +  N     E+ RF GK P N+     Q
Sbjct  164   QGLSLSLCPSNPSSIGLHSFE-LR-----HTPTHQNQDNSQEEMRFFGKSPANIQQQMMQ  217

Query  1488  DYF-----------FQIRSSKYLGPAQELLKEFCCVGTTQSD----EPKRKSQWQQDDHT  1354
             D F           FQ+R+SKYLGPAQ+LL EFC + T Q D    +P +  Q   D + 
Sbjct  218   DGFLKAANLHHQAQFQLRNSKYLGPAQDLLNEFCNIRTKQGDALKQKPHKPKQLDDDQNG  277

Query  1353  TSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVY  1174
             +SS+  SL SL F+ELQK K+K+L +L+EVDRRY+HY DQM  +VSSFEAVAG GAA+VY
Sbjct  278   SSSRKQSLESLEFIELQKRKTKMLSMLEEVDRRYRHYCDQMKTMVSSFEAVAGTGAASVY  337

Query  1173  SALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQ  994
             SALAS+ MSRHFRCLRD I+AQ+ A KKAM EK+  +  PG TKGETPRLK++DQ LRQQ
Sbjct  338   SALASKAMSRHFRCLRDGIVAQIHATKKAMGEKDPVA--PGTTKGETPRLKILDQALRQQ  395

Query  993   KAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV  814
             +A QQ++MM+SHPWRPQRGLPERSVS LRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV
Sbjct  396   RAFQQMSMMESHPWRPQRGLPERSVSFLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV  455

Query  813   SNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGR-----ERLDKKP-  652
             SNWFINARVRLWKPMVEEMYLEE KEQD  M SSDG     +  +GR        D+KP 
Sbjct  456   SNWFINARVRLWKPMVEEMYLEETKEQDKNMASSDGVTDLDENINGRPNQNPSSTDQKPT  515

Query  651   --NVVRLDSECISSLINIPAKAGGDHH-----------------QFGAVELDFSPYTHNS  529
               +++R+DSEC+SS+I+ P K G +                    FG+++LDFS Y H++
Sbjct  516   PDHLIRIDSECLSSIISNPDKNGTNKSTISFQSHHLQHQQQSFGNFGSMDLDFSSYNHHA  575

Query  528   GGAVGY---RPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPP  358
              G V Y       +   GGGGVSLTLGLQQHGGSG+ LAFSP SQ+SLFYPRD I DC P
Sbjct  576   AGGVSYANDSASNQNFNGGGGVSLTLGLQQHGGSGVSLAFSPASQSSLFYPRDHIEDCQP  635

Query  357   VQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             VQYSLLDGEGQNLPYRNLMG+QLLHD+AG
Sbjct  636   VQYSLLDGEGQNLPYRNLMGAQLLHDMAG  664


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 9/72 (13%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSD-SAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQ  1810
             +S +MV++  + Y D S+ N  IQ+ H+++Q+Q +E NPEI+NL++GME M+GF  KNLQ
Sbjct  9     KSRNMVSSGSFCYPDVSSSNPTIQT-HLVNQIQGYESNPEIFNLTTGME-MIGFS-KNLQ  65

Query  1809  AQ-----SDMWK  1789
              Q     S MWK
Sbjct  66    HQQSDSNSVMWK  77



>ref|XP_006439494.1| hypothetical protein CICLE_v10019130mg [Citrus clementina]
 gb|ESR52734.1| hypothetical protein CICLE_v10019130mg [Citrus clementina]
Length=690

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/457 (66%), Positives = 346/457 (76%), Gaps = 40/457 (9%)
 Frame = -2

Query  1533  DRFLGKPE---NLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS-----  1378
             D FLGKP    N+ H +  + FQ+R+SKYL PAQE+LKEFC +GT Q+D  K KS     
Sbjct  238   DGFLGKPAIPPNIHHQT-GHQFQLRNSKYLAPAQEILKEFCSLGTKQNDATKLKSNKAKQ  296

Query  1377  QWQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVA  1198
             QW  ++  +SS+  SL SL F+ELQK K+KLL +L+EVDRRY+HY DQM AVVSSFEAVA
Sbjct  297   QWDDENAGSSSRKQSLCSLEFMELQKRKTKLLSMLEEVDRRYRHYCDQMKAVVSSFEAVA  356

Query  1197  GDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKM  1018
             G+GAA VYSALAS+ MSRHFRCLRD I+ Q++A KKAM EK+  +  PG ++GETPRLK+
Sbjct  357   GNGAARVYSALASKAMSRHFRCLRDGIVGQIQATKKAMGEKDPVA--PGTSRGETPRLKI  414

Query  1017  IDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             IDQ LRQQ+A QQ++MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ
Sbjct  415   IDQALRQQRAFQQMSMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  474

Query  837   TGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRER---  667
             TGLSRSQVSNWFINARVRLWKPMVEEMYLEE KEQDN M SSDG+   +D  SGR     
Sbjct  475   TGLSRSQVSNWFINARVRLWKPMVEEMYLEETKEQDNNMASSDGA-TDLDDNSGRPNQTQ  533

Query  666   ---LDKKPN---VVRLDSECISSLIN---------IPAKAGGDHH------QFGAVELDF  550
                 D+KP    +VR+DSEC+SS+IN          P KA   HH       FGA+ELDF
Sbjct  534   NPPADQKPTQDQLVRIDSECLSSIINNHDKNDANKNPNKALPSHHMQQNFGSFGAMELDF  593

Query  549   SPYTHNSGGAVGYRPG----ERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPR  382
             S Y  ++ G V Y       +   GG GGVSLTLGLQQHGGSG+ LAFSP SQ+SLFYPR
Sbjct  594   SSYNQHTVGGVSYANDSANHQNFNGGSGGVSLTLGLQQHGGSGVSLAFSPASQSSLFYPR  653

Query  381   DQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             D I DC  VQYSLLDGEGQNLPYRNLMG+QLLHDLAG
Sbjct  654   DHIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  690


 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 8/72 (11%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSD-SAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQ  1810
             +S +++++ G+ YSD S+ N  +   HMM+Q+Q FE N EI+NL++GME M+GF  KNLQ
Sbjct  9     KSRNIISSGGFCYSDVSSSNPTLHQTHMMNQIQGFEGNHEIFNLTTGME-MIGFS-KNLQ  66

Query  1809  AQSD-----MWK  1789
               +      MWK
Sbjct  67    QHTSDNNSVMWK  78



>ref|XP_006476516.1| PREDICTED: homeobox protein BEL1 homolog [Citrus sinensis]
Length=690

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/457 (66%), Positives = 346/457 (76%), Gaps = 40/457 (9%)
 Frame = -2

Query  1533  DRFLGKPE---NLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS-----  1378
             D FLGKP    N+ H +  + FQ+R+SKYL PAQE+L EFC +GT Q+D  K KS     
Sbjct  238   DGFLGKPAIPPNIHHQT-GHQFQLRNSKYLAPAQEILNEFCSLGTKQNDATKLKSNKAKQ  296

Query  1377  QWQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVA  1198
             QW  ++  +SS+  SL SL F+ELQK K+KLL +L+EVDRRY+HY DQM AVVSSFEAVA
Sbjct  297   QWNDENAGSSSRKQSLCSLEFMELQKRKTKLLSMLEEVDRRYRHYCDQMKAVVSSFEAVA  356

Query  1197  GDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKM  1018
             G+GAA VYSALAS+ MSRHFRCLRD ++ Q++A KKAM EK+  +  PG ++GETPRLK+
Sbjct  357   GNGAARVYSALASKAMSRHFRCLRDGVVGQIQATKKAMGEKDPVA--PGTSRGETPRLKI  414

Query  1017  IDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             IDQTLRQQ+A QQ++MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ
Sbjct  415   IDQTLRQQRAFQQMSMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  474

Query  837   TGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRER---  667
             TGLSRSQVSNWFINARVRLWKPMVEEMYLEE KEQDN M SSDG+   +D  SGR     
Sbjct  475   TGLSRSQVSNWFINARVRLWKPMVEEMYLEETKEQDNNMASSDGA-TDLDDNSGRPNQTQ  533

Query  666   ---LDKKPN---VVRLDSECISSLIN---------IPAKAGGDHH------QFGAVELDF  550
                 D+KP    +VR+DSEC+SS+IN          P KA   HH       FGA+ELDF
Sbjct  534   NPPADQKPTQDQLVRIDSECLSSIINNHDKNDANKNPNKALPSHHMQQNFGSFGAMELDF  593

Query  549   SPYTHNSGGAVGYRPG----ERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPR  382
             S Y  ++ G V Y       +   GG GGVSLTLGLQQHGGSG+ LAFSP SQ+SLFYPR
Sbjct  594   SSYNQHTVGGVSYANDSANHQNFNGGSGGVSLTLGLQQHGGSGVSLAFSPASQSSLFYPR  653

Query  381   DQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             D I DC  VQYSLLDGEGQNLPYRNLMG+QLLHDLAG
Sbjct  654   DHIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  690


 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 8/72 (11%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSD-SAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQ  1810
             +S +++++ G+ YSD S+ N  +   HMM+Q+Q FE N EI+NL++GME M+GF  KNLQ
Sbjct  9     KSRNIISSGGFCYSDVSSSNPTLHQTHMMNQIQGFEGNHEIFNLTTGME-MIGFS-KNLQ  66

Query  1809  AQSD-----MWK  1789
               +      MWK
Sbjct  67    QHTSDNNSVMWK  78



>ref|XP_011022632.1| PREDICTED: homeobox protein BEL1 homolog [Populus euphratica]
Length=665

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/511 (59%), Positives = 361/511 (71%), Gaps = 56/511 (11%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFD---------------DLRLMaassssSRLNNIQHDEDDR  1528
             +GLSLSL  +NPS+IG +SF+               ++R    S ++ +   +Q    D 
Sbjct  164   QGLSLSLCPSNPSSIGLHSFELRHTPTHQNQDNSQEEMRFFGKSPANIQQQMMQ----DG  219

Query  1527  FLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSD----EPKRKSQWQQDD  1360
             FL K  NL H +Q   FQ+R+SKYLGP Q+LL EFC + T Q D    +P +  QW  D 
Sbjct  220   FLTKAANLHHQAQ---FQLRNSKYLGPVQDLLNEFCNIRTKQGDALKQKPHKPKQWDDDQ  276

Query  1359  HTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAAT  1180
             + + S+  SL SL F+ELQK K+K+L +L+EVDRRY+HY DQM  +VSSFEAVAG GAA+
Sbjct  277   NGSYSRKQSLESLQFIELQKRKTKMLSMLEEVDRRYRHYCDQMKTMVSSFEAVAGTGAAS  336

Query  1179  VYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLR  1000
             VYSALAS+ MSRHFRCLRD I+ Q+ A KKAM EK+  +  PG TKGETPRLK++DQ LR
Sbjct  337   VYSALASKAMSRHFRCLRDGIVEQIHATKKAMGEKDPVA--PGTTKGETPRLKILDQALR  394

Query  999   QQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRS  820
             QQ+A QQ+ MM+SHPWRPQRGLPERSVS LRAWLFEHFLHPYPSDVDKHIL+RQTGLSRS
Sbjct  395   QQRAFQQMGMMESHPWRPQRGLPERSVSFLRAWLFEHFLHPYPSDVDKHILSRQTGLSRS  454

Query  819   QVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGR-----ERLDKK  655
             QVSNWFINARVRLWKPMVEEMYLEE KEQDN M SSDG     +  +GR        D+K
Sbjct  455   QVSNWFINARVRLWKPMVEEMYLEETKEQDNNMASSDGVTDLDENINGRPNQNPSSTDQK  514

Query  654   P---NVVRLDSECISSLINIPAKAGGDHH-----------------QFGAVELDFSPYTH  535
             P   +++R+DSEC+SS+I+ P K G +                    FG+++LDFS Y H
Sbjct  515   PTPDHLIRIDSECLSSIISNPDKNGTNKSTISFQSHHLQHQQQSFGNFGSMDLDFSSYNH  574

Query  534   NSGGAVGY---RPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDC  364
             ++ G V Y       +    GGGVSLTLGLQQHGGSG+ LAFSP SQ+SLFY RD I DC
Sbjct  575   HAAGGVSYANDSASNQNFNSGGGVSLTLGLQQHGGSGVSLAFSPASQSSLFYHRDHIEDC  634

Query  363   PPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
              PVQYSLLDGEGQNLPYRNLMG+QLLHD+AG
Sbjct  635   QPVQYSLLDGEGQNLPYRNLMGAQLLHDMAG  665


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 9/72 (13%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSD-SAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQ  1810
             +S +MV++  + Y D S+ N  IQ+ H+ +Q+Q FE NPEI+NL++GME M+GF  KNLQ
Sbjct  9     KSRNMVSSGSFCYPDVSSSNPTIQT-HLGNQIQGFESNPEIFNLTTGME-MIGFS-KNLQ  65

Query  1809  AQ-----SDMWK  1789
              Q     S MWK
Sbjct  66    HQQSDSNSVMWK  77



>ref|XP_002299516.2| hypothetical protein POPTR_0001s09720g [Populus trichocarpa]
 gb|EEE84321.2| hypothetical protein POPTR_0001s09720g [Populus trichocarpa]
Length=663

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/512 (60%), Positives = 357/512 (70%), Gaps = 60/512 (12%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDEDDRFLGK-----------  1516
             +GLSLSL S+NPS IG   F+ LR  +         N  + ++ RF GK           
Sbjct  164   QGLSLSLCSSNPSTIGLQPFE-LRHTSTHQ------NQDNPQEMRFFGKSPANIQQQMMQ  216

Query  1515  PENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRK----SQWQQDDHTTS  1348
               NL H  Q   FQ+R+SKY+GP Q+LL EFC +GT Q D  K+K     QW  D + +S
Sbjct  217   AANLHHQGQ---FQLRNSKYMGPTQDLLNEFCSLGTKQGDALKQKLHKPKQWDDDQNGSS  273

Query  1347  SQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSA  1168
             S+  SL SL F+ELQK K+KLL +L+EVDRRY+HY DQM  VVSSFEAVAG GAA+VYSA
Sbjct  274   SRKQSLQSLEFIELQKRKTKLLSMLEEVDRRYRHYCDQMKDVVSSFEAVAGTGAASVYSA  333

Query  1167  LASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKA  988
             LAS+ MSRHFRCLRD I+AQ+ A KK M +K++ +  PG T+GETPRLK++DQ LRQQ+A
Sbjct  334   LASKAMSRHFRCLRDGIVAQIHATKKGMGDKDTIA--PGTTRGETPRLKILDQNLRQQRA  391

Query  987   IQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ---  817
              Q ++MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ   
Sbjct  392   FQHMSMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQARL  451

Query  816   ---VSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGR-----ERLD  661
                VSNWFINARVRLWKPMVEEMYLEE KEQDN M SSDG     +  +GR        D
Sbjct  452   HLSVSNWFINARVRLWKPMVEEMYLEETKEQDNNMASSDGVTDLDENSNGRPNQNPSSTD  511

Query  660   KKPN---VVRLDSECISSLINIPAKAGGDHH-----------------QFGAVELDFSPY  541
             +KP    +VR+DSEC+SS+I+ P K   +                    FGA+ELDFS Y
Sbjct  512   QKPTPDQLVRIDSECLSSIISNPDKNDTNKSIKTFQSHHLQHQQQNFGNFGAMELDFSSY  571

Query  540   THNSGGAVGY--RPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGD  367
              H++   V Y       +   GGGVSLTLGLQQHGGSG+ LAFSP SQ+SLFYPRD I D
Sbjct  572   NHHTAAGVSYANESVNNQNFNGGGVSLTLGLQQHGGSGVSLAFSPGSQSSLFYPRDHIED  631

Query  366   CPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             C  VQYSLLDGEGQNLPYRNLMG+QLLHDLAG
Sbjct  632   CQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  663


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 51/72 (71%), Gaps = 9/72 (13%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSD-SAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQ  1810
             +S SMV++  + Y+D S+ N  IQ+ H+++Q+Q FE NPE++NL++GME M+GF  KNLQ
Sbjct  9     KSRSMVSSGSFCYTDVSSSNPTIQT-HLVNQIQGFESNPEMFNLTTGME-MIGFS-KNLQ  65

Query  1809  AQ-----SDMWK  1789
              Q     S MWK
Sbjct  66    QQKSDSNSAMWK  77



>ref|XP_009604673.1| PREDICTED: homeobox protein BEL1 homolog [Nicotiana tomentosiformis]
 ref|XP_009604675.1| PREDICTED: homeobox protein BEL1 homolog [Nicotiana tomentosiformis]
 ref|XP_009604676.1| PREDICTED: homeobox protein BEL1 homolog [Nicotiana tomentosiformis]
Length=640

 Score =   541 bits (1393),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 304/512 (59%), Positives = 364/512 (71%), Gaps = 64/512 (13%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDEDDRFLGKPE-NLGHPSQD  1486
             +GLSLSL S+NPS+IG  SF+             L + Q    D FLGK   N+   +Q 
Sbjct  145   QGLSLSLCSSNPSSIGLQSFE-------------LRHQQQIIQDGFLGKAAANIQQQNQG  191

Query  1485  YFFQIRSSKYLGPAQELLKEFCCVGTTQSD-------EPKRKSQWQQDDHTTSSQNHSLG  1327
             Y+ Q++ S+YLGPAQELL EFC +GT Q+D       + ++ +QW+ D++ ++S+  +L 
Sbjct  192   YYHQLKDSRYLGPAQELLVEFCSLGTKQNDHSSAKVLKQQKSNQWE-DENASTSKKQTLQ  250

Query  1326  SLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMS  1147
             SL  LELQK K+KLL +L+EVDRRYKHY DQM AVVS+FEAVAG+GAA VYS LAS+ MS
Sbjct  251   SLDLLELQKRKTKLLQMLEEVDRRYKHYCDQMKAVVSTFEAVAGNGAARVYSTLASKAMS  310

Query  1146  RHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMM  967
             RHFRCLRD I+ Q+KA KKAM EK++    PG T+GETPRL+++DQTLRQQKA QQ+ MM
Sbjct  311   RHFRCLRDGIVGQIKATKKAMGEKDTVVV-PGTTRGETPRLRLLDQTLRQQKAFQQMNMM  369

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             ++HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV
Sbjct  370   ETHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  429

Query  786   RLWKPMVEEMYLEEVKEQDNIMGSSDGSRAA---VDGGSGRERL---------DKKPNVV  643
             RLWKPMVEEMYLEE K+Q   + S DGS+     ++G S   ++         D+KPN+V
Sbjct  430   RLWKPMVEEMYLEETKDQQENLESPDGSKGLDHDMNGISVGRQINQNPQLHIEDQKPNLV  489

Query  642   RLDSECISSLINIPAKA-------------------------GGDHHQFGAVELDFSPYT  538
             R+DSECISS+IN P K                          GGD H FGA+ELDFS Y 
Sbjct  490   RIDSECISSIINHPEKNDTTNNNNKNCLQNHHQVHNLHSFGRGGD-HSFGAIELDFSSYN  548

Query  537   HNSGGAVGYRPGERKTggggGVSLTLGLQQHGGSGIGLA-FSPTSQNSLFYPRDQ--IGD  367
             HNS GA+ Y     +   GGGVSLTLGL Q+GGSG+GL+ FS  SQ+SLFYPRD     D
Sbjct  549   HNSTGAIAYGNESVQHNIGGGVSLTLGLNQNGGSGMGLSTFSQASQSSLFYPRDDHIDQD  608

Query  366   CPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             C  VQYSLLD E QNLPYRNLMG+QLLHDLAG
Sbjct  609   CQQVQYSLLDSENQNLPYRNLMGAQLLHDLAG  640


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 41/63 (65%), Gaps = 4/63 (6%)
 Frame = -2

Query  1977  SMVTNTGYWYSDSAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQAQSD  1798
             SMVT+TGYWYSD           +  QLQSFE NPEIYNL+SGME M+GFP  N Q    
Sbjct  13    SMVTSTGYWYSDHTSTPSNIPNLVNHQLQSFETNPEIYNLTSGME-MIGFPTNNPQV---  68

Query  1797  MWK  1789
             MWK
Sbjct  69    MWK  71



>ref|XP_002279230.2| PREDICTED: homeobox protein BEL1 homolog [Vitis vinifera]
Length=672

 Score =   532 bits (1371),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 294/459 (64%), Positives = 342/459 (75%), Gaps = 45/459 (10%)
 Frame = -2

Query  1533  DRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS----QWQQ  1366
             D FLGK  NL   +    FQ+R+SKYLGPAQ+LL E C +GT Q D P++K+    QW+ 
Sbjct  221   DGFLGKAANLNQGN----FQLRNSKYLGPAQQLLNECCNLGTKQIDPPRQKAPKTNQWED  276

Query  1365  DD--HTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGD  1192
             ++   ++ S+  SL SL  +ELQK KSKLL +L+EVDRRYKHY DQM AVVSSFEAVAG+
Sbjct  277   ENGSSSSCSRKPSLYSLELMELQKRKSKLLSMLEEVDRRYKHYCDQMKAVVSSFEAVAGN  336

Query  1191  GAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMID  1012
             GAA VYSALAS+ MSRHFRCLRD I+ Q++A KKAM EK+  +  PG T+GETPRL+++D
Sbjct  337   GAARVYSALASKAMSRHFRCLRDGIVGQIQATKKAMGEKDPVA--PGTTRGETPRLRVLD  394

Query  1011  QTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  832
             Q LRQQ+A QQ++MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG
Sbjct  395   QALRQQRAFQQMSMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  454

Query  831   LSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGG----SGRERL  664
             LSRSQVSNWFINARVRLWKPMVEEMYLEE KEQDN+ GS DG+    D G    + + R+
Sbjct  455   LSRSQVSNWFINARVRLWKPMVEEMYLEETKEQDNL-GSPDGATDPDDNGRPNPNPQPRI  513

Query  663   -DKKPN---VVRLDSECISSLINIPAKA-----------------------GGDHHQFGA  565
              D+KP    +VR+DSEC+SS+IN P K                        G     FGA
Sbjct  514   EDQKPTAEQLVRIDSECLSSIINNPEKNDSKNGKSLQNPHPHHLHHHQPNFGRVAEAFGA  573

Query  564   VELDFSPYTHNSGGAVGY-RPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFY  388
             VELDFS Y H++ GAV +         GG GVSLTLGLQQHGGSG+ LAFSP SQ+SLFY
Sbjct  574   VELDFSSYNHHTAGAVSFTNDSAHHNFGGSGVSLTLGLQQHGGSGVSLAFSPASQSSLFY  633

Query  387   PRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
              RD I DC PVQYSLLDGEGQNLPYRNLMG+QLLHDLAG
Sbjct  634   SRDPIEDCQPVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  672


 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 54/72 (75%), Gaps = 7/72 (10%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSD-SAMNTQIQS-GHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNL  1813
             +S +MV++ G+ YSD S+ N  IQ+  H+++Q+QSFE NPE++NL++GME M+GFP KNL
Sbjct  9     KSRNMVSSAGFVYSDVSSTNPSIQTQTHLVNQIQSFESNPEMFNLTTGME-MIGFPPKNL  67

Query  1812  QAQSD----MWK  1789
             Q  SD    MWK
Sbjct  68    QQPSDANSVMWK  79



>gb|KHN35035.1| Homeobox protein BEL1 like [Glycine soja]
Length=642

 Score =   530 bits (1366),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 333/652 (51%), Positives = 415/652 (64%), Gaps = 109/652 (17%)
 Frame = -2

Query  1962  TGYWYSDSAMNTQIQSGH---MMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQAQSDMW  1792
             TG+ YSD      + SG+   +++Q+Q F  +PE+YNL++GMEM +GFP  +  A   MW
Sbjct  12    TGFCYSD------VSSGNPTMLVNQIQGFVSDPEMYNLTTGMEM-IGFPKSDTNAV--MW  62

Query  1791  K-----PVPLS----------------HSENMvaggggapvlggggwaVEGN--------  1699
             +     P P S                +++N      G          + GN        
Sbjct  63    RSFIPEPGPSSSKTINDSSTTFYHHDYNNKNADFTPAGNISETSAENLIVGNHDSAPWQD  122

Query  1698  NNSNEMKVSITQ------------KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLN  1555
             NN+N    S  +            +GLSLSLSSTNPS IG  SF+ LR      +    +
Sbjct  123   NNNNRFDDSSLRCVFPCETNERPSQGLSLSLSSTNPSTIGLQSFE-LR-----QTGHHPD  176

Query  1554  NIQHDEDDRFLGKP------------------ENLGHPSQDYFFQIRSSKYLGPAQELLK  1429
              +     + F GKP                    +    Q   F +++SK+L PAQ+LL 
Sbjct  177   FVSSSSREGFFGKPVSLQQQQMLSQDGYVSSNSKVASVYQQGHFLVKNSKFLVPAQDLLN  236

Query  1428  EFCCVGTTQSD--EPKR--KSQW--QQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDE  1267
             EFC +   QSD  +P +  K QW  Q+++   SS+ HSL SL F+ELQK K+KLL +L+E
Sbjct  237   EFCSLCAKQSDLGKPTKSLKKQWEDQENNGVGSSKKHSLTSLEFVELQKRKTKLLSMLEE  296

Query  1266  VDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakka  1087
             VDRRYKHYR+QM +VVSSFEAVAG+GAATVYSALA + MSRHFRCL+D IL+Q++A +KA
Sbjct  297   VDRRYKHYRNQMKSVVSSFEAVAGNGAATVYSALALKAMSRHFRCLKDGILSQIQATRKA  356

Query  1086  maekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLR  907
             M EK+  +  PG T+GETPRLK+IDQTLRQQ+A QQ++MM++HPWRPQRGLPER+VSVLR
Sbjct  357   MGEKDPVA--PGTTRGETPRLKVIDQTLRQQRAFQQMSMMETHPWRPQRGLPERAVSVLR  414

Query  906   AWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDN  727
             AWLFEHFLHPYPSDVDKHILARQTGLSR QVSNWFINARVRLWKPMVEEMYLEEVK+ +N
Sbjct  415   AWLFEHFLHPYPSDVDKHILARQTGLSRGQVSNWFINARVRLWKPMVEEMYLEEVKDPEN  474

Query  726   IMGSSDGSRAAVDGG------------SGRERLDKKPNVVRLDSECISSLIN---IPAKA  592
              + SS+G+    +              S R   D+KP++VR+DSEC SS+IN    P   
Sbjct  475   NIASSEGATDQDNDINPNNVQYPPPPLSSRSE-DQKPSLVRIDSECASSIINNHSTPDNK  533

Query  591   G---GDHHQFGAVELDFSPYTHNSGGAVGYRPGERK-TggggGVSLTLGLQQHGGSGIGL  424
                 G    FG+VELDFS YTH+S G V Y   ++       GVSLTLGLQQH   G+ L
Sbjct  534   NDPKGQEQCFGSVELDFSSYTHHSSGMVSYGSSDQNGNNNQSGVSLTLGLQQH---GVSL  590

Query  423   AFSPTSQNSLFYPRDQIGDCPPV-QYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             AF P +Q+SL+YPRDQI DC PV QYSLLDGEGQNLPYRNLMG+QLLHDLAG
Sbjct  591   AFPPATQSSLYYPRDQIEDCQPVHQYSLLDGEGQNLPYRNLMGAQLLHDLAG  642



>ref|XP_003517476.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Glycine 
max]
 ref|XP_006573786.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Glycine 
max]
Length=646

 Score =   516 bits (1329),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 287/492 (58%), Positives = 350/492 (71%), Gaps = 53/492 (11%)
 Frame = -2

Query  1620  IGFNSFDDLRLMaassssSRLNNIQHDEDDRFLGKPENLGHP---SQDYF----------  1480
             IG  SF+ LR      +   L+ +     D F GKP +L      SQD +          
Sbjct  166   IGLQSFE-LR-----QTGQHLDFVSSSSRDGFFGKPVSLQQQQMVSQDGYVSSNSKVASV  219

Query  1479  -----FQIRSSKYLGPAQELLKEFCCVGTTQSD--EPKR---KSQWQQDDHTT-SSQNHS  1333
                  F +++SK+L PAQ+LL EFC +   QSD  +P +   K QW+++++   SS+ HS
Sbjct  220   YQQGHFLVKNSKFLVPAQDLLNEFCSLDAKQSDLGKPTKSLNKKQWEEENNGIGSSKKHS  279

Query  1332  LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRV  1153
             L SL F+ELQK K+KLL +L+EVDRRYKHYR+QM +VVSSFEAVAG+GAATVYSALA + 
Sbjct  280   LTSLEFVELQKRKTKLLSMLEEVDRRYKHYRNQMKSVVSSFEAVAGNGAATVYSALALKA  339

Query  1152  MSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLT  973
             MSRHFRCL+D I+AQ++A +KAM EK+  +  PG T+GETPRLK+IDQTLRQQ+A QQ++
Sbjct  340   MSRHFRCLKDGIMAQIQATRKAMGEKDPVA--PGTTRGETPRLKVIDQTLRQQRAFQQMS  397

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
             MM++HPWRPQRGLPER+VSVLRAWLFEHFLHPYPSDVDKHILARQTGLSR QVSNWFINA
Sbjct  398   MMETHPWRPQRGLPERAVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRGQVSNWFINA  457

Query  792   RVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDG-----------GSGRERLDKKPNV  646
             RVRLWKPMVEEMYLEEVK+ +N + SS+G+    +             S     D+KP++
Sbjct  458   RVRLWKPMVEEMYLEEVKDPENNIASSEGATDQDNDINPNNVEYPPPPSSSRSEDQKPSL  517

Query  645   VRLDSECISSLIN---IPAKAG---GDHHQFGAVELDFSPYTHNSGGAVGYRPGERK-Tg  487
             VR+DSEC SS+IN    P       G    FG+VELDFS YTH+S G V Y   ++    
Sbjct  518   VRIDSECASSIINNHSTPDNKNDPKGHEQCFGSVELDFSSYTHHSSGIVSYGSNDQNGNN  577

Query  486   gggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRN  307
                GVSLTLGLQQH   G+ LAF P +Q+SL+YPRDQI DC PVQYSL DGEGQNLPYRN
Sbjct  578   NQSGVSLTLGLQQH---GVSLAFPPATQSSLYYPRDQIEDCQPVQYSLFDGEGQNLPYRN  634

Query  306   LMGSQLLHDLAG  271
             LMG+QLLHDLAG
Sbjct  635   LMGAQLLHDLAG  646



>gb|KDP25399.1| hypothetical protein JCGZ_20555 [Jatropha curcas]
Length=690

 Score =   516 bits (1329),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 294/458 (64%), Positives = 344/458 (75%), Gaps = 42/458 (9%)
 Frame = -2

Query  1533  DRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS-----QWQ  1369
             D FL K  NL    Q   F +R+SKYLGPAQELL EFC +GT Q+D+ ++KS     QW+
Sbjct  238   DGFLTKASNLHQQGQ---FHLRNSKYLGPAQELLNEFCSLGTKQTDQQRQKSYKNTKQWE  294

Query  1368  QDDHTTSS---QNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVA  1198
             +++ ++SS   +  SL SL FL+LQK K+KL+ +L+EV+RRY+HY DQM AVVSSFEAVA
Sbjct  295   EENGSSSSNSSRKQSLYSLEFLDLQKRKTKLISMLEEVERRYRHYCDQMKAVVSSFEAVA  354

Query  1197  GDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKM  1018
             G GAATVYSALAS+ MSRHFRCLRD I+ Q+ A KKAM EK+  +  PG T+GETPRL++
Sbjct  355   GAGAATVYSALASKAMSRHFRCLRDGIVTQIHATKKAMGEKDPVA--PGTTRGETPRLRI  412

Query  1017  IDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             +DQTLRQQ+AIQQ+TMM++HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ
Sbjct  413   LDQTLRQQRAIQQMTMMETHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  472

Query  837   TGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGR-----  673
             TGLSRSQVSNWFINARVRLWKPMVEEMYLEE KEQDN + S DG     +  +GR     
Sbjct  473   TGLSRSQVSNWFINARVRLWKPMVEEMYLEETKEQDNNLASPDGITELEENINGRPSQNL  532

Query  672   ERLDKKPN---VVRLDSECISSLINIP--------AKAGGDHH---------QFGAVELD  553
                D+KP    ++R+DSEC+SS+I+ P         K+   HH          FGAVELD
Sbjct  533   SSTDQKPTPDQLIRIDSECLSSIISNPDKNDTSKTNKSFQTHHLHTQQQNFGAFGAVELD  592

Query  552   FSPYTH-NSGGAVGY---RPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYP  385
             FS Y H N+ G V Y       +    GGGVSLTLGLQQHGGSG+ LAFSP SQ+SLFYP
Sbjct  593   FSSYNHQNAPGGVSYGNDTSANQNFNNGGGVSLTLGLQQHGGSGVSLAFSPASQSSLFYP  652

Query  384   RDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             RD I DC  VQYSLLDGEGQNLPYRNLMG+QLLHDLAG
Sbjct  653   RDHIDDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  690


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 14/86 (16%)
 Frame = -2

Query  1986  RSSSMVTN---TGYWYSDSAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKN  1816
             +S +MV++   TG+ YSD + N      H+ +Q+Q+FE NPEI+NL++GME M+GF    
Sbjct  9     KSRNMVSSSSTTGFCYSDVSNNNPTIQTHIGNQIQAFETNPEIFNLTTGME-MIGFSRNL  67

Query  1815  LQAQSD-----MW-----KPVPLSHS  1768
              Q QS+     +W     KP   SHS
Sbjct  68    PQQQSESNTSVLWKGFFNKPTSNSHS  93



>ref|XP_003538310.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Glycine 
max]
 ref|XP_006590505.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Glycine 
max]
Length=642

 Score =   513 bits (1321),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 297/508 (58%), Positives = 359/508 (71%), Gaps = 56/508 (11%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDEDDRFLGKP----------  1513
             +GLSLSLSSTNPS IG  SF+ LR      +    + +     + F GKP          
Sbjct  147   QGLSLSLSSTNPSTIGLQSFE-LR-----QTGHHPDFVSSSSREGFFGKPVSLQQQQMLS  200

Query  1512  --------ENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSD--EPKR--KSQW-  1372
                       +    Q   F +++SK+L PAQ+LL EFC +   QSD  +P +  K QW 
Sbjct  201   QDGYVSSNSKVASVYQQGHFLVKNSKFLVPAQDLLNEFCSLCAKQSDLGKPTKSLKKQWE  260

Query  1371  -QQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAG  1195
              Q+++   SS+ HSL SL F+ELQK K+KLL +L+EVDRRYKHYR+QM +VVSSFEAVAG
Sbjct  261   DQENNGVGSSKKHSLTSLEFVELQKRKTKLLSMLEEVDRRYKHYRNQMKSVVSSFEAVAG  320

Query  1194  DGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMI  1015
             +GAATVYSALA + MSRHFRCL+D IL+Q++A +KAM EK+  +  PG T+GETPRLK+I
Sbjct  321   NGAATVYSALALKAMSRHFRCLKDGILSQIQATRKAMGEKDPVA--PGTTRGETPRLKVI  378

Query  1014  DQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQT  835
             DQTLRQQ+A QQ++MM++HPWRPQRGLPER+VSVLRAWLFEHFLHPYPSDVDKHILARQT
Sbjct  379   DQTLRQQRAFQQMSMMETHPWRPQRGLPERAVSVLRAWLFEHFLHPYPSDVDKHILARQT  438

Query  834   GLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGG---------  682
             GLSR QVSNWFINARVRLWKPMVEEMYLEEVK+ +N + SS+G+    +           
Sbjct  439   GLSRGQVSNWFINARVRLWKPMVEEMYLEEVKDPENNIASSEGATDQDNDINPNNVQYPP  498

Query  681   ---SGRERLDKKPNVVRLDSECISSLIN---IPAKAG---GDHHQFGAVELDFSPYTHNS  529
                S R   D+KP++VR+DSEC SS+IN    P       G    FG+VELDFS YTH+S
Sbjct  499   PPLSSRSE-DQKPSLVRIDSECASSIINNHSTPDNKNDPKGQEQCFGSVELDFSSYTHHS  557

Query  528   GGAVGYRPGERK-TggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPV-  355
              G V Y   ++       GVSLTLGLQQH   G+ LAF P +Q+SL+YPRDQI DC PV 
Sbjct  558   SGMVSYGSSDQNGNNNQSGVSLTLGLQQH---GVSLAFPPATQSSLYYPRDQIEDCQPVH  614

Query  354   QYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             QYSLLDGEGQNLPYRNLMG+QLLHDLAG
Sbjct  615   QYSLLDGEGQNLPYRNLMGAQLLHDLAG  642



>ref|XP_002509843.1| bel1 homeotic protein, putative [Ricinus communis]
 gb|EEF51230.1| bel1 homeotic protein, putative [Ricinus communis]
Length=698

 Score =   514 bits (1324),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 306/521 (59%), Positives = 359/521 (69%), Gaps = 70/521 (13%)
 Frame = -2

Query  1641  SSTNPSAIGFNSFD----------------DLRLMaassssSRLN----NIQHDE---DD  1531
             SS NPS+IG  SF+                ++R + +SS          N QH +    D
Sbjct  184   SSANPSSIGLQSFELRHTSNHHDHNQQQEQEMRFLNSSSRDGFFGKSPANTQHQQQMMQD  243

Query  1530  RFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS----QWQQD  1363
              F+ K   L H  Q   FQ+R+SKYLGPAQELL EFC +GT QSD+ ++KS    QW+ +
Sbjct  244   GFMTKAATLHHQGQ---FQLRNSKYLGPAQELLNEFCSLGTKQSDQLRQKSSKPKQWENE  300

Query  1362  D---HTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGD  1192
             +    +++S+  SL SL F+ELQK K+KLL +L+EV+RRY+HY DQM AVVSSFEAVAG 
Sbjct  301   NGSSSSSASRKQSLCSLEFMELQKRKTKLLSMLEEVERRYRHYCDQMKAVVSSFEAVAGA  360

Query  1191  GAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMID  1012
             GAA VYSALAS+ MSRHFRCLRD I+AQ+       A  E    APG TKGETPRL+++D
Sbjct  361   GAAMVYSALASKAMSRHFRCLRDGIVAQI--HATKKAMGEKDPVAPGTTKGETPRLRILD  418

Query  1011  QTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  832
             QTLRQQ+AIQQ+TMM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG
Sbjct  419   QTLRQQRAIQQMTMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  478

Query  831   LSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGR-----ER  667
             LSRSQVSNWFINARVRLWKPMVEEMYLEE KEQDN M S DG    ++  +GR       
Sbjct  479   LSRSQVSNWFINARVRLWKPMVEEMYLEETKEQDNNMASPDGI-TDLEDNNGRPSQNLSS  537

Query  666   LDKKPN---VVRLDSECISSLINIPAK----------------------AGGDHHQFGAV  562
              D+KP    ++R+DSEC+SS+I+ P K                         +   FGAV
Sbjct  538   TDQKPTPDQLIRVDSECLSSIISNPDKNDISKTTKTFQNHHHLHTQQQQQQHNFGAFGAV  597

Query  561   ELDFSPYTHNSGGAVGY---RPGERKTggggGVSLTLGLQQHGGS-GIGLAFSPTSQNSL  394
             ELD S Y H++ G V Y     G  +   GGGVSLTLGLQQHGGS G+ LAFSP SQ+SL
Sbjct  598   ELDISSYNHHAAGGVSYANDHGGNHQNFNGGGVSLTLGLQQHGGSGGVSLAFSPASQSSL  657

Query  393   FYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             FY RD I DC PVQYSLLDGEGQNLPYRNLMG+QLLHDLAG
Sbjct  658   FYSRDHIDDCQPVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  698



>ref|XP_007158519.1| hypothetical protein PHAVU_002G159000g [Phaseolus vulgaris]
 gb|ESW30513.1| hypothetical protein PHAVU_002G159000g [Phaseolus vulgaris]
Length=638

 Score =   511 bits (1316),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 292/503 (58%), Positives = 358/503 (71%), Gaps = 51/503 (10%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDEDDRFLGKPENL-------  1504
             +GLSLSLSSTNPS IG  SF+ LR      +S   + +     + F GKP ++       
Sbjct  148   QGLSLSLSSTNPSTIGLQSFE-LR-----QTSHHPDFVPSSSREGFFGKPVSVQQQQMLQ  201

Query  1503  -GHPS---------QDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS---QWQQD  1363
              G+ S         Q   F +++SKYL PAQ+LL EFC +   QS+  K KS   QW+++
Sbjct  202   DGYVSSNSKAASVYQQGHFLVKNSKYLVPAQDLLNEFCSLDAKQSEAGKPKSLKKQWEEE  261

Query  1362  DHTTSS-QNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGA  1186
             ++ + S +  SL SL F+ELQK K+KLL +L+EVDRRYKHYR+QM +VVSSFE VAG+GA
Sbjct  262   NNCSGSLKKPSLTSLEFVELQKRKTKLLSMLEEVDRRYKHYRNQMKSVVSSFETVAGNGA  321

Query  1185  ATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQT  1006
             ATVYSALA + MSRHF+CL+D IL Q++  +KAM EK+  +  PG T+GETPRLK+IDQ 
Sbjct  322   ATVYSALALKAMSRHFKCLKDGILGQIQTTRKAMGEKDPVA--PGTTRGETPRLKVIDQA  379

Query  1005  LRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLS  826
             LRQQ+A QQ++MM++HPWRPQRGLPER+VSVLRAWLFEHFLHPYPSDVDKHILARQTGLS
Sbjct  380   LRQQRAFQQMSMMETHPWRPQRGLPERAVSVLRAWLFEHFLHPYPSDVDKHILARQTGLS  439

Query  825   RSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDG----------GSG  676
             R QVSNWFINARVRLWKPMVEEMYLEEVK+ +N M SS+G+    +            S 
Sbjct  440   RGQVSNWFINARVRLWKPMVEEMYLEEVKDHENNMASSEGATDPENDINPNVQNPPPHSA  499

Query  675   RERLDKKPNVVRLDSECISSLIN------IPAKAGGDHHQFGAVELDFSPYTHNSGGAVG  514
             R   D+KP+++R+DSEC SS+IN            G    FG+VELDFS YTH+S G V 
Sbjct  500   RSE-DQKPSLLRIDSECASSIINNNHTLDNKNDPKGQEQCFGSVELDFSSYTHHSSGMVS  558

Query  513   YRPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFY--PRDQIGDCPPVQYSLL  340
             +   ++      GVSLTLGLQQH   G+ LAF P +Q+SL+Y  PRDQI DC PVQYSLL
Sbjct  559   FGSNDQNGNSQSGVSLTLGLQQH---GVSLAFPPPTQSSLYYPNPRDQIEDCQPVQYSLL  615

Query  339   DGEGQNLPYRNLMGSQLLHDLAG  271
             DGEGQNLPYRNLMG+QLLHDLAG
Sbjct  616   DGEGQNLPYRNLMGAQLLHDLAG  638



>ref|XP_010053224.1| PREDICTED: homeobox protein BEL1 homolog [Eucalyptus grandis]
 ref|XP_010053225.1| PREDICTED: homeobox protein BEL1 homolog [Eucalyptus grandis]
 gb|KCW77489.1| hypothetical protein EUGRSUZ_D01826 [Eucalyptus grandis]
Length=723

 Score =   512 bits (1319),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 286/460 (62%), Positives = 326/460 (71%), Gaps = 60/460 (13%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSD-----EPKRKSQWQQDDH-----TTSSQNHSL  1330
             FQ+R+SKYLGPAQE+L EFC +G  QSD     +P +   +   D      + SS+  SL
Sbjct  267   FQLRNSKYLGPAQEILNEFCSLGAKQSDLLKHQKPNKSKAYDDQDGDNGGPSGSSKQQSL  326

Query  1329  GSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVM  1150
             GSL F+ELQK K+KLL +LDEVDRRY+HY DQM AVVSSFEAVAG GAATVYSALAS+ M
Sbjct  327   GSLEFMELQKRKTKLLSMLDEVDRRYRHYCDQMKAVVSSFEAVAGSGAATVYSALASKAM  386

Query  1149  SRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTM  970
             SRHFRCLRD I+ Q++A KKAM EK+ +S  PG T+GETPRLK+IDQ LRQQ+A QQ+TM
Sbjct  387   SRHFRCLRDGIVGQIQATKKAMGEKDLAS--PGTTRGETPRLKIIDQALRQQRAFQQMTM  444

Query  969   MDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINAR  790
             MD+HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINAR
Sbjct  445   MDNHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINAR  504

Query  789   VRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGS----GRERL---DKKPN---VVR  640
             VRLWKPMVEEMY EE +E DN MGSSDG+    D G      RE     D+KP    +VR
Sbjct  505   VRLWKPMVEEMYTEETREHDN-MGSSDGAADLEDDGRPNNHNREATRVEDQKPTSDQLVR  563

Query  639   LDSECISSLINIPAKAGGDHHQ-----------------------------FGAVELDFS  547
             +DSEC SS++  P K+   HH                              +G +E+DFS
Sbjct  564   IDSECFSSIVTSPDKSDQHHHSKMAATRAPQNHHHHHLHPQNSGFGRVGDAYGGMEIDFS  623

Query  546   PYTHNSGGAV------GYRPGERKTggggGVSLTLGLQQHGGS--GIGLAFSPTSQNSLF  391
              Y H+   +       G    +   G GGGVSLTLGLQQHGG   G+ LAFS  SQNSLF
Sbjct  624   SYNHHPVTSAAPYSNDGDASHQNFNGSGGGVSLTLGLQQHGGPSHGVSLAFSSVSQNSLF  683

Query  390   YPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             YPRD I DC PVQYSLLDGEGQ LPYRNLMG+QLLHDLAG
Sbjct  684   YPRDHIEDCHPVQYSLLDGEGQTLPYRNLMGAQLLHDLAG  723



>emb|CBI34373.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   499 bits (1284),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 276/428 (64%), Positives = 319/428 (75%), Gaps = 44/428 (10%)
 Frame = -2

Query  1533  DRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS----QWQQ  1366
             D FLGK  NL   +    FQ+R+SKYLGPAQ+LL E C +GT Q D P++K+    QW+ 
Sbjct  55    DGFLGKAANLNQGN----FQLRNSKYLGPAQQLLNECCNLGTKQIDPPRQKAPKTNQWED  110

Query  1365  DD--HTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGD  1192
             ++   ++ S+  SL SL  +ELQK KSKLL +L+EVDRRYKHY DQM AVVSSFEAVAG+
Sbjct  111   ENGSSSSCSRKPSLYSLELMELQKRKSKLLSMLEEVDRRYKHYCDQMKAVVSSFEAVAGN  170

Query  1191  GAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMID  1012
             GAA VYSALAS+ MSRHFRCLRD I+ Q++A KKAM EK+  +  PG T+GETPRL+++D
Sbjct  171   GAARVYSALASKAMSRHFRCLRDGIVGQIQATKKAMGEKDPVA--PGTTRGETPRLRVLD  228

Query  1011  QTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  832
             Q LRQQ+A QQ++MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG
Sbjct  229   QALRQQRAFQQMSMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  288

Query  831   LSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKP  652
             LSRSQVSNWFINARVRLWKPMVEEMYLEE KEQDN+ GS DG+    D  +GR   + +P
Sbjct  289   LSRSQVSNWFINARVRLWKPMVEEMYLEETKEQDNL-GSPDGATDPDD--NGRPNPNPQP  345

Query  651   NVVRLDSECISSLINIPAKAGGDHHQFGAVELDFSPYTHNSGGAVGY-RPGERKTggggG  475
                                          VELDFS Y H++ GAV +         GG G
Sbjct  346   ----------------------------PVELDFSSYNHHTAGAVSFTNDSAHHNFGGSG  377

Query  474   VSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGS  295
             VSLTLGLQQHGGSG+ LAFSP SQ+SLFY RD I DC PVQYSLLDGEGQNLPYRNLMG+
Sbjct  378   VSLTLGLQQHGGSGVSLAFSPASQSSLFYSRDPIEDCQPVQYSLLDGEGQNLPYRNLMGA  437

Query  294   QLLHDLAG  271
             QLLHDLAG
Sbjct  438   QLLHDLAG  445



>ref|XP_007210325.1| hypothetical protein PRUPE_ppa002081mg [Prunus persica]
 gb|EMJ11524.1| hypothetical protein PRUPE_ppa002081mg [Prunus persica]
Length=719

 Score =   503 bits (1295),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 287/477 (60%), Positives = 339/477 (71%), Gaps = 60/477 (13%)
 Frame = -2

Query  1533  DRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDE--------PKRKS  1378
             D FLGK         +  F +R+SKYL PAQ+LL EFC +GT  S +        P +  
Sbjct  247   DGFLGKATASSSLHPEGLFHLRNSKYLAPAQQLLNEFCSLGTKPSTDHHHPSKQKPHKNK  306

Query  1377  QWQQDDH--TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSF  1210
              W+Q+D+  T+SS+N   ++ SL F+ELQK K++LL +L+EV+RRYKHY DQM AVVSSF
Sbjct  307   LWEQEDNGTTSSSRNKQSNIYSLEFVELQKRKTRLLSMLEEVERRYKHYCDQMKAVVSSF  366

Query  1209  EAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETP  1030
             E VAG GAATVYSALA++ MSRHFR L+D I+ Q++A +KAM EK+  +  PG T+GETP
Sbjct  367   ETVAGAGAATVYSALAAKAMSRHFRSLKDGIVNQIQATRKAMGEKDPVA--PGTTRGETP  424

Query  1029  RLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHI  850
             RL+++DQTLRQQ+A QQ+ MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHI
Sbjct  425   RLRILDQTLRQQRAFQQMNMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHI  484

Query  849   LARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMG---SSDGSRAAVDGG-  682
             LARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEE KE++N M    SSDG     D G 
Sbjct  485   LARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEETKERENNMNNMTSSDG--ITTDLGD  542

Query  681   ---SGRERL-----DKKPN---VVRLDSECISSLINIPAKAGG---------DHH-----  577
                SG+  L     DKKP    +VR+DSEC+SS+I  P K            +HH     
Sbjct  543   SSRSGQNPLHTRPEDKKPTPDQLVRIDSECLSSIITNPEKNHDSRSSKSTLLNHHMHPQQ  602

Query  576   -------QFGAVELDFSPYTH---NSGGAVGY----RPGERKTggggGVSLTLGLQQHGG  439
                     FG +ELDFS Y H   +SGG V Y         +   GGGVSLTLGLQQHGG
Sbjct  603   SFGRVNESFGTMELDFSSYNHHQQHSGGTVSYANDHHHNPNQGFNGGGVSLTLGLQQHGG  662

Query  438   SGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQN-LPYRNLMGSQLLHDLAG  271
             +G+ LAFSP SQ+SLFYPRD I +C PVQYSLLDGEGQN LPYRNLMG+QLLHDLAG
Sbjct  663   NGVSLAFSPASQSSLFYPRDHIEECQPVQYSLLDGEGQNTLPYRNLMGAQLLHDLAG  719


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = -2

Query  1968  TNTGYWYSDSAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKN-LQAQSDMW  1792
             ++ G+ YSD + N  I      +Q+Q F  NPEI+NL++GME M+GFP +N     S MW
Sbjct  16    SSVGFCYSDVSSNPTIHQTQFTNQIQDFGSNPEIFNLTTGME-MIGFPKQNESNNNSAMW  74

Query  1791  K  1789
             K
Sbjct  75    K  75



>ref|XP_008238940.1| PREDICTED: homeobox protein BEL1 homolog [Prunus mume]
Length=716

 Score =   503 bits (1294),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 282/472 (60%), Positives = 338/472 (72%), Gaps = 53/472 (11%)
 Frame = -2

Query  1533  DRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDE--------PKRKS  1378
             D FLGK         +  F +R+SKYL PAQ+LL EFC +GT  S +        P +  
Sbjct  247   DGFLGKATASSSLHPEGLFHLRNSKYLAPAQQLLNEFCSLGTKPSTDHLHPSMQKPHKNK  306

Query  1377  QWQQDDH--TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSF  1210
              W+Q+D+  T+SS+N   ++ SL F+ELQK K++LL +L+EV+RRYKHY DQM AVVSSF
Sbjct  307   LWEQEDNGTTSSSRNKQSNIYSLEFVELQKRKTRLLSMLEEVERRYKHYCDQMKAVVSSF  366

Query  1209  EAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETP  1030
             E VAG GAATVYSALA++ MSRHFR L+D I++Q++  +KAM EK+  +  PG TKGETP
Sbjct  367   ETVAGAGAATVYSALAAKAMSRHFRSLKDGIVSQIQVTRKAMGEKDPVA--PGTTKGETP  424

Query  1029  RLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHI  850
             RL+++DQTLRQQ+A QQ+ MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHI
Sbjct  425   RLRILDQTLRQQRAFQQMNMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHI  484

Query  849   LARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMG---SSDG-SRAAVDGG  682
             LARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEE KE++N M    SSDG ++   D  
Sbjct  485   LARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEETKERENNMNNLTSSDGITKDPGDSS  544

Query  681   SGRERL---DKKPN---VVRLDSECISSLINIPAKAGG---------DHH----------  577
                + +   D+KP    +VR+DSEC+SS+I  P K            +HH          
Sbjct  545   RSGQNIRPEDQKPTPDQLVRIDSECLSSIITNPDKNHDSRSSKSTLLNHHMHPQQSFGRV  604

Query  576   --QFGAVELDFSPYTH---NSGGAVGY----RPGERKTggggGVSLTLGLQQHGGSGIGL  424
                FG +ELDFS Y H   +SGG V Y         +   GGGVSLTLGLQQHGG+G+ L
Sbjct  605   NESFGTMELDFSSYNHHQQHSGGTVSYANDHHHNPNQGFNGGGVSLTLGLQQHGGNGVSL  664

Query  423   AFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQN-LPYRNLMGSQLLHDLAG  271
             AFSP SQ+SLFYPRD I +C PVQYSLLDGEGQN LPYRNLMG+QLLHDLAG
Sbjct  665   AFSPASQSSLFYPRDHIEECQPVQYSLLDGEGQNTLPYRNLMGAQLLHDLAG  716



>ref|XP_004298825.1| PREDICTED: homeobox protein BEL1 homolog [Fragaria vesca subsp. 
vesca]
Length=652

 Score =   493 bits (1270),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 283/472 (60%), Positives = 333/472 (71%), Gaps = 61/472 (13%)
 Frame = -2

Query  1533  DRFLGKPENLGHPS-----QDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDE---PKRKS  1378
             D +LGK   LGH +     Q   FQ+R+SKYLGPAQELL EFC +GT Q+D    PK KS
Sbjct  191   DGYLGKSSGLGHQALLHENQAGLFQLRNSKYLGPAQELLNEFCSLGTKQTDALGVPKHKS  250

Query  1377  ----QWQQDDH---TTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVV  1219
                 QW+  D+   + S +  SL SL F+ELQK K++LL +L+EV+RRYKHY DQM AVV
Sbjct  251   NKTKQWEDQDNNNGSASKKQSSLYSLEFVELQKRKTRLLQMLEEVERRYKHYCDQMKAVV  310

Query  1218  SSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKG  1039
             ++FE VAG GAATVYS LAS+ MSRHFR L+D I+AQ++  +KAM EK+  +  PGA++G
Sbjct  311   ATFETVAGAGAATVYSKLASKAMSRHFRSLKDGIVAQIQETRKAMGEKDPVA--PGASRG  368

Query  1038  ETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVD  859
             ETPRL+++DQTLRQQ+A QQ+ MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVD
Sbjct  369   ETPRLRILDQTLRQQRAFQQMNMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVD  428

Query  858   KHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDN--IMGSSDGSRAAVDG  685
             KHILARQTGLSRSQVSNWFINARVRLWKPMVEEMY+EE KE +N   M SSDG      G
Sbjct  429   KHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYMEETKEHENNINMSSSDGVTTDHLG  488

Query  684   GSGRERL---DKKPN-----VVRLDSECISSLI-NIPAKAGGDH--------------HQ  574
                       D+KP      +VR+DSEC+SS+I N P +    H                
Sbjct  489   DPSTHMTRPEDQKPTQDQLQLVRIDSECLSSIITNNPGEKSTGHDSRSGKSTLQMHPQQS  548

Query  573   FGAV--------ELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQHGGS-GIGLA  421
             FG V        ELDF+ Y  N        P +   GGG GVSLTLGL QHGG+ G+ LA
Sbjct  549   FGRVTDAFGSSMELDFTNYNQN--------PNQSFNGGGHGVSLTLGLNQHGGTNGVSLA  600

Query  420   FSPTSQNSLFYPRDQIGDCPPVQY-SLLDGEGQ-NLPYRNLMGSQLLHDLAG  271
             FSP+SQ+SLFYPRD I +C PVQY SLLDGEGQ NLPYRNLMG+QLLHDLAG
Sbjct  601   FSPSSQSSLFYPRDHIEECQPVQYSSLLDGEGQNNLPYRNLMGAQLLHDLAG  652



>ref|XP_008373620.1| PREDICTED: homeobox protein BEL1 homolog [Malus domestica]
 ref|XP_008373687.1| PREDICTED: homeobox protein BEL1 homolog [Malus domestica]
Length=687

 Score =   493 bits (1268),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 288/479 (60%), Positives = 342/479 (71%), Gaps = 62/479 (13%)
 Frame = -2

Query  1533  DRFLGKPENLGHPS------QDYFFQIRSSKYLGPAQELLKEFCCVGTT-------QSDE  1393
             D FLGK       S       +  FQ+R+SKYLGPAQ+LL EFC +GTT       Q  +
Sbjct  213   DGFLGKAAYHASASGASSLQHEGLFQLRNSKYLGPAQQLLNEFCSLGTTKPTTADTQKQK  272

Query  1392  PKRKSQW--QQDDHTTSS----QNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQM  1231
             P +  QW  Q+D+ +TSS    Q  ++ SL F+ELQK K++LL +L+EV+RRYKHY DQM
Sbjct  273   PHKNKQWGEQEDNGSTSSSRNKQQSNICSLEFVELQKRKTRLLSMLEEVERRYKHYCDQM  332

Query  1230  TAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPG  1051
              AVV+SFEAVAG GAATVYSALA++ MSRHFR L+D I++Q++A +KAM EK+  +  PG
Sbjct  333   KAVVASFEAVAGAGAATVYSALAAKAMSRHFRSLKDGIVSQIQATRKAMGEKDPVA--PG  390

Query  1050  ATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYP  871
              T+GETPRL+++DQTLRQQ+A QQ+ MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYP
Sbjct  391   TTRGETPRLRILDQTLRQQRAFQQMNMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYP  450

Query  870   SDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMG-----SSDG  706
             SDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMY+EE KE++N M      SSDG
Sbjct  451   SDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYMEETKERENNMNISNMTSSDG  510

Query  705   SRAAVDGGSGRER-LDKKPN---VVRLDSECISSLINIPAKA------------------  592
                A D    + R  D+KP    +VR+DSEC+SS+I  P K                   
Sbjct  511   --IATDPSPHQSRPEDEKPTHDQLVRMDSECLSSIITYPEKNHDSRGSKNTISSHNMHPH  568

Query  591   ---GGDHHQFGAVELDFSPYTH---NSGGAVGY-----RPGERKTggggGVSLTLGLQQH  445
                G  +  FG +ELDFS Y H   +SGG V Y      P  +    GGGVSLTLGLQQH
Sbjct  569   QNFGRVNESFGTMELDFSSYNHHQQHSGGTVSYANDHHHPSNQGFNAGGGVSLTLGLQQH  628

Query  444   GGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQ-NLPYRNLMGSQLLHDLAG  271
             GG+G+ LAFSP SQNSLFYPRD I +C PVQYSLLDGEG+ NLPYRNLMG+QLLHDLAG
Sbjct  629   GGNGVSLAFSPASQNSLFYPRDHIEECQPVQYSLLDGEGENNLPYRNLMGAQLLHDLAG  687



>ref|XP_003532909.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Glycine 
max]
 ref|XP_006584730.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Glycine 
max]
Length=646

 Score =   484 bits (1246),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 288/496 (58%), Positives = 355/496 (72%), Gaps = 56/496 (11%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDEDDRFLGKPENL-------  1504
             +GLSLSLSSTNPS IG  SF+  +  +       L++    E   F GKP N        
Sbjct  169   QGLSLSLSSTNPSGIGLQSFELRQTTSHHHHQQHLSDFVSREG--FFGKPVNAQQQQEML  226

Query  1503  --GHPS--------QDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS-QWQQDDH  1357
               G+ S        Q   F I++SK+L P+Q LL EFC +GT ++D PK+K+ QW++ ++
Sbjct  227   QDGYLSPNKAANIYQQGHFLIKNSKFLVPSQVLLNEFCSLGTKENDVPKQKNKQWEEGNN  286

Query  1356  TT--SSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAA  1183
                 SS+NHSL SL F+ELQK K++LL +L+EVDRRYKHYRDQM AV+SSFEAVAG+GAA
Sbjct  287   NGGGSSKNHSLSSLEFVELQKRKTRLLAMLEEVDRRYKHYRDQMKAVMSSFEAVAGNGAA  346

Query  1182  TVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTL  1003
             TVYSALA + MSRHFRCL+D I+ Q++A +K M EKE ++  PG T+GETPRLK+IDQ+L
Sbjct  347   TVYSALALKAMSRHFRCLKDGIMDQIRATRKGMGEKELAAV-PGTTRGETPRLKIIDQSL  405

Query  1002  RQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSR  823
             RQQ+A QQ+++M++HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLS+
Sbjct  406   RQQRAFQQISIMETHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSK  465

Query  822   SQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPN--  649
             SQVSNWFINARVRLWKPMVEEMYLEE KE  N + SS+G    + G       D+KP   
Sbjct  466   SQVSNWFINARVRLWKPMVEEMYLEEEKEHQNDVASSEGGGINILG-------DQKPTQA  518

Query  648   -VVRLDSECISSLINIP-----AKAG------GDHHQFGAVELDFSPYTHNSGGAVGYRP  505
              +VR+DSEC+SS++N P      K+G           FG+VELDF  YTH    + G+  
Sbjct  519   RLVRIDSECMSSIVNNPDDKNDTKSGKTIQNDNQMDAFGSVELDFWSYTHQY--SSGHSG  576

Query  504   GERKTggggGVSLTLGLQQHGGSGIGLAFSP-TSQNSLFYPRDQIGDCPPVQYSLLDGEG  328
             G         VSLTLGLQQHG SG+ LAF P  +Q+S+FYPRDQI DC  VQYSL+DG+G
Sbjct  577   G---------VSLTLGLQQHGESGVSLAFPPAATQSSMFYPRDQIEDCQTVQYSLVDGKG  627

Query  327   QNLPYRNLMGSQLLHD  280
             QN+PYRNLMG+ LLHD
Sbjct  628   QNMPYRNLMGTHLLHD  643



>gb|AAP47023.1|AF375964_1 bell-like homeodomain protein 3 [Solanum lycopersicum]
Length=523

 Score =   478 bits (1229),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 294/493 (60%), Positives = 348/493 (71%), Gaps = 44/493 (9%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDE-DDRFLGKPENLGHPSQD  1486
             +GLSLSL S+NPS+IG  SF+            R  ++Q     D FLGK  ++      
Sbjct  46    QGLSLSLCSSNPSSIGLQSFE-----------LRHQDLQQGLIHDGFLGKSTSIQQGYFH  94

Query  1485  YFFQIRSSKYLGPAQELLKEFCCVGTTQS-DEPKRKSQWQQDDHT-TSSQNHSLGSLHFL  1312
             ++ Q+R SKYLGPAQELL EFC +G  ++ D    K   +Q D T T+S+   L SL  L
Sbjct  95    HYHQVRDSKYLGPAQELLSEFCSLGIKKNNDHSSSKLLLKQHDTTATTSKKQLLQSLDLL  154

Query  1311  ELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRC  1132
             ELQK K+KLL +L+EVDRRYKHY DQM  VVSSFEAVAG+GAATVYSALASR MSRHFRC
Sbjct  155   ELQKRKTKLLQMLEEVDRRYKHYCDQMKGVVSSFEAVAGNGAATVYSALASRAMSRHFRC  214

Query  1131  LRDAILAQLkaakkam-aekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHP  955
             LRD I+AQ+KA K AM  +  +++  PG+T+GETPRL+++DQTLRQQKA QQ+ MM++HP
Sbjct  215   LRDGIVAQIKATKMAMGEKDSTTTLIPGSTRGETPRLRLLDQTLRQQKAFQQMNMMETHP  274

Query  954   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  775
             WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK
Sbjct  275   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  334

Query  774   PMVEEMYLEEVKEQDNI-MGSSDGSRAAVD----GGSGRERLDKKPNVVRLDSECISSLI  610
             PMVEEMYLEE KE++   +GS DGS+A +D           + +KPN+VR++SECISS+I
Sbjct  335   PMVEEMYLEETKEEEEENVGSQDGSKALIDEMTINNHQSSHIVQKPNLVRIESECISSII  394

Query  609   ----------NIPAKAGGDHHQFGAVELDFSP-YTHNSGGAVGYRPGERKTggggGVSLT  463
                       N     GGD   FGA+ELDFS    + + G+  +       GG GGVSLT
Sbjct  395   NHHPHDKNDQNYGVIRGGD-QSFGAIELDFSTNIAYATNGSDHHHHHHGGGGGSGGVSLT  453

Query  462   LGLQQHGGSGIGL-AFSP-------TSQNSLFYPRDQIGDCPPVQY-SLLDGEGQNLPYR  310
             LGLQQHGGS +GL  FS          Q+SLFYPRD   D   VQY SLLD E QNLPYR
Sbjct  454   LGLQQHGGSSMGLTTFSSQPSHHNHNHQSSLFYPRD---DHDQVQYSSLLDSENQNLPYR  510

Query  309   NLMGSQLLHDLAG  271
             NLMG+QLLHDLAG
Sbjct  511   NLMGAQLLHDLAG  523



>gb|KHN25686.1| Homeobox protein BEL1 like [Glycine soja]
Length=436

 Score =   474 bits (1219),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 252/427 (59%), Positives = 306/427 (72%), Gaps = 37/427 (9%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSD--EPKR---KSQWQQDDHTT-SSQNHSLGSLH  1318
             F +++SK+L PAQ+LL EFC +   QSD  +P +   K QW+++++   SS+ HSL SL 
Sbjct  23    FLVKNSKFLVPAQDLLNEFCSLDAKQSDLGKPTKSLNKKQWEEENNGIGSSKKHSLTSLE  82

Query  1317  FLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHF  1138
             F+ELQK K+KLL +L+EVDRRYKHYR+QM +VVSSFEAVAG+GAATVYSALA + MSRHF
Sbjct  83    FVELQKRKTKLLSMLEEVDRRYKHYRNQMKSVVSSFEAVAGNGAATVYSALALKAMSRHF  142

Query  1137  RCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSH  958
             RCL+D I+AQ+       A  E    APG T+GETPRLK+IDQTLRQQ+A QQ++MM++H
Sbjct  143   RCLKDGIMAQI--QATRKAMGEKDPVAPGTTRGETPRLKVIDQTLRQQRAFQQMSMMETH  200

Query  957   PWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLW  778
             PWRPQRGLPER+VSVLRAWLFEHFLHP    VD ++          QVSNWFINARVRLW
Sbjct  201   PWRPQRGLPERAVSVLRAWLFEHFLHPKTPLVDPYV--------SKQVSNWFINARVRLW  252

Query  777   KPMVEEMYLEEVKEQDNIMGSSDGSR-----------AAVDGGSGRERLDKKPNVVRLDS  631
             KPMVEEMYLEEVK+ +N + SS+G+                  S     D+KP++VR+DS
Sbjct  253   KPMVEEMYLEEVKDPENNIASSEGATDQDNDINPNNVEYPPPPSSSRSEDQKPSLVRIDS  312

Query  630   ECISSLIN---IPAKAG---GDHHQFGAVELDFSPYTHNSGGAVGYRPGERK-TggggGV  472
             EC SS+IN    P       G    FG+VELDFS YTH+S G V Y   ++       GV
Sbjct  313   ECASSIINNHSTPDNKNDPKGHEQCFGSVELDFSSYTHHSSGIVSYGSNDQNGNNNQSGV  372

Query  471   SLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQ  292
             SLTLGLQQH   G+ LAF P +Q+SL+YPRDQI DC PVQYSL DGEGQNLPYRNLMG+Q
Sbjct  373   SLTLGLQQH---GVSLAFPPATQSSLYYPRDQIEDCQPVQYSLFDGEGQNLPYRNLMGAQ  429

Query  291   LLHDLAG  271
             LLHDLAG
Sbjct  430   LLHDLAG  436



>ref|XP_010325299.1| PREDICTED: bell-like homeodomain protein 3 isoform X1 [Solanum 
lycopersicum]
Length=644

 Score =   480 bits (1235),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 295/493 (60%), Positives = 349/493 (71%), Gaps = 44/493 (9%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDE-DDRFLGKPENLGHPSQD  1486
             +GLSLSL S+NPS+IG  SF+            R  ++Q     D FLGK  ++      
Sbjct  167   QGLSLSLCSSNPSSIGLQSFE-----------LRHQDLQQGLIHDGFLGKSTSIQQGYFH  215

Query  1485  YFFQIRSSKYLGPAQELLKEFCCVGTTQS-DEPKRKSQWQQDDHT-TSSQNHSLGSLHFL  1312
             ++ Q+R SKYLGPAQELL EFC +G  ++ D    K   +Q D T T+S+   L SL  L
Sbjct  216   HYHQVRDSKYLGPAQELLSEFCSLGIKKNNDHSSSKLLLKQHDTTATTSKKQLLQSLDLL  275

Query  1311  ELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRC  1132
             ELQK K+KLL +L+EVDRRYKHY DQM  VVSSFEAVAG+GAATVYSALASR MSRHFRC
Sbjct  276   ELQKRKTKLLQMLEEVDRRYKHYCDQMKGVVSSFEAVAGNGAATVYSALASRAMSRHFRC  335

Query  1131  LRDAILAQLkaakkam-aekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHP  955
             LRD I+AQ+KA K AM  +  +++  PG+T+GETPRL+++DQTLRQQKA QQ+ MM++HP
Sbjct  336   LRDGIVAQIKATKMAMGEKDSTTTLIPGSTRGETPRLRLLDQTLRQQKAFQQMNMMETHP  395

Query  954   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  775
             WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK
Sbjct  396   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  455

Query  774   PMVEEMYLEEVKEQDNI-MGSSDGSRAAVD----GGSGRERLDKKPNVVRLDSECISSLI  610
             PMVEEMYLEE KE++   +GS DGS+A +D           +D+KPN+VR++SECISS+I
Sbjct  456   PMVEEMYLEETKEEEEENVGSQDGSKALIDEMTINNHQSSHIDQKPNLVRIESECISSII  515

Query  609   ----------NIPAKAGGDHHQFGAVELDFSP-YTHNSGGAVGYRPGERKTggggGVSLT  463
                       N     GGD   FGA+ELDFS    + + G+  +       GG GGVSLT
Sbjct  516   NHHPHDKNDQNYGVIRGGD-QSFGAIELDFSTNIAYATNGSDHHHHHHGGGGGSGGVSLT  574

Query  462   LGLQQHGGSGIGL-AFSP-------TSQNSLFYPRDQIGDCPPVQY-SLLDGEGQNLPYR  310
             LGLQQHGGS +GL  FS          Q+SLFYPRD   D   VQY SLLD E QNLPYR
Sbjct  575   LGLQQHGGSSMGLTTFSSQPSHHNHNHQSSLFYPRD---DHDQVQYSSLLDSENQNLPYR  631

Query  309   NLMGSQLLHDLAG  271
             NLMG+QLLHDLAG
Sbjct  632   NLMGAQLLHDLAG  644


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 9/74 (12%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSDSAMNTQIQSGH---MMSQLQSFEPNPEIYNLSSGM-----EMMVG  1831
             RSSSMVT+TGYW+S S  N Q  + H   +  QLQ+FE NP++YNLSS       +MM+G
Sbjct  17    RSSSMVTSTGYWFS-SDTNNQNPTPHNNIVNHQLQNFETNPDLYNLSSSTTSSMDQMMIG  75

Query  1830  FPFKNLQAQSDMWK  1789
             FP  N      +WK
Sbjct  76    FPPNNNNPHHVLWK  89



>ref|NP_001266274.1| bell-like homeodomain protein 3 [Solanum lycopersicum]
 gb|AEW69798.1| Hop-interacting protein THI035 [Solanum lycopersicum]
Length=624

 Score =   479 bits (1233),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 295/493 (60%), Positives = 349/493 (71%), Gaps = 44/493 (9%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHD-EDDRFLGKPENLGHPSQD  1486
             +GLSLSL S+NPS+IG  SF+            R  ++Q     D FLGK  ++      
Sbjct  147   QGLSLSLCSSNPSSIGLQSFE-----------LRHQDLQQGLIHDGFLGKSTSIQQGYFH  195

Query  1485  YFFQIRSSKYLGPAQELLKEFCCVGTTQS-DEPKRKSQWQQDDHT-TSSQNHSLGSLHFL  1312
             ++ Q+R SKYLGPAQELL EFC +G  ++ D    K   +Q D T T+S+   L SL  L
Sbjct  196   HYHQVRDSKYLGPAQELLSEFCSLGIKKNNDHSSSKLLLKQHDTTATTSKKQLLQSLDLL  255

Query  1311  ELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRC  1132
             ELQK K+KLL +L+EVDRRYKHY DQM  VVSSFEAVAG+GAATVYSALASR MSRHFRC
Sbjct  256   ELQKRKTKLLQMLEEVDRRYKHYCDQMKGVVSSFEAVAGNGAATVYSALASRAMSRHFRC  315

Query  1131  LRDAILAQLkaakkam-aekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHP  955
             LRD I+AQ+KA K AM  +  +++  PG+T+GETPRL+++DQTLRQQKA QQ+ MM++HP
Sbjct  316   LRDGIVAQIKATKMAMGEKDSTTTLIPGSTRGETPRLRLLDQTLRQQKAFQQMNMMETHP  375

Query  954   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  775
             WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK
Sbjct  376   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  435

Query  774   PMVEEMYLEEVKEQDNI-MGSSDGSRAAVD----GGSGRERLDKKPNVVRLDSECISSLI  610
             PMVEEMYLEE KE++   +GS DGS+A +D           +D+KPN+VR++SECISS+I
Sbjct  436   PMVEEMYLEETKEEEEENVGSQDGSKALIDEMTINNHQSSHIDQKPNLVRIESECISSII  495

Query  609   ----------NIPAKAGGDHHQFGAVELDFSP-YTHNSGGAVGYRPGERKTggggGVSLT  463
                       N     GGD   FGA+ELDFS    + + G+  +       GG GGVSLT
Sbjct  496   NHHPHDKNDQNYGVIRGGD-QSFGAIELDFSTNIAYATNGSDHHHHHHGGGGGSGGVSLT  554

Query  462   LGLQQHGGSGIGL-AFSP-------TSQNSLFYPRDQIGDCPPVQY-SLLDGEGQNLPYR  310
             LGLQQHGGS +GL  FS          Q+SLFYPRD   D   VQY SLLD E QNLPYR
Sbjct  555   LGLQQHGGSSMGLTTFSSQPSHHNHNHQSSLFYPRD---DHDQVQYSSLLDSENQNLPYR  611

Query  309   NLMGSQLLHDLAG  271
             NLMG+QLLHDLAG
Sbjct  612   NLMGAQLLHDLAG  624


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 42/70 (60%), Gaps = 9/70 (13%)
 Frame = -2

Query  1974  MVTNTGYWYSDSAMNTQIQSGH---MMSQLQSFEPNPEIYNLSSGM-----EMMVGFPFK  1819
             MVT+TGYW+S S  N Q  + H   +  QLQ+FE NP++YNLSS       +MM+GFP  
Sbjct  1     MVTSTGYWFS-SDTNNQNPTPHNNIVNHQLQNFETNPDLYNLSSSTTSSMDQMMIGFPPN  59

Query  1818  NLQAQSDMWK  1789
             N      +WK
Sbjct  60    NNNPHHVLWK  69



>ref|XP_006343945.1| PREDICTED: homeobox protein BEL1 homolog [Solanum tuberosum]
Length=633

 Score =   476 bits (1224),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 295/491 (60%), Positives = 344/491 (70%), Gaps = 50/491 (10%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHD-EDDRFLGKPENLGHPSQD  1486
             +GLSLSL S+NP +IG  SF+            R  ++Q     D FLGK  N+      
Sbjct  166   QGLSLSLCSSNPPSIGLQSFE-----------LRHQDLQQGLIHDGFLGKSTNIQQGYFH  214

Query  1485  YFFQIRSSKYLGPAQELLKEFCCVGTTQS-DEPKRKSQWQQDDHTTS-SQNHSLGSLHFL  1312
             +  Q+R SKYLGPAQELL EFC +G  ++ D    K   +Q + T S S+   L SL  L
Sbjct  215   HHHQVRDSKYLGPAQELLSEFCSLGIKKNNDHSSSKVLLKQHESTASTSKKQLLQSLDLL  274

Query  1311  ELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRC  1132
             ELQK K+KLL +L+EVDRRYKHY DQM AVVSSFEAVAG+GAATVYSALASR MSRHFRC
Sbjct  275   ELQKRKTKLLQMLEEVDRRYKHYCDQMKAVVSSFEAVAGNGAATVYSALASRAMSRHFRC  334

Query  1131  LRDAILAQLkaakkam-aekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHP  955
             LRD I+AQ+KA K AM  +  +S+  PG+T+GETPRL+++DQTLRQQKA QQ+ MM++HP
Sbjct  335   LRDGIVAQIKATKMAMGEKDSTSTLIPGSTRGETPRLRLLDQTLRQQKAFQQMNMMETHP  394

Query  954   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  775
             WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK
Sbjct  395   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  454

Query  774   PMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRE-----RLDKKPNVVRLDSECISSLI  610
             PMVEEMY+EE KE++N+ GS DGS+A +D  +  +       D+KPN+VR+DSECISS+I
Sbjct  455   PMVEEMYIEETKEEENV-GSPDGSKALIDDMTIHQSHIDHHQDQKPNLVRIDSECISSII  513

Query  609   ----------NIPAKAGGDHHQFGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSLTL  460
                       N     GGD   FGA+ELDFS     +  A G   G      GGGVSLTL
Sbjct  514   NHHPHEKNDQNYGVIRGGD-QSFGAIELDFS-----TNIAYG-TSGGDHHHHGGGVSLTL  566

Query  459   GLQQHGGSGIGLAFSPT-------SQNSLFYPRDQIGDCPPVQY-SLLDGEGQNLPYRNL  304
             GLQQHGGSG       T       +Q+SLFYPRD       VQY SLLD E QNLPYRNL
Sbjct  567   GLQQHGGSGGSSMGLTTFSSQPSHNQSSLFYPRDD----DQVQYTSLLDSENQNLPYRNL  622

Query  303   MGSQLLHDLAG  271
             MG+QLLHDLAG
Sbjct  623   MGAQLLHDLAG  633


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 4/70 (6%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSDSAMNTQIQSGHMMS-QLQSFEPNPEIYNLS---SGMEMMVGFPFK  1819
             RSSSMVT+TGYW+S    N      +M++ QLQ+FE NPE+YNLS   S M+ M+GFP  
Sbjct  16    RSSSMVTSTGYWFSSDTNNPNPTPHNMVNHQLQNFETNPEMYNLSSTTSSMDQMIGFPPN  75

Query  1818  NLQAQSDMWK  1789
             N      +WK
Sbjct  76    NNNPHHVLWK  85



>ref|XP_009363416.1| PREDICTED: homeobox protein BEL1 homolog [Pyrus x bretschneideri]
 ref|XP_009363417.1| PREDICTED: homeobox protein BEL1 homolog [Pyrus x bretschneideri]
 ref|XP_009363418.1| PREDICTED: homeobox protein BEL1 homolog [Pyrus x bretschneideri]
Length=682

 Score =   477 bits (1227),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 275/452 (61%), Positives = 329/452 (73%), Gaps = 52/452 (12%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGT------TQSDEPKRKSQW--QQDDHTTSS----QN  1339
              FQ+R+SKYLGPAQ+LL EFC +GT      TQ  +P +  QW  Q+D+ +TSS    Q 
Sbjct  235   LFQLRNSKYLGPAQQLLNEFCSLGTKLTTADTQKQKPHKNKQWGEQEDNGSTSSSRNKQQ  294

Query  1338  HSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALAS  1159
              ++ SL F+ELQK K++LL +L+EV+RRY +Y DQM AVVSSFEAVAG GAATVYSALA+
Sbjct  295   SNIYSLEFVELQKRKNRLLSMLEEVERRYTNYCDQMKAVVSSFEAVAGAGAATVYSALAA  354

Query  1158  RVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQ  979
             + MSRHFR L+D I++Q++  +KAM EK+  +  PGAT+GETP L+++DQTLRQQ+A QQ
Sbjct  355   KAMSRHFRSLKDGIVSQIQVTRKAMGEKDPVA--PGATRGETPGLRILDQTLRQQRAFQQ  412

Query  978   LTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  799
             + MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI
Sbjct  413   MNMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  472

Query  798   NARVRLWKPMVEEMYLEEVKEQD--NIMGSSDGSRAAVDGGSGRER-LDKKPN---VVRL  637
             NARVRLWKPMVEEMY+EE KE++  N + SSDG   A D    + R  D+KP    +VR+
Sbjct  473   NARVRLWKPMVEEMYMEETKERENNNSITSSDG--IATDPSQHQSRPEDEKPTHDQLVRI  530

Query  636   DSECISSLINIPAKA---------------------GGDHHQFGAVELDFSPYTH---NS  529
             DSEC+SS+I  P K                      G  +  FG +ELDFS Y H   +S
Sbjct  531   DSECLSSIITNPEKNQYSRSSKSTILSQHMNPQQSFGRVNESFGTMELDFSSYNHHQQHS  590

Query  528   GGAVGYRPGERKTggg-----gGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDC  364
             GG V Y   +           GGVSLTLGLQQH G+G+ LAFSP SQ+SLFYPRD   +C
Sbjct  591   GGTVSYSNDQHHNPNQGFNGGGGVSLTLGLQQHDGNGVSLAFSPASQSSLFYPRDNAEEC  650

Query  363   PPVQYSLLDGEGQ-NLPYRNLMGSQLLHDLAG  271
              PVQYSLLDGEGQ NLPYRNLMG+QLLHDLAG
Sbjct  651   QPVQYSLLDGEGQNNLPYRNLMGAQLLHDLAG  682



>ref|XP_010275694.1| PREDICTED: homeobox protein BEL1 homolog [Nelumbo nucifera]
 ref|XP_010275695.1| PREDICTED: homeobox protein BEL1 homolog [Nelumbo nucifera]
Length=685

 Score =   477 bits (1227),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 272/475 (57%), Positives = 325/475 (68%), Gaps = 63/475 (13%)
 Frame = -2

Query  1533  DRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRK----SQWQQ  1366
             D + GK  N+        FQ+++SKYL  AQELL E C +G+ Q+D  K+K    +QW+ 
Sbjct  220   DGYFGKAANI----HQVHFQLKNSKYLATAQELLNEICSLGSRQTDPSKQKLHKSNQWE-  274

Query  1365  DDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGA  1186
             D++   SQ   L +L  LELQK K+KLL +L+EVDRRY+ Y DQM AVVSSFEAVAG G 
Sbjct  275   DENGCPSQKQPLHNLDLLELQKRKAKLLSMLEEVDRRYRQYCDQMKAVVSSFEAVAGTGT  334

Query  1185  ATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQT  1006
             A VYSALAS+ MS+HFR LRDAI+ Q+KA KKAM EK+  +  PG T+GETPRL+++DQT
Sbjct  335   AKVYSALASKAMSKHFRSLRDAIVGQIKATKKAMGEKDPVA--PGTTRGETPRLRLLDQT  392

Query  1005  LRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLS  826
             LRQQ+A QQ++MM+SHPWRPQRGLPERSVS+LRAWLFEHFLHPYPSDVDKHILARQTGLS
Sbjct  393   LRQQRAFQQMSMMESHPWRPQRGLPERSVSLLRAWLFEHFLHPYPSDVDKHILARQTGLS  452

Query  825   RSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGG----SGRERLDK  658
             RSQVSNWFINARVRLWKPMVEEMYLEEVKEQDN+  S  GS    D G    S +   + 
Sbjct  453   RSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNMASSDGGSSHGGDNGRPNQSHKSNQNA  512

Query  657   KPN----------VVRLDSECISSLINIPAKAGGDHHQ----------------------  574
             +PN          +VR DSE +SS+IN P K   DH +                      
Sbjct  513   QPNSEDHKPTHDQLVRDDSESLSSIINNPDK--NDHSKAGRNNHNHHHRHEQQQLQQQLQ  570

Query  573   ------------FGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQHGGSGI  430
                         FGA++LDFS Y  ++   V +     +   G GVSLTLGLQQHGGSG+
Sbjct  571   QQQQQLGRVAEPFGAIDLDFSAYNQHTASTVSFTNDGIQQNLGNGVSLTLGLQQHGGSGV  630

Query  429   GL-AFSPTSQNSLFYPRDQIGDCPPVQYSL-LDGEGQNLPYRNLMGSQLLHDLAG  271
              L +FSP S NSLF+ RD I DC  +QYS+ LDGEGQ LPYRNLMG+QLLHDLAG
Sbjct  631   NLSSFSPASHNSLFFTRDHIEDCQSIQYSMSLDGEGQTLPYRNLMGAQLLHDLAG  685


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 53/71 (75%), Gaps = 7/71 (10%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSDSAMNTQ--IQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNL  1813
             +S ++V++ G+ Y D++ N +  I S H+M+Q+QSFE NPE++NL++G++M+ GFP KNL
Sbjct  9     KSRNLVSSAGFAYLDASSNEKPTIHS-HLMNQMQSFESNPELFNLTTGIDML-GFPSKNL  66

Query  1812  QAQSD---MWK  1789
             Q + +   MWK
Sbjct  67    QERENNLVMWK  77



>ref|XP_009363409.1| PREDICTED: homeobox protein BEL1 homolog [Pyrus x bretschneideri]
 ref|XP_009363410.1| PREDICTED: homeobox protein BEL1 homolog [Pyrus x bretschneideri]
 ref|XP_009363411.1| PREDICTED: homeobox protein BEL1 homolog [Pyrus x bretschneideri]
Length=682

 Score =   475 bits (1222),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 274/452 (61%), Positives = 328/452 (73%), Gaps = 52/452 (12%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGT------TQSDEPKRKSQW--QQDDHTTSS----QN  1339
              FQ+R+SKYLGPAQ+LL EFC +GT      TQ  +P +  QW  Q+D+ +TSS    Q 
Sbjct  235   LFQLRNSKYLGPAQQLLNEFCSLGTKLTTADTQKQKPHKNKQWGEQEDNGSTSSSRNKQQ  294

Query  1338  HSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALAS  1159
              ++ SL F+ELQK K++LL +L+EV+RRY +Y DQM  VVSSFEAVAG GAATVYSALA+
Sbjct  295   SNIYSLEFVELQKRKNRLLSMLEEVERRYTNYCDQMKDVVSSFEAVAGAGAATVYSALAA  354

Query  1158  RVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQ  979
             + MSRHFR L+D I++Q++  +KAM EK+  +  PGAT+GETP L+++DQTLRQQ+A QQ
Sbjct  355   KAMSRHFRSLKDGIVSQIQVTRKAMGEKDPVA--PGATRGETPGLRILDQTLRQQRAFQQ  412

Query  978   LTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  799
             + MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI
Sbjct  413   MNMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  472

Query  798   NARVRLWKPMVEEMYLEEVKEQD--NIMGSSDGSRAAVDGGSGRER-LDKKPN---VVRL  637
             NARVRLWKPMVEEMY+EE KE++  N + SSDG   A D    + R  D+KP    +VR+
Sbjct  473   NARVRLWKPMVEEMYMEETKERENNNSITSSDG--IATDPSQHQSRPEDEKPTHDQLVRI  530

Query  636   DSECISSLINIPAKA---------------------GGDHHQFGAVELDFSPYTH---NS  529
             DSEC+SS+I  P K                      G  +  FG +ELDFS Y H   +S
Sbjct  531   DSECLSSIITNPEKNQYSRSSKSTILSQHMNPQQSFGRVNESFGTMELDFSSYNHHQQHS  590

Query  528   GGAVGYRPGERKTggg-----gGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDC  364
             GG V Y   +           GGVSLTLGLQQH G+G+ LAFSP SQ+SLFYPRD   +C
Sbjct  591   GGTVSYSNDQHHNPNQGFNGGGGVSLTLGLQQHDGNGVSLAFSPASQSSLFYPRDNAEEC  650

Query  363   PPVQYSLLDGEGQ-NLPYRNLMGSQLLHDLAG  271
              PVQYSLLDGEGQ NLPYRNLMG+QLLHDLAG
Sbjct  651   QPVQYSLLDGEGQNNLPYRNLMGAQLLHDLAG  682



>gb|ACD39462.1| BEL14 protein [Solanum etuberosum]
Length=534

 Score =   468 bits (1203),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 298/512 (58%), Positives = 346/512 (68%), Gaps = 70/512 (14%)
 Frame = -2

Query  1707  EGNNNSNEMKVSITQKGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDE-DD  1531
             EGN  S++        GLSLSL S+NPS+IG  SF+            R  ++Q     D
Sbjct  56    EGNERSSQ--------GLSLSLCSSNPSSIGLQSFE-----------LRHQDLQQGLIHD  96

Query  1530  RFLGKPENLGHPSQDYFF------QIRSSKYLGPAQELLKEFCCVGTTQS-DEPKRKSQW  1372
              FLGK  N+    Q YF       Q+R SKYLGPAQELL EFC +G  ++ D    K   
Sbjct  97    GFLGKSTNI---QQGYFHHHHHHHQVRDSKYLGPAQELLSEFCSLGIKKNNDHSSSKVLL  153

Query  1371  QQDDHTTS-SQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAG  1195
             +Q + TTS S+   L SL  LELQK K+KLL +L+EVDRRY+HY DQM AVVSSFEAVAG
Sbjct  154   KQHECTTSTSKKQLLQSLDLLELQKRKTKLLQMLEEVDRRYRHYCDQMKAVVSSFEAVAG  213

Query  1194  DGAATVYSALASRVMSRHFRCLRDAILAQLkaakkam-aekesssaAPGATKGETPRLKM  1018
             +GAATVYSALASR MSRHFRCLRD I+AQ+KA K AM  +  +S+  PG+T+GETPRL++
Sbjct  214   NGAATVYSALASRAMSRHFRCLRDGIVAQIKATKMAMGEKDSTSTLIPGSTRGETPRLRL  273

Query  1017  IDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             +DQTLRQQKA QQ+ MM++HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ
Sbjct  274   LDQTLRQQKAFQQMNMMETHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  333

Query  837   TGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERL--  664
             TGLSRSQVSNWFINARVRLWKPMVEEMYLEE KE++N+ GS DGS+   D    +  +  
Sbjct  334   TGLSRSQVSNWFINARVRLWKPMVEEMYLEETKEEENV-GSPDGSKGLDDMTIHQSHIDH  392

Query  663   --DKKPNVVRLDSECISSLINIPAKAGGDH------------HQFGAVELDFSPYTHNSG  526
               D+KPN+VR+DSECISS+IN       DH              FGA+ELDFS     + 
Sbjct  393   HQDQKPNLVRIDSECISSIINHQPHEKNDHQVQTYGVIRGGDQSFGAIELDFS-----TN  447

Query  525   GAVGYRPGERKTggggGVSLTLGLQQHGGSGIGLAFSPT----------SQNSLFYPRDQ  376
              A G   G      GGGVSLTLGLQQHGGSG       T          +Q+SLFYPRD 
Sbjct  448   IAYG-TSGGDHHHHGGGVSLTLGLQQHGGSGGSSMGLTTFSSQPSHHHHNQSSLFYPRDD  506

Query  375   IGDCPPVQY-SLLDGEGQNLPYRNLMGSQLLH  283
                   VQY SLLD E QNLPYRNLMG+QLLH
Sbjct  507   ----DQVQYSSLLDSENQNLPYRNLMGAQLLH  534



>ref|XP_010255251.1| PREDICTED: homeobox protein BEL1 homolog [Nelumbo nucifera]
 ref|XP_010255252.1| PREDICTED: homeobox protein BEL1 homolog [Nelumbo nucifera]
 ref|XP_010255253.1| PREDICTED: homeobox protein BEL1 homolog [Nelumbo nucifera]
Length=691

 Score =   472 bits (1215),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 287/523 (55%), Positives = 347/523 (66%), Gaps = 69/523 (13%)
 Frame = -2

Query  1653  SLSLSSTNPSAIGFNSFDDLRLMaassssSRL-NNIQHDE-----DDRFLGKPENLGHPS  1492
             S  L  TN         DD+R ++++S       +I H +      D F GK  N+    
Sbjct  176   SFELRDTNHHHHHQQHQDDMRFISSNSRDGLFGKSINHQQQQQILQDGFFGKAANV----  231

Query  1491  QDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRK----SQWQQDDHTTSSQNHSLGS  1324
                 FQ+++SKYL PAQELL E C +GT Q+D+PK+K    +QW++++   SS+   L +
Sbjct  232   HQVHFQLKNSKYLAPAQELLNEVCNLGTKQTDQPKQKPHKANQWEEENGGDSSKKQPLYT  291

Query  1323  LHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSR  1144
             L  LELQK K+KLL +L+EVDRRY+ Y ++M  VVSSFEAVAG G A VYSALAS+ MS+
Sbjct  292   LDLLELQKRKAKLLSMLEEVDRRYRQYCEEMKGVVSSFEAVAGTGGAKVYSALASKAMSK  351

Query  1143  HFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMD  964
             HFRCLRD I+ Q+KA KKAM EK+  +  PG TKGETPRL++IDQ LRQQ+A QQ++MM+
Sbjct  352   HFRCLRDGIVGQIKATKKAMGEKDLVA--PGTTKGETPRLRLIDQALRQQRAFQQMSMME  409

Query  963   SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVR  784
             SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVR
Sbjct  410   SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVR  469

Query  783   LWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGR-------------ERLDKKPN--  649
             LWKPMVEEMYLEE K+ DN M SS+G  +  D    R                D+KP   
Sbjct  470   LWKPMVEEMYLEETKDLDN-MTSSEGGTSHGDNAGRRPNQNHNSNQTPQPNSEDQKPTTD  528

Query  648   -VVRLDSECISSLINIPAKAG-------------GDHHQ-----------------FGAV  562
              +VR +SE +SS+I+ P K G             GDH                   FGAV
Sbjct  529   QLVRAESESLSSIISNPEKNGSSSSSKINGRNDQGDHCHHQQNQQQQLGSSRVPELFGAV  588

Query  561   ELDFSPYT-HNSGGAVGY--RPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLF  391
             +LDFS Y  H +   + +    G      GGGVSLTLGLQQHGGSG+ L+FSP SQ+SLF
Sbjct  589   DLDFSAYNQHTAASTISFANNGGVHHQNIGGGVSLTLGLQQHGGSGVSLSFSPASQHSLF  648

Query  390   YPRDQIG-DCPPV-QYSLLDGEGQ-NLPYRNLMGSQLLHDLAG  271
             +PRD I  DC  + QYS+LDGEGQ NLPYRNLMG+QLLHDLAG
Sbjct  649   FPRDHINEDCQSIHQYSMLDGEGQNNLPYRNLMGAQLLHDLAG  691


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 52/71 (73%), Gaps = 7/71 (10%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSDSAMNTQ--IQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNL  1813
             +  ++V+ TG+ Y  ++ N+   IQS H+++Q+QSFE +PE++NL+SG+EM+ GFP KNL
Sbjct  9     KPKNLVSPTGFCYLGTSSNSSPTIQS-HLVNQMQSFESSPELFNLTSGIEML-GFPSKNL  66

Query  1812  Q---AQSDMWK  1789
             Q   + S MWK
Sbjct  67    QQRDSNSVMWK  77



>ref|XP_006580557.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Glycine 
max]
 ref|XP_006580558.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Glycine 
max]
 ref|XP_006580559.1| PREDICTED: homeobox protein BEL1 homolog isoform X3 [Glycine 
max]
Length=635

 Score =   469 bits (1207),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 255/416 (61%), Positives = 316/416 (76%), Gaps = 33/416 (8%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDE-PKRKS-----QWQQDDHTT-SSQNHSLGSL  1321
             F I++SK+L PAQ LL EFC +GT ++D  PK+K      QW++ +    SS+NHSL SL
Sbjct  239   FLIKNSKFLVPAQVLLNEFCSLGTKENDVLPKQKCSQKNKQWEEGNSGGGSSKNHSLSSL  298

Query  1320  HFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRH  1141
              ++ELQK K+KLL +L+EVDRRYKHYR+QM AVVSSFEAVAG+GAATVYSALA + MSRH
Sbjct  299   EYVELQKRKTKLLAMLEEVDRRYKHYRNQMKAVVSSFEAVAGNGAATVYSALALKAMSRH  358

Query  1140  FRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDS  961
             FRCL+D I+ +++A +K M EK+  +A PG T+GETPRL+++DQ+LRQQ+A QQ+++M++
Sbjct  359   FRCLKDGIMDEIEATRKGMGEKDHVAAVPGTTRGETPRLRIVDQSLRQQRAFQQISIMET  418

Query  960   HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRL  781
             HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ GLSR QVSNWFINARVRL
Sbjct  419   HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQAGLSRRQVSNWFINARVRL  478

Query  780   WKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPNVVRLDSECISSLINIP  601
             WKPMVEEMYLEE KEQ+N + SSD +    D     E+  ++  ++R+DSEC+SS++N  
Sbjct  479   WKPMVEEMYLEEEKEQENDVASSDINVPEED-----EKPTQEAPLLRIDSECMSSIVNDV  533

Query  600   AKAG------GDHHQFGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQHGG  439
              K+G           FG+VELDFS YTH                   GVSLTLGLQQHG 
Sbjct  534   TKSGKTIQNDNQMDAFGSVELDFSSYTH--------------AHHSSGVSLTLGLQQHGE  579

Query  438   SGIGLAFSP-TSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLA  274
             SG+ LAF P  +Q+S+FYPRDQI +C  VQYSLLD EGQN+P+RN+MG+ LLHDL 
Sbjct  580   SGVSLAFLPAATQSSMFYPRDQIQECQTVQYSLLDAEGQNMPFRNVMGTHLLHDLV  635



>gb|KHN16798.1| Homeobox protein BEL1 like [Glycine soja]
Length=421

 Score =   461 bits (1185),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 263/433 (61%), Positives = 322/433 (74%), Gaps = 44/433 (10%)
 Frame = -2

Query  1515  PENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS-QWQQDDHTT--SS  1345
             P    +  Q   F I++SK+L P+Q LL EFC +GT ++D PK+K+ QW++ ++    SS
Sbjct  9     PNKAANIYQQGHFLIKNSKFLVPSQVLLNEFCSLGTKENDVPKQKNKQWEEGNNNGGGSS  68

Query  1344  QNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSAL  1165
             +NHSL SL F+ELQK K++LL +L+EVDRRYKHYRDQM AV+SSFEA   +GAATVYSAL
Sbjct  69    KNHSLSSLEFVELQKRKTRLLAMLEEVDRRYKHYRDQMKAVMSSFEA---NGAATVYSAL  125

Query  1164  ASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAI  985
             A + MSRHFRCL+D I+ Q++A +K M EKE ++  PG T+GETPRLK+IDQ+LRQQ+A 
Sbjct  126   ALKAMSRHFRCLKDGIMDQIRATRKGMGEKELAAV-PGTTRGETPRLKIIDQSLRQQRAF  184

Query  984   QQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ--VS  811
             QQ+++M++HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLS+SQ  VS
Sbjct  185   QQISIMETHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSKSQARVS  244

Query  810   NWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPN---VVR  640
             NWFINARVRLWKPMVEEMYLEE KE  N + SS+G    + G       D+KP    +VR
Sbjct  245   NWFINARVRLWKPMVEEMYLEEEKEHQNDVASSEGGGINILG-------DQKPTQARLVR  297

Query  639   LDSECISSLINIP-----AKAG------GDHHQFGAVELDFSPYTHN-SGGAVGYRPGER  496
             +DSEC+SS++N P      K+G           FG+VELDF  YTH  S G  G      
Sbjct  298   IDSECMSSIVNNPDDKNDTKSGKTIQNDNQMDAFGSVELDFWSYTHQYSSGHSG------  351

Query  495   KTggggGVSLTLGLQQHGGSGIGLAFSP-TSQNSLFYPRDQIGDCPPVQYSLLDGEGQNL  319
                   GVSLTLGLQQHG SG+ LAF P  +Q+S+FYPRDQI DC  VQYSL+DG+GQN+
Sbjct  352   ------GVSLTLGLQQHGESGVSLAFPPAATQSSMFYPRDQIEDCQTVQYSLVDGKGQNM  405

Query  318   PYRNLMGSQLLHD  280
             PYRNLMG+ LLHD
Sbjct  406   PYRNLMGTHLLHD  418



>ref|XP_011073138.1| PREDICTED: homeobox protein BEL1 homolog [Sesamum indicum]
Length=603

 Score =   467 bits (1202),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 265/441 (60%), Positives = 326/441 (74%), Gaps = 50/441 (11%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEPK-RKSQWQQDDHTTSSQNHSL-GSLHFLEL  1306
             FQ R+SKYLGPAQELL EFC +G+ ++ + K +K    +DD +   +  S   S   LEL
Sbjct  175   FQPRNSKYLGPAQELLTEFCNLGSDKTSKLKVQKCSGLEDDESDDVKKQSFYSSFDLLEL  234

Query  1305  QKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLR  1126
             QK K+KLL +LDEVDRRYKHYRDQM AVV SFE+VAG+G+A VYSA+ASR MSRHF+CL+
Sbjct  235   QKRKTKLLQMLDEVDRRYKHYRDQMKAVVQSFESVAGNGSAQVYSAMASRAMSRHFKCLK  294

Query  1125  DAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRP  946
             D IL+Q+KA KKAM EK+S++  PG TKGETPRL+++DQTLRQQ+A QQ++M+++ PWRP
Sbjct  295   DGILSQIKAIKKAMGEKDSAA--PGTTKGETPRLRILDQTLRQQRAFQQMSMIENPPWRP  352

Query  945   QRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  766
             QRGLPERSVSVLR+WLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV
Sbjct  353   QRGLPERSVSVLRSWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMV  412

Query  765   EEMYLEEVKEQDNIMGSSDGSRAAVDGGS-----GRERLDKKPN---VVRLDSECISSLI  610
             EEMYLE++KE ++ MG  DG+    + G+     G +  D+KP    ++R+DS+ +SS+I
Sbjct  413   EEMYLEDLKEGED-MGELDGAANHHENGNQNPPPGND--DQKPTQDQLIRIDSDYLSSII  469

Query  609   NIPAK---------AGGDHH-------------QFG-AVELDFSPYTHNSGGA-VGYRPG  502
             N P K          G DHH             ++G +++ DFS Y+  +GGA V Y  G
Sbjct  470   NNPGKNDPKAPDKSLGSDHHHHHQESSFSRVGEEYGTSMQFDFSSYSQQAGGATVSYGGG  529

Query  501   ERKTggggGVSLTLGLQQHGGS-GIGLAFSPTSQNSLFYPR--DQIGDCPPV-QYSLLDG  334
                     GVSLTLGLQQ+G S G+ LAFSP +Q+SLFYPR  D + DC  V QYSLLD 
Sbjct  530   S-------GVSLTLGLQQNGASGGVSLAFSPATQSSLFYPRSSDNMEDCQTVHQYSLLDS  582

Query  333   EGQNLPYRNLMGSQLLHDLAG  271
             E QNLPYRNLMG+QLLHDLAG
Sbjct  583   ENQNLPYRNLMGAQLLHDLAG  603


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 5/55 (9%)
 Frame = -2

Query  1971  VTNTGYWYSDSAMNT---QIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKN  1816
             VT+TGY YSD A +T    IQ+ H++SQLQSFE NP+IYNL++ M  M+GFP KN
Sbjct  10    VTSTGYCYSDDASSTGNPNIQT-HLLSQLQSFESNPDIYNLTTSMG-MIGFPSKN  62



>gb|ACD39465.1| BEL14 protein [Solanum palustre]
Length=534

 Score =   461 bits (1185),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 291/497 (59%), Positives = 338/497 (68%), Gaps = 62/497 (12%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDE-DDRFLGKPENLGHPSQD  1486
             +GLSLSL  +NPS+IG  SF+            R  ++Q     D FLGK  N+    Q 
Sbjct  63    QGLSLSLCPSNPSSIGLQSFE-----------LRHQDLQQGLIHDGFLGKSTNI---QQG  108

Query  1485  YFF------QIRSSKYLGPAQELLKEFCCVGTTQS-DEPKRKSQWQQDDHTTS-SQNHSL  1330
             YF       Q+R SKYLGPAQELL EFC +G  ++ D    K   +Q + TTS S+   L
Sbjct  109   YFHHHHHHHQVRDSKYLGPAQELLSEFCSLGIKKNNDHSSSKVLLKQHESTTSTSKKQLL  168

Query  1329  GSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVM  1150
              SL  LELQK K+KLL +L+EVDRRY+HY DQM AVVSSFEAVAG+GAATVYSALASR M
Sbjct  169   QSLDLLELQKRKTKLLQMLEEVDRRYRHYCDQMKAVVSSFEAVAGNGAATVYSALASRAM  228

Query  1149  SRHFRCLRDAILAQLkaakkam-aekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLT  973
             SRHFRCLRD I+AQ+KA K AM  +  +S+  PG+T+GETPRL+++DQTLRQQKA QQ+ 
Sbjct  229   SRHFRCLRDGIVAQIKATKMAMGEKDSTSTLIPGSTRGETPRLRLLDQTLRQQKAFQQMN  288

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
             MM++HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV NWFINA
Sbjct  289   MMETHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVPNWFINA  348

Query  792   RVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERL----DKKPNVVRLDSEC  625
             RVRLWKPMVEEMYLEE KE++N+ GS DGS+   D    +  +    D+KPN+ R+DSEC
Sbjct  349   RVRLWKPMVEEMYLEETKEEENV-GSPDGSKGLDDMTIHQSHIDHHQDQKPNLARIDSEC  407

Query  624   ISSLINIPAKAGGDH------------HQFGAVELDFSPYTHNSGGAVGYRPGERKTggg  481
             ISS+IN       DH              FGA+ELDFS     +  A G   G      G
Sbjct  408   ISSIINHQPHEKNDHQVQTYGVIRGGDQSFGAIELDFS-----TNIAYG-TSGGDHHHHG  461

Query  480   gGVSLTLGLQQHGGSGIGLAFSPT----------SQNSLFYPRDQIGDCPPVQY-SLLDG  334
             GGVSLTLGLQQHGGSG       T          +Q+SLFYPRD       VQY SLLD 
Sbjct  462   GGVSLTLGLQQHGGSGGSSMGLTTFSSQPSHHHHNQSSLFYPRDD----DQVQYSSLLDS  517

Query  333   EGQNLPYRNLMGSQLLH  283
             E QNLPYRNLMG+QLLH
Sbjct  518   ENQNLPYRNLMGAQLLH  534



>ref|XP_011080922.1| PREDICTED: homeobox protein BEL1 homolog [Sesamum indicum]
Length=648

 Score =   464 bits (1194),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 269/448 (60%), Positives = 319/448 (71%), Gaps = 59/448 (13%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRK-------SQWQQDDHTTSSQNHSLGSLHF  1315
             +R+SKYLGPAQELL EFC +GT ++D+   K        +WQ +D   + +  SL SL  
Sbjct  213   VRNSKYLGPAQELLNEFCNLGTKETDKSSSKIKVQKMSGEWQDED---AVKKQSLYSLDL  269

Query  1314  LELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFR  1135
             LELQ+ K+KLL +L+EVD+RYKHY DQM AVVSSFEAVAG+GAATVYSA+ASR MS+HFR
Sbjct  270   LELQRRKTKLLQMLEEVDKRYKHYCDQMKAVVSSFEAVAGNGAATVYSAMASRAMSKHFR  329

Query  1134  CLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHP  955
             CLRD IL+Q++A KKAM +K++S+  PG  KGETPRL+++DQTLRQQ+A+QQ++MM+SHP
Sbjct  330   CLRDGILSQIRATKKAMGDKDTST--PGTMKGETPRLRILDQTLRQQRALQQMSMMESHP  387

Query  954   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  775
             WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK
Sbjct  388   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  447

Query  774   PMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGR------------ERLDKKP---NVVR  640
             PMVEEMYLEE KE++ I    DG+ AA +                    D+KP    +VR
Sbjct  448   PMVEEMYLEEQKEEEGI---GDGASAAANLDDNHHDHHGLTIQNPSRTKDQKPAHDQLVR  504

Query  639   LDSECISSLIN----------IPAKAGGDHHQ-------------FGAVELDFSPYTHNS  529
             +DSEC+SS+IN            A A  +H Q             + A+ELDFS YTH+ 
Sbjct  505   IDSECLSSIINNTDKNASKNKSKAAALQNHEQQNHPCSFGRPGDSYSAMELDFSSYTHHH  564

Query  528   GGAVGYRPGERKTggggGVSLT-LGLQQHGGSGIGLAFSPTS-QNSLFYPRDQIGDCPPV  355
               A     G     GGGGVSLT    Q  GG G+ L FSP S Q+SLFYPRD + DC  V
Sbjct  565   SSAG----GGPTNYGGGGVSLTLGLHQHGGGGGVSLPFSPVSVQSSLFYPRDHMEDCQTV  620

Query  354   QYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             QYSLLD E QNLPYRNLMG+QLLHDLAG
Sbjct  621   QYSLLDSENQNLPYRNLMGAQLLHDLAG  648


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 43/65 (66%), Gaps = 9/65 (14%)
 Frame = -2

Query  1974  MVTNTGYWYSDSAMNTQIQSGHMMSQLQSFEPNPEIYNLSS-GMEMMVGFPFKNLQAQ--  1804
             M+ +TGY YS ++      S H+++QLQSF+PNPEIYN+S+ GM  M+GFP K    Q  
Sbjct  12    MIASTGYCYSGAS-----SSHHLVTQLQSFDPNPEIYNMSTAGMGGMIGFPSKTTLHQEN  66

Query  1803  -SDMW  1792
              S +W
Sbjct  67    GSGLW  71



>gb|AAN03624.1|AF406700_1 BEL1-related homeotic protein 14 [Solanum tuberosum]
Length=532

 Score =   460 bits (1183),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 288/482 (60%), Positives = 334/482 (69%), Gaps = 51/482 (11%)
 Frame = -2

Query  1659  GLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDE-DDRFLGKPENLGHPSQDY  1483
             GLSLSL S+NPS+IG  SF+            R  ++Q     D FLGK  N+      +
Sbjct  69    GLSLSLCSSNPSSIGLQSFE-----------LRHQDLQQGLIHDGFLGKSTNIQQGYFHH  117

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQS-DEPKRKSQWQQDDHTTS-SQNHSLGSLHFLE  1309
               Q+R SKYLGPAQELL EFC +G  ++ D    K   +Q + T S S+   L SL  LE
Sbjct  118   HHQVRDSKYLGPAQELLSEFCSLGIKKNNDHSSSKVLLKQHESTASTSKKQLLQSLDLLE  177

Query  1308  LQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCL  1129
             LQK K+KLL +L+EVDRRYKHY DQM AVVSSFEAVAG+GAATVYSALASR MSRHFRCL
Sbjct  178   LQKRKTKLLQMLEEVDRRYKHYCDQMKAVVSSFEAVAGNGAATVYSALASRAMSRHFRCL  237

Query  1128  RDAILAQLkaakkam-aekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPW  952
             RD I+AQ+KA K AM  +  +S+  PG+T+GETPRL+++DQTLRQQKA QQ+ MM++HPW
Sbjct  238   RDGIVAQIKATKMAMGEKDSTSTLIPGSTRGETPRLRLLDQTLRQQKAFQQMNMMETHPW  297

Query  951   RPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKP  772
             RPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKP
Sbjct  298   RPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKP  357

Query  771   MVEEMYLEEVKEQDNIMGSSDGSRAAVDGGS------GRERLDKKPNVVRLDSECISSLI  610
             MVEEMYLEE KE++N+ GS DGS+A +D  +         + D+KPN+VR+DSECISS+I
Sbjct  358   MVEEMYLEETKEEENV-GSPDGSKALIDDMTIHQSHIDHHQADQKPNLVRIDSECISSII  416

Query  609   ----------NIPAKAGGDHHQFGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSLTL  460
                       N     GGD   FGA+ELDFS     +  A G   G      GGGVSLTL
Sbjct  417   NHQPHEKNDQNYGVIRGGD-QSFGAIELDFS-----TNIAYG-TSGGDHHHHGGGVSLTL  469

Query  459   GLQQHGGSGIGLAFSPT-------SQNSLFYPRDQIGDCPPVQY-SLLDGEGQNLPYRNL  304
             GLQQHGGSG       T       +Q+SLFYPRD       VQY SLLD E QNLPYRNL
Sbjct  470   GLQQHGGSGGSSMGLTTFSSQPSHNQSSLFYPRDD----DQVQYSSLLDSENQNLPYRNL  525

Query  303   MG  298
              G
Sbjct  526   DG  527



>gb|KEH21114.1| BEL1-related homeotic protein [Medicago truncatula]
Length=620

 Score =   458 bits (1178),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 264/441 (60%), Positives = 324/441 (73%), Gaps = 43/441 (10%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDE---PKRKSQ-------WQQDDH---TTSSQN  1339
             F +++SK+L PAQELL EFC + +T+ ++    K+KSQ       W+ D++   ++SS  
Sbjct  184   FLLKNSKFLLPAQELLNEFCSLESTKQNDLVLQKQKSQKFNNKQSWEDDNNNGGSSSSIK  243

Query  1338  HSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALAS  1159
              SL S+ F+ELQK K+KLL +L+EVDRRYKHY +QM +VVSSFEAVAG+GAA VYSALA 
Sbjct  244   QSLTSVEFVELQKRKTKLLSMLEEVDRRYKHYCNQMRSVVSSFEAVAGNGAAKVYSALAL  303

Query  1158  RVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQ  979
             + MSRHFRCL+D IL Q++  +KAM EK+  +  PG TKGETPRLK++D+ LRQQ+A QQ
Sbjct  304   KAMSRHFRCLKDGILEQIQTTRKAMGEKDPVA--PGTTKGETPRLKILDRVLRQQRAFQQ  361

Query  978   LTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  799
             + MM++HPWRPQRGLPERSVS+LRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI
Sbjct  362   INMMETHPWRPQRGLPERSVSILRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  421

Query  798   NARVRLWKPMVEEMYLEEVKEQ----------DNIMGSSDGSRAAVDGGSGRERLDKKPN  649
             NARVRLWKPMVEEMYLEE KEQ          +NI    D      +    +   D+KP 
Sbjct  422   NARVRLWKPMVEEMYLEEEKEQQRNTTTSDGGNNINHEEDNLNVLQNQSQTQPHEDQKPR  481

Query  648   VVRLDSECISSLINIPAKAGG-----DHHQ-----FGAVELDFSPY-THNSGG--AVGYR  508
             ++R+DSEC+SS+IN   K        +HHQ     FG+V++DFS Y TH+S       Y 
Sbjct  482   LLRIDSECVSSIINNDHKNDANNKNLNHHQLAADAFGSVDIDFSSYNTHHSSSDMVAAYT  541

Query  507   PGE--RKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDG  334
              GE   + G  GGVSLTLGLQQHGG+G+ LAF PTSQ+ +FY RDQI +  PVQYSLLDG
Sbjct  542   SGESFHQGGSSGGVSLTLGLQQHGGNGVSLAFPPTSQSPMFYTRDQIEE--PVQYSLLDG  599

Query  333   EGQNL-PYRNLMGSQLLHDLA  274
             EG N+ PYRNLMG+QLLHDLA
Sbjct  600   EGTNIMPYRNLMGTQLLHDLA  620



>ref|XP_010089065.1| Homeobox protein BEL1-like protein [Morus notabilis]
 gb|EXB37312.1| Homeobox protein BEL1-like protein [Morus notabilis]
Length=678

 Score =   459 bits (1182),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 284/494 (57%), Positives = 338/494 (68%), Gaps = 75/494 (15%)
 Frame = -2

Query  1545  HDEDDRFLGKPEN--LGHPSQDY----FFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKR  1384
             H     FLGK  N  L HP Q       F +R+S+YLGPAQELL EFC +GT Q++  K+
Sbjct  190   HHNHHAFLGKSPNHLLLHPHQQVSAGQAFHLRNSRYLGPAQELLSEFCSLGTKQTELQKQ  249

Query  1383  KSQWQ------QDDH----TTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQ  1234
             KS  +      QDD      +SS+   L SL F+ELQK K+KLL +L+EV+RRYK+Y DQ
Sbjct  250   KSSQKNKQLEDQDDSNNNGASSSKKQLLYSLEFVELQKRKTKLLSMLEEVERRYKNYCDQ  309

Query  1233  MTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAP  1054
             M AVVSSFEAVAG GAATVYSALAS+ MSRHFRCL+D I++Q++A +KAM EK+ +   P
Sbjct  310   MRAVVSSFEAVAGAGAATVYSALASKAMSRHFRCLKDGIVSQIQATRKAMGEKDVAV--P  367

Query  1053  GATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPY  874
             G ++GETPRL+ +DQ LRQQ+A QQ++MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPY
Sbjct  368   GTSRGETPRLRALDQALRQQRAFQQMSMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPY  427

Query  873   PSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKE----QDNIMGSSDG  706
             PSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMY+EE KE     +NI  SSDG
Sbjct  428   PSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYVEETKEPSDANNNIGSSSDG  487

Query  705   SRAAVDGGSGRER------LDKKPNV---VRLDSECISSLINIPAKAGG-----------  586
                 + G   R+        D+KP V   VR+DSEC+SS++  P K              
Sbjct  488   VTMEL-GDPSRQTSRNPPDQDQKPTVDQLVRIDSECLSSIVINPDKTDMRSSSKSLQIRP  546

Query  585   -------------DHHQFGAVELDFSP-------------YTHNSGGAVGYRPGERKTgg  484
                              FG VELDFS              Y++++  A+G+       GG
Sbjct  547   SMQVQRQQNFDRFSETAFGTVELDFSSYNQHQPSTAGTVLYSNDNANAIGF--NNGGGGG  604

Query  483   ggGVSLTLGLQQHGGS--GIGLAFSPTSQNSLFYPRD-QIGDC-PPVQYSLLDGEGQNLP  316
             GGGVSLTLGLQQH G+  G+ LAFSP SQ+SLFY RD +I +C P VQYSLLDGEGQNLP
Sbjct  605   GGGVSLTLGLQQHAGANHGVSLAFSPASQSSLFYTRDHEIDECQPAVQYSLLDGEGQNLP  664

Query  315   YRNLMGSQLLHDLA  274
             YRNLMG+QLLHDLA
Sbjct  665   YRNLMGAQLLHDLA  678



>ref|XP_007160096.1| hypothetical protein PHAVU_002G292000g [Phaseolus vulgaris]
 gb|ESW32090.1| hypothetical protein PHAVU_002G292000g [Phaseolus vulgaris]
Length=647

 Score =   457 bits (1176),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 261/434 (60%), Positives = 318/434 (73%), Gaps = 51/434 (12%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRK----SQWQQDDHTT-SSQNHSLGSLHF  1315
             F I++SK+L PAQ LL EFC +GT ++D  K+K    ++W++ ++   SS+NHSL SL F
Sbjct  233   FLIKNSKFLVPAQLLLNEFCSLGTKENDVQKQKHSQKNKWEEGNNGGGSSKNHSLSSLEF  292

Query  1314  LELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFR  1135
             +ELQK K++LL +L+EVDRRYKHY +QM  VVSSFEAVAG+GAATVYSALA R MSRHFR
Sbjct  293   VELQKRKTRLLSMLEEVDRRYKHYCNQMKGVVSSFEAVAGNGAATVYSALALRAMSRHFR  352

Query  1134  CLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHP  955
             CL+D I+ Q++A +KAM EK+  +  PG T+GETPRLK+ID++LRQQ+A QQ++MM++HP
Sbjct  353   CLKDGIMDQIQATRKAMGEKDPVA--PGTTRGETPRLKIIDRSLRQQRAFQQISMMETHP  410

Query  954   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  775
             WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK
Sbjct  411   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  470

Query  774   PMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPN---VVRLDSECISSLINI  604
             PMVEEMYLEE KE  N + SS+G  A  +G     R D+KP    ++R+DSE +SS++  
Sbjct  471   PMVEEMYLEEEKEHQNDVASSEGGGANPEGDQNAPREDQKPTQARLLRIDSESVSSMVTS  530

Query  603   ------------------------PAKAGGDHHQFGAVELDFSPYTHNSGGAVGYRPGER  496
                                     PA+A      FG+VELDFS Y  +S           
Sbjct  531   TDHKNDTKSGKGLQNDNQLNDSSHPAEA------FGSVELDFSSYAQHS-----------  573

Query  495   KTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLP  316
                 GGGVSLTLGLQQ G S + LAF P +Q+S+FY RDQI +C  VQYSLLDGEGQN+P
Sbjct  574   SGVVGGGVSLTLGLQQQGESVVSLAFPPATQSSMFYARDQIEECQTVQYSLLDGEGQNMP  633

Query  315   YRNLMGSQLLHDLA  274
             YRNLMG+QLLHDL 
Sbjct  634   YRNLMGTQLLHDLV  647


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 45/70 (64%), Gaps = 6/70 (9%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSDSAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQA  1807
             +S  M ++TG +YSD + N+     H+M+ +Q F  +PE++NL++GME M+GF  KNL  
Sbjct  9     KSKDMGSSTGLFYSDVSSNSPTLQPHLMNHIQGFVTDPEMFNLTTGME-MIGFS-KNLHP  66

Query  1806  QSD----MWK  1789
              S+    MWK
Sbjct  67    HSESNGVMWK  76



>ref|XP_010934930.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
Length=575

 Score =   444 bits (1142),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 283/590 (48%), Positives = 369/590 (63%), Gaps = 81/590 (14%)
 Frame = -2

Query  1896  LQSFEPNPEIYNLSSGMEMMVGFPFKNLQAQSDMWKP-VPLSHSENMvaggggapvlggg  1720
             +QSFE N E++ L  GMEM+ G   K+    S++W+  +P    E           +   
Sbjct  19    MQSFESNQELFGLQGGMEML-GATSKH--QTSNLWRGFMPRDFPEASSKNLMVTTEMVAS  75

Query  1719  gwaVEGNNNSNEM-----KVSITQKGLSLSL-SSTNPSAIGFNSF----DDLRLMaasss  1570
                 + +++S        +   + +GLSLSL +  N  AIG        D   ++ + ++
Sbjct  76    ASPWQVDDSSLRSLFPCEETEQSNRGLSLSLFNPKNSDAIGVPQACYQSDSRDVLLSRAA  135

Query  1569  sSRLNNIQHDEDDRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEP  1390
             SS    +   E   F        +P Q   FQ+++SKYLGPA+ELL EFC +G   S + 
Sbjct  136   SSHQQQVFMQEGRGF--------NPQQP--FQLKNSKYLGPAKELLNEFCNLGAEISSKK  185

Query  1389  K--RKSQWQQDDHTTS----SQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMT  1228
             +  + SQW++   ++S    ++N  L S+  LELQ+ K+KLL +L+EVDRRY+ Y DQM 
Sbjct  186   RSQKASQWEEGGPSSSSSSWNRNQPLNSMDLLELQRRKAKLLAMLEEVDRRYRKYCDQMR  245

Query  1227  AVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGA  1048
             AVVSSFEAVA +GAATVYS LAS+ MSRHFRCLRD I+ Q++A +KA+ EK++ +  PG 
Sbjct  246   AVVSSFEAVAREGAATVYSTLASKAMSRHFRCLRDGIVGQIRATRKAIGEKDTVA--PGT  303

Query  1047  TKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPS  868
             T+GETPRLK++DQ +RQQKA QQ  M+D HPWRPQRGLPERSVS+LRAWLFEHFLHPYP+
Sbjct  304   TRGETPRLKLVDQCIRQQKAFQQAGMLDGHPWRPQRGLPERSVSILRAWLFEHFLHPYPN  363

Query  867   DVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVD  688
             DVDKHILARQTGLSRSQVSNWFINARVRLWKPMVE+MYLEEVKEQ++   SS+ +     
Sbjct  364   DVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEDMYLEEVKEQNS--QSSNATTTGQQ  421

Query  687   GGSGRE-----RLDKKPNVVRL--DSECISSLIN----------IPAKAGGDHHQ-----  574
               + R+      LD+KP  V+L  DS+ +SS+IN            A+A   H Q     
Sbjct  422   DNTNRKPNPDPVLDQKPAPVQLLNDSDSLSSIINSSHQSDPKNTANARASQHHTQQHQVP  481

Query  573   ----FGAVELDFSPY----THNSGGAVGYRPGERKTggggGVSLTLGLQQHGGSGIGLAF  418
                 FG   LDF PY    + N GG                VSLTLGLQQH G G+ L+F
Sbjct  482   RAESFGVASLDF-PYGSCGSQNLGGG---------------VSLTLGLQQHSGGGMSLSF  525

Query  417   SPTSQNSLFYPRDQI-GDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             SP SQ+SL + R+ I  D   VQ+++LDGE Q LPYRN+MG+QLLHDLAG
Sbjct  526   SPASQHSLLFSREHIDDDGQQVQFTILDGEAQTLPYRNMMGAQLLHDLAG  575



>ref|XP_008807227.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
 ref|XP_008807228.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
Length=607

 Score =   441 bits (1134),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 281/604 (47%), Positives = 356/604 (59%), Gaps = 84/604 (14%)
 Frame = -2

Query  1902  SQLQSFEPNPEIYNLSSGMEMM-VGFPFKNLQAQSDMWKPVPLSHSENMvaggggapvlg  1726
             S +QSFEPN E+Y+L +GMEM+  GF  K   + S +   +  S +EN++     A    
Sbjct  28    SMIQSFEPNQELYSLQAGMEMLGRGFFPKVGSSSSSIGGELSQSPNENLMVTAETAATST  87

Query  1725  gggwaVEGN---NNSNEMKVSI-------TQKGLSLSLSSTNPSAIGFNSFDDLRLMaas  1576
                     N      N ++  +         +GLSLSL +  PS       + +  M   
Sbjct  88    MLNLWQRSNRMLGEDNSLRCLLPTEGNQQPNQGLSLSLCNPEPS-------EAIAGMEQP  140

Query  1575  sssSRLNNIQHDE---DDRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVG--  1411
                  L+    DE      ++ +   L   S     Q++ SKYL PAQELL EFC +G  
Sbjct  141   FRQQHLSANSRDELFPKSTYVLEDRRLFPQSYQQVQQLKHSKYLIPAQELLNEFCSLGRG  200

Query  1410  -TTQSDEPKRKSQWQQ-DDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRD  1237
              ++   +  + +QW++    + SS N SL SL  +ELQK K++LL +L+EVDRRYK Y +
Sbjct  201   SSSSKHKSHKTNQWEEGGSSSNSSWNQSLCSLDIIELQKRKAELLSMLEEVDRRYKKYCE  260

Query  1236  QMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaA  1057
             QM  VV SFEAVAG+GAA VYS LAS+ MS+HFRCLRD I+ Q+   +   A  +    A
Sbjct  261   QMRTVVLSFEAVAGEGAAMVYSTLASKAMSKHFRCLRDGIVGQI--QETKKAMGDKDPVA  318

Query  1056  PGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHP  877
             PG T+GETPRLK++DQ LRQQKA QQ  +M+SHPWRPQRGLPERSVS+LR+WLFEHFLHP
Sbjct  319   PGTTRGETPRLKLLDQCLRQQKAFQQPGLMESHPWRPQRGLPERSVSILRSWLFEHFLHP  378

Query  876   YPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQD----NIMGSSD  709
             YPSDVDKHILARQTGLSRSQV+NWFINARVRLWKPMVEEMYLEE KEQD    N   S+D
Sbjct  379   YPSDVDKHILARQTGLSRSQVNNWFINARVRLWKPMVEEMYLEETKEQDKQTSNGENSND  438

Query  708   GSRAAVDGGSGR-----------ERLDKKPNVVRL--DSECISSLIN-------------  607
              +    +  S R              D+KP   +L  DS+ +SS+IN             
Sbjct  439   NNARTGELQSNRNPNPNSSSLQSHAEDQKPTPGQLLNDSDSLSSIINSSHHRADARDPTS  498

Query  606   --IPAKAGGDHH------QFGAVELDFSPY----THNSGGAVGYRPGERKTggggGVSLT  463
                P      HH       FGAV+LDF+ Y     HN GG                VSLT
Sbjct  499   SKFPYHDARRHHPVPRAENFGAVDLDFTSYGECSNHNFGGG---------------VSLT  543

Query  462   LGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLH  283
             LGLQQH G G+ L+FSP SQ+ L +  +Q+ DC P Q+S++DGE QNLPYRNLMG+Q+LH
Sbjct  544   LGLQQHSGRGMSLSFSPASQHPLLFSGEQMEDCQPSQFSIIDGEAQNLPYRNLMGAQMLH  603

Query  282   DLAG  271
             DLAG
Sbjct  604   DLAG  607



>ref|XP_008796900.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
Length=571

 Score =   436 bits (1121),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 284/597 (48%), Positives = 366/597 (61%), Gaps = 87/597 (15%)
 Frame = -2

Query  1917  SGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQAQSDMWKP-VPLSHSENMvagggg  1741
             +GH    +QSFEPN E+Y L  GMEM+ G P K+    S++W+  VP    E        
Sbjct  14    AGHQA--MQSFEPNQELYGLQGGMEML-GAPSKH--QSSNLWRGFVPRDFPEASSKNFMV  68

Query  1740  apvlggggwaVEGNNNSNEMKVSITQ-----KGLSLSLSSTNPS-AIGFNSFDDLRLMaa  1579
                        + +++S        +     +GLSLSL +  PS AIG            
Sbjct  69    TTETVAPASPWQVDDSSLRSLFPCEETGQPNRGLSLSLFNPKPSDAIGVPP---------  119

Query  1578  ssssSRLNNIQHDEDDRFLGKPENLGHPSQDYF-----------FQIRSSKYLGPAQELL  1432
                    +  Q D  D  L +  +  H  Q +            FQ+++SKYLGPA+ELL
Sbjct  120   -------SCYQSDSRDGLLSRAAS-SHQQQIFMQEGRGFDSHQPFQLKNSKYLGPAKELL  171

Query  1431  KEFCCVG--TTQSDEPKRKSQWQQDDHTTSSQ--NHSLGSLHFLELQKTKSKLLHLLDEV  1264
              EFC +G   + S   ++ SQW++   ++SS   +  L S+  LELQ+ ++KLL +L+EV
Sbjct  172   TEFCNLGGEISSSKRSQKASQWEEGGPSSSSSSWHQPLNSMDPLELQRRRAKLLSMLEEV  231

Query  1263  DRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkam  1084
             DRRY+ Y +QM AVVSSFEAVAG GAAT YS LAS+ MSRHFRCLRD I+ Q++AA+KA+
Sbjct  232   DRRYRKYCEQMRAVVSSFEAVAGKGAATFYSTLASKAMSRHFRCLRDGIVGQIRAAEKAI  291

Query  1083  aekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRA  904
              EK++ +  PG TKGETPRLK++DQ LRQQKA  Q  M++ HPWRPQRGLPERSVS+LRA
Sbjct  292   GEKDAVA--PGTTKGETPRLKLLDQCLRQQKAFHQAGMLEDHPWRPQRGLPERSVSILRA  349

Query  903   WLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDN-  727
             WLFEHFLHPYP+DVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMY+EE KEQ++ 
Sbjct  350   WLFEHFLHPYPTDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYMEETKEQNSQ  409

Query  726   ----IMGSSDGSRAAVDGGSGRERLDKKPNVVRL--DSECISSLI----------NIPAK  595
                   G  D +    +   G   LD+KP  V+L  DS+ +SS+I           + AK
Sbjct  410   SSNATTGQQDDANPNPNLNPG---LDQKPAPVQLLNDSDSLSSIINSSHHSDQKNTMNAK  466

Query  594   AGGDH---HQ------FGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQHG  442
             A  DH   HQ      FG   LDFS   ++  G+     G         VSLTLGLQQH 
Sbjct  467   ASRDHNPQHQVPRTESFGVSNLDFS---YSGCGSRNLGSG---------VSLTLGLQQHS  514

Query  441   GSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             G G+ L+FSP+SQ+SL +  + + D   VQ+++LDGE Q +PYRN+MG+QLLHDLAG
Sbjct  515   GGGMSLSFSPSSQHSLLFSGEHVDDGQQVQFAILDGEAQTVPYRNMMGAQLLHDLAG  571



>ref|XP_010933991.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
 ref|XP_010933992.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
 ref|XP_010933993.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
Length=596

 Score =   437 bits (1123),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 292/600 (49%), Positives = 364/600 (61%), Gaps = 87/600 (15%)
 Frame = -2

Query  1902  SQLQSFEPNPEIYNLSSGMEMM-VGFPFKNLQAQSDMWKPVPLSHSENMvaggggapvlg  1726
             S +QSFEPN E+Y+L +GMEM+  GF  K   + S +   +  S +EN++     A    
Sbjct  28    SMIQSFEPNQELYSLQAGMEMLGRGFFPKVGSSSSSIGGELSHSSNENLMVTAETAVTAT  87

Query  1725  gggwaVEGNNNSNEMKVSITQ--------------KGLSLSLSSTNPS-AIG--FNSFDD  1597
                        SN M V  +               +GLSLSL +  PS AI    ++F  
Sbjct  88    MMNSW----QRSNRMLVEDSSLRCLLPTDGNQQPSQGLSLSLCNPEPSEAIDGMEHAFRQ  143

Query  1596  LRLMaassssSRLNNIQHDEDDRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCC  1417
               L +  +           ED R   +       S     Q++ SKYL PAQELL EFC 
Sbjct  144   QHLFSKPTEVL--------EDRRLFPQ-------SHQQVQQLKHSKYLTPAQELLNEFCS  188

Query  1416  VGT---TQSDEPKRKSQWQQD-DHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYK  1249
             +G    +   +  + +QW++    + SS N SL SL  +ELQK K++L  +L+EVDRRYK
Sbjct  189   LGAGSSSSKHKSHKTNQWEEGGSSSNSSWNQSLYSLDIIELQKRKAELSSMLEEVDRRYK  248

Query  1248  HYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekes  1069
              Y +QM  VVSSFEAVAG+GAA VYS LAS+ MS+HFRCLRD I+ Q++  KKAM EK+ 
Sbjct  249   KYCEQMRTVVSSFEAVAGEGAARVYSILASKAMSKHFRCLRDGIVGQIQVTKKAMGEKDP  308

Query  1068  ssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEH  889
              +  PG T+GETPRLK++DQ LRQQKA QQ  MM+SHPWRPQRGLPERSVS+LRAWLFEH
Sbjct  309   VA--PGTTRGETPRLKLLDQCLRQQKAFQQAGMMESHPWRPQRGLPERSVSILRAWLFEH  366

Query  888   FLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQD----NIM  721
             FLHPYPSDVDKHILARQTGLSRSQV+NWFINARVRLWKPMVEEMYLEE+KE+D    N  
Sbjct  367   FLHPYPSDVDKHILARQTGLSRSQVNNWFINARVRLWKPMVEEMYLEEIKEKDRQTPNEE  426

Query  720   GSSDGSRAAVDGGSGRERL-----DKKPNVVRL--DSECISSLINIP--AKAGGD-----  583
              S+D +    +       L     D+KP + +L  DS+ +SS++N       G D     
Sbjct  427   NSNDNNPGPGNPNPNSSSLQLLAEDQKPTLGQLLNDSDSLSSIVNSSHHRTDGRDPTNNK  486

Query  582   ---------HH-------QFGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQ  451
                      HH        FG V+LDF+ Y   S    G          GGGVSLTLGLQ
Sbjct  487   ISYRDPRRPHHPAVPRAENFGVVDLDFTSYGECSNPNFG----------GGGVSLTLGLQ  536

Query  450   QHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             QH G G+ L+FSP SQ+SL + R+Q+ DC P Q+S+LDGE QNLPYRNLM +QLLHDLAG
Sbjct  537   QHNGGGMSLSFSPASQHSLLFSREQMEDCQPGQFSILDGEAQNLPYRNLMEAQLLHDLAG  596



>ref|XP_004503684.1| PREDICTED: homeobox protein BEL1 homolog [Cicer arietinum]
Length=604

 Score =   436 bits (1121),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 251/438 (57%), Positives = 308/438 (70%), Gaps = 44/438 (10%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDE---------PKRKSQWQQDDHTTSSQ---NH  1336
             F +++SK+L PAQELL EFC +GTT+ ++          K K  W++D++  SS     H
Sbjct  175   FVLKNSKFLAPAQELLNEFCSLGTTKQNDVGLVQKQKSQKYKQGWEEDNNNGSSSSSIKH  234

Query  1335  SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASR  1156
             SL S+ F+ELQK K+KLL +L+EVDRRYKHY +QM +VV SFEAVAG+GAA VYSALA +
Sbjct  235   SLTSIEFVELQKRKTKLLSMLEEVDRRYKHYSNQMKSVVCSFEAVAGNGAAKVYSALALK  294

Query  1155  VMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQL  976
              MSRHFRCL+D IL Q++  +KAM EK+  +  PG TKGETPRLK++D+ LRQQ+A QQ+
Sbjct  295   AMSRHFRCLKDGILEQIETTRKAMGEKDPVA--PGTTKGETPRLKILDRVLRQQRAFQQI  352

Query  975   TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFIN  796
              MM++HPWRPQRGLPERSVS+LRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFIN
Sbjct  353   NMMETHPWRPQRGLPERSVSILRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFIN  412

Query  795   ARVRLWKPMVEEMYLEEVKEQDNIMGSSDGS------RAAVDGGSGRERLDKKPNVVRLD  634
             ARVRLWKPMVEEMYLEE KEQ     +S+G           +    +   D+KP +VR++
Sbjct  413   ARVRLWKPMVEEMYLEEEKEQQRKTTTSEGGNNEENINVIQNQSPTQAHEDEKPRLVRIN  472

Query  633   SECISSLINIPAKAGGDHHQ--------------FGAVELDFSPYTHNSGGAVGYRPGER  496
             SEC+SS+IN       DH                FG+V++DFS Y H+S     Y   + 
Sbjct  473   SECVSSIIN-----NQDHKNEANKNMNPQLANDTFGSVDIDFSSY-HSSDMVAAYTTSDH  526

Query  495   KTggg--gGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDG-EGQ  325
                     GVSLTLGLQQHGG+G+ LAF  T+Q  +FY RD      PVQYSLLDG +G 
Sbjct  527   NHNFHGGSGVSLTLGLQQHGGNGVSLAFPSTTQTPMFYTRDDDHIEEPVQYSLLDGDQGT  586

Query  324   NL-PYRNLMGSQLLHDLA  274
             N+ PYRNLMG+QLLHDLA
Sbjct  587   NIMPYRNLMGTQLLHDLA  604



>gb|KGN50071.1| hypothetical protein Csa_5G152860 [Cucumis sativus]
Length=606

 Score =   435 bits (1119),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 259/469 (55%), Positives = 310/469 (66%), Gaps = 73/469 (16%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQ--SDEPKRKSQWQQDDHTTSSQNHSLGSLHFLE  1309
              F +R+SK+L P QELL EFC +G T   S  PK K        ++SS N SL SL F+E
Sbjct  146   IFHLRNSKFLAPTQELLYEFCSLGITNHSSSSPKHKHP------SSSSTNFSLHSLDFME  199

Query  1308  LQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCL  1129
             LQK K+KL  +L+EV+RRY+HY +QM AVV+SFEAVAG GAA VYSALAS+ MSRHFR L
Sbjct  200   LQKRKTKLFSMLEEVERRYRHYCEQMKAVVASFEAVAGSGAARVYSALASKAMSRHFRSL  259

Query  1128  RDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWR  949
             +D I+ Q++A +KAM EK+  +  PG T+GETPRL++IDQ LRQQ+A  Q+++M+SHPWR
Sbjct  260   KDGIVGQIQATRKAMGEKDPIA--PGTTRGETPRLRVIDQALRQQRAFHQISIMESHPWR  317

Query  948   PQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPM  769
             PQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPM
Sbjct  318   PQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPM  377

Query  768   VEEMYLEEVKEQDNIM---------GSSDGSRAAVDGGSGRERL-----DKKPN---VVR  640
             VEEMYLEE KEQ+  +          S DG     D   G   +     D+KP    ++R
Sbjct  378   VEEMYLEETKEQEEEIDNSFNNNANNSFDGVTDFNDDIDGHRSIATRLEDQKPTPDQLLR  437

Query  639   LDSECISSLINIPAKAGGDH------------HQ----------------FGAVELDFSP  544
             +DSEC+SS+I+  ++   DH            HQ                FG VELDFS 
Sbjct  438   IDSECLSSIISSNSEKNNDHSRTIKTMQNHHGHQLHGNHNHTFGRVVGDAFGTVELDFSS  497

Query  543   YTHNSG-GAVGYRPGERKTggggG-------VSLTLGLQQH------GGSGIGLAFS---  415
             Y H++G G V Y                   VSLTLGLQQH      G  G+ +AF+   
Sbjct  498   YNHHTGSGGVSYHNSSHNNNNQHFNNGSGGGVSLTLGLQQHAAAGGNGNGGVSIAFASAG  557

Query  414   -PTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
                 QNSLF+ RD + +C PVQYSLLDGE QNLPYRNLMG+QLLHDLAG
Sbjct  558   PAVGQNSLFFTRDHMEECQPVQYSLLDGETQNLPYRNLMGAQLLHDLAG  606



>ref|XP_008437318.1| PREDICTED: LOW QUALITY PROTEIN: homeobox protein BEL1 homolog 
[Cucumis melo]
Length=608

 Score =   427 bits (1099),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 258/469 (55%), Positives = 309/469 (66%), Gaps = 73/469 (16%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQ--SDEPKRKSQWQQDDHTTSSQNHSLGSLHFLE  1309
              F +R+SK+L P QELL EFC +G T   S  PK K        ++SS N SL SL F+E
Sbjct  148   IFHLRNSKFLAPTQELLYEFCSLGITNHSSSSPKHKHP------SSSSTNFSLHSLDFME  201

Query  1308  LQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCL  1129
             LQK K+KL  +L+EV+RRY+HY +QM AVV+SFEAVAG GAA VYSALAS+ MSRHFR L
Sbjct  202   LQKRKTKLFSMLEEVERRYRHYCEQMKAVVASFEAVAGSGAARVYSALASKAMSRHFRSL  261

Query  1128  RDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWR  949
             +D I+ Q++A +KAM EK+  +  PG T+GETPRL++IDQ LRQQ+A  Q+++M+SHPWR
Sbjct  262   KDGIVGQIQATRKAMGEKDPIA--PGTTRGETPRLRVIDQALRQQRAFHQISIMESHPWR  319

Query  948   PQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPM  769
             PQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPM
Sbjct  320   PQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPM  379

Query  768   VEEMYLEEVKEQDNIM---------GSSDGSRAAVDGGSGRERL-----DKKPN---VVR  640
             VEEMYLEE KEQ+  +          S DG     D   G   +     D+KP    ++R
Sbjct  380   VEEMYLEETKEQEEEIDNSFNNNANNSFDGVTDFNDDIDGHRSIATRLEDQKPTPDQLLR  439

Query  639   LDSECISSLINIPAKAGGD------------HHQ----------------FGAVELDFSP  544
             +DSEC+SS+I+  ++                HHQ                FG VELDFS 
Sbjct  440   IDSECLSSIISSNSEKNDHSRTIKTMQNHHGHHQLHGNHNHTFGRVVGDAFGTVELDFSS  499

Query  543   YTHNSG-GAVGYRPGERKTggggG-------VSLTLGLQQH------GGSGIGLAFS---  415
             Y H++G G V Y                   VSLTLGLQQH      G  G+ +AF+   
Sbjct  500   YNHHTGSGGVSYHNSSNNNNSQHFNNGSGGGVSLTLGLQQHAAAGGNGNGGVSIAFASAG  559

Query  414   -PTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
                 QNSLF+ RD + +C PVQYSLLDGE QNLPYRNLMG+QLLHDLAG
Sbjct  560   PAVGQNSLFFTRDHMEECQPVQYSLLDGETQNLPYRNLMGAQLLHDLAG  608



>ref|XP_010919091.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
 ref|XP_010919093.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
 ref|XP_010919094.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
Length=599

 Score =   426 bits (1094),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 279/613 (46%), Positives = 356/613 (58%), Gaps = 110/613 (18%)
 Frame = -2

Query  1902  SQLQSFEPNPEIYNLSSGMEMM-VGFPFKNLQAQSDMWKPVPLSHSENMvaggggapvlg  1726
             S +QSFE N E+Y+L +GMEM+  GF    +     +  P   S +EN++          
Sbjct  28    SNIQSFESNQELYSLQAGMEMLGRGF----IPKAGGLICP---SSNENLMVTPAETAATT  80

Query  1725  gggwaVEGNNN---------------SNEMKVSITQKGLSLSLSSTNPSAIGFNSFDDLR  1591
                 + +  N                SN+  +    +GLSLSL +  PS       + + 
Sbjct  81    TTMNSWQHPNRMLVEDSSLRCLFPNGSNQQPI----RGLSLSLCNPEPS-------ESIA  129

Query  1590  LMaassssSRLNNIQHDE----------DDRFLGKPENLGHPSQDYF---FQIRSSKYLG  1450
              M        L     DE          D RF           Q ++    QI+S K+L 
Sbjct  130   GMEQPILQQHLPTNSRDELFPKSTDLLQDRRFF----------QQFYQQPRQIKSFKFLI  179

Query  1449  PAQELLKEFCCVGTTQSDEPKRK---SQWQQDDHTT-SSQNHSLGSLHFLELQKTKSKLL  1282
             PA+ELL EFC +G   +   ++    +QW++   ++ +S+N SL S   LEL+K K+KLL
Sbjct  180   PARELLNEFCSLGGADNSSKQKSCKANQWEEGGSSSGASRNQSLYSSDVLELKKRKAKLL  239

Query  1281  HLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLk  1102
              +L+EVDRRYK Y +QM AVVSSFEAVAG+GAATVYS LAS+ MS+HFRCL+D I+ Q++
Sbjct  240   SMLEEVDRRYKKYCEQMRAVVSSFEAVAGEGAATVYSMLASKAMSKHFRCLKDGIVGQIQ  299

Query  1101  aakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERS  922
             A KKAM EK+  +  PG T+GETPRLK++DQ LRQQKA QQ+  M+S PWRPQRGLPE S
Sbjct  300   ATKKAMGEKDPVA--PGTTRGETPRLKLLDQCLRQQKAFQQVGTMESCPWRPQRGLPECS  357

Query  921   VSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEV  742
             VS+LRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEE+
Sbjct  358   VSILRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEI  417

Query  741   KEQDNIMG-SSDGSRAAVDGGSGRERLDKKPN----VVRLD--------------SECIS  619
             KE+D       +      D   G    ++ PN     ++L               S+ +S
Sbjct  418   KEKDKQTAQEEEEEEEEEDNRPGEIHSNRNPNPNSSSLQLHVEDQKPAPGELLNYSDSLS  477

Query  618   SLINI---------PAKAGGDHH--------QFGAVELDFSPYTHNSGGAVGYRPGERKT  490
             S++N          P  +   +H          GA+ LDF+ Y   S    G        
Sbjct  478   SIVNSSHHRADGREPTNSKSSYHYPRQHHPVPIGAMVLDFTSYGECSNQNFG--------  529

Query  489   ggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYR  310
                 GVSLTLGLQQH   G+ L+FSP SQ+SLF+ R Q+ DC P Q+S+LDGE QNLPYR
Sbjct  530   ---DGVSLTLGLQQHNEGGMSLSFSPASQHSLFFSRAQMEDCQPGQFSILDGETQNLPYR  586

Query  309   NLMGSQLLHDLAG  271
             NLMG+QLLHDLAG
Sbjct  587   NLMGAQLLHDLAG  599



>ref|XP_008783445.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
 ref|XP_008783446.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
 ref|XP_008783447.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
Length=607

 Score =   422 bits (1085),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 284/611 (46%), Positives = 353/611 (58%), Gaps = 98/611 (16%)
 Frame = -2

Query  1902  SQLQSFEPNPEIYNLSSGMEMM-VGFPFKNLQAQSDMWKPVPLSHSENMvaggggapvlg  1726
             S +QSFE N E+Y+L +GMEM+  GF  K   + S +      S +EN++     A    
Sbjct  28    SNIQSFESNQELYSLRAGMEMLGRGFIPKVGGSSSGIGGGFCQSSNENLMVSAETAGTTT  87

Query  1725  gggwaVEGN--------------NNSNEMKVSITQKGLSLSLSSTNPSAIGFNSFDDLRL  1588
                     N              N +N+  +    +GLSLSL +  PS       + +  
Sbjct  88    TVNSWQHPNRMLVEDPSLRCLFPNVANQQPI----RGLSLSLCNPEPS-------ESIAG  136

Query  1587  MaassssSRLNNIQHDE----------DDRFLGKPENLGHPSQDYFFQIRSSKYLGPAQE  1438
             M        L     DE          D RF  +       S     Q++SSK+L PAQE
Sbjct  137   MEQPILQQHLPTNSTDELFPKSAALLQDRRFFQQ-------SYQQPRQLKSSKFLIPAQE  189

Query  1437  LLKEFCCVG---TTQSDEPKRKSQWQQD-DHTTSSQNHSLGSLHFLELQKTKSKLLHLLD  1270
             LL EFC +G    +   +  + +QW++    + SS+N SL S   LELQK K+KLL +L+
Sbjct  190   LLNEFCSLGGAGNSSKQKSYKANQWEEGGSSSNSSRNQSLYSSDVLELQKRKAKLLSMLE  249

Query  1269  EVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakk  1090
             EVDRRYK Y +QM AVVSSFEAVAG+GAA+VYS LAS+ MS+HFRCL+D I+ Q++A KK
Sbjct  250   EVDRRYKKYCEQMRAVVSSFEAVAGEGAASVYSMLASKAMSKHFRCLKDGIVGQIRAIKK  309

Query  1089  amaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVL  910
             AM EK+  +  PG  +GETPRLK+IDQ LRQQKA QQ   M+S PWRPQRGLPE SVS+L
Sbjct  310   AMGEKDPVA--PGTIRGETPRLKLIDQCLRQQKAFQQAGTMESCPWRPQRGLPECSVSIL  367

Query  909   RAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQD  730
             RAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMY EE+KEQD
Sbjct  368   RAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYSEEIKEQD  427

Query  729   NIMGSSDG------------SRAAVDGGSGRERL---DKKPNVVRL--DSECISSLINI-  604
                   +             S+   +  S   +L   D+KP    L   S+ +SS++N  
Sbjct  428   KQTSQEENNGHNNCRPGELQSKRNPNPNSSSLQLHAEDQKPTPGELLNCSDSLSSIVNSS  487

Query  603   --------PAKAGGDHH------------QFGAVELDFSPYTHNSGGAVGYRPGERKTgg  484
                     P       H             FG ++LDF+ Y   S    G          
Sbjct  488   HHCTNGRDPTDGKSSFHDPRQHHPVPRAENFGVMDLDFTSYGECSNQNFG----------  537

Query  483   ggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNL  304
               GVSLTLGLQQH    + L+FSP SQ+SLF+ R Q+ DC P Q+S+LDGE QNLPYRNL
Sbjct  538   -DGVSLTLGLQQHNEGAMSLSFSPASQHSLFFSRAQMEDCQPGQFSILDGEAQNLPYRNL  596

Query  303   MGSQLLHDLAG  271
             MG+QLLHDLAG
Sbjct  597   MGAQLLHDLAG  607



>gb|EPS58139.1| hypothetical protein M569_16677, partial [Genlisea aurea]
Length=459

 Score =   412 bits (1059),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 245/490 (50%), Positives = 310/490 (63%), Gaps = 81/490 (17%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDEDDRF---LGKPENLGHPS  1492
             +GLSLSL+S+NP+AIG   F+ LR               H  D RF        +     
Sbjct  25    QGLSLSLNSSNPAAIGVQPFE-LRQ-------------HHHHDSRFGQAASSRSSQVSVQ  70

Query  1491  QDYFFQIRSSKYLGPAQELLKEFC-CVGTTQSDEPKRKSQWQQDDHTTSSQNHSLGSLHF  1315
                F  +R+SKYLGPAQ+LL +FC   G  +S++  +  +  + +   +    +L SL  
Sbjct  71    TQTFSLLRNSKYLGPAQDLLNQFCNLAGDAESEKTLKSYKNTETEEEDAVNRQALYSLDV  130

Query  1314  LELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFR  1135
             +ELQ+ KSKLL +LDEVD RY+HY DQM AV +SFEA+AGDGAA VYS +AS+ MSRHFR
Sbjct  131   IELQRRKSKLLQMLDEVDNRYRHYCDQMKAVNASFEAIAGDGAARVYSRMASKAMSRHFR  190

Query  1134  CLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHP  955
             CLRD I  Q+++ +KAM EK+      G +KGETPRL+++DQTLRQQ+A+QQ++MM++HP
Sbjct  191   CLRDGIAMQIRSVRKAMGEKDC-----GMSKGETPRLRLLDQTLRQQRALQQMSMMETHP  245

Query  954   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  775
             WRPQRGLPER+VS+LRAWLFEHFLHPYP DVDKHILARQTGLSRSQVSNWFINARVRLWK
Sbjct  246   WRPQRGLPERAVSMLRAWLFEHFLHPYPCDVDKHILARQTGLSRSQVSNWFINARVRLWK  305

Query  774   PMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKP---NVVRLDSECISSLINI  604
             PMVEEMY EE+KE +                +G++  D+KP   +  R DSEC+SS+IN 
Sbjct  306   PMVEEMYREELKESE----------------TGQKDPDQKPTRQHFRRTDSECLSSIINA  349

Query  603   PAKAGGD---------HHQFGA---------VELDFSPYTHNSGGAVGYRPGERKTgggg  478
               K GG          H    A         +E+DFS Y H                   
Sbjct  350   DDKNGGQRKNKEAAAIHQNLTAFSSSSYGPQMEMDFSSYAHRQPTG--------------  395

Query  477   GVSLTLGLQQHG-GSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLM  301
              VSLTLGL QH  G G GL F P +  ++F   +Q+ +C   Q++LL+ E Q LPYRNLM
Sbjct  396   -VSLTLGLHQHAGGGGGGLTFLPPA--AVF---EQMEECQNQQFTLLESENQTLPYRNLM  449

Query  300   GSQLLHDLAG  271
             G+QLLHDLAG
Sbjct  450   GAQLLHDLAG  459



>ref|XP_010941166.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
Length=573

 Score =   409 bits (1052),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 241/436 (55%), Positives = 296/436 (68%), Gaps = 51/436 (12%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQ-----NHSLGSLHF  1315
             FQ+++SKYL PA+ELL EFC +G   S + + +   Q ++   SS      N SL S+  
Sbjct  156   FQLKNSKYLIPAKELLNEFCSLGGEISSKKRSQKASQGEEGGPSSSSSSLWNQSLNSMDL  215

Query  1314  LELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFR  1135
             LELQ+ K+KLL +L+EVDR Y+ Y  QM  VVSSFEAVAG+GAATVYS LAS+ MSRHFR
Sbjct  216   LELQRRKAKLLSMLEEVDRGYRKYCKQMRVVVSSFEAVAGEGAATVYSRLASKAMSRHFR  275

Query  1134  CLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHP  955
             CLRD I+ Q++A KKA+ EK+S +   G T+GETPRLK++DQ LRQ+KA QQ  MM+SHP
Sbjct  276   CLRDGIVGQIRAMKKAIGEKDSIAL--GTTRGETPRLKLLDQCLRQEKAFQQAGMMESHP  333

Query  954   WRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  775
             WRPQRGLPERSV++LRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK
Sbjct  334   WRPQRGLPERSVTILRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWK  393

Query  774   PMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRER-------LDKKPNVVRL--DSECI  622
             PM+EEMY +E+ E +N       S AA        R       L++KP   +L  DS+ +
Sbjct  394   PMIEEMYSQEMNEHNN-----QSSHAATSHEDNTNRNPNHNFSLNQKPAPGQLLNDSDSL  448

Query  621   SSL----------INIPAKAGGDH---HQ------FGAVELDFSPYTHNSGGAVGYRPGE  499
             SS+            I  K   DH   HQ      FGAV  D S Y+  S G    R G 
Sbjct  449   SSIINSSHHSDEKATINVKTSQDHNPEHQVPRTESFGAVGRDISSYS--SCGNQNLRSG-  505

Query  498   RKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNL  319
                     VSLTLGLQQ+ G G+ L+FSP SQ+SL + R+ + D   VQ+S+LDGE ++L
Sbjct  506   --------VSLTLGLQQNSGVGMSLSFSPASQHSLLFSREHMDDGQQVQFSILDGEARSL  557

Query  318   PYRNLMGSQLLHDLAG  271
             PYRN+MG+QLLHDLAG
Sbjct  558   PYRNMMGAQLLHDLAG  573



>ref|XP_009389789.1| PREDICTED: homeobox protein BEL1 homolog [Musa acuminata subsp. 
malaccensis]
Length=605

 Score =   409 bits (1052),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 244/455 (54%), Positives = 307/455 (67%), Gaps = 43/455 (9%)
 Frame = -2

Query  1545  HDEDDRFLGKPEN---LGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGT----TQSDEPK  1387
             H +D RF     +   L +P Q     ++S+KYL PA+ELL EFC + T    +  D+  
Sbjct  164   HLQDGRFFQSSTSQSALINPYQQSQQPLKSTKYLIPARELLNEFCSLETAVIGSSKDKAS  223

Query  1386  RKSQWQQDDHTTSSQ--NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSS  1213
             +   W++   ++SS   N SL SL   ELQ  K+KLL +L+EVD+RY+ YR+QM AVV S
Sbjct  224   KTKPWEEGGTSSSSISFNQSLYSLDIHELQGRKAKLLSMLEEVDKRYRRYREQMRAVVLS  283

Query  1212  FEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGET  1033
             FEAVAG+GAATVYSALA++VMSRHFRCLRD I+ Q+ A KKAM EK++ +  PG ++GET
Sbjct  284   FEAVAGEGAATVYSALAAKVMSRHFRCLRDGIVGQIDAIKKAMGEKDAVA--PGTSRGET  341

Query  1032  PRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKH  853
             PRLK+IDQ +RQQ+A QQ  MM+SHPWRPQRGLPERSVS+LRAWLFEHFLHPYPSDVDKH
Sbjct  342   PRLKLIDQCIRQQRAFQQAGMMESHPWRPQRGLPERSVSILRAWLFEHFLHPYPSDVDKH  401

Query  852   ILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIM------GSSDG-SRAA  694
             ILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEE KEQ+N         SSD  +R  
Sbjct  402   ILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEETKEQENQTSQEENYNSSDNVNRNL  461

Query  693   VDGGSGRERL-DKKPNVVRLDSE--CISSLINIP---AKAGGDHHQ-------FGAVELD  553
             +      + + D+KP   +L +E   +S +I+      +AG    Q       FG V+LD
Sbjct  462   IYNSCQVDNVEDRKPAPGQLLTEPDSLSWVISNSDGRERAGSKSSQNPNASDNFGVVDLD  521

Query  552   FSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTS-QNSLFYPRDQ  376
             F+ Y   S  + G            GVSLTLGLQQH G G+GL+FSP + Q SL + R+Q
Sbjct  522   FTSYNQCSRPSFG-----------SGVSLTLGLQQHNGGGMGLSFSPPAPQPSLLFSREQ  570

Query  375   IGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
             + +C P Q  ++D + QN  YRNL+G+QLL   AG
Sbjct  571   MEECHPSQLPIVDADAQNSAYRNLVGAQLLRHFAG  605



>ref|XP_004143976.1| PREDICTED: homeobox protein BEL1 homolog [Cucumis sativus]
Length=557

 Score =   405 bits (1042),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 240/425 (56%), Positives = 287/425 (68%), Gaps = 65/425 (15%)
 Frame = -2

Query  1356  TTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATV  1177
             ++SS N SL SL F+ELQK K+KL  +L+EV+RRY+HY +QM AVV+SFEAVAG GAA V
Sbjct  135   SSSSTNFSLHSLDFMELQKRKTKLFSMLEEVERRYRHYCEQMKAVVASFEAVAGSGAARV  194

Query  1176  YSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQ  997
             YSALAS+ MSRHFR L+D I+ Q++A +KAM EK+  +  PG T+GETPRL++IDQ LRQ
Sbjct  195   YSALASKAMSRHFRSLKDGIVGQIQATRKAMGEKDPIA--PGTTRGETPRLRVIDQALRQ  252

Query  996   QKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
             Q+A  Q+++M+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ
Sbjct  253   QRAFHQISIMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  312

Query  816   VSNWFINARVRLWKPMVEEMYLEEVKEQDNIM---------GSSDGSRAAVDGGSGRERL  664
             VSNWFINARVRLWKPMVEEMYLEE KEQ+  +          S DG     D   G   +
Sbjct  313   VSNWFINARVRLWKPMVEEMYLEETKEQEEEIDNSFNNNANNSFDGVTDFNDDIDGHRSI  372

Query  663   -----DKKPN---VVRLDSECISSLINIPAKAGGDH------------HQ----------  574
                  D+KP    ++R+DSEC+SS+I+  ++   DH            HQ          
Sbjct  373   ATRLEDQKPTPDQLLRIDSECLSSIISSNSEKNNDHSRTIKTMQNHHGHQLHGNHNHTFG  432

Query  573   ------FGAVELDFSPYTHNSG-GAVGYRPGERKTggggG-------VSLTLGLQQH---  445
                   FG VELDFS Y H++G G V Y                   VSLTLGLQQH   
Sbjct  433   RVVGDAFGTVELDFSSYNHHTGSGGVSYHNSSHNNNNQHFNNGSGGGVSLTLGLQQHAAA  492

Query  444   ---GGSGIGLAFS----PTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLL  286
                G  G+ +AF+       QNSLF+ RD + +C PVQYSLLDGE QNLPYRNLMG+QLL
Sbjct  493   GGNGNGGVSIAFASAGPAVGQNSLFFTRDHMEECQPVQYSLLDGETQNLPYRNLMGAQLL  552

Query  285   HDLAG  271
             HDLAG
Sbjct  553   HDLAG  557



>ref|XP_010676435.1| PREDICTED: homeobox protein BEL1 homolog [Beta vulgaris subsp. 
vulgaris]
Length=731

 Score =   404 bits (1037),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 255/493 (52%), Positives = 306/493 (62%), Gaps = 90/493 (18%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQ-SDEPKRKSQWQQDDHTTSSQNH----------  1336
             F  +R+SKY+GP QELL EFC +GT Q SDE +RK Q  + +                  
Sbjct  239   FELMRNSKYMGPTQELLIEFCNLGTKQNSDESQRKKQPLKKNKEQWEFEEGEEDDDHNNN  298

Query  1335  --------------------SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVS  1216
                                 SL  +  LELQK K+KLL +L+E+D+RYK+Y +QM  VVS
Sbjct  299   NNNTNNASSSSSSRNANTTTSLYGVSLLELQKRKTKLLAMLEELDKRYKNYCEQMKGVVS  358

Query  1215  SFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAP-GATKG  1039
             SFEAVAG  AA VYSALAS+ MSRHFRCLRD+I+ Q+KA KKAM EK+S++A   G T+G
Sbjct  359   SFEAVAGPKAANVYSALASKAMSRHFRCLRDSIVTQIKATKKAMGEKDSNNATILGTTRG  418

Query  1038  ETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVD  859
             ETPRL+++DQ LRQQ+A QQ+TMM+SHPWRPQRGLPERSVS+LRAWLFEHFLHPYPSDVD
Sbjct  419   ETPRLRILDQNLRQQRAYQQMTMMESHPWRPQRGLPERSVSILRAWLFEHFLHPYPSDVD  478

Query  858   KHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKE-QDNIMGSS----DGSRAA  694
             KHILARQTGL+RSQVSNWFINARVRLWKPMVE+MYLEE KE QD  MGSS    D   + 
Sbjct  479   KHILARQTGLTRSQVSNWFINARVRLWKPMVEQMYLEETKEQQDKNMGSSSDGTDHQLSC  538

Query  693   VDGGSG-------RERLDKKPNVVRLDSECISSLINI------------PAKAGGDHHQF  571
              D   G       +++      ++R+D   +SS++N             P      H QF
Sbjct  539   TDHLGGILPPPPPQDQKPDPDQLIRIDPGSLSSIVNTTTTTTTTSNRDDPQNRINHHLQF  598

Query  570   -------GAVE-------LDF-SPYTHNSGGAVGYRPGERKTg---------------gg  481
                    G VE       LDF S  ++N+       P    T                  
Sbjct  599   QQSSQFIGRVEGFGSMDHLDFPSSSSYNNQQNHHATPFGSNTNDQNDNNTPHQTFGGGNN  658

Query  480   gGVSLTLGLQQHGGSGIGLAFSPTSQN-SLFYPRDQIGDCPPV--QYSLLDG-EGQNLPY  313
               VSLTLGLQQH G+G+ LAFSP SQ  SLFYPRD + DC  V  QYSLLDG +GQNLPY
Sbjct  659   NNVSLTLGLQQHDGNGVSLAFSPASQTASLFYPRDHMDDCQQVHHQYSLLDGDQGQNLPY  718

Query  312   RNLMGSQLLHDLA  274
             RNLMG+Q+L D A
Sbjct  719   RNLMGAQVLQDFA  731



>ref|XP_009384235.1| PREDICTED: homeobox protein BEL1 homolog [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384242.1| PREDICTED: homeobox protein BEL1 homolog [Musa acuminata subsp. 
malaccensis]
Length=558

 Score =   395 bits (1015),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 235/423 (56%), Positives = 283/423 (67%), Gaps = 31/423 (7%)
 Frame = -2

Query  1500  HPSQDYFFQIRSSKYLGPAQELLKEFCCV-GTTQSDEPKRKSQWQQDDHTT--SSQNHSL  1330
             HP Q    Q+R+SK+L PAQELL EFC + G   S     K+  + ++  +  SS N SL
Sbjct  152   HPQQP--LQLRNSKFLRPAQELLSEFCSLRGEISSKRRPNKTSLEDEEKASLSSSWNQSL  209

Query  1329  GSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVM  1150
              S+  LELQK K+KL  ++ EVD+RY+ Y +QM  V +SFEAVAG  AA VYSALA R M
Sbjct  210   HSMDLLELQKIKAKLSSMIAEVDKRYRKYCEQMRTVTASFEAVAGKEAARVYSALAHRAM  269

Query  1149  SRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTM  970
             SRHFRCLRD I+ Q+ AAKKAM EK+ ++A  G T+GETPRLK++D+ +RQQKA  Q  M
Sbjct  270   SRHFRCLRDGIVGQIHAAKKAMGEKDPTAA--GTTRGETPRLKLLDKCIRQQKAFHQ-GM  326

Query  969   MDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINAR  790
             M+  PWRPQRGLPER+VS+LRAWLFEHFLHPYP+DVDKHILARQTGLSRSQVSNWFINAR
Sbjct  327   MEQPPWRPQRGLPERAVSILRAWLFEHFLHPYPNDVDKHILARQTGLSRSQVSNWFINAR  386

Query  789   VRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPNVVRL--DSECISS  616
             VRLWKPMVEEMYLEE KE DN    +       D  +     D+KP   +L  DSE +SS
Sbjct  387   VRLWKPMVEEMYLEETKELDNQSNQAANGPEDSDNPNSNLSFDQKPLPAQLLVDSESLSS  446

Query  615   LINIPAKA-------GGDHHQ-FGAV-ELDFSPYTHNSGGAVGYRPGERKTggggGVSLT  463
             +IN               HHQ FG V +L FS   +NS  +   R G         VSLT
Sbjct  447   IINSGHHGHQRNDLISSTHHQDFGVVGDLGFS---YNSRSSDNSRAG---------VSLT  494

Query  462   LGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLH  283
             LGLQQH G G+  +  P SQ SL + R+ I      Q+S+LDGE +NL YRNLMG+QLLH
Sbjct  495   LGLQQHNGGGMSFSLLPNSQPSLLFSRETIDGDQQAQFSILDGEAENLRYRNLMGAQLLH  554

Query  282   DLA  274
             DLA
Sbjct  555   DLA  557



>ref|XP_008794767.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
 ref|XP_008794768.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
Length=571

 Score =   391 bits (1004),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 238/428 (56%), Positives = 302/428 (71%), Gaps = 38/428 (9%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCV-GTTQSDEPKRK-SQWQQD--DHTTSSQNHSLGSLHFL  1312
             FQ+++SKYL PA+ELL EFC + G   S +  +K SQW++     ++SS N SL S+  L
Sbjct  157   FQLKNSKYLIPAKELLNEFCSLRGEISSKKRSQKASQWEEGGPSSSSSSWNQSLNSMDLL  216

Query  1311  ELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRC  1132
             ELQ+ K+KLL +L+EVDR Y+ Y  QM  VVSSFEA+AG+GAA +YS LAS+ MSRHFRC
Sbjct  217   ELQRRKAKLLSMLEEVDRGYRKYCKQMRVVVSSFEAMAGEGAAAIYSGLASKAMSRHFRC  276

Query  1131  LRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPW  952
             LRDAI+ +++A KKA+ EK+++S  PG T+GETPRLK++DQ LRQ +A QQ  +++SH W
Sbjct  277   LRDAIVGEIRATKKAIGEKDTAS--PGTTRGETPRLKLLDQRLRQHQAFQQAGLIESHSW  334

Query  951   RPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKP  772
             RPQRGLPERSVS+LRAWLFEHFLHPYP+DVDKHILARQ GLSRSQVSNWFINARVRLWKP
Sbjct  335   RPQRGLPERSVSILRAWLFEHFLHPYPNDVDKHILARQAGLSRSQVSNWFINARVRLWKP  394

Query  771   MVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSG---RERLDKKPNVVRL--DSECISSLIN  607
             MVEEMY E++KEQDN+   +  S    +  S       L +KP   +L  DS+ +SS+IN
Sbjct  395   MVEEMYSEDMKEQDNLSSHAATSHQDNNTSSNPNHNSSLSQKPAPGQLLNDSDSLSSIIN  454

Query  606   ----------IPAKAGGDHH------QFGAVELDFSPYTHNSGGAVGYRPGERKTggggG  475
                       + A+A   H+       FG VELD S Y   S G    R G         
Sbjct  455   GSHRSDGKNTVNAEASQRHNPQQQAENFGVVELDISSY--GSCGNQNLRGG---------  503

Query  474   VSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGS  295
             VSLTLGLQQ+ G+G  L+FSP SQ+SL + R+ I D   +Q+++LDGE + LPYRN+MG+
Sbjct  504   VSLTLGLQQNSGAGKTLSFSPASQHSLLFSREHIDDGQQLQFAILDGEARTLPYRNVMGA  563

Query  294   QLLHDLAG  271
             QLLHDLAG
Sbjct  564   QLLHDLAG  571



>gb|EYU23458.1| hypothetical protein MIMGU_mgv1a002357mg [Erythranthe guttata]
Length=684

 Score =   386 bits (991),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 255/454 (56%), Positives = 307/454 (68%), Gaps = 76/454 (17%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHSLGSLHFLELQKTK  1294
             I +SKYL P QELL EFC +   Q+DE   KS+  +   ++     ++ +L  LELQ+ K
Sbjct  254   ITNSKYLLPTQELLYEFCSL---QTDEIDHKSKPPKPTDSSLVDETAIKTLDLLELQRRK  310

Query  1293  SKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAIL  1114
             +KLL +L+EVDRRYK Y DQM AV+SSFE+ AG+G+A VYS+LASR MSRHFRCLRD I+
Sbjct  311   AKLLQMLEEVDRRYKRYCDQMKAVISSFESTAGNGSARVYSSLASRAMSRHFRCLRDGIV  370

Query  1113  AQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGL  934
             +Q+KAAKKAM +K+ S+  PG+ KGETPRL+++DQTLRQQ+A+QQ+++M+SHPWRPQRGL
Sbjct  371   SQIKAAKKAMGDKDVSA--PGSVKGETPRLRLLDQTLRQQRAMQQMSLMESHPWRPQRGL  428

Query  933   PERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMY  754
             PERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMY
Sbjct  429   PERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMY  488

Query  753   LEEVK-------------------EQDNIMGSSDGSRAAVDGGSGRERLDKKPN---VVR  640
             LEE+K                   E D +M S + SR+           D KP+   +VR
Sbjct  489   LEELKEDEGVAGDGSGGGGGAAVYENDGLMSSQNHSRSE----------DLKPSHDQLVR  538

Query  639   LDSECISSLINIPAKA----GG--------DHHQ----FG----------AVELDF---S  547
             +DSEC+SS+IN   +A    GG         HHQ    FG          A+ELDF   S
Sbjct  539   MDSECLSSIINNNNEAKRNKGGAAAAVQNEQHHQINPSFGRVIGDSYGSAAMELDFSSYS  598

Query  546   PYTHNSGGAVGYRPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFY-PRDQIG  370
              ++   G  V Y       GGGGGVSLTLGL Q    G G     T+QNSLFY  R +  
Sbjct  599   HHSSGGGSTVHY-----GGGGGGGVSLTLGLHQ---HGGGGVGLGTTQNSLFYGGRSEQM  650

Query  369   DCPPVQYSLLD-GEGQNLPYRNLMGSQLLHDLAG  271
                  QY+LLD GE QNLPYRNLMG+QLLHDLAG
Sbjct  651   VEDNNQYTLLDGGENQNLPYRNLMGAQLLHDLAG  684



>ref|XP_002870636.1| hypothetical protein ARALYDRAFT_493837 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46895.1| hypothetical protein ARALYDRAFT_493837 [Arabidopsis lyrata subsp. 
lyrata]
Length=606

 Score =   378 bits (970),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 227/441 (51%), Positives = 286/441 (65%), Gaps = 60/441 (14%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEP------------KRKSQWQQDDH-------  1357
             FQI SSKYL PAQELL EFC +G  +SDE             K++ +W    H       
Sbjct  187   FQIGSSKYLSPAQELLSEFCSLGVKESDEEVMMMKHKKKQKGKQQEEWDTSHHNNNDQHD  246

Query  1356  ---TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGD  1192
                TTSS+ H   L SL F+ELQK K+KLL +L+E+ RRY HYR+QM    ++FEA  G 
Sbjct  247   QSATTSSKKHVPPLHSLEFMELQKRKAKLLSMLEELKRRYGHYREQMRVAAAAFEAAVGV  306

Query  1191  GAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPG-ATKGETPRLKMI  1015
             GAA +Y+ALASR MSRHFRCL+D ++ Q++A  +A+ E+E  + A   A +GETPRL+++
Sbjct  307   GAAEIYTALASRAMSRHFRCLKDGLVGQIQATSQALGEREEDNRAVSIAARGETPRLRLL  366

Query  1014  DQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQT  835
             DQ LRQQK+ +Q+T++D+HPWRPQRGLPER+V+ LRAWLFEHFLHPYPSDVDKHILARQT
Sbjct  367   DQALRQQKSYRQMTLVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKHILARQT  426

Query  834   GLSRSQVSNWFINARVRLWKPMVEEMYLEEVK-EQDNIMGSSDGSRAAVDGGSGRERLDK  658
             GLSRSQVSNWFINARVRLWKPM+EEMY EE + EQ  I                   +D 
Sbjct  427   GLSRSQVSNWFINARVRLWKPMIEEMYCEETRGEQMEITNPM--------------MIDT  472

Query  657   KPN---VVRLDSECISSLINIPAKAGGDHHQFGAVEL----DFSPYTHNSGGAVGYRPGE  499
             KP+   ++R++ E +SS++  P    G +   G   L    DFS Y + +    G   G 
Sbjct  473   KPDPNQLIRVEPESLSSIVTNPTSKTGHNSNHGTTSLGSTFDFSLYGNQAVTYAG-EGGP  531

Query  498   RKTggggGVSLTLGLQQH-GGSGIGLAFSPTSQNS--LFYPRDQIGDCPPVQYS---LLD  337
             R     G VSLTLGLQ++ G  G+ LA SP +     LFY RD I +  PVQYS   L D
Sbjct  532   R-----GDVSLTLGLQRNDGNGGVSLALSPVTAQGGQLFYGRDHIEEG-PVQYSASMLDD  585

Query  336   GEGQNLPYRNLMGSQLLHDLA  274
              + QNLPYRNLMG+QLLHD+ 
Sbjct  586   DQVQNLPYRNLMGAQLLHDIV  606



>ref|XP_010545511.1| PREDICTED: homeobox protein BEL1 homolog [Tarenaya hassleriana]
Length=612

 Score =   377 bits (969),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 249/502 (50%), Positives = 318/502 (63%), Gaps = 64/502 (13%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLR--LMaassssSRLNNIQHDEDDRFLGKPENLGHPSQ  1489
             +GLSLSLSS+NP++I  +SF+ LR             NN+QH +    +    +  H  Q
Sbjct  136   QGLSLSLSSSNPTSISLHSFE-LRPHTARQGYFGKTHNNLQHTQ---MVMNNNSHHHHHQ  191

Query  1488  DYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEP--------------KRKSQWQQDDH--  1357
             D F QI  SKYL PA E+L EFC +GT +SDE               ++  QW+ +D+  
Sbjct  192   DQF-QILRSKYLIPAHEILNEFCSLGTKESDEAIITMVMKQKNQKVKQQLKQWEGNDNKD  250

Query  1356  ------TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAV  1201
                   + SS+ H   L SL F+ELQK K+KLL +LDE+DRRY+HYRDQM A V++FEA 
Sbjct  251   NHDASASASSRKHVPPLHSLEFMELQKRKAKLLSMLDEIDRRYRHYRDQMRAAVAAFEAA  310

Query  1200  AGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLK  1021
             AG GAA  Y+ALA++ MSRHFRCLRD ++ Q++A  +           PG T+GETPRL+
Sbjct  311   AGIGAAETYTALAAKAMSRHFRCLRDCVVGQIEAMGERQDPVA-----PGTTRGETPRLR  365

Query  1020  MIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILAR  841
             ++DQ  RQQK  +QL+++++HPWRPQRGLPE +VS+LRAWLFEHFL+PYPSDVDKHILAR
Sbjct  366   LLDQAFRQQKVYRQLSLVEAHPWRPQRGLPENAVSILRAWLFEHFLNPYPSDVDKHILAR  425

Query  840   QTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLD  661
             QTGLSRSQVSNWFINARVRLWKPM+EEMY EE +      G  +G+   ++        D
Sbjct  426   QTGLSRSQVSNWFINARVRLWKPMIEEMYSEETR------GERNGN--IINRQENVMLTD  477

Query  660   KKPN---VVRLDSECISSLINIPAKAGGDHHQFGAV----ELDFSPYTHNSGGAVGYRPG  502
              KP    ++R+D E +S +I  P       H+ GA       DFS Y H +    G    
Sbjct  478   PKPEPNPMIRVDPESLSYMITNPNTKISQSHRQGATPFGSTFDFSSYGHQAVTYAGDSSN  537

Query  501   ERKTggggGVSLTLGLQQH-GGSGIGLAFSPTSQNSLFYPRDQIGDCP--PVQYS--LLD  337
             +    G  GVSLTLGLQ+H G SG+ LAFSP +  SLFY     GDC    VQYS  +LD
Sbjct  538   QGLEEGTRGVSLTLGLQRHNGNSGVSLAFSPAA--SLFY-----GDCQQGSVQYSTAMLD  590

Query  336   G-EGQNLPYRNLMGSQLLHDLA  274
             G E QNLPYRNL+G+QLLHD+ 
Sbjct  591   GDESQNLPYRNLIGAQLLHDIV  612



>ref|NP_198957.1| homeobox protein BEL1 [Arabidopsis thaliana]
 sp|Q38897.2|BEL1_ARATH RecName: Full=Homeobox protein BEL1 homolog [Arabidopsis thaliana]
 dbj|BAB08513.1| homeotic protein BEL1 homolog [Arabidopsis thaliana]
 gb|AAK83580.1| AT5g41410/MYC6_12 [Arabidopsis thaliana]
 gb|AAO11553.1| At5g41410/MYC6_12 [Arabidopsis thaliana]
 gb|AAB05099.2| homeobox protein [Arabidopsis thaliana]
 gb|AED94676.1| homeobox protein BEL1-like protein [Arabidopsis thaliana]
Length=611

 Score =   377 bits (967),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 226/441 (51%), Positives = 287/441 (65%), Gaps = 60/441 (14%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEP------------KRKSQWQQDDH-------  1357
             FQI SSKYL PAQELL EFC +G  +SDE             K++ +W    H       
Sbjct  192   FQIGSSKYLSPAQELLSEFCSLGVKESDEEVMMMKHKKKQKGKQQEEWDTSHHSNNDQHD  251

Query  1356  ---TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGD  1192
                TTSS+ H   L SL F+ELQK K+KLL +L+E+ RRY HYR+QM    ++FEA  G 
Sbjct  252   QSATTSSKKHVPPLHSLEFMELQKRKAKLLSMLEELKRRYGHYREQMRVAAAAFEAAVGL  311

Query  1191  GAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPG-ATKGETPRLKMI  1015
             G A +Y+ALASR MSRHFRCL+D ++ Q++A  +A+ E+E  + A   A +GETPRL+++
Sbjct  312   GGAEIYTALASRAMSRHFRCLKDGLVGQIQATSQALGEREEDNRAVSIAARGETPRLRLL  371

Query  1014  DQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQT  835
             DQ LRQQK+ +Q+T++D+HPWRPQRGLPER+V+ LRAWLFEHFLHPYPSDVDKHILARQT
Sbjct  372   DQALRQQKSYRQMTLVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKHILARQT  431

Query  834   GLSRSQVSNWFINARVRLWKPMVEEMYLEEVK-EQDNIMGSSDGSRAAVDGGSGRERLDK  658
             GLSRSQVSNWFINARVRLWKPM+EEMY EE + EQ  I              +    +D 
Sbjct  432   GLSRSQVSNWFINARVRLWKPMIEEMYCEETRSEQMEI--------------TNPMMIDT  477

Query  657   KPN---VVRLDSECISSLINIPAKAGGDHHQFGAVEL----DFSPYTHNSGGAVGYRPGE  499
             KP+   ++R++ E +SS++  P    G +   G + L    DFS Y + +    G   G 
Sbjct  478   KPDPDQLIRVEPESLSSIVTNPTSKSGHNSTHGTMSLGSTFDFSLYGNQAVTYAG-EGGP  536

Query  498   RKTggggGVSLTLGLQQH-GGSGIGLAFSPTSQNS--LFYPRDQIGDCPPVQYS---LLD  337
             R     G VSLTLGLQ++ G  G+ LA SP +     LFY RD I +  PVQYS   L D
Sbjct  537   R-----GDVSLTLGLQRNDGNGGVSLALSPVTAQGGQLFYGRDHIEEG-PVQYSASMLDD  590

Query  336   GEGQNLPYRNLMGSQLLHDLA  274
              + QNLPYRNLMG+QLLHD+ 
Sbjct  591   DQVQNLPYRNLMGAQLLHDIV  611



>ref|XP_006283321.1| hypothetical protein CARUB_v10004359mg [Capsella rubella]
 gb|EOA16219.1| hypothetical protein CARUB_v10004359mg [Capsella rubella]
Length=633

 Score =   376 bits (965),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 233/454 (51%), Positives = 288/454 (63%), Gaps = 62/454 (14%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEP------------KRKSQW--------QQDD  1360
             FQI SSKYL PAQELL EFC +G  +SDE             K++  W        QQD 
Sbjct  190   FQIGSSKYLSPAQELLSEFCSLGVKESDEEVMMMKNKRKQKGKQQEDWDTSHNNNDQQDQ  249

Query  1359  H-TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDG  1189
               TTSS+ H   L SL F+ELQK K+KLL +L+E+ RRY HYR+QM    +SFEA  G G
Sbjct  250   SATTSSKKHVPPLHSLEFMELQKRKAKLLSMLEELKRRYGHYREQMRVAAASFEAAVGVG  309

Query  1188  AATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPG-ATKGETPRLKMID  1012
             AA VY+ALASR MSRHFRCL+D ++ Q++A  +A+ E+E  S A   A +GETPRL+++D
Sbjct  310   AAEVYTALASRAMSRHFRCLKDGLVGQIQATSQALGEREEDSRAVSIAARGETPRLRLLD  369

Query  1011  QTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  832
             Q LRQQK+ +Q+T++D+HPWRPQRGLPER+V+ LRAWLFEHFLHPYPSDVDKHILARQTG
Sbjct  370   QALRQQKSYRQMTLVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKHILARQTG  429

Query  831   LSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKP  652
             LSRSQVSNWFINARVRLWKPM+EEMY EE +  + +M  +  +            +D KP
Sbjct  430   LSRSQVSNWFINARVRLWKPMIEEMYCEETRG-EQVMDITTTTTNP----MMMMMIDTKP  484

Query  651   N---VVRLDSECISSLINIPAK-----AGGDHHQFGAVELDFSPYTHNSGGAVGYRPGER  496
             +   ++R++ E +SS++  P              FG+   DFS Y +N   AV Y  GE 
Sbjct  485   DPNQMIRVEPESLSSIVTNPTSKMTGQTKATTTTFGST-FDFSLYGNNQ--AVTY-AGE-  539

Query  495   KTggggGVSLTLGLQQH--GGSGIGLAFSP----------TSQNSLFYPRDQIGD-----  367
               G  G VSLTLGLQQ   G  G+ LA SP          T+   L+Y    I D     
Sbjct  540   GGGPRGDVSLTLGLQQRNDGNGGVSLALSPLTTAHQGTTTTTTGQLYYGTSNIRDHMEQE  599

Query  366   CPPVQYS---LLDGEGQNLPYRNLMGSQLLHDLA  274
              P  QYS   L D + QNLPYRNLMG+QLLHDL 
Sbjct  600   GPVHQYSASMLDDDQVQNLPYRNLMGAQLLHDLV  633



>ref|XP_010553534.1| PREDICTED: homeobox protein BEL1 homolog [Tarenaya hassleriana]
Length=655

 Score =   375 bits (963),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 238/449 (53%), Positives = 292/449 (65%), Gaps = 65/449 (14%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEP---------KRKSQWQ---------------Q  1366
             I  SKYL PAQELL EFC +GT QSDE          K K QW+                
Sbjct  223   IVRSKYLVPAQELLNEFCSLGTKQSDEETVMMKQKIEKGKQQWESNNNNDNGSDHHHHHH  282

Query  1365  DDHTTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGD  1192
             +  +TSS+ H   L SL F+ELQK K+KLL +LDE+DRRY HYR+QM A  ++FEA AG 
Sbjct  283   ESASTSSRKHVPPLHSLEFMELQKRKAKLLSMLDEIDRRYHHYREQMRAAAAAFEAAAGV  342

Query  1191  GAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMID  1012
              AA  Y+ALA++ MSRHFRCLRD+++ Q++A KKAM E+E   A PG T+GETPRL+++D
Sbjct  343   VAAETYTALAAKAMSRHFRCLRDSVVGQIQATKKAMGEREDPGA-PGTTRGETPRLRLLD  401

Query  1011  QTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  832
             Q LRQQK  +Q++++D HPWRPQRGLPER+VS+LRAWLFEHFLHPYPSDVDKHILARQTG
Sbjct  402   QALRQQKVYRQMSLVDPHPWRPQRGLPERAVSILRAWLFEHFLHPYPSDVDKHILARQTG  461

Query  831   LSRSQVSNWFINARVRLWKPMVEEMYLEE--------VKEQDNIMGSSDGSRAAVDGGSG  676
             LSRSQVSNWFINARVRLWKPM+EEMY EE        +  Q+NIM         V+    
Sbjct  462   LSRSQVSNWFINARVRLWKPMIEEMYSEETRGERNESINHQENIM---------VNPVLT  512

Query  675   RERLDKKPNVVRLDSECISSLINIPAKAGGDHHQ----FGAVELDFSPYTHNS---GGAV  517
               + +  P + R D   +SS+I  P+     HHQ    FG+   DFS Y H +   GG  
Sbjct  513   DPKPELNPIMNRADPGSLSSIITNPSSK--THHQGTTPFGS-SFDFSLYGHQAVTYGGDS  569

Query  516   GYRPGERKTggggGVSLTLGLQQH--GGSGIGLAFSPTSQNSLFYPRDQIGDCP---PVQ  352
                  E +T    GVSLTLGLQ+H  G  G+ LAFSP +Q +  + RD + D      VQ
Sbjct  570   SDMGFEDRT---RGVSLTLGLQRHNDGNGGVSLAFSPAAQGAPLFFRDHVEDYHQQGSVQ  626

Query  351   YSL--LDG-EGQNLPYRNLMGSQLLHDLA  274
             YS   LDG + QNLPYRNLMG+QLLHD+ 
Sbjct  627   YSTTHLDGDDAQNLPYRNLMGAQLLHDIV  655



>ref|XP_006405354.1| hypothetical protein EUTSA_v10027690mg [Eutrema salsugineum]
 dbj|BAJ33952.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46807.1| hypothetical protein EUTSA_v10027690mg [Eutrema salsugineum]
Length=597

 Score =   371 bits (953),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 217/438 (50%), Positives = 284/438 (65%), Gaps = 60/438 (14%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEP------KRKSQWQQ-----------DDH--  1357
             F I SSKYL PAQELL EFC +G  +SD+       KRK + +Q           D H  
Sbjct  184   FPIGSSKYLSPAQELLSEFCSLGVKESDDEVMMMKHKRKQKGKQQEEWDTSNNNNDQHHD  243

Query  1356  ---TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGD  1192
                TTSS+ H   L SL F+ELQK K+KLL +L+E+ RRY HYR+QM    ++FE   G 
Sbjct  244   QSATTSSKKHVPPLHSLEFMELQKRKAKLLSMLEELKRRYGHYREQMRIAAAAFETAVGV  303

Query  1191  GAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPG-ATKGETPRLKMI  1015
             GAA +Y+ALASR MSRHFRCL+D ++ Q++A  +A+ E++  + A   + +GETPRL+++
Sbjct  304   GAAEMYTALASRAMSRHFRCLKDGLVGQIQATSQALGERDEDNRAASISARGETPRLRLL  363

Query  1014  DQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQT  835
             DQ LRQQK+ +Q++++++HPWRPQRGLPER+V+ LRAWLFEHFLHPYPSDVDKHILARQT
Sbjct  364   DQALRQQKSYRQMSLVEAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKHILARQT  423

Query  834   GLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKK  655
             GLSRSQVSNWFINARVRLWKPM+EEMY EE +          G +  V   +    +D K
Sbjct  424   GLSRSQVSNWFINARVRLWKPMIEEMYCEETR----------GEQMEVTNPTF---IDTK  470

Query  654   PN---VVRLDSECISSLINIP-----AKAGGDHHQFGAVELDFSPYTHNSGGAVGYRPGE  499
             P+   ++R++ E +SS++        +  G     FG+   DFS Y ++   AV Y  GE
Sbjct  471   PDPNQIIRVEPESLSSIVTKTGHKDNSNQGTASSSFGST-FDFSLYGNH---AVTY-AGE  525

Query  498   RKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNS--LFYPRDQIGDCPPVQYSLLDG-EG  328
               T     VSLTLGLQ     G+ LA SP +  +  L+Y RD +        S+LDG + 
Sbjct  526   GGT---RDVSLTLGLQ---NGGVSLALSPVTAQAGPLYYGRDHMEGSVQYTASMLDGDQA  579

Query  327   QNLPYRNLMGSQLLHDLA  274
             QNLPYRNLMG+QLLHD+ 
Sbjct  580   QNLPYRNLMGAQLLHDMV  597



>gb|KFK33010.1| hypothetical protein AALP_AA6G318600 [Arabis alpina]
Length=588

 Score =   369 bits (947),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 222/433 (51%), Positives = 286/433 (66%), Gaps = 56/433 (13%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEP------KRKSQWQQ----------DDH---  1357
             FQI SSKYL PAQELL EFC +G  +SDE       KRK + +Q          +DH   
Sbjct  181   FQIGSSKYLSPAQELLSEFCSLGVKESDEEVMMMKNKRKQKGKQQEEWDTSNNNNDHDQS  240

Query  1356  -TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGA  1186
              TTSS+ H   L SL F+ELQK K+KLL +L+E+ RRY HYR+QM    ++FEA  G GA
Sbjct  241   ATTSSKKHVPPLHSLEFMELQKRKAKLLSMLEELKRRYGHYREQMRVAAAAFEAAVGVGA  300

Query  1185  ATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPG-ATKGETPRLKMIDQ  1009
             A +Y+ LASR MSRHFR ++D ++ Q+++  +AM E+E  + A   A +GETPRL+++DQ
Sbjct  301   AEMYTTLASRAMSRHFRRVKDGLVEQIQSTSQAMGEREEDNRAVSIAARGETPRLRLLDQ  360

Query  1008  TLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGL  829
              LRQQK+ +Q++++D+HPWRPQRGLPER+V+ LRAWLFEHFLHPYPSDVDKHILARQTGL
Sbjct  361   ALRQQKSYRQMSLVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKHILARQTGL  420

Query  828   SRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPN  649
             SRSQVSNWFINARVRLWKPM+EEMY EE + +   M ++               +D KP+
Sbjct  421   SRSQVSNWFINARVRLWKPMIEEMYCEETRGEQMEMNTNS------------MLIDTKPD  468

Query  648   ---VVRLDSECISSLINIPAKAGGDHHQFGAVELDFSPYTHNSGGAVGYRPGERKTgggg  478
                ++R++ E +SS++  P   G     FG+   DFS Y +    AV Y  GE  T    
Sbjct  469   PNQIMRVEPESLSSIVTKPGHKGTT-SSFGST-FDFSLYGNQ---AVTY-AGEGGT---R  519

Query  477   GVSLTLGLQQHGGSGIGLAFSPTS--QNSLFYPRDQIGDCPPVQYS---LLDGEGQNLPY  313
              VSLTLGLQ     G+ LA SP +  +  L+Y RD I +   VQY+   L D + QNLPY
Sbjct  520   DVSLTLGLQ---NGGVSLALSPVTAQEGPLYYGRDHIEEG-SVQYAPSILDDDQAQNLPY  575

Query  312   RNLMGSQLLHDLA  274
             RNLMG+QLLHD+ 
Sbjct  576   RNLMGAQLLHDMV  588



>ref|XP_010447491.1| PREDICTED: homeobox protein BEL1 homolog [Camelina sativa]
Length=617

 Score =   368 bits (945),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 232/446 (52%), Positives = 289/446 (65%), Gaps = 62/446 (14%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEP------------KRKSQW-----QQDDH--  1357
             FQI SSKYL PAQELL EFC +G  +SDE             K++ +W       D H  
Sbjct  190   FQIGSSKYLSPAQELLSEFCSLGVKESDEEVMMMKHKKKQKGKQQEEWDTSHNNNDQHDQ  249

Query  1356  --TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDG  1189
               TTSS+ H   L SL F+ELQK K+KLL LL+E+ RRY HYR+QM    +SFEA  G G
Sbjct  250   SATTSSKKHVPPLHSLEFMELQKRKAKLLSLLEELKRRYGHYREQMRVAAASFEAAVGVG  309

Query  1188  AATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPG-ATKGETPRLKMID  1012
             AA VY+ALASR MSRHFRCL+D ++ Q++A  +A+ E+E  + A   A +GETPRL+++D
Sbjct  310   AAEVYTALASRAMSRHFRCLKDGLVGQVQATSQALGEREEDNRAVSIAARGETPRLRLLD  369

Query  1011  QTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  832
             Q LRQQK+ +Q+T++D+HPWRPQRGLPER+V+ LRAWLFEHFLHPYPSDVDKHILARQTG
Sbjct  370   QALRQQKSYRQMTLVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKHILARQTG  429

Query  831   LSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKP  652
             LSRSQVSNWFINARVRLWKPM+EEMY EE +  + IM  +               +D KP
Sbjct  430   LSRSQVSNWFINARVRLWKPMIEEMYCEETRG-EQIMEITTNPMM----------IDTKP  478

Query  651   N---VVRLDSECISSLINIP-AKAGGDHHQ--------FGAVELDFSPYTHNSGGAVGYR  508
             +   ++R++ E +SS++  P +K G   H         +G+   DFS Y + +    G  
Sbjct  479   DPNQIIRVEPESLSSIVTNPTSKTGLKAHSSNQHATTPYGS-NFDFSLYGNQAVTYAG-E  536

Query  507   PGERKTggggGVSLTLGLQQH--GGSGIGLAFSP-TSQNSLFY--PRDQIGDCPPVQYS-  346
              G R     G VSLTLGLQQ   G  G+ LA SP T+Q    Y   RD I    PVQYS 
Sbjct  537   GGPR-----GDVSLTLGLQQRNDGNGGVSLALSPVTAQGGQLYYGSRDHIDQEGPVQYSA  591

Query  345   --LLDGEGQNLPYRNLMGSQLLHDLA  274
               L D + QNLPYRNLMG+QLLHD+ 
Sbjct  592   SMLDDDQVQNLPYRNLMGAQLLHDIV  617



>ref|XP_009395309.1| PREDICTED: homeobox protein BEL1 homolog [Musa acuminata subsp. 
malaccensis]
Length=510

 Score =   364 bits (935),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 226/437 (52%), Positives = 283/437 (65%), Gaps = 53/437 (12%)
 Frame = -2

Query  1524  LGKPENLGHPSQDYFFQIR------SSKYLGPAQELLKEFCCV--GTTQSDEPKRKSQWQ  1369
             +G P++L    Q  F   R       SKYL P QELL EFC +  G    + PK+ S+ +
Sbjct  108   IGLPDSLQQQQQQLFVHARREHYLKKSKYLKPTQELLSEFCNIQEGLNSKEGPKQGSRRE  167

Query  1368  QDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDG  1189
             + D   SS   SL S++ LEL K K+KL  +L+EVDRRY+ Y +QM AVVSSFE +AG+G
Sbjct  168   EGD--PSSWQQSLYSMNHLELHKLKAKLFSMLEEVDRRYRKYCEQMKAVVSSFETMAGEG  225

Query  1188  AATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQ  1009
             AA +YS LAS+ MSRHFR L+D I+ Q+ A KKAM E + S+  PG T+ ETPRLK++DQ
Sbjct  226   AADIYSTLASKAMSRHFRRLKDGIVDQINAVKKAMGETDPSA--PGGTRAETPRLKLLDQ  283

Query  1008  TLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGL  829
              +RQQKA+Q   M+   PWRPQRGLPERSVS+LRAWLFEHFLHPYPSDVDK ILAR+ GL
Sbjct  284   CIRQQKALQH-GMVQQLPWRPQRGLPERSVSILRAWLFEHFLHPYPSDVDKVILARKAGL  342

Query  828   SRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPN  649
             SRSQVSNWFINARVR+WKPMVEEMY EE+KE D     +    +A+        L  KP 
Sbjct  343   SRSQVSNWFINARVRIWKPMVEEMYSEEMKELDAKSNQNPNPNSALS-------LVHKPF  395

Query  648   VVRLDSECISSLINI-------PAK---AGGDHHQFGAVELD-FSPYTHNSGGAVGYRPG  502
             +   DSE +SS+IN        P +   +G DH  FG V+ D FS Y++ +   +     
Sbjct  396   LN--DSESLSSIINSSHHGVHQPQQQRVSGADH--FGVVDYDVFSSYSNFASDDL-----  446

Query  501   ERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQN  322
              R++     VSLTLGLQQH G G+ L+FS  SQ  L + R         + S+LDGE Q 
Sbjct  447   -RRS-----VSLTLGLQQHNGGGMSLSFSAASQQPLHHGRQG-------ELSMLDGEAQG  493

Query  321   LPYRNLMGSQLLHDLAG  271
             +P R LMG+QLLHDLAG
Sbjct  494   VPRRTLMGTQLLHDLAG  510



>gb|EPS62339.1| hypothetical protein M569_12452, partial [Genlisea aurea]
Length=440

 Score =   362 bits (928),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 239/486 (49%), Positives = 293/486 (60%), Gaps = 80/486 (16%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDEDDRFLGKPENLGHPSQDY  1483
             +GLSLSL+S+NP+A+   SF+                               L       
Sbjct  12    RGLSLSLNSSNPAAVTLQSFE-------------------------------LRQARSPQ  40

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQSDE---PKRKSQWQQDDHTT--SSQNHSLGSLH  1318
                +  S+YL PAQ LL EFC +   ++     P+R ++   D      + +  SL +  
Sbjct  41    VAVLAGSRYLLPAQHLLAEFCNLHAEEAKTEPPPQRINECDGDGDDDEGAVKRQSLYASG  100

Query  1317  FLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHF  1138
              LELQ  KSKLLH+ DEVDRRY+HY DQM AVV SFEAVAG G+A VY+ +AS+ MSRHF
Sbjct  101   VLELQTRKSKLLHMSDEVDRRYRHYTDQMKAVVGSFEAVAGAGSARVYTTMASKAMSRHF  160

Query  1137  RCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSH  958
             RCLRD I+ +++  KKAM E++      GA+KGETPRL+++DQ LRQQ+A+QQ++MM++H
Sbjct  161   RCLRDGIVREIRVLKKAMGERDGGGGG-GASKGETPRLRILDQKLRQQRALQQMSMMETH  219

Query  957   PWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLW  778
             PWRPQRGLPER+VSVLRAWLFEHFLHPYP DVDKHILARQTGLSRSQVSNWFINARVRLW
Sbjct  220   PWRPQRGLPERAVSVLRAWLFEHFLHPYPCDVDKHILARQTGLSRSQVSNWFINARVRLW  279

Query  777   KPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPN----VVRLDSECISSLI  610
             KPMVEEMY EEVKE       S+       GG GR   D+KP+    +  +DS+C+S +I
Sbjct  280   KPMVEEMYREEVKE-------SEADDRGGGGGGGRRNDDRKPSQDQLMTGIDSDCLSYII  332

Query  609   NIP--------------AKAGGDHHQFGAVELDFSPYTHNSGGAVGYRPGERKTggggGV  472
             N                A A G H   G    DFS Y      A     G         V
Sbjct  333   NNAKTKNKGAILHQNPVAFADGGHQMVG---FDFSSYAGQHAAAPPSNYG---------V  380

Query  471   SLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQ  292
             SLTLGL QHGG G   A +P    S+F   DQ+ DC    +SLLD + Q L YRNLMG+Q
Sbjct  381   SLTLGLHQHGGGGFPPATAPP---SMF---DQMEDCQNAHFSLLDSDNQTLHYRNLMGAQ  434

Query  291   LLHDLA  274
             LLHDLA
Sbjct  435   LLHDLA  440



>ref|XP_009140091.1| PREDICTED: homeobox protein BEL1 homolog [Brassica rapa]
Length=593

 Score =   365 bits (938),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 240/502 (48%), Positives = 315/502 (63%), Gaps = 67/502 (13%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLN--NIQHDEDDRFLGKPENLGHPSQ  1489
             +GLSLSLSS+NP+ I   SFD LR      S    +  N+ H +    L    +  + S 
Sbjct  120   QGLSLSLSSSNPTNISLQSFD-LRHQQQGYSGKSTDHQNLPHSQM-MMLMNSHHQNNSSN  177

Query  1488  DYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEP-----KRKSQWQQ-----------DDH  1357
              + FQI SSKYL  AQELL+EFC +G  +SD+      KRK + +Q           D H
Sbjct  178   HHQFQIGSSKYLSAAQELLREFCSLGVKESDDEVMMKHKRKQKGKQQEDWDASNNNNDQH  237

Query  1356  ----TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAG  1195
                 TTSS+ H   L SL F+ELQK K+KLL +L+E+ RRY HYR+QM    ++FEA  G
Sbjct  238   DNSATTSSKKHVPPLHSLEFMELQKRKAKLLAMLEELKRRYGHYREQMRLATAAFEAAVG  297

Query  1194  DGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssa-APGATKGETPRLKM  1018
              GAA +Y+ALASR MSRHFRCL+D ++ Q++A  +A+ E++  +     A +GETPRL++
Sbjct  298   VGAAEMYTALASRAMSRHFRCLKDGLVGQIQATSQALGERDEDNRGVSNAARGETPRLRL  357

Query  1017  IDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             +DQ LRQQK+ +Q++++++HPWRPQRGLPER+V+ LRAWLFEHFLHPYPSDVDKHILARQ
Sbjct  358   LDQALRQQKSYRQMSLVEAHPWRPQRGLPERAVTALRAWLFEHFLHPYPSDVDKHILARQ  417

Query  837   TGLSRSQVSNWFINARVRLWKPMVEEMYLEEVK-EQDNIMGSSDGSRAAVDGGSGRERLD  661
             +GLSRSQVSNWFINARVRLWKPM+EEMY EE + E++  M  ++              +D
Sbjct  418   SGLSRSQVSNWFINARVRLWKPMIEEMYCEETRGEEEQQMEITNPM-----------FMD  466

Query  660   KKPN---VVRLDSECISSLINIPAKAG-GDHHQFGAVE----LDFSPYTHNSGGAVGYRP  505
              KP+   ++R++ E +SS++    K G  D+   G        DFS Y   S  AV Y  
Sbjct  467   TKPDPNQIMRVEPESLSSVV---TKTGHKDNSNLGTASFGSTFDFSSY---SNQAVTY-S  519

Query  504   GERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNS--LFYPRDQIGDCPPVQYS---LL  340
             GE   GG   VSLTLGLQ     G+ LA SP +     L+Y RD +     VQY+   L 
Sbjct  520   GE---GGARDVSLTLGLQ---NGGVSLALSPVTAQGGPLYYGRDHMDGS--VQYTSSILD  571

Query  339   DGEGQNLPYRNLMGSQLLHDLA  274
             D + QNLPY NLMG+Q LHD+ 
Sbjct  572   DDQAQNLPYMNLMGAQSLHDMV  593



>ref|XP_010441306.1| PREDICTED: homeobox protein BEL1 homolog [Camelina sativa]
Length=613

 Score =   366 bits (939),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 229/446 (51%), Positives = 287/446 (64%), Gaps = 63/446 (14%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEP------------KRKSQW-----QQDDH--  1357
             FQI SSKYL PAQELL EFC +G  +SDE             K++ +W       D H  
Sbjct  187   FQIGSSKYLSPAQELLSEFCSLGVKESDEEVMMMKHKKKQKGKQQEEWDTSHNNNDQHDQ  246

Query  1356  --TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDG  1189
               TTSS+ H   L SL F+ELQK K+KLL LL+E+ RRY HYR+QM    +SFEA  G G
Sbjct  247   SATTSSKKHVPPLHSLEFMELQKRKAKLLSLLEELKRRYGHYREQMRVAAASFEAAVGVG  306

Query  1188  AATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPG-ATKGETPRLKMID  1012
             AA VY+ALASR MSRHFRCL+D ++ Q++A  +A+ E+E  + A   A +GETPRL+++D
Sbjct  307   AAEVYTALASRAMSRHFRCLKDGLVGQVQATSQALGEREEDNRAVSIAARGETPRLRLLD  366

Query  1011  QTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  832
             Q LRQQK+ +Q+T++D+HPWRPQRGLPER+V+ LRAWLFEHFLHPYPSDVDKHILARQTG
Sbjct  367   QALRQQKSYRQMTLVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKHILARQTG  426

Query  831   LSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKP  652
             LSRSQVSNWFINARVRLWKPM+EEMY EE + +             +D  +    +D KP
Sbjct  427   LSRSQVSNWFINARVRLWKPMIEEMYCEETRGEQ------------MDITTNPMMIDTKP  474

Query  651   N---VVRLDSECISSLINIPAKAGG------DHH---QFGAVELDFSPYTHNSGGAVGYR  508
             +   ++ ++ E +SS++  P    G      + H    +G+   DFS Y + +    G  
Sbjct  475   DPNQIIGVEPESLSSIVTNPTSKTGLKALNSNQHATTSYGS-NFDFSLYGNQAVTYAG-E  532

Query  507   PGERKTggggGVSLTLGLQQH--GGSGIGLAFSP-TSQNSLFY--PRDQIGDCPPVQYS-  346
              G R     G VSLTLGLQQ   G  G+ LA SP T+Q    Y   RD I    PVQYS 
Sbjct  533   GGPR-----GDVSLTLGLQQRNDGNGGVSLALSPVTAQGGQLYYGSRDHIDQEGPVQYSA  587

Query  345   --LLDGEGQNLPYRNLMGSQLLHDLA  274
               L D + QNLPYRNLMG+QLLHD+ 
Sbjct  588   SMLDDDQVQNLPYRNLMGAQLLHDIV  613



>ref|XP_010436095.1| PREDICTED: homeobox protein BEL1 homolog [Camelina sativa]
Length=617

 Score =   365 bits (937),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 228/446 (51%), Positives = 288/446 (65%), Gaps = 63/446 (14%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEP------------KRKSQW-----QQDDH--  1357
             FQI SSKYL PAQELL EFC +G  +SDE             K++ +W       D H  
Sbjct  191   FQIGSSKYLSPAQELLSEFCSLGVKESDEEVMMMKHKKKQKGKQQEEWDTSHNNNDQHEQ  250

Query  1356  --TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDG  1189
               TTSS+ H   L SL F+ELQK K+KLL LL+E+ RRY HYR+QM    +SFEA  G G
Sbjct  251   SATTSSKKHVPPLHSLEFMELQKRKAKLLSLLEELKRRYGHYREQMRIAAASFEAAVGVG  310

Query  1188  AATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPG-ATKGETPRLKMID  1012
             AA VY+ALASR MSRHFRCL+D ++ Q++A  +A+ E+E  + A   A +GETPRL+++D
Sbjct  311   AAEVYTALASRAMSRHFRCLKDGLVGQVQATSQALGEREEDNRAVSIAARGETPRLRLLD  370

Query  1011  QTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  832
             Q LRQQK+ +Q+T++D+HPWRPQRGLPER+V+ LRAWLFEHFLHPYPSDVDKHILARQTG
Sbjct  371   QALRQQKSYRQMTLVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKHILARQTG  430

Query  831   LSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKP  652
             LSRSQVSNWFINARVRLWKPM+EEMY EE + +             ++  +    +D KP
Sbjct  431   LSRSQVSNWFINARVRLWKPMIEEMYCEETRGEQ------------MESTTNPMMVDTKP  478

Query  651   N---VVRLDSECISSLINIPAKAGG----DHHQ-----FGAVELDFSPYTHNSGGAVGYR  508
             +   ++R++ E +SS++  P    G    + +Q     +G+   DFS Y + +    G  
Sbjct  479   DPNQIIRVEPESLSSIVTNPTSKTGLKALNSNQPATTSYGS-NFDFSLYGNQAVTCAG-E  536

Query  507   PGERKTggggGVSLTLGLQQH--GGSGIGLAFSP-TSQNSLFY--PRDQIGDCPPVQYS-  346
              G R     G VSLTLGLQQ   G  G+ LA SP T+Q    Y   RD      PVQYS 
Sbjct  537   GGPR-----GDVSLTLGLQQRNDGNGGVSLALSPVTAQGGQLYYGSRDHTDQEGPVQYSA  591

Query  345   --LLDGEGQNLPYRNLMGSQLLHDLA  274
               L D + QNLPYRNLMG+QLLHD+ 
Sbjct  592   SMLDDDQVQNLPYRNLMGAQLLHDIV  617



>ref|XP_009395039.1| PREDICTED: homeobox protein BEL1 homolog [Musa acuminata subsp. 
malaccensis]
Length=516

 Score =   356 bits (913),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 214/411 (52%), Positives = 271/411 (66%), Gaps = 27/411 (7%)
 Frame = -2

Query  1476  QIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHT-----TSSQNHSLGSLHFL  1312
             Q+R+SK+LGPAQELL EFC V T QS   K+ ++   +        +S  + SL S+  +
Sbjct  120   QLRNSKFLGPAQELLNEFCGV-TGQSSSKKKPNKTNHEGEAGKPSLSSPWHQSLRSMDLV  178

Query  1311  ELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRC  1132
             ELQK K++LL +L+EVD RY+ Y ++M  VV+ FE V G+GAA+ Y+ LAS+ MSRHFRC
Sbjct  179   ELQKIKAQLLSMLEEVDMRYRKYYEEMRGVVAWFEVVGGEGAASAYAGLASKAMSRHFRC  238

Query  1131  LRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPW  952
             LRD I+ Q++A K+A  EK+S++  PG T GETPRL+M+DQ +R+QKA QQ TM + HPW
Sbjct  239   LRDGIVGQIRAVKEATGEKDSAA--PGTTPGETPRLRMLDQRIRRQKAFQQGTM-EPHPW  295

Query  951   RPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKP  772
             RPQRGLP+RSVSVLRAWLFEHFLHPYP+D DKHILARQTGLSR QVSNWFINARVRLWKP
Sbjct  296   RPQRGLPDRSVSVLRAWLFEHFLHPYPNDADKHILARQTGLSRGQVSNWFINARVRLWKP  355

Query  771   MVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRER----LDKKPNVVR--LDSECISSLI  610
             MVEEMYLEE KE +N    +   R   D  +         D+KP  V+  +DSE +SS+I
Sbjct  356   MVEEMYLEETKELENQADQAPTGREHNDHPNPNPNSGLSFDQKPLPVQPLVDSESLSSII  415

Query  609   NIPAKAGGDHHQFGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQHGGSGI  430
             N    +    HQ+         + H S     Y      T    GVSLTLGLQ H G G+
Sbjct  416   NSSHHSDQTLHQYRQQH-----HRHVSDLGFPYSSSSSST----GVSLTLGLQHHSGGGM  466

Query  429   GLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDL  277
              L+    SQ    +  D + D   V +S+ DGE  NLPYR+LMG+QLL D+
Sbjct  467   SLSLLHDSQ---LFSADHVDDDQQVHFSISDGEAVNLPYRDLMGAQLLQDM  514



>emb|CDY44476.1| BnaCnng11290D [Brassica napus]
Length=568

 Score =   353 bits (906),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 221/480 (46%), Positives = 301/480 (63%), Gaps = 48/480 (10%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLN--NIQHDEDDRFLGKPENLGHPSQ  1489
             +GLSLSLSS+NP++I   SFD LR      S    +  N+ H +    L    +  + S 
Sbjct  120   QGLSLSLSSSNPTSISLQSFD-LRHQQQGYSGKSTDHQNLPHSQM-MVLMNSHHQNNSSN  177

Query  1488  DYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHSLGSLHFLE  1309
              + FQI SSKYL  AQELL EFC +G  +S   K++  W   ++     + S  +     
Sbjct  178   HHQFQIGSSKYLSAAQELLSEFCSLGVKES---KQQEDWDASNNNNDQHDQSATTSAKKH  234

Query  1308  LQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCL  1129
             LQK K+KLL +L+E+ RRY HYR+QM    ++FEA  G GAA +Y+ALASR MSRHFRCL
Sbjct  235   LQKRKAKLLAMLEELKRRYGHYREQMRLATAAFEAAVGVGAAEMYTALASRAMSRHFRCL  294

Query  1128  RDAILAQLkaakkamaekesssaAPG-ATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPW  952
             +D ++ Q++A  +A+ E++  +     A +GETPRL+++DQ LRQQK+ +Q++++++HPW
Sbjct  295   KDGLVGQIQAMSQALGERDEDNRGVSIAARGETPRLRLLDQALRQQKSYRQMSLVEAHPW  354

Query  951   RPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKP  772
             RPQRGLPER+V+ LRAWLFEHFLHPYPSDVDKHILARQ+GLSRSQVSNWFINARVRLWKP
Sbjct  355   RPQRGLPERAVTALRAWLFEHFLHPYPSDVDKHILARQSGLSRSQVSNWFINARVRLWKP  414

Query  771   MVEEMYLEEVK-EQDNIMGSSDGSRAAVDGGSGRERLDKKPN---VVRLDSECISSLINI  604
             M+EEMY EE + E++  M  ++              +D KP+   ++R++ E +SS++  
Sbjct  415   MIEEMYCEETRGEEEQQMEITNPM-----------FMDTKPDPNQIMRVEPESLSSVV--  461

Query  603   PAKAG-GDHHQFGAVE----LDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQHGG  439
               K G  D+   G        DFS Y++ +    G   G R+      VSLTLGLQ    
Sbjct  462   -TKTGHKDNSNLGTASFGSTFDFSLYSNQAVTYTG-EGGARE------VSLTLGLQ---N  510

Query  438   SGIGLAFSPTSQNS--LFYPRDQIGDCPPVQYS---LLDGEGQNLPYRNLMGSQLLHDLA  274
              G+ LA SP +     L+Y RD +     VQY+   L D + QNLPY NLMG+Q LHD+ 
Sbjct  511   GGVSLALSPVTAQGGPLYYGRDHMDGS--VQYTSSILDDDQAQNLPYMNLMGAQSLHDMV  568



>ref|XP_009418082.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=601

 Score =   349 bits (895),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 231/461 (50%), Positives = 296/461 (64%), Gaps = 52/461 (11%)
 Frame = -2

Query  1539  EDDRFLGKP-----ENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTT--------QS  1399
             +D RF   P      NL  PSQ     +++SKYL  AQ+LL EFC + TT        ++
Sbjct  155   QDGRFFRPPISPTTSNLHQPSQHL---LKTSKYLLAAQDLLNEFCNMNTTADSGSSKKKA  211

Query  1398  DEPKRKSQWQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVV  1219
              + K++++      T+ SQ+     +H  ELQ  K+KLL + +EVDRRY+ YR +M AVV
Sbjct  212   SKTKQRNEGGSSSSTSLSQSLYSLDIH--ELQTRKAKLLSMREEVDRRYRRYRHRMKAVV  269

Query  1218  SSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKG  1039
             SSFEA+AG+GAA  YS LAS+VMSRHF CLRD I  Q++A ++ M EK++ +    +T+G
Sbjct  270   SSFEAMAGEGAAAAYSTLASKVMSRHFGCLRDRIAGQIQAIRRQMGEKDAVAEGGSSTRG  329

Query  1038  ETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVD  859
             ETPRLK+IDQ LRQQKA QQ  +M+S PWRPQRGLP+RSVS+LRAWLFEHFLHPYPSDVD
Sbjct  330   ETPRLKLIDQRLRQQKAFQQAGVMESEPWRPQRGLPQRSVSILRAWLFEHFLHPYPSDVD  389

Query  858   KHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGS--------  703
             KHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEE+ EQ++     D S        
Sbjct  390   KHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEILEQEDQTSLGDNSNDDDAINP  449

Query  702   ---------RAAVDGGSGRERLDKKPNVVRLDSECISSLINIPAKAGGDH-----HQFGA  565
                      + ++      +  ++KP   +L ++  S    + + +  D        FGA
Sbjct  450   PNHPQSSQNQNSIYNSCEVDIEEQKPAAGQLLTDSDSLSWIVSSSSARDRISSKSSDFGA  509

Query  564   VELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQHGGSG-IGLAFSPT--SQNSL  394
             V+LDFS Y H       +  G         VSLTLGLQQH G G +  +F P+  SQ SL
Sbjct  510   VDLDFSSYNHYYCSNQNFGSG---------VSLTLGLQQHNGGGSVRPSFPPSLASQQSL  560

Query  393   FYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
              Y ++Q+ +C P Q+S+LDGE QNL YRNLMG+QLL DLAG
Sbjct  561   VYSKEQMEECHPSQFSILDGEAQNLHYRNLMGAQLLRDLAG  601



>ref|XP_009418083.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   348 bits (893),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 231/461 (50%), Positives = 296/461 (64%), Gaps = 52/461 (11%)
 Frame = -2

Query  1539  EDDRFLGKP-----ENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTT--------QS  1399
             +D RF   P      NL  PSQ     +++SKYL  AQ+LL EFC + TT        ++
Sbjct  135   QDGRFFRPPISPTTSNLHQPSQHL---LKTSKYLLAAQDLLNEFCNMNTTADSGSSKKKA  191

Query  1398  DEPKRKSQWQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVV  1219
              + K++++      T+ SQ+     +H  ELQ  K+KLL + +EVDRRY+ YR +M AVV
Sbjct  192   SKTKQRNEGGSSSSTSLSQSLYSLDIH--ELQTRKAKLLSMREEVDRRYRRYRHRMKAVV  249

Query  1218  SSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKG  1039
             SSFEA+AG+GAA  YS LAS+VMSRHF CLRD I  Q++A ++ M EK++ +    +T+G
Sbjct  250   SSFEAMAGEGAAAAYSTLASKVMSRHFGCLRDRIAGQIQAIRRQMGEKDAVAEGGSSTRG  309

Query  1038  ETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVD  859
             ETPRLK+IDQ LRQQKA QQ  +M+S PWRPQRGLP+RSVS+LRAWLFEHFLHPYPSDVD
Sbjct  310   ETPRLKLIDQRLRQQKAFQQAGVMESEPWRPQRGLPQRSVSILRAWLFEHFLHPYPSDVD  369

Query  858   KHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGS--------  703
             KHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEE+ EQ++     D S        
Sbjct  370   KHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEILEQEDQTSLGDNSNDDDAINP  429

Query  702   ---------RAAVDGGSGRERLDKKPNVVRLDSECISSLINIPAKAGGDH-----HQFGA  565
                      + ++      +  ++KP   +L ++  S    + + +  D        FGA
Sbjct  430   PNHPQSSQNQNSIYNSCEVDIEEQKPAAGQLLTDSDSLSWIVSSSSARDRISSKSSDFGA  489

Query  564   VELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQHGGSG-IGLAFSPT--SQNSL  394
             V+LDFS Y H       +  G         VSLTLGLQQH G G +  +F P+  SQ SL
Sbjct  490   VDLDFSSYNHYYCSNQNFGSG---------VSLTLGLQQHNGGGSVRPSFPPSLASQQSL  540

Query  393   FYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLAG  271
              Y ++Q+ +C P Q+S+LDGE QNL YRNLMG+QLL DLAG
Sbjct  541   VYSKEQMEECHPSQFSILDGEAQNLHYRNLMGAQLLRDLAG  581



>ref|XP_010533636.1| PREDICTED: homeobox protein BEL1 homolog [Tarenaya hassleriana]
 ref|XP_010533637.1| PREDICTED: homeobox protein BEL1 homolog [Tarenaya hassleriana]
Length=588

 Score =   335 bits (859),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 207/435 (48%), Positives = 260/435 (60%), Gaps = 79/435 (18%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEPK--------RKSQW-----QQDDH----TT  1351
             FQI  SKYL P QELL E C +GT QSD  +         + +W      +D+H      
Sbjct  200   FQILRSKYLAPVQELLNEICSLGTKQSDHEEMTMKNQKGEEQEWGGNNDDKDNHRHDDDL  259

Query  1350  SSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATV  1177
             S++ H   L SL F+EL K K+KLL +LDE++RR+ HYRDQM AV ++FE  AG GAA  
Sbjct  260   SARKHVPPLHSLEFMELHKRKAKLLSMLDEINRRHHHYRDQMRAVATAFETAAGVGAAET  319

Query  1176  YSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQ  997
             Y+A A++ MSRHFRCLRD +  Q+ A KKAM E+E   A PG T+G+TPRL+++DQ  RQ
Sbjct  320   YTASAAKAMSRHFRCLRDGVARQIHATKKAMGEREDPVA-PGMTRGDTPRLRLLDQAFRQ  378

Query  996   QKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
             QK   Q++++D+HPWRPQRGLPER+VS+LRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ
Sbjct  379   QKVYSQMSLVDAHPWRPQRGLPERAVSILRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  438

Query  816   VSNWFINARVRLWKPMVEEMYLEEVK-EQDNIMGSSDGSRAAVDGGSGRERLDKKPNVV-  643
             VSNWFINARVRLWKPM+EEMY EE + EQ +    S+     + G         +PN + 
Sbjct  439   VSNWFINARVRLWKPMIEEMYSEETRGEQKDEANISNQENDMLTGPI------HEPNRMN  492

Query  642   RLDSECISSLINIP----AKAGGDHHQ------FGAVELDFSPYTHNSGGAVGYRPGERK  493
             R+D E +SS+I  P    A+     HQ      FG+   DF  Y H    AV Y      
Sbjct  493   RVDPESLSSIITNPSSITARKPSQTHQHATTSSFGSA-FDFQLYGHQ---AVTY-----D  543

Query  492   TggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQN--L  319
                   VS  +G  Q+                                SLLDG+ Q   L
Sbjct  544   GDSSNQVSGKVGQLQYSS------------------------------SLLDGDHQALIL  573

Query  318   PYRNLMGSQLLHDLA  274
             P+RNLMG+QL+HD+ 
Sbjct  574   PHRNLMGAQLVHDIV  588



>gb|KDO76308.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
Length=454

 Score =   329 bits (844),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 203/248 (82%), Gaps = 11/248 (4%)
 Frame = -2

Query  1533  DRFLGKPE---NLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS-----  1378
             D FLGKP    N+ H +  + FQ+R+SKYL PAQE+LKEFC +GT Q+D  K KS     
Sbjct  203   DGFLGKPAIPPNIHHQT-GHQFQLRNSKYLAPAQEILKEFCSLGTKQNDATKLKSNKAKQ  261

Query  1377  QWQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVA  1198
             QW  ++  +SS+  SL SL F+ELQK K+KLL +L+EVDRRY+HY DQM AVVSSFEAVA
Sbjct  262   QWDDENAGSSSRKQSLCSLEFMELQKRKTKLLSMLEEVDRRYRHYCDQMKAVVSSFEAVA  321

Query  1197  GDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKM  1018
             G+GAA VYSALAS+ MSRHFRCLRD I+ Q++A KKAM EK+  +  PG ++GETPRLK+
Sbjct  322   GNGAARVYSALASKAMSRHFRCLRDGIVGQIQATKKAMGEKDPVA--PGTSRGETPRLKI  379

Query  1017  IDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             IDQTLRQQ+A QQ++MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ
Sbjct  380   IDQTLRQQRAFQQMSMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  439

Query  837   TGLSRSQV  814
             TGLSRSQV
Sbjct  440   TGLSRSQV  447



>ref|XP_009396189.1| PREDICTED: homeobox protein BEL1 homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   331 bits (849),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 209/455 (46%), Positives = 268/455 (59%), Gaps = 51/455 (11%)
 Frame = -2

Query  1539  EDDRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPK------RKS  1378
             E  + + + E L  P    F+   +SKY+ PAQELL E C +G   + + +      +K 
Sbjct  114   EQQQLMQEREGLAAPPPPPFYS-HNSKYVKPAQELLGELCSLGGEWNSQERSEKASHKKK  172

Query  1377  QWQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVA  1198
             +      ++SS   SL +++ LEL   K KLL +L+EV RRY+ Y +QM  VVSSFE++A
Sbjct  173   REPSSSSSSSSWQQSLCAMNHLELHNLKIKLLSMLEEVGRRYRKYGEQMEGVVSSFESIA  232

Query  1197  GDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKM  1018
             G+G+ATVY  LAS  MS+HF+ L+D I  Q+ A ++AM EK+ S+  P  T+GETPRLK+
Sbjct  233   GEGSATVYLTLASTAMSKHFKRLKDGIAGQINAVRRAMGEKDPSA--PAMTRGETPRLKL  290

Query  1017  IDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             +DQ +RQQKA+QQ  M    PWRPQRGLPE SVS+LRAWLFEHFLHPYPSDVDK ILARQ
Sbjct  291   LDQCMRQQKALQQ-GMAQQLPWRPQRGLPEHSVSILRAWLFEHFLHPYPSDVDKIILARQ  349

Query  837   TGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGR--ERL  664
             TGL+RSQVSNWFINARVR+WKPMVE+MY EE  E D    S        +  + +    L
Sbjct  350   TGLTRSQVSNWFINARVRIWKPMVEDMYAEETMELDGHSNSPTTGHQHSNNQNPKPNSTL  409

Query  663   DKKPNVVRL--DSECISSLINIPAKAGGDH------------------------HQFGAV  562
             ++KP  V+L  DSE +SSLIN       +H                          F  V
Sbjct  410   ERKPLPVQLLDDSESLSSLINSSHHDDQNHSFSSKTLLRQSQQQHQHHQQITGAENFSVV  469

Query  561   ELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPR  382
             + DFS  ++ S                  VSLTLGLQQ    G+   FS  SQ  L + R
Sbjct  470   DFDFSSGSYASDN------------LRSSVSLTLGLQQQSKGGMSSTFSAASQQPLLFAR  517

Query  381   DQIGDCPPVQYSLLDG-EGQNLPYRNLMGSQLLHD  280
                G    V +S++DG E Q LPYRNLMG Q+LHD
Sbjct  518   QHAGHGQYVGFSMVDGEEDQPLPYRNLMGIQMLHD  552



>ref|XP_006385772.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
 gb|ERP63569.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
Length=467

 Score =   328 bits (840),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 183/300 (61%), Positives = 220/300 (73%), Gaps = 25/300 (8%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDEDDRFLGK-PENLGHPS-Q  1489
             +GLSLSL  +NPS+IG +SF+ LR      + +  N     E+ RF GK P N+     Q
Sbjct  164   QGLSLSLCPSNPSSIGLHSFE-LR-----HTPTHQNQDNSQEEMRFFGKSPANIQQQMMQ  217

Query  1488  DYF-----------FQIRSSKYLGPAQELLKEFCCVGTTQSD----EPKRKSQWQQDDHT  1354
             D F           FQ+R+SKYLGPAQ+LL EFC + T Q D    +P +  Q   D + 
Sbjct  218   DGFLKAANLHHQAQFQLRNSKYLGPAQDLLNEFCNIRTKQGDALKQKPHKPKQLDDDQNG  277

Query  1353  TSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVY  1174
             +SS+  SL SL F+ELQK K+K+L +L+EVDRRY+HY DQM  +VSSFEAVAG GAA+VY
Sbjct  278   SSSRKQSLESLEFIELQKRKTKMLSMLEEVDRRYRHYCDQMKTMVSSFEAVAGTGAASVY  337

Query  1173  SALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQ  994
             SALAS+ MSRHFRCLRD I+AQ+ A KKAM EK+  +  PG TKGETPRLK++DQ LRQQ
Sbjct  338   SALASKAMSRHFRCLRDGIVAQIHATKKAMGEKDPVA--PGTTKGETPRLKILDQALRQQ  395

Query  993   KAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV  814
             +A QQ++MM+SHPWRPQRGLPERSVS LRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ 
Sbjct  396   RAFQQMSMMESHPWRPQRGLPERSVSFLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQA  455


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 9/72 (13%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSD-SAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQ  1810
             +S +MV++  + Y D S+ N  IQ+ H+++Q+Q +E NPEI+NL++GME M+GF  KNLQ
Sbjct  9     KSRNMVSSGSFCYPDVSSSNPTIQT-HLVNQIQGYESNPEIFNLTTGME-MIGFS-KNLQ  65

Query  1809  AQ-----SDMWK  1789
              Q     S MWK
Sbjct  66    HQQSDSNSVMWK  77



>ref|XP_006439495.1| hypothetical protein CICLE_v10019130mg [Citrus clementina]
 gb|ESR52735.1| hypothetical protein CICLE_v10019130mg [Citrus clementina]
Length=489

 Score =   327 bits (839),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 202/248 (81%), Gaps = 11/248 (4%)
 Frame = -2

Query  1533  DRFLGKPE---NLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS-----  1378
             D FLGKP    N+ H +  + FQ+R+SKYL PAQE+LKEFC +GT Q+D  K KS     
Sbjct  238   DGFLGKPAIPPNIHHQT-GHQFQLRNSKYLAPAQEILKEFCSLGTKQNDATKLKSNKAKQ  296

Query  1377  QWQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVA  1198
             QW  ++  +SS+  SL SL F+ELQK K+KLL +L+EVDRRY+HY DQM AVVSSFEAVA
Sbjct  297   QWDDENAGSSSRKQSLCSLEFMELQKRKTKLLSMLEEVDRRYRHYCDQMKAVVSSFEAVA  356

Query  1197  GDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKM  1018
             G+GAA VYSALAS+ MSRHFRCLRD I+ Q++A KKAM EK+  +  PG ++GETPRLK+
Sbjct  357   GNGAARVYSALASKAMSRHFRCLRDGIVGQIQATKKAMGEKDPVA--PGTSRGETPRLKI  414

Query  1017  IDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             IDQ LRQQ+A QQ++MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ
Sbjct  415   IDQALRQQRAFQQMSMMESHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  474

Query  837   TGLSRSQV  814
             TGLSRSQV
Sbjct  475   TGLSRSQV  482


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 8/72 (11%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSD-SAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQ  1810
             +S +++++ G+ YSD S+ N  +   HMM+Q+Q FE N EI+NL++GME M+GF  KNLQ
Sbjct  9     KSRNIISSGGFCYSDVSSSNPTLHQTHMMNQIQGFEGNHEIFNLTTGME-MIGFS-KNLQ  66

Query  1809  AQSD-----MWK  1789
               +      MWK
Sbjct  67    QHTSDNNSVMWK  78



>ref|XP_004964302.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Setaria 
italica]
 ref|XP_004964303.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Setaria 
italica]
Length=493

 Score =   323 bits (827),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 208/429 (48%), Positives = 262/429 (61%), Gaps = 77/429 (18%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCV---------GTTQSDEPKRKSQWQQDDHTTSSQ-----  1342
             FQ+RSSKYL P QELL EFC +         G          ++W  DD  TSS      
Sbjct  116   FQLRSSKYLVPVQELLSEFCSLEGDLLHAMNGGVNKRALNGGNKW--DDVETSSSSGLWG  173

Query  1341  NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
             + SL S+  LEL++ K++LL +++EVDRRY+ YR+QM AV  SFEAVAG GA+ VY+ LA
Sbjct  174   HPSLSSMDLLELERMKARLLSMVEEVDRRYRRYREQMRAVEVSFEAVAGAGASQVYTRLA  233

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekesssaAP-GATKGETPRLKMIDQTLRQQKAI  985
              R MSRHFRCLRDA++AQ++A +KAM E++ S+++P GATKG+TPRLK++DQ LRQQ+A 
Sbjct  234   LRAMSRHFRCLRDALVAQVRALRKAMGERDGSASSPAGATKGDTPRLKVLDQCLRQQRAF  293

Query  984   QQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNW  805
             QQ   ++++PWRPQRGLPER+V+VLRAWLFEHFLHPYP+DVDKHILARQTGLSRSQVSNW
Sbjct  294   QQPGTIENYPWRPQRGLPERAVAVLRAWLFEHFLHPYPNDVDKHILARQTGLSRSQVSNW  353

Query  804   FINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPNVVRLDSEC  625
             FINARVRLWKPM+E+MY EEVK+Q     + + S      G+G  + +++      +S  
Sbjct  354   FINARVRLWKPMIEDMYTEEVKQQSE--AAQNPSGGGAGAGAGAVKPEQQSTTTIGESAF  411

Query  624   -ISSLINIPAKA------GGDHHQFGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSL  466
              I+S  N P         GGDHH      L   P  H S                  VSL
Sbjct  412   RITSAGNNPTTTSINVTDGGDHHHL----LSSYPSLHGS------------------VSL  449

Query  465   TLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQN---LPYRNLM-G  298
             TLGLQQ           P +   +                +L GE      LPY +L  G
Sbjct  450   TLGLQQQ----------PFASPMMM---------------MLHGEETEEPVLPYIDLTAG  484

Query  297   SQLLHDLAG  271
             SQ LHDLAG
Sbjct  485   SQFLHDLAG  493



>gb|EEC79849.1| hypothetical protein OsI_21328 [Oryza sativa Indica Group]
Length=524

 Score =   323 bits (829),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 210/446 (47%), Positives = 271/446 (61%), Gaps = 60/446 (13%)
 Frame = -2

Query  1494  SQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRK---------SQWQQDDHTTSSQ  1342
             +Q   FQ+R SKYLGP + LL EFC +     D  K++          +W   + + S  
Sbjct  99    AQPLMFQLRGSKYLGPVKALLAEFCSLDVEAMDGAKQQRPPNPNPKIGKWDDVEGSGSWG  158

Query  1341  NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
             N SL S+  L+L++ K+++L +++EVDRRY+ YR+QM AV  SFEAVAG GAA VY+ LA
Sbjct  159   NLSLSSMDLLDLERRKARILSMVEEVDRRYRRYREQMRAVEVSFEAVAGGGAAQVYTKLA  218

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekes------ssaAPGATKGETPRLKMIDQTLR  1000
              R MSRHFRCLRDA++ Q++A + AM E +       ++AAPGATKG+TPRL+++DQ LR
Sbjct  219   MRAMSRHFRCLRDALVGQVRALRNAMGESQRDAAGGVAAAAPGATKGDTPRLRVLDQCLR  278

Query  999   QQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRS  820
             QQ+A QQ   +DS PWRPQRGLPER+V+VLRAWLFEHFLHPYP+DVDKHILARQTGLSRS
Sbjct  279   QQRAFQQSGAVDSFPWRPQRGLPERAVAVLRAWLFEHFLHPYPNDVDKHILARQTGLSRS  338

Query  819   QVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRA---AVDGGSGRERLDKKPN  649
             QVSNWFINARVRLWKPM+E+MY EE K +     SSDG+     +  G   + R D K N
Sbjct  339   QVSNWFINARVRLWKPMIEDMYKEETKPE-----SSDGNNKLNPSAAGNKQQHRDDPKKN  393

Query  648   VVRLDSECI------------------SSLINIPAKAGG--DHHQFGAVELDFSPYTHNS  529
                  +E                    SS + IPA A    DHH   + +L    ++++S
Sbjct  394   YTATTAEASLVQQSSYHLHLRSSGNPNSSSLMIPAAASTSIDHHHDSSHQL-LGGHSYSS  452

Query  528   GGAVGYRPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQY  349
                + +  G       G VSLTLGLQQ           P +  S+ +   Q      +  
Sbjct  453   AAGLHHGHG-------GAVSLTLGLQQ--------QQQPFAA-SMMHQHQQQQQQSFMVE  496

Query  348   SLLDGEGQNLPYRNLMGSQLLHDLAG  271
             +  + E   LPYRNLM SQLLHD AG
Sbjct  497   AAEEEEDDVLPYRNLMESQLLHDFAG  522



>gb|ACU01963.1| bell1-like protein [Comandra umbellata]
Length=342

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 199/351 (57%), Positives = 228/351 (65%), Gaps = 65/351 (19%)
 Frame = -2

Query  1158  RVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQ  979
             R MS HFR LRD I+ Q+KA  KAM EK+ +   PG TKGETPRL+++DQTLRQQKA  Q
Sbjct  2     RAMSSHFRRLRDGIVDQIKAMNKAMGEKDGAMITPGTTKGETPRLRILDQTLRQQKAFWQ  61

Query  978   LTMMD-SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  802
             + M++ SHPWRPQRGLPE+SVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF
Sbjct  62    MNMVEGSHPWRPQRGLPEQSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  121

Query  801   INARVRLWKPMVEEMYLEEVK--EQDNIMGSSDGSRAAVDGGSGRER------------L  664
             INARVRLWKPMVEEMYLEE K  EQD+ + ++D        G+G  R             
Sbjct  122   INARVRLWKPMVEEMYLEETKEQEQDHALNAND-----EHNGNGNSRPKQNHPPHHSQAK  176

Query  663   DKKPN----VVRLDSECISSLINI--PAKAGGDHHQ---------------FGAVELDFS  547
             D+KP     V R+DSEC+SS+I+   P      H +               FGAVELDF+
Sbjct  177   DQKPTPDQLVTRMDSECLSSIISPTHPKSLSTKHTKTLQSMGRVAQAANPNFGAVELDFT  236

Query  546   PYTH------------NSGGAVGYRPGERKTggggGVSLTLGLQQH----GGSGIGLAFS  415
              Y              N+G A+      R    GGGVSLTLGLQQ     GGSG+ LAFS
Sbjct  237   NYNQQYGSGSISSSYMNNGNALDNFGSGR----GGGVSLTLGLQQEQAGKGGSGVSLAFS  292

Query  414   PTSQNSLFYPRDQIGDCPPVQYSLLDGEG---QNLPYRNLMGSQLLHDLAG  271
             P SQ+SL Y R  I DC  V+YSLLD      QNL YRNLMG+QLLHDLAG
Sbjct  293   P-SQSSLLYSRGHIEDCQTVEYSLLDHSSEAQQNLQYRNLMGAQLLHDLAG  342



>emb|CDP12057.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   318 bits (814),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 227/303 (75%), Gaps = 24/303 (8%)
 Frame = -2

Query  1662  KGLSLSL-SSTNPSAIGFNSF-----DDLRLMaassssSRLN----NIQHDE---DDRFL  1522
             +GLSLSL SS NPS IG  SF     DD+R   ++S   +      NIQ  +   +D FL
Sbjct  153   QGLSLSLGSSNNPSTIGLQSFELKHQDDMRFAPSTSRDGQFIGKSLNIQQQQQMMEDGFL  212

Query  1521  GKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKR-----KSQWQ-QDD  1360
             GK  NL H      FQIRSSKYL PAQELL EFC + T Q+D   +      SQWQ Q++
Sbjct  213   GKAANLHHQG---LFQIRSSKYLAPAQELLNEFCNLETKQTDRTSKLKLHKTSQWQDQEN  269

Query  1359  HTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAAT  1180
              +  S+  SL SL  +ELQK K+KLL +L+EVDRRYKHY +QM AVVSSFEAVAG+GAA 
Sbjct  270   ASNPSKMQSLCSLDLMELQKRKAKLLQMLEEVDRRYKHYCNQMKAVVSSFEAVAGNGAAA  329

Query  1179  VYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLR  1000
             VYSALAS+ MSRHFRCLRD I+ Q+KA KKA+ EK++++  PG T+GETPRL+++DQ LR
Sbjct  330   VYSALASKAMSRHFRCLRDGIVGQIKATKKALGEKDTAA--PGTTRGETPRLRLLDQALR  387

Query  999   QQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRS  820
             QQ+A QQ++MM+SHPWRPQRGLPER+VSVLRAWLFEHFLHPYP+DVDKHILARQTGLSRS
Sbjct  388   QQRAFQQMSMMESHPWRPQRGLPERAVSVLRAWLFEHFLHPYPTDVDKHILARQTGLSRS  447

Query  819   QVS  811
             Q S
Sbjct  448   QAS  450


 Score = 75.1 bits (183),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 8/68 (12%)
 Frame = -2

Query  1974  MVTNTGYWYSD-SAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQAQSD  1798
             MVT TGY YSD S +N  IQ+ H+++QLQSFE NPEIYNL++GME M+GFP KNLQ  S 
Sbjct  1     MVTTTGYCYSDPSNVNPSIQT-HIVTQLQSFESNPEIYNLTTGME-MIGFPSKNLQPTSH  58

Query  1797  -----MWK  1789
                  MWK
Sbjct  59    DNNSVMWK  66



>gb|EMS65600.1| Homeobox protein BEL1-like protein [Triticum urartu]
Length=457

 Score =   317 bits (812),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 197/433 (45%), Positives = 254/433 (59%), Gaps = 59/433 (14%)
 Frame = -2

Query  1497  PSQDYFFQIRSSKYLGPAQELLKEFCCV------GTTQSDEPKRKSQWQQDDHTTS--SQ  1342
             P Q   F++ SS+YLGPA+ELL EFC +      G      PK+  + +           
Sbjct  60    PMQQPPFRLNSSRYLGPARELLSEFCNLEGDAMNGGAMMRAPKQDGEVEASSPACGPWGA  119

Query  1341  NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
             N S+ S+ ++ L++ K++LL +++EVDR Y  YR++M A   SFEAVAG GAA VY+ +A
Sbjct  120   NPSVSSMDYMALERRKARLLSMIEEVDRCYWRYREKMRATEMSFEAVAGVGAAQVYTKMA  179

Query  1161  SRVMSRHFRCLRDAILAQ---LkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQK  991
              R MSRHFRCLRDA++ Q   LK +     + +    APGA+KG+TPRL+++DQ LR+Q+
Sbjct  180   MRAMSRHFRCLRDALVGQIRTLKKSMGESRDADGMLVAPGASKGDTPRLRVVDQCLRRQR  239

Query  990   AIQQL---TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRS  820
             A QQ      ++S PWRPQRGLPER+V+VLR+WLFEHFLHPYP+DVDKHILARQ+GLSRS
Sbjct  240   AFQQYGGGAAIESCPWRPQRGLPERAVAVLRSWLFEHFLHPYPNDVDKHILARQSGLSRS  299

Query  819   QVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKP----  652
             QVSNWFINARVRLWKPM+EEMY EE  + D             DGG+   R +  P    
Sbjct  300   QVSNWFINARVRLWKPMIEEMYAEETIQHD-------------DGGTSSGRGEPAPTDHH  346

Query  651   --NVVRLDSECISSLINIPAKAG----GDHHQFGAVELDFSPYTHNSGGAVGYRPGERKT  490
               N+    +  I+   N    +G    GD     ++ +D   + H      GY P  R  
Sbjct  347   NNNLAACTTVTITGDQNCHRLSGRNNPGDCFIPSSLVVDGGKFLH------GY-PSLRSD  399

Query  489   ggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYR  310
              G G VSLTLGLQQ        A     Q+SL      IG          +GE   LPYR
Sbjct  400   SGSGVVSLTLGLQQQQAFA-SPAMIMQQQSSLM-----IG---------AEGEDMVLPYR  444

Query  309   NLMGSQLLHDLAG  271
             NLMGS+LLHD  G
Sbjct  445   NLMGSELLHDFVG  457



>dbj|BAD67687.1| putative homeotic protein BEL1 [Oryza sativa Japonica Group]
 dbj|BAE48304.1| OsBEL protein [Oryza sativa Japonica Group]
Length=529

 Score =   318 bits (816),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 212/451 (47%), Positives = 272/451 (60%), Gaps = 65/451 (14%)
 Frame = -2

Query  1494  SQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRK---------SQWQQDDHTTSSQ  1342
             +Q   FQ+R SKYLGP + LL EFC +     D  K++          +W   + + S  
Sbjct  99    AQPLMFQLRGSKYLGPVKALLAEFCSLDVEAMDGAKQQRPPNPNPKIGKWDDVEGSGSWG  158

Query  1341  NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
             N SL S+  L+L++ K+++L +++EVDRRY+ YR+QM AV  SFEAVAG GAA VY+ LA
Sbjct  159   NLSLSSMDLLDLERRKARILSMVEEVDRRYRRYREQMRAVEVSFEAVAGGGAAQVYTKLA  218

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekes------ssaAPGATKGETPRLKMIDQTLR  1000
              R MSRHFRCLRDA++ Q++A + AM E +       ++AAPGATKG+TPRL+++DQ LR
Sbjct  219   MRAMSRHFRCLRDALVGQVRALRNAMGESQRDAAGGVAAAAPGATKGDTPRLRVLDQCLR  278

Query  999   QQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRS  820
             QQ+A QQ   +DS PWRPQRGLPER+V+VLRAWLFEHFLHPYP+DVDKHILARQTGLSRS
Sbjct  279   QQRAFQQSGAVDSFPWRPQRGLPERAVAVLRAWLFEHFLHPYPNDVDKHILARQTGLSRS  338

Query  819   QVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRA---AVDGGSGRERLDKKPN  649
             QVSNWFINARVRLWKPM+E+MY EE K +     SSDG+     +  G   + R D K N
Sbjct  339   QVSNWFINARVRLWKPMIEDMYKEETKPE-----SSDGNNKLNPSAAGNKQQHRDDPKKN  393

Query  648   VVRLDSEC------------------ISSLINIPAKAGG--DHHQFGAVELDFSPYTHNS  529
                  +E                    SS + IPA A    DHH   + +L    ++++S
Sbjct  394   YTATTAEASLVQQSSYHLHLRSSGNRNSSSLMIPAAASTSIDHHHDSSHQL-LGGHSYSS  452

Query  528   GGAVGYRPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQY  349
                + +  G       G VSLTLGLQQ           P +  S+ +   Q       Q 
Sbjct  453   AAGLHHGHG-------GAVSLTLGLQQ--------QQQPFAA-SMMHQHQQHQHQHQQQQ  496

Query  348   SLL-----DGEGQNLPYRNLMGSQLLHDLAG  271
             S +     + E   LPYRNLM SQLLHD AG
Sbjct  497   SFMVEAAEEEEDDVLPYRNLMESQLLHDFAG  527



>ref|NP_001056572.1| Os06g0108900 [Oryza sativa Japonica Group]
 dbj|BAF18486.1| Os06g0108900 [Oryza sativa Japonica Group]
Length=530

 Score =   318 bits (815),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 212/451 (47%), Positives = 272/451 (60%), Gaps = 65/451 (14%)
 Frame = -2

Query  1494  SQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRK---------SQWQQDDHTTSSQ  1342
             +Q   FQ+R SKYLGP + LL EFC +     D  K++          +W   + + S  
Sbjct  100   AQPLMFQLRGSKYLGPVKALLAEFCSLDVEAMDGAKQQRPPNPNPKIGKWDDVEGSGSWG  159

Query  1341  NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
             N SL S+  L+L++ K+++L +++EVDRRY+ YR+QM AV  SFEAVAG GAA VY+ LA
Sbjct  160   NLSLSSMDLLDLERRKARILSMVEEVDRRYRRYREQMRAVEVSFEAVAGGGAAQVYTKLA  219

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekes------ssaAPGATKGETPRLKMIDQTLR  1000
              R MSRHFRCLRDA++ Q++A + AM E +       ++AAPGATKG+TPRL+++DQ LR
Sbjct  220   MRAMSRHFRCLRDALVGQVRALRNAMGESQRDAAGGVAAAAPGATKGDTPRLRVLDQCLR  279

Query  999   QQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRS  820
             QQ+A QQ   +DS PWRPQRGLPER+V+VLRAWLFEHFLHPYP+DVDKHILARQTGLSRS
Sbjct  280   QQRAFQQSGAVDSFPWRPQRGLPERAVAVLRAWLFEHFLHPYPNDVDKHILARQTGLSRS  339

Query  819   QVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRA---AVDGGSGRERLDKKPN  649
             QVSNWFINARVRLWKPM+E+MY EE K +     SSDG+     +  G   + R D K N
Sbjct  340   QVSNWFINARVRLWKPMIEDMYKEETKPE-----SSDGNNKLNPSAAGNKQQHRDDPKKN  394

Query  648   VVRLDSEC------------------ISSLINIPAKAGG--DHHQFGAVELDFSPYTHNS  529
                  +E                    SS + IPA A    DHH   + +L    ++++S
Sbjct  395   YTATTAEASLVQQSSYHLHLRSSGNRNSSSLMIPAAASTSIDHHHDSSHQL-LGGHSYSS  453

Query  528   GGAVGYRPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQY  349
                + +  G       G VSLTLGLQQ           P +  S+ +   Q       Q 
Sbjct  454   AAGLHHGHG-------GAVSLTLGLQQ--------QQQPFAA-SMMHQHQQHQHQHQQQQ  497

Query  348   SLL-----DGEGQNLPYRNLMGSQLLHDLAG  271
             S +     + E   LPYRNLM SQLLHD AG
Sbjct  498   SFMVEAAEEEEDDVLPYRNLMESQLLHDFAG  528



>gb|AAK96704.1| homeotic protein BEL1 homolog [Arabidopsis thaliana]
Length=513

 Score =   317 bits (812),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 175/335 (52%), Positives = 225/335 (67%), Gaps = 43/335 (13%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEP------------KRKSQWQQDDH-------  1357
             FQI SSKYL PAQELL EFC +G  +SDE             K++ +W    H       
Sbjct  192   FQIGSSKYLSPAQELLSEFCSLGVKESDEEVMMMKHKKKQKGKQQEEWDTSHHSNNDQHD  251

Query  1356  ---TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGD  1192
                TTSS+ H   L SL F+ELQK K+KLL +L+E+ RRY HYR+QM    ++FEA  G 
Sbjct  252   QSATTSSKKHVPPLHSLEFMELQKRKAKLLSMLEELKRRYGHYREQMRVAAAAFEAAVGL  311

Query  1191  GAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPG-ATKGETPRLKMI  1015
             G A +Y+ALASR MSRHFRCL+D ++ Q++A  +A+ E+E  + A   A +GETPRL+++
Sbjct  312   GGAEIYTALASRAMSRHFRCLKDGLVGQIQATSQALGEREEDNRAVSIAARGETPRLRLL  371

Query  1014  DQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQT  835
             DQ LRQQK+ +Q+T++D+HPWRPQRGLPER+V+ LRAWLFEHFLHPYPSDVDKHILARQT
Sbjct  372   DQALRQQKSYRQMTLVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKHILARQT  431

Query  834   GLSRSQVSNWFINARVRLWKPMVEEMYLEEVK-EQDNIMGSSDGSRAAVDGGSGRERLDK  658
             GLSRSQVSNWFINARVRLWKPM+EEMY EE + EQ  I                   +D 
Sbjct  432   GLSRSQVSNWFINARVRLWKPMIEEMYCEETRSEQMEITNPM--------------MIDT  477

Query  657   KPN---VVRLDSECISSLINIPAKAGGDHHQFGAV  562
             KP+   ++R++ E +SS++  P    G +   G +
Sbjct  478   KPDPDQLIRVEPESLSSIVTNPTSKSGHNSTHGTM  512



>gb|EMT21256.1| Homeobox BEL1-like protein [Aegilops tauschii]
Length=457

 Score =   314 bits (804),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 247/425 (58%), Gaps = 55/425 (13%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCV------GTTQSDEPKRKSQWQQDDHTTS--SQNHSLGS  1324
             F++ SS+YLGPA+ELL EFC +      G      PKR  + +           N SL S
Sbjct  66    FRLNSSRYLGPARELLGEFCSLEGDAMNGGAMMRAPKRDGEVEASSPACGPWGANPSLSS  125

Query  1323  LHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSR  1144
             ++++ L++ K++LL +++EVDR Y+ YR++M A   SFEAVAG GAA VY+ LA R MSR
Sbjct  126   MNYMALERRKARLLSMIEEVDRCYRRYREKMRATELSFEAVAGTGAAQVYTKLAMRAMSR  185

Query  1143  HFRCLRDAILAQ---LkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQL-  976
             HFRCLRDA++ Q   LK +     + E    APGA+KG+TPRL+++DQ LR+Q+A QQ  
Sbjct  186   HFRCLRDALVGQIRTLKKSMGESRDAEGMLVAPGASKGDTPRLRVVDQCLRRQRAFQQYG  245

Query  975   --TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  802
                 ++S PWRPQRGLPER+V+VLR+WLFEHFLHPYP+DVDKHILARQ+GLSRSQVSNWF
Sbjct  246   GAAAIESCPWRPQRGLPERAVAVLRSWLFEHFLHPYPNDVDKHILARQSGLSRSQVSNWF  305

Query  801   INARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPNVVRL-DSEC  625
             INARVRLWKPM+EEMY EE  + D+  G+S G             L     V    D  C
Sbjct  306   INARVRLWKPMIEEMYAEETIQHDD-GGTSGGKGELAPTDHHNNNLAAWTTVTTTGDQSC  364

Query  624   --ISSLIN-----IPAKAGGDHHQFGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSL  466
               +S   N     IP+    D  QF     D+     +SG  +              VSL
Sbjct  365   HRLSGRNNPGDCFIPSSLVADGSQF---LHDYPSLCSDSGSGM--------------VSL  407

Query  465   TLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLL  286
             TLGLQQ              Q +   P   +    P+     + E   LPYRNLMGS+LL
Sbjct  408   TLGLQQ--------------QRAFTSPAMIMQQQSPLMIGA-EEEDMVLPYRNLMGSELL  452

Query  285   HDLAG  271
             HD  G
Sbjct  453   HDFVG  457



>ref|XP_010228131.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Brachypodium 
distachyon]
Length=394

 Score =   311 bits (798),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 195/423 (46%), Positives = 250/423 (59%), Gaps = 64/423 (15%)
 Frame = -2

Query  1467  SSKYLGPAQELLKEFCCVGTTQSDEPKRKS-QWQQDDHTTSSQNH--------SLGSLHF  1315
             SS+Y+GPA+ELL E C +    +  PK    QW  + + ++S ++        S  S+  
Sbjct  5     SSRYMGPARELLAELCSLTDHAARTPKAGGGQWDVEANYSASWDNNSNPGALLSYSSMDL  64

Query  1314  LELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFR  1135
             L LQ+ K++LL ++ EVDRRY+ YR+QM A   SF+AVAG GAA VY+ LA R MSRHFR
Sbjct  65    LALQRRKARLLSMVQEVDRRYRRYREQMRATELSFDAVAGTGAAQVYTKLAMRAMSRHFR  124

Query  1134  CLRDAILAQ---LkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLT-MM  967
              LRDA++ Q   L+             AAPGA++G+TPRL+++DQ LRQQ+A QQ     
Sbjct  125   SLRDALVRQVRALRKTMGEGDTTGGLFAAPGASRGDTPRLRVLDQCLRQQRAFQQSGGTT  184

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             +S+PWRPQRGLPER+V+VLR+WLFEHFLHPYP+DVDKHILARQTGLSRSQVSNWFINARV
Sbjct  185   ESYPWRPQRGLPERAVAVLRSWLFEHFLHPYPNDVDKHILARQTGLSRSQVSNWFINARV  244

Query  786   RLWKPMVEEMYL-EEVKEQ-----------DNIMGSSDGSRAAVDGGSGRERLDKKPNVV  643
             RLWKPM+EEMY  EE KEQ           D+  G++  + AA    +G    +  P+ +
Sbjct  245   RLWKPMIEEMYTEEETKEQGGGNGGGKTIPDDHHGNTGAAWAATRPITG----EIPPHRL  300

Query  642   RLDSECISSLINIPAKAGGDHHQFGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSLT  463
                S  +S+   IPA    D  Q       F  Y  ++GGA               VSLT
Sbjct  301   GGSSCFVSAAPIIPAN---DGQQL------FHSYLSSNGGA---------------VSLT  336

Query  462   LGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLH  283
             LGLQQ       +     S + +    DQ            + E   LPYRNLMGS+LLH
Sbjct  337   LGLQQRQQQPAMMIMQQRSSSLMLGAGDQE-----------EEEDVVLPYRNLMGSELLH  385

Query  282   DLA  274
             DLA
Sbjct  386   DLA  388



>ref|XP_003557261.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Brachypodium 
distachyon]
Length=457

 Score =   311 bits (796),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 194/425 (46%), Positives = 251/425 (59%), Gaps = 64/425 (15%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKS-QWQQDDHTTSSQNH--------SLGSL  1321
             + SS+Y+GPA+ELL E C +    +  PK    QW  + + ++S ++        S  S+
Sbjct  66    LNSSRYMGPARELLAELCSLTDHAARTPKAGGGQWDVEANYSASWDNNSNPGALLSYSSM  125

Query  1320  HFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRH  1141
               L LQ+ K++LL ++ EVDRRY+ YR+QM A   SF+AVAG GAA VY+ LA R MSRH
Sbjct  126   DLLALQRRKARLLSMVQEVDRRYRRYREQMRATELSFDAVAGTGAAQVYTKLAMRAMSRH  185

Query  1140  FRCLRDAILAQ---LkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLT-  973
             FR LRDA++ Q   L+             AAPGA++G+TPRL+++DQ LRQQ+A QQ   
Sbjct  186   FRSLRDALVRQVRALRKTMGEGDTTGGLFAAPGASRGDTPRLRVLDQCLRQQRAFQQSGG  245

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
               +S+PWRPQRGLPER+V+VLR+WLFEHFLHPYP+DVDKHILARQTGLSRSQVSNWFINA
Sbjct  246   TTESYPWRPQRGLPERAVAVLRSWLFEHFLHPYPNDVDKHILARQTGLSRSQVSNWFINA  305

Query  792   RVRLWKPMVEEMYL-EEVKEQ-----------DNIMGSSDGSRAAVDGGSGRERLDKKPN  649
             RVRLWKPM+EEMY  EE KEQ           D+  G++  + AA    +G    +  P+
Sbjct  306   RVRLWKPMIEEMYTEEETKEQGGGNGGGKTIPDDHHGNTGAAWAATRPITG----EIPPH  361

Query  648   VVRLDSECISSLINIPAKAGGDHHQFGAVELDFSPYTHNSGGAVGYRPGERKTggggGVS  469
              +   S  +S+   IPA  G         +  F  Y  ++GGA               VS
Sbjct  362   RLGGSSCFVSAAPIIPANDG---------QQLFHSYLSSNGGA---------------VS  397

Query  468   LTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQL  289
             LTLGLQQ       +     S + +    DQ            + E   LPYRNLMGS+L
Sbjct  398   LTLGLQQRQQQPAMMIMQQRSSSLMLGAGDQE-----------EEEDVVLPYRNLMGSEL  446

Query  288   LHDLA  274
             LHDLA
Sbjct  447   LHDLA  451



>dbj|BAJ91914.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=477

 Score =   310 bits (794),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 197/436 (45%), Positives = 256/436 (59%), Gaps = 51/436 (12%)
 Frame = -2

Query  1518  KPENLGHPS----QDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQ----QD  1363
             +P  +  PS    Q   F + SS+YLGPA+ELL EFC     + D   R +  Q      
Sbjct  73    QPFTVAPPSMMTMQQQSFWLNSSRYLGPARELLTEFC---NLEGDAMNRGATMQALKLDS  129

Query  1362  DHTTSS----QNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAG  1195
             D + +      N S+ S+ ++ L++ K++LL +++EVDR Y+ YR++M A   SF+AVAG
Sbjct  130   DKSPACGPWGANPSVSSMDYMALERRKTRLLSMVEEVDRCYRRYREKMWATEMSFDAVAG  189

Query  1194  DGAATVYSALASRVMSRHFRCLRDAILAQ---LkaakkamaekesssaAPGATKGETPRL  1024
              GAA VY+ LA R MSRHFRCLRDA++ Q   LK +     + +   AAPGA+KG+TPRL
Sbjct  190   MGAAQVYTKLAMRAMSRHFRCLRDALVGQIRTLKKSMGESRDADGMLAAPGASKGDTPRL  249

Query  1023  KMIDQTLRQQKAIQQL---TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKH  853
             +++DQ LR+Q+A QQ      ++S PWRPQRGLPER+V+VLR+WLFEHFLHPYP+DVDKH
Sbjct  250   RVVDQCLRRQRAFQQYGGAAAIESCPWRPQRGLPERAVAVLRSWLFEHFLHPYPNDVDKH  309

Query  852   ILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEE-VKEQDNIMGSSDGSRAAVDGGSG  676
             ILARQ+GLSRSQVSNWFINARVRLWKPM+EEMY EE ++  DN      G  +  D    
Sbjct  310   ILARQSGLSRSQVSNWFINARVRLWKPMIEEMYAEETIQHDDNGASGGRGEPSPTDHHKN  369

Query  675   RERLDKKPNVVRLDSECISSLINIPAKAGGDHHQFGAVELDFSPYTHNS-GGAVGYRPGE  499
             +     K   +R +S    S  N P+               F P +  + GG +   P  
Sbjct  370   KLAAWTKVATIRDESRHRLSSTNNPSDC-------------FIPSSLVAEGGQLHGYPTL  416

Query  498   RKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNL  319
                 G G VSLTLGLQQ   +    A     Q+SL    D+              E   L
Sbjct  417   HGDVGNGAVSLTLGLQQQ-RAFTSPAMMMQQQSSLMVGADE--------------EDVVL  461

Query  318   PYRNLMGSQLLHDLAG  271
             PYRNLMGS+LLHD AG
Sbjct  462   PYRNLMGSELLHDFAG  477



>dbj|BAJ85202.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=477

 Score =   310 bits (794),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 197/436 (45%), Positives = 256/436 (59%), Gaps = 51/436 (12%)
 Frame = -2

Query  1518  KPENLGHPS----QDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQ----QD  1363
             +P  +  PS    Q   F + SS+YLGPA+ELL EFC     + D   R +  Q      
Sbjct  73    QPFTVAPPSMMTMQQQSFWLNSSRYLGPARELLTEFC---NLEGDAMNRGATMQALKLDS  129

Query  1362  DHTTSS----QNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAG  1195
             D + +      N S+ S+ ++ L++ K++LL +++EVDR Y+ YR++M A   SF+AVAG
Sbjct  130   DKSPACGPWGANPSVSSMDYMALERRKTRLLSMVEEVDRCYRRYREKMWATEMSFDAVAG  189

Query  1194  DGAATVYSALASRVMSRHFRCLRDAILAQ---LkaakkamaekesssaAPGATKGETPRL  1024
              GAA VY+ LA R MSRHFRCLRDA++ Q   LK +     + +   AAPGA+KG+TPRL
Sbjct  190   MGAAQVYTKLAMRAMSRHFRCLRDALVGQVRTLKKSMGESRDADGMLAAPGASKGDTPRL  249

Query  1023  KMIDQTLRQQKAIQQL---TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKH  853
             +++DQ LR+Q+A QQ      ++S PWRPQRGLPER+V+VLR+WLFEHFLHPYP+DVDKH
Sbjct  250   RVVDQCLRRQRAFQQYGGAAAIESCPWRPQRGLPERAVAVLRSWLFEHFLHPYPNDVDKH  309

Query  852   ILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEE-VKEQDNIMGSSDGSRAAVDGGSG  676
             ILARQ+GLSRSQVSNWFINARVRLWKPM+EEMY EE ++  DN      G  +  D    
Sbjct  310   ILARQSGLSRSQVSNWFINARVRLWKPMIEEMYAEETIQHDDNGASGGRGEPSPTDHHKN  369

Query  675   RERLDKKPNVVRLDSECISSLINIPAKAGGDHHQFGAVELDFSPYTHNS-GGAVGYRPGE  499
             +     K   +R +S    S  N P+               F P +  + GG +   P  
Sbjct  370   KLAAWTKVATIRDESRHRLSSTNNPSDC-------------FIPSSLVAEGGQLHGYPTL  416

Query  498   RKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNL  319
                 G G VSLTLGLQQ   +    A     Q+SL    D+              E   L
Sbjct  417   HGDVGNGAVSLTLGLQQQ-RAFTSPAMMMQQQSSLMVGADE--------------EDVVL  461

Query  318   PYRNLMGSQLLHDLAG  271
             PYRNLMGS+LLHD AG
Sbjct  462   PYRNLMGSELLHDFAG  477



>dbj|BAJ89622.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90323.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=600

 Score =   311 bits (798),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 181/368 (49%), Positives = 239/368 (65%), Gaps = 41/368 (11%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCV-GTTQSDEPKRKSQWQQDDH-------TTSSQNHSLGS  1324
             +Q+R S +L P Q+LL+EFC +     S  PK+ +   Q++H       +    +  +  
Sbjct  161   WQLRGSSFLLPTQQLLQEFCSIPADADSKAPKKPTA--QEEHGGSSSSASWPPSSAQIQG  218

Query  1323  LHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSR  1144
             +   ELQ+ K+KL  +++EVDRRY+ YR+QM AV +SFEAVAG  AA VY+ +ASR +SR
Sbjct  219   MDAAELQRLKAKLYTMIEEVDRRYRRYREQMRAVAASFEAVAGQRAAAVYTRMASRTISR  278

Query  1143  HFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMD  964
             HFR +RD + AQ++A + A+ EK++ +A PG TKGETPRL+ +DQ LRQ KA Q   M++
Sbjct  279   HFRSVRDGVAAQVRAVRGALGEKDAGAAVPGMTKGETPRLRALDQCLRQHKAYQS-GMLE  337

Query  963   SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVR  784
             SHPWRPQRGLPER+VSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVR
Sbjct  338   SHPWRPQRGLPERAVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVR  397

Query  783   LWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGG-------------SGRERLDKKPNVV  643
             LWKPMVEEMY EE+K+++   G   G + A+  G             +   R ++KP   
Sbjct  398   LWKPMVEEMYAEEMKDKEEGSGGDGGGQPALQAGDLANPSPAAAGSYASEGRGEQKPTRA  457

Query  642   RL----DSECISSLINIPAKAGGDHHQFGAV-ELDFSPYTHNSGGAVGYRPGERKTgggg  478
             +L    D+  ++S+++I   A      FG + +LDF  Y   + G             G 
Sbjct  458   QLHQLHDAGSLASVVSIGQSADPQGLNFGMMDQLDFDAYEAATAG------------FGN  505

Query  477   GVSLTLGL  454
             GVSLTLGL
Sbjct  506   GVSLTLGL  513



>ref|XP_002436343.1| hypothetical protein SORBIDRAFT_10g000800 [Sorghum bicolor]
 gb|EER87710.1| hypothetical protein SORBIDRAFT_10g000800 [Sorghum bicolor]
Length=478

 Score =   308 bits (788),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 172/323 (53%), Positives = 217/323 (67%), Gaps = 38/323 (12%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFC-----CVGTTQSDEPKRKSQWQQDDHTTSSQNH------S  1333
             FQ+RSSKYL P Q+LL EFC      +       P+  ++W  DD  TSS +       S
Sbjct  129   FQLRSSKYLAPVQDLLSEFCSLEGDLLHAMNKRAPRAGNKW--DDVETSSSSSGLWGHPS  186

Query  1332  LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRV  1153
             L S+  LEL++ K++LL +++EVDRRY+ YR+QM AV  SFEAVAG GA+ VY+ LA R 
Sbjct  187   LSSMDLLELERRKARLLSMVEEVDRRYRRYREQMRAVEVSFEAVAGAGASQVYTRLALRA  246

Query  1152  MSRHFRCLRDAILAQLkaakkam------aekesssaAPGATKGETPRLKMIDQTLRQQK  991
             MSRHFRCLRDA++AQ++A +KAM          +++ A GATKG+TPRLK++DQ LRQQ+
Sbjct  247   MSRHFRCLRDALVAQVRALRKAMGERDGGPGAAAAATAAGATKGDTPRLKVLDQCLRQQR  306

Query  990   AIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVS  811
             A Q    ++++PWRPQRGLPER+V+VLRAWLFEHFLHPYP+DVDKHILARQTGLSRSQVS
Sbjct  307   AFQHPGTIENYPWRPQRGLPERAVAVLRAWLFEHFLHPYPNDVDKHILARQTGLSRSQVS  366

Query  810   NWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPNVVRLDS  631
             NWFINARVRLWKPM+EEMY EEV ++ N    +      +           KP  +    
Sbjct  367   NWFINARVRLWKPMIEEMYTEEVNQKSNATPQNPSGGGVI-----------KPEQM----  411

Query  630   ECISSLINIPAKAGGDHHQFGAV  562
                 S   +PA  GGDH  F A 
Sbjct  412   ----STTAVPAAIGGDHSHFLAT  430



>ref|NP_001140899.1| putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
 gb|ACF84914.1| unknown [Zea mays]
 gb|AFW75230.1| putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
Length=498

 Score =   308 bits (790),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 207/421 (49%), Positives = 257/421 (61%), Gaps = 64/421 (15%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCV------GTTQ---SDEPKRKSQWQQDDHTTSSQNH---  1336
             FQ+RSSKYLGPAQELL EFC +       T +   S      S+W  DD  TSS +    
Sbjct  124   FQLRSSKYLGPAQELLAEFCSLEGDLLHATNKQGASGAAAGNSRW--DDVETSSSSSAGL  181

Query  1335  ----SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSA  1168
                 SL S+  LEL++ K++LL +++EVDRRY+ YR+QM +V  SFEAVAG GA+ VY+ 
Sbjct  182   WGHLSLSSMDLLELERRKARLLSMVEEVDRRYRRYREQMRSVEVSFEAVAGAGASQVYTR  241

Query  1167  LASRVMSRHFRCLRDAILAQLkaakka--maekesssaAPGATKGETPRLKMIDQTLRQQ  994
             LA R MSRHFRCLRDA++AQ++A +KA    +   + AA GATKG+TPRLK++DQ LRQQ
Sbjct  242   LALRAMSRHFRCLRDALVAQVRALRKAMGERDGGPAGAAAGATKGDTPRLKVLDQCLRQQ  301

Query  993   KAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV  814
             +A Q    +D++PWRPQRGLPER+V+VLRAWLFEHFLHPYP+DVDKHILARQTGLSRSQV
Sbjct  302   RAFQHPGTIDNYPWRPQRGLPERAVAVLRAWLFEHFLHPYPNDVDKHILARQTGLSRSQV  361

Query  813   SNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPNVVRLD  634
             SNWFINARVRLWKPM+EEMY EEV    N   + D S+    GG     +  KP     +
Sbjct  362   SNWFINARVRLWKPMIEEMYTEEV----NPKPADDTSQNPSAGGGVGVGVAIKP-----E  412

Query  633   SECISSLINIPAKAGGDHHQFGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGL  454
              +  ++        GG  H FG     +     + GGA               VSLTLGL
Sbjct  413   QQVSTAAAGATIGGGGGDHLFGP---SYPSMYGSHGGA---------------VSLTLGL  454

Query  453   QQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLA  274
             QQ           P +   +   R       P+     D +   LPYR+LMGSQLLH  A
Sbjct  455   QQ----------QPFASTMMHQRR-------PLMTFQGDEQEPALPYRDLMGSQLLHHFA  497

Query  273   G  271
             G
Sbjct  498   G  498



>gb|AIB05777.1| HB transcription factor, partial [Zea mays]
Length=498

 Score =   308 bits (789),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 207/421 (49%), Positives = 257/421 (61%), Gaps = 64/421 (15%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCV------GTTQ---SDEPKRKSQWQQDDHTTSSQNH---  1336
             FQ+RSSKYLGPAQELL EFC +       T +   S      S+W  DD  TSS +    
Sbjct  124   FQLRSSKYLGPAQELLAEFCSLEGDLLHATNKQGASVAAAGNSRW--DDVETSSSSSAGL  181

Query  1335  ----SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSA  1168
                 SL S+  LEL++ K++LL +++EVDRRY+ YR+QM +V  SFEAVAG GA+ VY+ 
Sbjct  182   WGHLSLSSMDLLELERRKARLLSMVEEVDRRYRRYREQMRSVEVSFEAVAGAGASQVYTR  241

Query  1167  LASRVMSRHFRCLRDAILAQLkaakka--maekesssaAPGATKGETPRLKMIDQTLRQQ  994
             LA R MSRHFRCLRDA++AQ++A +KA    +   + AA GATKG+TPRLK++DQ LRQQ
Sbjct  242   LALRAMSRHFRCLRDALVAQVRALRKAMGERDGGPAGAAAGATKGDTPRLKVLDQCLRQQ  301

Query  993   KAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV  814
             +A Q    +D++PWRPQRGLPER+V+VLRAWLFEHFLHPYP+DVDKHILARQTGLSRSQV
Sbjct  302   RAFQHPGTIDNYPWRPQRGLPERAVAVLRAWLFEHFLHPYPNDVDKHILARQTGLSRSQV  361

Query  813   SNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPNVVRLD  634
             SNWFINARVRLWKPM+EEMY EEV    N   + D S+    GG     +  KP     +
Sbjct  362   SNWFINARVRLWKPMIEEMYTEEV----NPKPADDTSQNPSAGGGVGVGVAIKP-----E  412

Query  633   SECISSLINIPAKAGGDHHQFGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGL  454
              +  ++        GG  H FG     +     + GGA               VSLTLGL
Sbjct  413   QQVSTAAAGATIGGGGGDHLFGP---SYPSMYGSHGGA---------------VSLTLGL  454

Query  453   QQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGEGQNLPYRNLMGSQLLHDLA  274
             QQ           P +   +   R       P+     D +   LPYR+LMGSQLLH  A
Sbjct  455   QQ----------QPFASTMMHQRR-------PLMTFQGDEQEPALPYRDLMGSQLLHHFA  497

Query  273   G  271
             G
Sbjct  498   G  498



>ref|XP_006656551.1| PREDICTED: homeobox protein BEL1 homolog [Oryza brachyantha]
Length=511

 Score =   308 bits (788),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 201/443 (45%), Positives = 254/443 (57%), Gaps = 71/443 (16%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTT--QSDEPKRK---SQWQQDDHTTSSQ---NHSLGS  1324
             F +R SKYLGP +E+L EFC +       D  KR     +W   + ++SS    N SL S
Sbjct  100   FHLRGSKYLGPVKEMLAEFCSLEAEVHAMDGAKRAPKIGKWDDVERSSSSSPWGNLSLSS  159

Query  1323  LHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSR  1144
             +  L+L++ K+++L +++EVDRRY+ YR+QM AV  SFEAVAG GAA VY+ LA R MSR
Sbjct  160   MDLLDLERRKARILSMVEEVDRRYRRYREQMRAVEVSFEAVAGGGAAQVYTKLAMRAMSR  219

Query  1143  HFRCLRDAILAQ---LkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLT  973
             HFRCLRDA++ Q   L+      A   + +AAPGATKGETPRL+++DQ LRQQ++ QQ  
Sbjct  220   HFRCLRDALVGQVRALRKVMGDSAGGGAGAAAPGATKGETPRLRVLDQCLRQQRSFQQSG  279

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
              +D+ PWRPQRGLPER+V++LRAWLF+HFLHPYP+DVDKHILARQTGLSRSQVSNWFINA
Sbjct  280   AIDNFPWRPQRGLPERAVALLRAWLFDHFLHPYPNDVDKHILARQTGLSRSQVSNWFINA  339

Query  792   RVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAA----VDGGSG---RERLDKKPNVVRLD  634
             RVRLWKPM+E+MY EE K  +    +++ +         GG+G   + R DK        
Sbjct  340   RVRLWKPMIEDMYKEETKPAEESHHTANNNNNNKLNPSGGGAGNKQQHRDDKFYTTATPS  399

Query  633   SECISSLINIPA----------------------KAGGDHHQFGAVELDFSPYTHNSGGA  520
             S   +SL    +                        G  H  FG          H+   A
Sbjct  400   STVATSLAGESSYHHLRSSANANSSSLISAAASMDDGSRHQLFG----------HSYSSA  449

Query  519   VGYRPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLL  340
              G   G         VSLTLGLQQ        A S   Q   F           V+ +  
Sbjct  450   SGLHGG--------AVSLTLGLQQQQPFA---AMSMMQQQQSFM----------VEAAEE  488

Query  339   DGEGQNLPYRNLMGSQLLHDLAG  271
             + E   LPYRNLM SQLLHD AG
Sbjct  489   EDEEIVLPYRNLMESQLLHDFAG  511



>ref|NP_001065164.1| Os10g0534900 [Oryza sativa Japonica Group]
 gb|AAM88627.1| putative homeodomain protein [Oryza sativa Japonica Group]
 gb|AAP54799.1| Associated with HOX family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27078.1| Os10g0534900 [Oryza sativa Japonica Group]
 dbj|BAG90718.1| unnamed protein product [Oryza sativa Japonica Group]
Length=586

 Score =   304 bits (779),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 209/455 (46%), Positives = 279/455 (61%), Gaps = 64/455 (14%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCV---GTTQSDEPKRKSQWQQDDHTTSSQNHS------LG  1327
             + +R S++L P Q+LL+EFC +    TT      + ++  Q++  +   + S      + 
Sbjct  144   WHLRGSRFLLPTQQLLQEFCSLPVKSTTSPSSASKATKPPQEEAASGGGSSSWTAPTQIQ  203

Query  1326  SLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMS  1147
             S+   ELQ+ K KL  +L+EVDRRY+ Y +QM A+ +SFEAVAG+ AA  Y+ LASR +S
Sbjct  204   SMDAAELQRLKGKLYTMLEEVDRRYRRYCEQMRALAASFEAVAGERAAASYTRLASRTIS  263

Query  1146  RHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMM  967
             RHFR LRD ++AQL+A +K + EK+++   PG TKGETPRL+++DQ LRQ KA Q   M+
Sbjct  264   RHFRSLRDGVVAQLQAVRKQLGEKDTAV--PGMTKGETPRLRVLDQCLRQHKAYQ-AGML  320

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             +SHPWRPQRGLPER+VS+LRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV+NWFINARV
Sbjct  321   ESHPWRPQRGLPERAVSILRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVANWFINARV  380

Query  786   RLWKPMVEEMYLEEVKEQD------------NIMGSSDGSRAAVDGGSGRERLDKKPNVV  643
             RLWKPMVEEMY EE+K+++            N   SS  S     GG G +R ++KP+  
Sbjct  381   RLWKPMVEEMYAEEMKDEEGSGQSTQASNPQNPNPSSYTSEVRGGGGGGEDRGEQKPSRA  440

Query  642   RL--DSECISSLINIPAKAGG----DHHQ-----FGAV-ELDFSPYTHNSGGAVGYRPGE  499
             +L  D+  ++S+++I     G    DHH      FG + +LDF  Y            G 
Sbjct  441   QLLHDAGSLASVVSIGHGGAGRTMVDHHHHQSLNFGTMDQLDFDAYEAAG--------GG  492

Query  498   RKTggggGVSLTLGLQQ-----HGGSGIGLAFSPTSQNS-------LFYPRDQIGDCPP-  358
             +  G GGGVSLTLGLQQ     H G  +  A +    NS       LF    +     P 
Sbjct  493   QGFGAGGGVSLTLGLQQQHADPHDGVNVAFAAAAAPPNSSGVAAEYLFMGGGEHQQQLPQ  552

Query  357   -VQY-SLLDGEGQNLPYRNL----MGSQLLHDLAG  271
               Q+ ++++G+  +  YR L     G  LLHDLAG
Sbjct  553   TAQFGAVMEGDAASH-YRGLSATAAGFHLLHDLAG  586



>ref|XP_006829091.1| hypothetical protein AMTR_s00001p00262320 [Amborella trichopoda]
 gb|ERM96507.1| hypothetical protein AMTR_s00001p00262320 [Amborella trichopoda]
Length=498

 Score =   297 bits (761),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 214/481 (44%), Positives = 265/481 (55%), Gaps = 100/481 (21%)
 Frame = -2

Query  1533  DRFLGKPEN-------LGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQ  1375
             +RFL    N       L   S+    +I++S+YL PAQ+LL EFC +G+ + D+  R   
Sbjct  58    NRFLDSQSNASNIWPTLSLSSEKPMLEIKNSRYLVPAQKLLYEFCNLGSKR-DKSMRSIN  116

Query  1374  WQQDDHTTSSQNHSLGSLH---FLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEA  1204
              +    +TS+      S++     ELQK K         VD+RYK Y ++M +V SSFEA
Sbjct  117   GRSHGVSTSANMEPAPSVYSSDLFELQKRK---------VDKRYKQYCERMRSVASSFEA  167

Query  1203  VAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAP--GATKGETP  1030
             VAG GAA VY  +ASR MSRHFRCLRD I+AQL+A + A+ EKE++      GAT+GETP
Sbjct  168   VAGAGAAHVYLGMASRAMSRHFRCLRDGIVAQLRATRVALGEKEAAVMVSLNGATRGETP  227

Query  1029  RLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHI  850
              LK++DQ LR+Q+A+QQ+ MM++HPWRPQRGLPERSVS+LRAWLFEHFLHPYPSDVDKHI
Sbjct  228   SLKLVDQRLRRQRALQQMGMMEAHPWRPQRGLPERSVSLLRAWLFEHFLHPYPSDVDKHI  287

Query  849   LARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRE  670
             LARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEE KE           R   +  S   
Sbjct  288   LARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEAKEDIE-------DRQNPNPNSNSP  340

Query  669   RLDKKPNVVR--LDSECISSLI----------NIPAKAGGDHHQFGAVELDFSPYTHNSG  526
              +  +PN      DSE +SS++          N+P         F   E D S   H SG
Sbjct  341   FMPSEPNATAQDRDSESLSSIVISDTKDQVARNLPELG------FPYAEDDNSSQRHFSG  394

Query  525   GAVGYRPGERK-----------------------------TggggGVSLTLGLQQHGGSG  433
                    G+R+                             +  G GVSLTLGLQQ G   
Sbjct  395   MFPSEDSGQRQFSGNYTEESSVQLQFSGNYSDENSTHRQISMSGEGVSLTLGLQQGGAMN  454

Query  432   IGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDGE-------GQNLPYRNLMGSQLLHDLA  274
              G  FS   QN L +               L+GE        Q   YRNL+G  L+ D  
Sbjct  455   FG--FSSNPQNPLLF---------------LEGEDHGTGFGSQMGGYRNLVGGHLMRDYV  497

Query  273   G  271
             G
Sbjct  498   G  498



>dbj|BAK04286.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   300 bits (769),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 218/498 (44%), Positives = 292/498 (59%), Gaps = 93/498 (19%)
 Frame = -2

Query  1551  IQHDEDDRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQW  1372
             + HD D     + +  G P     + +RSS++L PAQ+LL+ +C +    +  PKR    
Sbjct  147   LPHDHDAATYAQAQGHGAP-----WPLRSSRFLAPAQQLLQGYCSLPVDTT--PKRGKPQ  199

Query  1371  QQD--------------DHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQ  1234
             QQD              D T S Q  ++ +L   EL++ + +L  +L+EVDRRY+ Y +Q
Sbjct  200   QQDEAGGGGEVSSSSTSDWTPSPQIQAMDAL---ELKRLRDRLYVMLEEVDRRYRRYCEQ  256

Query  1233  MTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAP  1054
             M  +   FEA AG+ AA+ Y+A+A+R +SRHFR LRD I+AQL+A +KA+ EK+ S   P
Sbjct  257   MRGLAGGFEAAAGERAASGYTAVAARTISRHFRSLRDGIVAQLQAVRKALGEKDVSP--P  314

Query  1053  GATKGETPRLKMIDQTLRQQKAIQQ--LTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLH  880
             G T+G+TPRLK++DQ +RQQKA+ Q    MMDSHPWRPQRGLPER+V++LRAWLFEHFL+
Sbjct  315   GMTRGDTPRLKVLDQCIRQQKAMHQNGGMMMDSHPWRPQRGLPERAVTILRAWLFEHFLN  374

Query  879   PYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVK-EQDNIMG-----  718
             PYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMY+EE+K EQ +  G     
Sbjct  375   PYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYVEEMKGEQQDDGGLNPNN  434

Query  717   -SSDGSRAA----------VDGGSGRERLDKKPNVVRL----DSECISSLINIPAKAGGD  583
              SS GS A+           D G      ++KP   +L    D+  ++S++NI A     
Sbjct  435   PSSSGSHASDAQGQQGAAAADEGERVVADERKPTRAQLHVGHDAGSLASVVNI-AGVQAR  493

Query  582   HHQFGAVE----LDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQH------GGSG  433
                +G ++    LDF  Y            G+   GG GGVSLTLGLQQH      GG G
Sbjct  494   MESYGVMDAGHHLDFDAYGGGQ--------GQGFGGGAGGVSLTLGLQQHDTHGHGGGGG  545

Query  432   IGLAF-SPTS----QNSLFYPRDQI---------GDCPPVQYSLLDGEG---------QN  322
             + +AF +P+S         +P +Q+         G    +Q+  + G+G         Q+
Sbjct  546   VNIAFGAPSSAQHGAGGFLFPGEQMDVMGLHPSGGHGQNIQFG-MGGQGAAEGSSHGVQD  604

Query  321   LPYRNL-MGSQLLHDLAG  271
               YR +  G  LL DLAG
Sbjct  605   QHYRGMSAGFHLLRDLAG  622



>dbj|BAJ99003.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03383.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   300 bits (768),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 218/498 (44%), Positives = 292/498 (59%), Gaps = 93/498 (19%)
 Frame = -2

Query  1551  IQHDEDDRFLGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQW  1372
             + HD D     + +  G P     + +RSS++L PAQ+LL+ +C +    +  PKR    
Sbjct  147   LPHDHDAATYAQAQGHGAP-----WPLRSSRFLAPAQQLLQGYCSLPVDTT--PKRGKPQ  199

Query  1371  QQD--------------DHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQ  1234
             QQD              D T S Q  ++ +L   EL++ + +L  +L+EVDRRY+ Y +Q
Sbjct  200   QQDEAGGGGEVSSSSTSDWTPSPQIQAMDAL---ELKRLRDRLYVMLEEVDRRYRRYCEQ  256

Query  1233  MTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAP  1054
             M  +   FEA AG+ AA+ Y+A+A+R +SRHFR LRD I+AQL+A +KA+ EK+ S   P
Sbjct  257   MRGLAGGFEAAAGERAASGYTAVAARTISRHFRSLRDGIVAQLQAVRKALGEKDVSP--P  314

Query  1053  GATKGETPRLKMIDQTLRQQKAIQQ--LTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLH  880
             G T+G+TPRLK++DQ +RQQKA+ Q    MMDSHPWRPQRGLPER+V++LRAWLFEHFL+
Sbjct  315   GMTRGDTPRLKVLDQCIRQQKAMHQNGGMMMDSHPWRPQRGLPERAVTILRAWLFEHFLN  374

Query  879   PYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVK-EQDNIMG-----  718
             PYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMY+EE+K EQ +  G     
Sbjct  375   PYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYVEEMKGEQQDDGGLNPNN  434

Query  717   -SSDGSRAA----------VDGGSGRERLDKKPNVVRL----DSECISSLINIPAKAGGD  583
              SS GS A+           D G      ++KP   +L    D+  ++S++NI A     
Sbjct  435   PSSSGSHASDAQGQQGAAAADEGERVVADERKPTRAQLHVGHDAGSLASVVNI-AGVPAR  493

Query  582   HHQFGAVE----LDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQH------GGSG  433
                +G ++    LDF  Y            G+   GG GGVSLTLGLQQH      GG G
Sbjct  494   MESYGVMDAGHHLDFDAYGGGQ--------GQGFGGGAGGVSLTLGLQQHDTHGHGGGGG  545

Query  432   IGLAF-SPTS----QNSLFYPRDQI---------GDCPPVQYSLLDGEG---------QN  322
             + +AF +P+S         +P +Q+         G    +Q+  + G+G         Q+
Sbjct  546   VNIAFGAPSSAQHGAGGFLFPGEQMDVMGLHPSGGHGQNIQFG-MGGQGAAEGSSHGVQD  604

Query  321   LPYRNL-MGSQLLHDLAG  271
               YR +  G  LL DLAG
Sbjct  605   QHYRGMSAGFHLLRDLAG  622



>ref|XP_004985907.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Setaria 
italica]
 ref|XP_004985908.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Setaria 
italica]
 ref|XP_004985909.1| PREDICTED: homeobox protein BEL1 homolog isoform X3 [Setaria 
italica]
Length=620

 Score =   298 bits (763),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 200/409 (49%), Positives = 262/409 (64%), Gaps = 59/409 (14%)
 Frame = -2

Query  1497  PSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRK----------SQWQQDD----  1360
             P     + +RSSK+L PAQ+LL+EFC +    +    ++          SQ QQ+D    
Sbjct  147   PQHAGAWHLRSSKFLVPAQQLLQEFCSLPVDSAAASNKRAKAVTAKQPSSQQQQEDGGEG  206

Query  1359  ---HTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDG  1189
                  + + +  + ++  LELQ+ K KL  +L+EVDRRY+ Y + M ++   FEAVAG+ 
Sbjct  207   SSSSASWAPSPQIQAMDALELQRLKDKLYIMLEEVDRRYRRYCELMRSLAGGFEAVAGER  266

Query  1188  AATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQ  1009
             AA  Y+ALASR +SRHFR LRD I+AQL+AA+KA+ EK+ S   PG T+G+TPRL+++DQ
Sbjct  267   AAAAYTALASRTISRHFRSLRDGIVAQLQAARKALGEKDMSV--PGMTRGDTPRLRVLDQ  324

Query  1008  TLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGL  829
              +RQQKA+ Q  MM+SHPWRPQRGLPER+V++LRAWLFEHFLHPYPSDVDKHILARQTGL
Sbjct  325   CIRQQKALTQAGMMESHPWRPQRGLPERAVTILRAWLFEHFLHPYPSDVDKHILARQTGL  384

Query  828   SRSQVSNWFINARVRLWKPMVEEMYLEEVKE-QDNIMGSSDG------------------  706
             SRSQVSNWFINARVRLWKPMVEEMY+EE+K+ Q +  G S G                  
Sbjct  385   SRSQVSNWFINARVRLWKPMVEEMYVEEMKDGQLDDGGGSGGQHSVNPNPSSSHASEAHG  444

Query  705   -----SRAAVDGGSGRERLDKKPNVVRL--DSECISSLINIPAKAGGDHH--QFGAVE-L  556
                   R   DG  G   +D+KP   +L  ++  ++S++NI    GG      FG ++ L
Sbjct  445   GGAAGGREVADG--GENGVDRKPTRAQLMHETGSLASVVNIGGAGGGVSRLANFGIMDHL  502

Query  555   DFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQ---HGGSGIGLAF  418
             DF  Y    GG  G +   ++ GG GGVSLTLGLQQ   H G G+ +AF
Sbjct  503   DFDAY----GG--GDQHNHQQAGGFGGVSLTLGLQQHDFHDGGGVNIAF  545



>ref|XP_009396457.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
Length=703

 Score =   298 bits (764),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 190/432 (44%), Positives = 248/432 (57%), Gaps = 65/432 (15%)
 Frame = -2

Query  1521  GKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQ  1342
             G+  ++G+ S       R+S+Y   AQELL+EFC VG  Q     + S+  +   +TS+ 
Sbjct  291   GQQLHMGYSSMGVVNVPRNSRYTKAAQELLEEFCSVGRGQ----LKGSRVGRHRGSTSNT  346

Query  1341  NHS------------------------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQ  1234
             N +                        L      E Q+ K+KL+ +LDEVDRRY HY DQ
Sbjct  347   NRNPSGGGGGGAGGGGASTTSSKDVPPLSPADRFEHQRKKTKLISMLDEVDRRYNHYCDQ  406

Query  1233  MTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAP  1054
             M  VV+SF++V G G+AT Y+ALA + MSRHFRCL+DAI AQLK   + + +KE +S++ 
Sbjct  407   MQIVVNSFDSVMGFGSATPYTALAQKAMSRHFRCLKDAIAAQLKQTCELLGDKEGASSS-  465

Query  1053  GATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPY  874
             G TKGETPRL+++DQ+LRQQ+A  Q+ +++   WRPQRGLPERSV++LR WLFEHFLHPY
Sbjct  466   GVTKGETPRLRLLDQSLRQQRAFNQMGVIEQEAWRPQRGLPERSVNILRGWLFEHFLHPY  525

Query  873   PSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQD------------  730
             PSD DKH+LARQTGLSR+QVSNWFINARVRLWKPMVEEMY +E ++++            
Sbjct  526   PSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYTQESEDKEERESETSQQRTQ  585

Query  729   NIMGSSDGSRAAVDGGSGRERLDKKPNVVRLDSECISSLINIPAKAGGDHHQFGAVE---  559
             + M    G R   +  S  E      ++ + +   +SS  N P      H   GAV+   
Sbjct  586   SPMQQQQGLRPETNAASESEASPSTSSITQRNHRLVSSDDNPPPGLSATHQSTGAVDDSV  645

Query  558   LDFSPYTHNS-------GGAVGYRPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQN  400
             L    Y H         G A G R G       G VSLTLGL+  GGS        TS+ 
Sbjct  646   LIGDMYHHYGVAATSALGPAAGMRFG-----AAGDVSLTLGLRHAGGS--------TSEK  692

Query  399   SLFYPRDQIGDC  364
             S F  RD  G C
Sbjct  693   SRFSARD-FGGC  703



>ref|XP_009614985.1| PREDICTED: BEL1-like homeodomain protein 4 [Nicotiana tomentosiformis]
Length=659

 Score =   297 bits (761),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/254 (59%), Positives = 190/254 (75%), Gaps = 9/254 (4%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG--------TTQSDEPKRKSQWQQDDHTTSSQNHSLGSLH  1318
             +R+S+Y+  AQELL+EFCCVG          + ++    S  + +D  +S  +  L +  
Sbjct  262   LRNSRYVKAAQELLEEFCCVGRGNFKNQRVKKYEDENPNSNTESEDRGSSKDHPPLSAAE  321

Query  1317  FLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHF  1138
               E Q+ K KLL +LDEVD RY  Y +QM A+V+SF+++ G GAA  Y+ALA + MSRHF
Sbjct  322   RCEYQRRKIKLLSMLDEVDARYTRYCEQMQAMVNSFDSMIGYGAAAPYTALAQKAMSRHF  381

Query  1137  RCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSH  958
             RC++DAI+AQLK   K + EK+ + +  G TKGETPRLKM+DQ LRQQKA+ Q+ M+DS 
Sbjct  382   RCIKDAIVAQLKQTCKYLGEKDVTGSG-GLTKGETPRLKMLDQKLRQQKALHQMGMLDSD  440

Query  957   PWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLW  778
              WRPQRGLPERSV+VLRAWLFEHFLHPYPS+ DKH+L+RQTGLS++QVSNWFINARVRLW
Sbjct  441   AWRPQRGLPERSVNVLRAWLFEHFLHPYPSEADKHLLSRQTGLSKNQVSNWFINARVRLW  500

Query  777   KPMVEEMYLEEVKE  736
             KPMVEEMY +E KE
Sbjct  501   KPMVEEMYQQETKE  514



>ref|XP_003538830.1| PREDICTED: BEL1-like homeodomain protein 2-like [Glycine max]
Length=705

 Score =   297 bits (760),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 186/258 (72%), Gaps = 10/258 (4%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTT----------SSQNHSLGS  1324
             +R+SKY   AQELL+EFC VG  Q  + K   Q    +             +     L +
Sbjct  269   LRNSKYAKAAQELLEEFCSVGRGQFKKSKFNRQNSNPNSNAGGGASPSSKDAPPPPPLSA  328

Query  1323  LHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSR  1144
                +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ + G GAA  Y+ALA + MSR
Sbjct  329   ADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLMMGFGAAVPYTALAQKAMSR  388

Query  1143  HFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMD  964
             HFRCL++AI AQLK + + + EK+ +  + G TKGETPRLKM++Q+LRQQ+A  Q+ MM+
Sbjct  389   HFRCLKEAITAQLKQSCEVLGEKDGAGNSGGLTKGETPRLKMLEQSLRQQRAFHQMGMME  448

Query  963   SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVR  784
                WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARVR
Sbjct  449   QEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVR  508

Query  783   LWKPMVEEMYLEEVKEQD  730
             LWKPMVEEMY +E+KE +
Sbjct  509   LWKPMVEEMYQQELKEAE  526



>gb|KHN42028.1| BEL1-like homeodomain protein 2 [Glycine soja]
Length=700

 Score =   296 bits (759),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 186/258 (72%), Gaps = 10/258 (4%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTT----------SSQNHSLGS  1324
             +R+SKY   AQELL+EFC VG  Q  + K   Q    +             +     L +
Sbjct  270   LRNSKYAKAAQELLEEFCSVGRGQFKKSKFNRQNSNPNSNAGGGASPSSKDAPPPPPLSA  329

Query  1323  LHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSR  1144
                +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ + G GAA  Y+ALA + MSR
Sbjct  330   ADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLMMGFGAAVPYTALAQKAMSR  389

Query  1143  HFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMD  964
             HFRCL++AI AQLK + + + EK+ +  + G TKGETPRLKM++Q+LRQQ+A  Q+ MM+
Sbjct  390   HFRCLKEAITAQLKQSCEVLGEKDGAGNSGGLTKGETPRLKMLEQSLRQQRAFHQMGMME  449

Query  963   SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVR  784
                WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARVR
Sbjct  450   QEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVR  509

Query  783   LWKPMVEEMYLEEVKEQD  730
             LWKPMVEEMY +E+KE +
Sbjct  510   LWKPMVEEMYQQELKEAE  527



>gb|AAN03625.1|AF406701_1 BEL1-related homeotic protein 22, partial [Solanum tuberosum]
Length=620

 Score =   294 bits (753),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 175/396 (44%), Positives = 236/396 (60%), Gaps = 55/396 (14%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQ----------------  1342
             +R+SKY+   QELL+EFCCVG  Q    K+ ++  ++++T++S                 
Sbjct  218   LRNSKYVKATQELLEEFCCVGKGQLF--KKINKVSRNNNTSTSPIINPSGSNNNNSSSSK  275

Query  1341  ---NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYS  1171
                  +L +   L+ Q+ K KLL +LDEV++RY HY +QM  VV+SF+ V G GAA  Y+
Sbjct  276   AIIPPNLSTAERLDHQRRKVKLLSMLDEVEKRYNHYCEQMQMVVNSFDLVMGFGAAVPYT  335

Query  1170  ALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQK  991
             ALA + MSRHF+CL+D + AQLK   +A+ EK++SS++ G TKGETPRLK+++Q+LRQQ+
Sbjct  336   ALAQKAMSRHFKCLKDGVAAQLKKTCEALGEKDASSSS-GLTKGETPRLKVLEQSLRQQR  394

Query  990   AIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVS  811
             A QQ+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QV+
Sbjct  395   AFQQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVA  454

Query  810   NWFINARVRLWKPMVEEMYLEEVKEQD------------------NIMGSSDGSRAAV-D  688
             NWFINARVRLWKPMVEEMY  EV E D                  NI+ +++ +      
Sbjct  455   NWFINARVRLWKPMVEEMYQREVNEDDVDDMQENQNSTNTQIPTPNIIITTNSNITETKS  514

Query  687   GGSGRERLDKKP--NVVRLDSECI-----------SSLINIPA-KAGGDHHQFGAVELDF  550
               +     DKKP  NV  +D   +           + L N P  +   DH  +     ++
Sbjct  515   AATATIASDKKPQINVSEIDPSIVAMNTHYSSSMPTQLTNFPTIQDESDHILYRRSGAEY  574

Query  549   SPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQHG  442
                   S   +G       T     VSLTLGL+  G
Sbjct  575   GTTNMASNSEIGSNMITFGTTTASDVSLTLGLRHAG  610



>gb|AAN03623.1|AF406699_1 BEL1-related homeotic protein 13 [Solanum tuberosum]
Length=567

 Score =   292 bits (748),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 153/282 (54%), Positives = 197/282 (70%), Gaps = 15/282 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNH--------SLGSLH  1318
             +R+SKY   AQELL+EFC VG  +  +   K+     +   S  N+        +L +  
Sbjct  163   LRNSKYAKAAQELLEEFCSVGRGKLKKTNNKAAANNPNTNPSGANNEASSKDVPTLSAAD  222

Query  1317  FLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHF  1138
              +E Q+ K KLL ++DEVDRRY HY +QM  VV+SF+ V G G A  Y+ALA + MSRHF
Sbjct  223   RIEHQRRKVKLLSMVDEVDRRYNHYCEQMQMVVNSFDLVMGFGTAVPYTALAQKAMSRHF  282

Query  1137  RCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSH  958
             RCL+DAI AQLK + + + EK++ ++  G TKGETPRLKM++Q+LRQQ+A  Q+ MM+  
Sbjct  283   RCLKDAIGAQLKQSCELLGEKDAGNS--GLTKGETPRLKMLEQSLRQQRAFHQMGMMEQE  340

Query  957   PWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLW  778
              WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARVRLW
Sbjct  341   AWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLW  400

Query  777   KPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKP  652
             KPMVE+MY +E K++D      DG   +    SG   + + P
Sbjct  401   KPMVEDMYQQEAKDED-----GDGDEKSQSQNSGNNIIAQTP  437



>ref|XP_006385770.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
 gb|ERP63567.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
Length=434

 Score =   287 bits (735),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 159/279 (57%), Positives = 194/279 (70%), Gaps = 25/279 (9%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNNIQHDEDDRFLGK-PENLGHPS-Q  1489
             +GLSLSL  +NPS+IG +SF+ LR      + +  N     E+ RF GK P N+     Q
Sbjct  164   QGLSLSLCPSNPSSIGLHSFE-LR-----HTPTHQNQDNSQEEMRFFGKSPANIQQQMMQ  217

Query  1488  DYF-----------FQIRSSKYLGPAQELLKEFCCVGTTQSD----EPKRKSQWQQDDHT  1354
             D F           FQ+R+SKYLGPAQ+LL EFC + T Q D    +P +  Q   D + 
Sbjct  218   DGFLKAANLHHQAQFQLRNSKYLGPAQDLLNEFCNIRTKQGDALKQKPHKPKQLDDDQNG  277

Query  1353  TSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVY  1174
             +SS+  SL SL F+ELQK K+K+L +L+EVDRRY+HY DQM  +VSSFEAVAG GAA+VY
Sbjct  278   SSSRKQSLESLEFIELQKRKTKMLSMLEEVDRRYRHYCDQMKTMVSSFEAVAGTGAASVY  337

Query  1173  SALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQ  994
             SALAS+ MSRHFRCLRD I+AQ+       A  E    APG TKGETPRLK++DQ LRQQ
Sbjct  338   SALASKAMSRHFRCLRDGIVAQI--HATKKAMGEKDPVAPGTTKGETPRLKILDQALRQQ  395

Query  993   KAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHP  877
             +A QQ++MM+SHPWRPQRGLPERSVS LRAWLFEHFLHP
Sbjct  396   RAFQQMSMMESHPWRPQRGLPERSVSFLRAWLFEHFLHP  434


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 9/72 (13%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSD-SAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNLQ  1810
             +S +MV++  + Y D S+ N  IQ+ H+++Q+Q +E NPEI+NL++GME M+GF  KNLQ
Sbjct  9     KSRNMVSSGSFCYPDVSSSNPTIQT-HLVNQIQGYESNPEIFNLTTGME-MIGFS-KNLQ  65

Query  1809  AQ-----SDMWK  1789
              Q     S MWK
Sbjct  66    HQQSDSNSVMWK  77



>gb|ACA61780.1| BIPINNATA [Solanum lycopersicum]
Length=675

 Score =   293 bits (751),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 187/253 (74%), Gaps = 7/253 (3%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG-----TTQSDEPKRKSQWQQDDHTTSSQNHSLGSLHFLE  1309
             +R+SKY   AQELL+EFC VG        +           ++  +S    +L +   +E
Sbjct  322   LRNSKYAKAAQELLEEFCSVGRGKLKKNNNKAAANNPSGGANNEASSKDVPTLSAADRIE  381

Query  1308  LQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCL  1129
              Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + MSRHFRCL
Sbjct  382   HQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAVPYTALAQKAMSRHFRCL  441

Query  1128  RDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWR  949
             +DAI AQLK + + + EK++ ++  G TKGETPRLKM++Q+LRQQ+A  Q+ MM+   WR
Sbjct  442   KDAIGAQLKQSCELLGEKDAGTS--GLTKGETPRLKMLEQSLRQQRAFHQMGMMEQEAWR  499

Query  948   PQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPM  769
             PQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARVRLWKPM
Sbjct  500   PQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPM  559

Query  768   VEEMYLEEVKEQD  730
             VE+MY +E K++D
Sbjct  560   VEDMYQQEAKDED  572



>ref|XP_009773433.1| PREDICTED: BEL1-like homeodomain protein 4 [Nicotiana sylvestris]
Length=657

 Score =   293 bits (750),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 148/254 (58%), Positives = 192/254 (76%), Gaps = 11/254 (4%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHSLGSL---------  1321
             +R+S+Y+  AQELL+EFCCVG       +R  +++ ++  +++++   GSL         
Sbjct  260   LRNSRYVKAAQELLEEFCCVGRGNFKN-QRVKKYEDENPNSNTESEDRGSLKDHPPLSAA  318

Query  1320  HFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRH  1141
                E Q+ K KLL +LDEVD RY  Y +QM A+V+SF+++ G GAA  Y+ALA + MSRH
Sbjct  319   ERSEYQRRKIKLLSMLDEVDARYTRYCEQMQAMVNSFDSMIGYGAAAPYTALAQKAMSRH  378

Query  1140  FRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDS  961
             FRC++DAI+AQLK   K + EK+ + +  G TKGETPRLKM+DQ LRQQKA+ Q+ M+DS
Sbjct  379   FRCIKDAIVAQLKQTCKYLGEKDVTGSG-GLTKGETPRLKMLDQKLRQQKALHQMGMLDS  437

Query  960   HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRL  781
               WRPQRGLPERSV+VLRAWLFEHFLHPYPS+ DKH+L+RQTGLS++QVSNWFINARVRL
Sbjct  438   DAWRPQRGLPERSVNVLRAWLFEHFLHPYPSEADKHLLSRQTGLSKNQVSNWFINARVRL  497

Query  780   WKPMVEEMYLEEVK  739
             WKPMVEEMY +E K
Sbjct  498   WKPMVEEMYQQETK  511



>ref|XP_007156875.1| hypothetical protein PHAVU_002G024800g [Phaseolus vulgaris]
 gb|ESW28869.1| hypothetical protein PHAVU_002G024800g [Phaseolus vulgaris]
Length=732

 Score =   294 bits (753),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 188/263 (71%), Gaps = 15/263 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQ--------------DDHTTSSQNH  1336
             +R++KY+  AQELL+EFC VG  Q  + K   Q                  D        
Sbjct  295   LRNTKYVKAAQELLEEFCSVGRGQFKKSKLNRQNSNPNSNPDGGGSSPSSKDAAIPPPPP  354

Query  1335  SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASR  1156
              L +   +E Q+ K KLL +LDE+DRRY HY +QM  VV+SF+ + G GAA  Y+ALA +
Sbjct  355   PLSAADRIEHQRRKVKLLSMLDEMDRRYNHYCEQMQMVVNSFDLMMGFGAAVPYTALAQK  414

Query  1155  VMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQL  976
              MSRHFRCL+DAI AQLK + + + EKE + A+ G TKGETPRLK+++Q+LRQQ+A  Q+
Sbjct  415   AMSRHFRCLKDAITAQLKQSCELLGEKEGAGAS-GLTKGETPRLKVLEQSLRQQRAFHQM  473

Query  975   TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFIN  796
              MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFIN
Sbjct  474   GMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFIN  533

Query  795   ARVRLWKPMVEEMYLEEVKEQDN  727
             ARVRLWKPMVEEMY +E+KE +N
Sbjct  534   ARVRLWKPMVEEMYQQELKEAEN  556



>ref|XP_004232087.1| PREDICTED: BEL1-like homeodomain protein 2 [Solanum lycopersicum]
Length=726

 Score =   294 bits (752),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 187/253 (74%), Gaps = 7/253 (3%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG-----TTQSDEPKRKSQWQQDDHTTSSQNHSLGSLHFLE  1309
             +R+SKY   AQELL+EFC VG        +           ++  +S    +L +   +E
Sbjct  322   LRNSKYAKAAQELLEEFCSVGRGKLKKNNNKAAANNPSGGANNEASSKDVPTLSAADRIE  381

Query  1308  LQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCL  1129
              Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + MSRHFRCL
Sbjct  382   HQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAVPYTALAQKAMSRHFRCL  441

Query  1128  RDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWR  949
             +DAI AQLK + + + EK++ ++  G TKGETPRLKM++Q+LRQQ+A  Q+ MM+   WR
Sbjct  442   KDAIGAQLKQSCELLGEKDAGTS--GLTKGETPRLKMLEQSLRQQRAFHQMGMMEQEAWR  499

Query  948   PQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPM  769
             PQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARVRLWKPM
Sbjct  500   PQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPM  559

Query  768   VEEMYLEEVKEQD  730
             VE+MY +E K++D
Sbjct  560   VEDMYQQEAKDED  572



>gb|KDP31824.1| hypothetical protein JCGZ_12285 [Jatropha curcas]
Length=812

 Score =   295 bits (756),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 188/267 (70%), Gaps = 20/267 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY+  AQELL+EFC VG  Q  + K   Q    +  T+                  
Sbjct  371   LRNSKYVKAAQELLEEFCSVGRGQFKKSKFSRQNTNPNSNTAGGGGGIGSGGTTGGGGSS  430

Query  1332  ------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYS  1171
                   L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G GAA  Y+
Sbjct  431   TKDFPPLSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAVPYT  490

Query  1170  ALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQK  991
             ALA + MSRHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRL+M++Q+LRQQ+
Sbjct  491   ALAQKAMSRHFRCLKDAIAAQLKHSCELLGEKDGAGTS-GITKGETPRLRMLEQSLRQQR  549

Query  990   AIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVS  811
             A  Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVS
Sbjct  550   AFHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVS  609

Query  810   NWFINARVRLWKPMVEEMYLEEVKEQD  730
             NWFINARVRLWKPMVEEMY +E KE++
Sbjct  610   NWFINARVRLWKPMVEEMYQQEAKEEE  636



>ref|XP_006338267.1| PREDICTED: BEL1-related homeotic protein 13 isoform X1 [Solanum 
tuberosum]
 ref|XP_006338268.1| PREDICTED: BEL1-related homeotic protein 13 isoform X2 [Solanum 
tuberosum]
Length=738

 Score =   294 bits (752),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/282 (55%), Positives = 196/282 (70%), Gaps = 15/282 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNH--------SLGSLH  1318
             +R+SKY   AQELL+EFC VG  +  +   K+     +   S  N+        +L +  
Sbjct  332   LRNSKYAKAAQELLEEFCSVGRGKLKKNNNKAAANNPNTNPSGANNEASSKDVPTLSAAD  391

Query  1317  FLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHF  1138
              +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + MSRHF
Sbjct  392   RIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAVPYTALAQKAMSRHF  451

Query  1137  RCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSH  958
             RCL+DAI AQLK   + + EK++ ++  G TKGETPRLKM++Q+LRQQ+A  Q+ MM+  
Sbjct  452   RCLKDAIGAQLKQCCELLGEKDAGTS--GLTKGETPRLKMLEQSLRQQRAFHQMGMMEQE  509

Query  957   PWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLW  778
              WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARVRLW
Sbjct  510   AWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLW  569

Query  777   KPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKP  652
             KPMVE+MY +E K+     G  DG   +    SG   + + P
Sbjct  570   KPMVEDMYQQEAKD-----GDGDGDEKSQSQNSGNNIIAQTP  606



>ref|XP_006344823.1| PREDICTED: BEL1-related homeotic protein 22 [Solanum tuberosum]
Length=672

 Score =   291 bits (745),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 150/268 (56%), Positives = 198/268 (74%), Gaps = 22/268 (8%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQ----------------  1342
             +R+SKY+   QELL+EFCCVG  Q    K+ ++  ++++T++S                 
Sbjct  270   LRNSKYVKATQELLEEFCCVGKGQLF--KKINKVFRNNNTSTSPIINPSGSNNNNSSSSK  327

Query  1341  ---NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYS  1171
                  +L +   L+ Q+ K+KLL +LDEV++RY HY +QM  VV+SF+ V G GAA  Y+
Sbjct  328   DIIPPNLSTAERLDHQRRKAKLLSMLDEVEKRYNHYCEQMQMVVNSFDLVMGFGAAVPYT  387

Query  1170  ALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQK  991
             ALA + MSRHF+CL+D + AQLK   +A+ EK++SS++ G TKGETPRLK+++Q+LRQQ+
Sbjct  388   ALAQKAMSRHFKCLKDGVAAQLKKTCEALGEKDASSSS-GLTKGETPRLKVLEQSLRQQR  446

Query  990   AIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVS  811
             A QQ+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QV+
Sbjct  447   AFQQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVA  506

Query  810   NWFINARVRLWKPMVEEMYLEEVKEQDN  727
             NWFINARVRLWKPMVEEMY  EV E D+
Sbjct  507   NWFINARVRLWKPMVEEMYQREVNEDDD  534



>ref|XP_007204284.1| hypothetical protein PRUPE_ppa001286mg [Prunus persica]
 gb|EMJ05483.1| hypothetical protein PRUPE_ppa001286mg [Prunus persica]
Length=862

 Score =   295 bits (756),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 158/300 (53%), Positives = 203/300 (68%), Gaps = 22/300 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY+  AQELL+EFC VG  Q  + K      + + T  S N +             
Sbjct  393   LRNSKYVKAAQELLEEFCSVGRGQLKKNKFGGTGGRHNSTNPSSNPAGSGGGGGASSSSS  452

Query  1332  -----LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSA  1168
                  L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV++F+ V G GAA  Y+A
Sbjct  453   KDVPPLSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNAFDLVMGFGAAVPYTA  512

Query  1167  LASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKA  988
             LA + MSRHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRLKM++Q+LRQQ+A
Sbjct  513   LAQKAMSRHFRCLKDAITAQLKHSCELLGEKDGAGTS-GITKGETPRLKMLEQSLRQQRA  571

Query  987   IQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN  808
               Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSN
Sbjct  572   FHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSN  631

Query  807   WFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPNVVRLDSE  628
             WFINARVRLWKPMVEEMY +E  E+   +G +  + A       RER ++  N   L+++
Sbjct  632   WFINARVRLWKPMVEEMYQQETNEE---VGGAAAAAADHHHQDQRERNNQNQNSSGLNAQ  688



>ref|XP_008241607.1| PREDICTED: BEL1-like homeodomain protein 4 [Prunus mume]
Length=862

 Score =   295 bits (755),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 158/300 (53%), Positives = 203/300 (68%), Gaps = 22/300 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY+  AQELL+EFC VG  Q  + K      + + T  S N +             
Sbjct  393   LRNSKYVKAAQELLEEFCSVGRGQLKKNKFGGTGGRHNSTNPSSNPAGSGGGGGASSSSS  452

Query  1332  -----LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSA  1168
                  L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV++F+ V G GAA  Y+A
Sbjct  453   KDVPPLSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNAFDLVMGFGAAVPYTA  512

Query  1167  LASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKA  988
             LA + MSRHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRLKM++Q+LRQQ+A
Sbjct  513   LAQKAMSRHFRCLKDAITAQLKHSCELLGEKDGAGTS-GITKGETPRLKMLEQSLRQQRA  571

Query  987   IQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN  808
               Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSN
Sbjct  572   FHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSN  631

Query  807   WFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPNVVRLDSE  628
             WFINARVRLWKPMVEEMY +E  E+   +G +  + A       RER ++  N   L+++
Sbjct  632   WFINARVRLWKPMVEEMYQQETNEE---VGGAAAAAADHHHQDQRERNNQNQNSSGLNAQ  688



>ref|XP_004238216.1| PREDICTED: BEL1-like homeodomain protein 4 [Solanum lycopersicum]
Length=692

 Score =   291 bits (745),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 188/256 (73%), Gaps = 12/256 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQ---------SDEPKRKSQWQQDDHTTSSQ-NHS-LG  1327
             +R+S+Y+   QELL+EFCCVG             D+    S  + +DH   S+ NH  L 
Sbjct  290   LRNSRYVKATQELLEEFCCVGRGNFKNQRVKKLDDDQNPNSNSESEDHRGPSKDNHPPLS  349

Query  1326  SLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMS  1147
             +    E Q+ K KLL +LDEVD RY  Y +QM A+V+SF++V G GAA  Y+ALA + MS
Sbjct  350   AAERSEYQRRKIKLLSMLDEVDARYTRYCEQMQAMVNSFDSVIGYGAAAPYTALAQKAMS  409

Query  1146  RHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMM  967
             RHFRC++DAI+ QLK   K + EK+ +  + G TKGETPRLKM+DQ LRQQKA+ Q+ M+
Sbjct  410   RHFRCIKDAIVGQLKQTCKYLGEKDVTGTS-GLTKGETPRLKMLDQKLRQQKALHQMGML  468

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             DS  WRPQRGLPERSV+VLRAWLFEHFLHPYPS+ DKH+L+RQTGLS++QVSNWFINARV
Sbjct  469   DSDAWRPQRGLPERSVNVLRAWLFEHFLHPYPSEADKHLLSRQTGLSKNQVSNWFINARV  528

Query  786   RLWKPMVEEMYLEEVK  739
             RLWKPMVEEMY +E K
Sbjct  529   RLWKPMVEEMYQQETK  544



>emb|CDX76849.1| BnaC08g34350D [Brassica napus]
Length=601

 Score =   288 bits (738),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 176/408 (43%), Positives = 233/408 (57%), Gaps = 54/408 (13%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHT-----------TSSQNH  1336
              + +R+SKY  PAQELL+EFC VG     + K       + +T            ++ N 
Sbjct  211   IYTLRNSKYTKPAQELLEEFCSVGRGHFKKNKLSRNNNSNPNTSGGGGSSSSPGVANDNP  270

Query  1335  SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASR  1156
              L     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ LA +
Sbjct  271   PLSPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAIPYTTLAQK  330

Query  1155  VMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAIQQ  979
              MSRHFRCL+DA++ QLK + + + E E++ +A+ G TKGETPRL++++Q+LRQQ+A   
Sbjct  331   AMSRHFRCLKDAVVVQLKRSCELLGENETAGAASSGLTKGETPRLRLLEQSLRQQRAFHH  390

Query  978   LTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  799
             + MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTGLSR+QVSNWFI
Sbjct  391   MGMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFI  450

Query  798   NARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPNVVRL------  637
             NARVRLWKPMVEEMY +E KE++       G        +     D KPN          
Sbjct  451   NARVRLWKPMVEEMYQQEAKERE-----EKGVEDYQQTNNSSNNSDTKPNESNFTLVQTI  505

Query  636   -----------------DSECI-SSLINIPAKAGGDHHQFGAVELDFSPYTHNSGGAVGY  511
                              DS  + SS++     +  D       + DFS +   + G + +
Sbjct  506   TAQTPTTTMMTPTPHENDSSFLPSSVVTAVPHSVSDSFTAATCQQDFSDHFQVNDGVIRF  565

Query  510   RPGERKTggggGVSLTLGLQQHGGSGIGLAFSPTSQNSLFYPRDQIGD  367
                   T   G VSLTLGL+  G         P ++N  F  RD  GD
Sbjct  566   -----GTKQAGDVSLTLGLRHTGN-------MPDNKNPSFSVRD-FGD  600



>dbj|BAJ88032.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score =   292 bits (748),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 183/262 (70%), Gaps = 17/262 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQ----------------SDEPKRKSQWQQDDHTTSSQ  1342
             +R+SKY   AQELL EFC VG  Q                S      S   Q   + S +
Sbjct  346   LRNSKYTRAAQELLDEFCSVGRGQTIKGGGRGGSSSNPNASKGGPSSSGAAQSPSSASKE  405

Query  1341  NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
                L      E Q+ K+KL+ +LDEVDRRY HY DQM  VV+ F++V G GAAT Y+ALA
Sbjct  406   PPQLSPADRFEQQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALA  465

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQ  982
              + MSRHFRCL+DAI AQL+   + + EK++ +++ G TKGETPRL+ IDQ+LRQQ+A  
Sbjct  466   QKAMSRHFRCLKDAIAAQLRHTCELLGEKDAGTSS-GLTKGETPRLRAIDQSLRQQRAFH  524

Query  981   QLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  802
              + MM+   WRPQRGLPERSVS+LR+WLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWF
Sbjct  525   HMGMMEQEAWRPQRGLPERSVSILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWF  584

Query  801   INARVRLWKPMVEEMYLEEVKE  736
             INARVRLWKPM+EEMY +E KE
Sbjct  585   INARVRLWKPMIEEMYQQETKE  606



>ref|XP_010243287.1| PREDICTED: BEL1-like homeodomain protein 2 [Nelumbo nucifera]
Length=809

 Score =   293 bits (751),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 192/264 (73%), Gaps = 23/264 (9%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R SKY   AQELL+EFC VG  Q     + ++  +   T+++ NHS             
Sbjct  371   LRHSKYAKAAQELLEEFCSVGRGQF----KNNRLGKHHGTSANPNHSNSAAGGGSPSSSK  426

Query  1332  ----LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSAL  1165
                 L +   ++ Q+ K KL+ +LDEVDRRY HY +QM  VV+SF++V G GAAT Y+AL
Sbjct  427   EQLPLSATDRIDYQRRKVKLMSMLDEVDRRYNHYCEQMQMVVNSFDSVMGFGAATPYTAL  486

Query  1164  ASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAI  985
             A + MSRHFRCL+DAI AQLK   + + EKE+ ++  G TKGETPRL++++Q+LRQQ+A 
Sbjct  487   AQKAMSRHFRCLKDAIAAQLKHICELLGEKEAGAS--GITKGETPRLRLLEQSLRQQRAF  544

Query  984   QQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNW  805
              Q+ MM+   WRPQRGLPERSV++LR+WLFEHFLHPYPSD DKH+LARQTGLSR+QVSNW
Sbjct  545   HQMGMMEQEAWRPQRGLPERSVNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNW  604

Query  804   FINARVRLWKPMVEEMYLEEVKEQ  733
             FINARVRLWKPMVEEMY +E KE+
Sbjct  605   FINARVRLWKPMVEEMYQQEAKEE  628



>ref|XP_009419344.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419353.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419362.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419368.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
Length=683

 Score =   290 bits (743),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 155/277 (56%), Positives = 190/277 (69%), Gaps = 21/277 (8%)
 Frame = -2

Query  1509  NLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPK--RKSQWQQDDHTTSSQNH  1336
             ++G+ + D    +R+SKY   AQELL+EFC VG  Q    K  RK     + +   S   
Sbjct  305   HMGYGAIDAISVLRNSKYARAAQELLEEFCSVGRGQLTGTKLGRKRGGSSNPNANPSGGG  364

Query  1335  S------------------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSF  1210
                                L S    E Q+ K+KL+ +LDEVDRRY HY DQM  VV+SF
Sbjct  365   GSSSAAAACSSSPKLDTTPLSSADKFEYQRRKAKLISMLDEVDRRYTHYCDQMQVVVNSF  424

Query  1209  EAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETP  1030
             ++V G GAA  Y+ALA + MSRHFRCL+DAI AQLK   + + EKE +S  PG TKGETP
Sbjct  425   DSVVGFGAAAPYTALAQKAMSRHFRCLKDAIAAQLKQTCETLGEKEVASN-PGITKGETP  483

Query  1029  RLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHI  850
             RL+++DQ+LRQQ+A  Q+ MMD   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DK +
Sbjct  484   RLRLLDQSLRQQRAFHQIGMMDQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKLL  543

Query  849   LARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVK  739
             L+RQTGLSR+QVSNWFINARVRLWKPMVEEMY +E +
Sbjct  544   LSRQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEFE  580



>gb|AAK38645.1|AF334758_1 homeodomain protein JUBEL1 [Hordeum vulgare subsp. vulgare]
Length=759

 Score =   292 bits (747),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 183/262 (70%), Gaps = 17/262 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQ----------------SDEPKRKSQWQQDDHTTSSQ  1342
             +R+SKY   AQELL EFC VG  Q                S      S   Q   + S +
Sbjct  346   LRNSKYTRAAQELLDEFCSVGRGQTIKGGGRGGSSSNPNASKGGPSSSGAAQSPSSASKE  405

Query  1341  NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
                L      E Q+ K+KL+ +LDEVDRRY HY DQM  VV+ F++V G GAAT Y+ALA
Sbjct  406   PPQLSPADRFEQQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALA  465

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQ  982
              + MSRHFRCL+DAI AQL+   + + EK++ +++ G TKGETPRL+ IDQ+LRQQ+A  
Sbjct  466   QKAMSRHFRCLKDAIAAQLRHTCELLGEKDAGTSS-GLTKGETPRLRAIDQSLRQQRAFH  524

Query  981   QLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  802
              + MM+   WRPQRGLPERSVS+LR+WLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWF
Sbjct  525   HMGMMEQEAWRPQRGLPERSVSILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWF  584

Query  801   INARVRLWKPMVEEMYLEEVKE  736
             INARVRLWKPM+EEMY +E KE
Sbjct  585   INARVRLWKPMIEEMYQQETKE  606



>ref|XP_003562164.1| PREDICTED: homeobox protein BEL1 homolog [Brachypodium distachyon]
 ref|XP_010229286.1| PREDICTED: homeobox protein BEL1 homolog [Brachypodium distachyon]
Length=609

 Score =   288 bits (737),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 197/435 (45%), Positives = 256/435 (59%), Gaps = 82/435 (19%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS----------L  1330
             + +RSS++L PAQ+LL+ FC +      +  + +Q Q+D       + S          +
Sbjct  130   WHLRSSRFLFPAQQLLEGFCSLPVDTKSKRTKAAQQQEDAGGGEGSSSSSSCRAPSSAQI  189

Query  1329  GSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVM  1150
              ++  LELQ+ K KL  +L+EVDRRY+ Y +QM  +   FEAVAG+ AA  Y+ALAS+ +
Sbjct  190   QAMDALELQRLKDKLYIMLEEVDRRYRRYCEQMRGLAGGFEAVAGERAAAGYTALASKTI  249

Query  1149  SRHFRCLRDAILAQLkaakkamaekesssaAP----GATKGETPRLKMIDQTLRQQKAIQ  982
             SRHFR LRD ++AQL+A +KA+ EK+SSSA+     G T+G+TPRLK++DQ +RQ KA+ 
Sbjct  250   SRHFRSLRDGVVAQLQAVRKALGEKDSSSASKSSPGGMTRGDTPRLKVLDQCIRQHKAMH  309

Query  981   Q--LTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN  808
             Q    MM++HPWRPQRGLPER+V+VLRAWLFEHFLHPYPSDVDKHIL+RQTGLSRSQVSN
Sbjct  310   QNGGLMMETHPWRPQRGLPERAVTVLRAWLFEHFLHPYPSDVDKHILSRQTGLSRSQVSN  369

Query  807   WFINARVRLWKPMVEEMYLEEVKEQDN------------------------IMGSSDGSR  700
             WFINARVRLWKPMVEEMY+EE+K+ D+                         +  +D  R
Sbjct  370   WFINARVRLWKPMVEEMYVEEMKDVDDGAHGQDQVDAAVGNNNPSSGSSSSNLVHADADR  429

Query  699   AA--VDGGSGRERLDKKPNVVRL----------DSECISSLINIPAKA--------GGDH  580
             AA  +  G G ER   KP   +L          D+  ++S++NI A            DH
Sbjct  430   AALLLRAGDGGER---KPTRAQLRHADADIGVHDAGSLASVVNIGAGRMVDSFVVDMDDH  486

Query  579   H-QFGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQ------HGGSGIGLA  421
             H QFG     F  Y  N   A      +    GGGGVSLTLGLQQ      HGG  I   
Sbjct  487   HGQFG-----FDAY--NDADAG-----QSSGFGGGGVSLTLGLQQHESSRHHGGVNIAFG  534

Query  420   FSPTSQNSLFYPRDQ  376
                 +     +P D 
Sbjct  535   APAPAHGGYLFPGDH  549



>gb|AET04003.2| BEL1-related homeotic protein [Medicago truncatula]
Length=839

 Score =   293 bits (751),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 190/272 (70%), Gaps = 20/272 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY+  AQELL+EFC VG  Q  + K   Q    +        S             
Sbjct  389   LRNSKYVKAAQELLEEFCSVGRGQFKKNKFSRQLSNPNSNQGGGGGSVGGGGASSSSSKD  448

Query  1332  ---LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
                L     +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA
Sbjct  449   VSPLSPADRIEHQRRKVKLLTMLDEVDRRYSHYCEQMQMVVNSFDLVMGFGAAVPYTALA  508

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQ  982
              + MSRHFRCL+DAI AQLK + + + EK+    + G TKGETPRLK+++Q+LRQQ+A  
Sbjct  509   QKAMSRHFRCLKDAITAQLKHSCELLGEKDGVGTS-GLTKGETPRLKLLEQSLRQQRAFH  567

Query  981   QLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  802
             Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWF
Sbjct  568   QMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWF  627

Query  801   INARVRLWKPMVEEMYLEEVKEQDNIMGSSDG  706
             INARVRLWKPMVE+MY +E+KE +   GSS+G
Sbjct  628   INARVRLWKPMVEDMYQQELKEAE---GSSEG  656



>ref|XP_009395654.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
Length=701

 Score =   290 bits (741),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 187/435 (43%), Positives = 246/435 (57%), Gaps = 63/435 (14%)
 Frame = -2

Query  1521  GKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQ  1342
             G+  ++G+        +R+SKY   AQELL+EFC V + +S    + S+  +    +S+ 
Sbjct  281   GQQFHMGYTGTGMVSVLRNSKYAKAAQELLEEFCSVMSGKS----KGSRVGRHRVGSSNI  336

Query  1341  NHS--------------------------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYR  1240
             N +                          L      E Q+ K+KL+ +LDEVDRRY HY 
Sbjct  337   NRNPSSGGGGGGASSTAAASTSSSKDVPPLSPADRFEHQRKKTKLISMLDEVDRRYSHYC  396

Query  1239  DQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssa  1060
             DQM  VV+SF++V G GAAT Y+ALA + MSRHFRCL+DAI+AQLK   + + ++E +S+
Sbjct  397   DQMQMVVNSFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIVAQLKQTCELLGDREGASS  456

Query  1059  APGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLH  880
             + G TKG+TPRL+++DQ+LRQQ++  Q+ MM+   WRPQRGLPERSVS+LR WLFEHFLH
Sbjct  457   S-GITKGDTPRLRLLDQSLRQQQSFSQMGMMEQEAWRPQRGLPERSVSILRGWLFEHFLH  515

Query  879   PYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSR  700
             PYPSD DKH+LARQTGLSR+QVSNWFINARVRLWKPMVEEMYL+E KE++     ++  R
Sbjct  516   PYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYLQESKEEEGTEKEANQQR  575

Query  699   AAVD----------GGSGRERLDKKPNVVRL---DSECISSLINIPAKAGGDHHQFGAVE  559
             A             G +     D  P+   +   +    SS  N P   G  H     V+
Sbjct  576   APSPMQQQQQSQRLGTNAASESDASPSTSSISHRNHRFASSSDNPPPGLGAAHQPSSGVD  635

Query  558   LDFSPYTHNSGGAVGYR---------PGER-KTggggGVSLTLGLQQHGGSGIGLAFSPT  409
                       G    Y          P  R + G  G VSLTLGL+  GG         T
Sbjct  636   DGVLVGVGQIGDVYRYYGAAATSELGPAARMRLGAAGDVSLTLGLRHAGGG--------T  687

Query  408   SQNSLFYPRDQIGDC  364
             S+ S F  RD +G C
Sbjct  688   SEKSRFSVRD-LGGC  701



>dbj|BAJ04685.1| BEL1-type homeodomain protein [Triticum aestivum]
Length=767

 Score =   291 bits (745),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 183/264 (69%), Gaps = 19/264 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQ------------------SDEPKRKSQWQQDDHTTS  1348
             +R+SKY   AQELL EFC VG  Q                  S      S   Q   + S
Sbjct  352   LRNSKYTRAAQELLDEFCSVGRGQTIKGGGRGAGGSSSNPNASKGGPSSSGAAQSPSSAS  411

Query  1347  SQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSA  1168
              +   L      E Q+ K+KL+ +LDEVDRRY HY DQM  VV+ F++V G GAAT Y+A
Sbjct  412   KEPPQLSPADRFEQQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTA  471

Query  1167  LASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKA  988
             LA + MSRHFRCL+DAI AQL+   + + EK++ +++ G TKGETPRL+ IDQ+LRQQ+A
Sbjct  472   LAQKAMSRHFRCLKDAIAAQLRHTCELLGEKDAGTSS-GLTKGETPRLRAIDQSLRQQRA  530

Query  987   IQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN  808
                + MM+   WRPQRGLPERSVS+LR+WLFEHFLHPYPSD DKH+LARQTGLSR+QVSN
Sbjct  531   FHHMGMMEQEAWRPQRGLPERSVSILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSN  590

Query  807   WFINARVRLWKPMVEEMYLEEVKE  736
             WFINARVRLWKPM+EEMY +E KE
Sbjct  591   WFINARVRLWKPMIEEMYQQETKE  614



>dbj|BAJ04686.1| BEL1-type homeodomain protein [Triticum aestivum]
Length=771

 Score =   291 bits (745),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 183/264 (69%), Gaps = 19/264 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQ------------------SDEPKRKSQWQQDDHTTS  1348
             +R+SKY   AQELL EFC VG  Q                  S      S   Q   + S
Sbjct  356   LRNSKYTRAAQELLDEFCSVGRGQTIKGGGRGAGGSSSNPNASKGGPSSSGAAQSPSSAS  415

Query  1347  SQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSA  1168
              +   L      E Q+ K+KL+ +LDEVDRRY HY DQM  VV+ F++V G GAAT Y+A
Sbjct  416   KEPPQLSPADRFEQQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTA  475

Query  1167  LASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKA  988
             LA + MSRHFRCL+DAI AQL+   + + EK++ +++ G TKGETPRL+ IDQ+LRQQ+A
Sbjct  476   LAQKAMSRHFRCLKDAIAAQLRHTCELLGEKDAGTSS-GLTKGETPRLRAIDQSLRQQRA  534

Query  987   IQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN  808
                + MM+   WRPQRGLPERSVS+LR+WLFEHFLHPYPSD DKH+LARQTGLSR+QVSN
Sbjct  535   FHHMGMMEQEAWRPQRGLPERSVSILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSN  594

Query  807   WFINARVRLWKPMVEEMYLEEVKE  736
             WFINARVRLWKPM+EEMY +E KE
Sbjct  595   WFINARVRLWKPMIEEMYQQETKE  618



>ref|XP_009109344.1| PREDICTED: BEL1-like homeodomain protein 2 [Brassica rapa]
 ref|XP_009109345.1| PREDICTED: BEL1-like homeodomain protein 2 [Brassica rapa]
Length=661

 Score =   288 bits (738),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 146/259 (56%), Positives = 188/259 (73%), Gaps = 13/259 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS------------L  1330
             IRSS+Y   AQELL+EFC VG   S + K ++    +       + S            L
Sbjct  256   IRSSRYTTAAQELLEEFCTVGRGFSKKTKLRNSSNPNTSGGDGGSGSPSSAGAIKDQSPL  315

Query  1329  GSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVM  1150
              +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + M
Sbjct  316   SASDRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGHGAALPYTALAQKAM  375

Query  1149  SRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAIQQLT  973
             SRHFRCL+DA+ AQL+ + + + +K+++  ++ G TKGETPRL++++Q+LRQQ+A  Q+ 
Sbjct  376   SRHFRCLKDAVAAQLRQSCELLGDKDAAGISSSGLTKGETPRLRLLEQSLRQQRAFHQMG  435

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
             MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINA
Sbjct  436   MMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINA  495

Query  792   RVRLWKPMVEEMYLEEVKE  736
             RVRLWKPMVEEMY +E KE
Sbjct  496   RVRLWKPMVEEMYQQESKE  514



>emb|CDY22463.1| BnaC03g61760D [Brassica napus]
Length=670

 Score =   288 bits (738),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 189/259 (73%), Gaps = 13/259 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS------------L  1330
             IR+S+Y   AQELL+EFC VG   S + K ++    +       + S            L
Sbjct  265   IRNSRYTTAAQELLEEFCTVGRGFSKKIKLRNSSNPNTSGGDGGSGSPSSAGAITDQPPL  324

Query  1329  GSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVM  1150
              +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + M
Sbjct  325   SASDRIEYQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGHGAALPYTALAQKAM  384

Query  1149  SRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAIQQLT  973
             SRHFRCL+DA++AQL+ + + + +K+++  ++ G TKGETPRL++++Q+LRQQ+A  Q+ 
Sbjct  385   SRHFRCLKDAVVAQLRQSCELLGDKDAAGISSSGLTKGETPRLRLLEQSLRQQRAFHQMG  444

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
             MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINA
Sbjct  445   MMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINA  504

Query  792   RVRLWKPMVEEMYLEEVKE  736
             RVRLWKPMVEEMY +E KE
Sbjct  505   RVRLWKPMVEEMYQQESKE  523



>dbj|BAJ04684.1| BEL1-type homeodomain protein [Triticum aestivum]
Length=765

 Score =   291 bits (744),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 183/264 (69%), Gaps = 19/264 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQ------------------SDEPKRKSQWQQDDHTTS  1348
             +R+SKY   AQELL EFC VG  Q                  S      S   Q   + S
Sbjct  350   LRNSKYTRAAQELLDEFCSVGRGQTIKGGGRGAGGSSSNPNASKGGPSSSGAGQSPSSAS  409

Query  1347  SQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSA  1168
              +   L      E Q+ K+KL+ +LDEVDRRY HY DQM  VV+ F++V G GAAT Y+A
Sbjct  410   REPPQLSPADRFEQQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTA  469

Query  1167  LASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKA  988
             LA + MSRHFRCL+DAI AQL+   + + EK++ +++ G TKGETPRL+ IDQ+LRQQ+A
Sbjct  470   LAQKAMSRHFRCLKDAIAAQLRHTCELLGEKDAGTSS-GLTKGETPRLRAIDQSLRQQRA  528

Query  987   IQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN  808
                + MM+   WRPQRGLPERSVS+LR+WLFEHFLHPYPSD DKH+LARQTGLSR+QVSN
Sbjct  529   FHHMGMMEQEAWRPQRGLPERSVSILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSN  588

Query  807   WFINARVRLWKPMVEEMYLEEVKE  736
             WFINARVRLWKPM+EEMY +E KE
Sbjct  589   WFINARVRLWKPMIEEMYQQETKE  612



>ref|XP_006649302.1| PREDICTED: homeobox protein BEL1 homolog [Oryza brachyantha]
Length=592

 Score =   286 bits (733),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 217/465 (47%), Positives = 280/465 (60%), Gaps = 68/465 (15%)
 Frame = -2

Query  1497  PSQDYFFQIRSSKYLGPAQELLKEFCCV---GTTQSDEPKRKS---QWQQDDHT------  1354
             PS    + +RSS++L PAQ+LL++FC +    T +S   K  +   Q QQDD        
Sbjct  140   PSVQGAWNLRSSRFLLPAQQLLQQFCNLPVENTKRSTNAKSATTALQAQQDDGVLGDGSS  199

Query  1353  ----TSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGA  1186
                 + + +  + ++  LELQ+ + KL  +L+EVDRRY+ Y +QM AV   FEAVAG+ A
Sbjct  200   SSSTSWTPSPQIQAMEPLELQRLRDKLYVMLEEVDRRYRRYCEQMKAVAGGFEAVAGERA  259

Query  1185  ATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQT  1006
             A  Y+ALASR +SRHFR LRD ++AQL+A +K + EK+++   PG TKGETPRL+++DQ 
Sbjct  260   AAAYTALASRTISRHFRSLRDGVVAQLQAVRKQLGEKDTAV--PGMTKGETPRLRVLDQC  317

Query  1005  LRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLS  826
             LRQ KA Q   M++SHPWRPQRGLPER+VS+LRAWLFEHFLHPYPSDVDKHILARQTGLS
Sbjct  318   LRQHKAYQA-GMLESHPWRPQRGLPERAVSILRAWLFEHFLHPYPSDVDKHILARQTGLS  376

Query  825   RSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGS----------SDGSRAAV--DGG  682
             RSQVSNWFINARVRLWKPMVEEMY+EE+K++D   G           S  S   V  DG 
Sbjct  377   RSQVSNWFINARVRLWKPMVEEMYVEEMKDKDGGSGGQGSLNPRPSCSHASEQLVVGDGD  436

Query  681   SGRERLDKKPNVVRLDSECISSLINI-----PAKAGGDHHQ---FGAVE-LDFSPY---T  538
             +G E+   +  +VR D+  ++S++N+      A  G   HQ   FG ++ LDF  Y    
Sbjct  437   AGGEQKPTRAQLVRHDAGSLASVVNVVDGAARAGGGARLHQVESFGIMDHLDFDAYDDGQ  496

Query  537   HNSGGAVGYRPGERKTggggGVSLTLGLQQHGG--SGIGLAFSPTSQ---NSLFYPRDQI  373
             H   G  G   G         VSLTLGLQQHG    G+ +AF            YP + +
Sbjct  497   HQQHGGFGASGG---------VSLTLGLQQHGSHDGGVNIAFGAPPHMGGAGFLYPGEHL  547

Query  372   GDCP-PVQ----YSLLDG-----EGQNLPYRNL-MGSQLLHDLAG  271
              D   PV      + +DG           YR+L  G  LL DLAG
Sbjct  548   VDAVHPVHGHYGGATMDGGDTTSHAAQERYRSLSAGFHLLRDLAG  592



>emb|CDY24765.1| BnaA08g15450D [Brassica napus]
Length=667

 Score =   288 bits (738),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 146/259 (56%), Positives = 188/259 (73%), Gaps = 13/259 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS------------L  1330
             IRSS+Y   AQELL+EFC VG   S + K ++    +       + S            L
Sbjct  256   IRSSRYTTAAQELLEEFCTVGRGFSKKTKLRNSSNPNTSGGDGGSGSPSSAGAIKDQSPL  315

Query  1329  GSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVM  1150
              +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + M
Sbjct  316   SASDRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGHGAALPYTALAQKAM  375

Query  1149  SRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAIQQLT  973
             SRHFRCL+DA+ AQL+ + + + +K+++  ++ G TKGETPRL++++Q+LRQQ+A  Q+ 
Sbjct  376   SRHFRCLKDAVAAQLRQSCELLGDKDAAGISSSGLTKGETPRLRLLEQSLRQQRAFHQMG  435

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
             MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINA
Sbjct  436   MMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINA  495

Query  792   RVRLWKPMVEEMYLEEVKE  736
             RVRLWKPMVEEMY +E KE
Sbjct  496   RVRLWKPMVEEMYQQESKE  514



>ref|XP_011025689.1| PREDICTED: BEL1-like homeodomain protein 4 [Populus euphratica]
Length=828

 Score =   291 bits (746),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 154/281 (55%), Positives = 193/281 (69%), Gaps = 14/281 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-----------LG  1327
             +R+SKY+  AQELL+EFC VG  Q  + K   Q        +                L 
Sbjct  389   LRNSKYVKAAQELLEEFCSVGRGQFKKSKFGRQNTNPSSNNNPGGGGGSSSSTKDLPPLS  448

Query  1326  SLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMS  1147
             +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + MS
Sbjct  449   AADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAVPYTALAQKAMS  508

Query  1146  RHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMM  967
             RHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRLK+++Q+LRQQ+A  Q+ MM
Sbjct  509   RHFRCLKDAIAAQLKLSCELLGEKDGAGTS-GITKGETPRLKLLEQSLRQQRAFHQMGMM  567

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             +   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARV
Sbjct  568   EQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARV  627

Query  786   RLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERL  664
             RLWKPMVE+MY +E KE++   G+ D  R   +  S    L
Sbjct  628   RLWKPMVEDMYQQESKEEE--PGAEDRERKQANNNSNNSGL  666



>ref|XP_006366455.1| PREDICTED: BEL1-like homeodomain protein 4-like [Solanum tuberosum]
Length=624

 Score =   286 bits (733),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 148/251 (59%), Positives = 185/251 (74%), Gaps = 12/251 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQ---------SDEPKRKSQWQQDDHTTSSQ-NHS-LG  1327
             +R+S+Y+   QELL+EFCCVG             D+    S  + +DH   S+ NH  L 
Sbjct  224   LRNSRYVKATQELLEEFCCVGRGNFKNQRVKKFDDDQNPNSNSESEDHRGPSKDNHPPLS  283

Query  1326  SLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMS  1147
             +    E Q+ K KLL +LDEVD RY  Y +QM A+V+SF++V G GAA  Y++LA + MS
Sbjct  284   AAERSEYQRRKIKLLSMLDEVDARYTRYCEQMQAMVNSFDSVIGYGAAAPYTSLAQKAMS  343

Query  1146  RHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMM  967
             RHFRC++DAI+ QLK   K + EK+ +  + G TKGETPRLKM+DQ LRQQKA+ Q+ M+
Sbjct  344   RHFRCIKDAIVGQLKQTCKYLGEKDVTGTS-GLTKGETPRLKMLDQKLRQQKALHQMGML  402

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             DS  WRPQRGLPERSV+VLRAWLFEHFLHPYPS+ DKH+L+RQTGLS++QVSNWFINARV
Sbjct  403   DSDAWRPQRGLPERSVNVLRAWLFEHFLHPYPSEADKHLLSRQTGLSKNQVSNWFINARV  462

Query  786   RLWKPMVEEMY  754
             RLWKPMVEEMY
Sbjct  463   RLWKPMVEEMY  473



>ref|XP_006574714.1| PREDICTED: BEL1-like homeodomain protein 2-like [Glycine max]
Length=766

 Score =   290 bits (742),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 184/262 (70%), Gaps = 15/262 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY   AQELL+EFC VG  Q  + K   Q                           
Sbjct  355   LRNSKYAKAAQELLEEFCSVGRGQFKKNKFNRQLSNPSSNLGGSGGGGGGASSSSSKDIP  414

Query  1332  -LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASR  1156
              L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA +
Sbjct  415   PLSAADRIEHQRRKVKLLTMLDEVDRRYSHYCEQMHMVVNSFDMVMGFGAAVPYTALAQK  474

Query  1155  VMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQL  976
              MSRHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRLKM++Q+LRQQ+A  Q+
Sbjct  475   AMSRHFRCLKDAITAQLKHSCEVLGEKDGAGNS-GLTKGETPRLKMLEQSLRQQRAFHQM  533

Query  975   TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFIN  796
              MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFIN
Sbjct  534   GMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFIN  593

Query  795   ARVRLWKPMVEEMYLEEVKEQD  730
             ARVRLWKPMVE+MY +E+KE +
Sbjct  594   ARVRLWKPMVEDMYQQELKEAE  615



>ref|XP_004300584.1| PREDICTED: BEL1-like homeodomain protein 4-like [Fragaria vesca 
subsp. vesca]
Length=824

 Score =   291 bits (745),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 151/277 (55%), Positives = 194/277 (70%), Gaps = 16/277 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNH--------------  1336
             +R+SKY+  AQELL+EFC VG  Q  + K   Q    + +++                  
Sbjct  358   LRNSKYVKAAQELLEEFCSVGRGQLKKNKLGRQSSSVNPSSNPAGTSGGGASSSSSKDAP  417

Query  1335  -SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALAS  1159
              +L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV++F+ V G GAA  Y+ALA 
Sbjct  418   PTLSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNAFDLVMGFGAAVPYTALAQ  477

Query  1158  RVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQ  979
             + MSRHFRCL+DA+ AQLK + + + EK+ +  + G TKGETPRLKM++Q+LRQQ+A  Q
Sbjct  478   KAMSRHFRCLKDAVTAQLKHSCELLGEKDGAGNS-GITKGETPRLKMLEQSLRQQRAFHQ  536

Query  978   LTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  799
             + MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFI
Sbjct  537   MGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFI  596

Query  798   NARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVD  688
             NARVRLWKPMVEEMY +E  E+    G +  +  +VD
Sbjct  597   NARVRLWKPMVEEMYQQEANEEGGGAGGAAAAAVSVD  633



>ref|NP_001148180.1| BEL1-related homeotic protein 14 [Zea mays]
 gb|ACG30080.1| BEL1-related homeotic protein 14 [Zea mays]
Length=623

 Score =   286 bits (732),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 217/482 (45%), Positives = 280/482 (58%), Gaps = 96/482 (20%)
 Frame = -2

Query  1491  QDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEP----------KRKSQWQQDDHTTSSQ  1342
             Q + + +RSS++L PAQ++L+EFC +    S             K   Q QQ+D   +  
Sbjct  163   QQHAWHLRSSRFLVPAQQVLQEFCSLPVDSSSAAASSKRAKAANKPAPQQQQEDGGGAEG  222

Query  1341  NHS---------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDG  1189
             + S         + ++  LELQ+ K KL  +L+EVDRRY+ Y +QM A+   FEAVAG+ 
Sbjct  223   SSSSASWAPSPQIQAMDALELQRLKDKLYIMLEEVDRRYRRYCEQMRALAGGFEAVAGER  282

Query  1188  AATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQ  1009
             AA  Y+ALASR +SRHFR LRD ++AQL+AA++A+ EK+ +   PG T+G+TPRL+++DQ
Sbjct  283   AAAAYTALASRTISRHFRSLRDGVVAQLQAARRALGEKDVAV--PGMTRGDTPRLRVLDQ  340

Query  1008  TLRQQKAIQQLT-MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  832
              +RQ KA+ Q   MM+SHPWRPQRGLPER+V++LRAWLFEHFLHPYPSDVDKHILARQTG
Sbjct  341   CIRQHKALTQAAGMMESHPWRPQRGLPERAVTILRAWLFEHFLHPYPSDVDKHILARQTG  400

Query  831   LSRSQVSNWFINARVRLWKPMVEEMYLEEVK---------------EQDNIMGSSDG--S  703
             LSRSQVSNWFINARVRLWKPMVEEMY+EE+K                 +N   SS G  S
Sbjct  401   LSRSQVSNWFINARVRLWKPMVEEMYVEEMKAEGQDGGGQQQVGVAVANNPNPSSAGHAS  460

Query  702   RAA----VDGGSGRERLDKKPNVVRL--DSECISSLINIPAKAGGDHHQFGAVE-LDFSP  544
              AA         G   +D+KP   +L  D+  ++S++NI    GG    FG ++ LDF  
Sbjct  461   EAAEDDGRGDSGGGAVVDRKPTRAQLLHDAGSLASVVNI---GGGSRAGFGIMDHLDFDA  517

Query  543   YTHNSGGAVGYRPGERKTggggGVSLTLGLQQH------GGSGIGLAFS---PTSQNS-L  394
             Y  +  GA               VSLTLGLQQH      G  G+ +AF    P   +  L
Sbjct  518   YGGHHAGA---------------VSLTLGLQQHDSHADGGAGGVNIAFGAPPPAHHHGYL  562

Query  393   FYPRDQI------GDCPP-----VQY----SLLDGE---GQNLPYRNLMGS---QLLHDL  277
             F P          G   P     VQ+    + +DGE   GQ   YR L G     LL DL
Sbjct  563   FAPTAAAAGHQMGGGVHPGLHHHVQFGGAGAGIDGEAAHGQEH-YRGLQGGGGFHLLRDL  621

Query  276   AG  271
             AG
Sbjct  622   AG  623



>gb|EEC67362.1| hypothetical protein OsI_34463 [Oryza sativa Indica Group]
Length=587

 Score =   285 bits (729),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 205/456 (45%), Positives = 276/456 (61%), Gaps = 65/456 (14%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCV---GTTQSDEPKRKSQWQQDDHTTSSQNHS------LG  1327
             + +R S++L P Q+LL+EFC +    TT      + ++  Q++  +   + S      + 
Sbjct  144   WHLRGSRFLLPTQQLLQEFCSLPVKSTTSPSSASKATKPPQEEAASGGGSSSWTAPTQIQ  203

Query  1326  SLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMS  1147
             S+   ELQ+ K KL  +L+EVDRRY+ Y +QM A+ +SFEAVAG+ AA  Y+ LASR +S
Sbjct  204   SMDAAELQRLKGKLYTMLEEVDRRYRRYCEQMRALAASFEAVAGERAAAAYTRLASRTIS  263

Query  1146  RHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMM  967
             RHFR LRD ++AQL+A +K + EK+++   PG TKGETPRL+++DQ LRQ KA Q   M+
Sbjct  264   RHFRSLRDGVVAQLQAVRKQLGEKDTAV--PGMTKGETPRLRVLDQCLRQHKAYQ-AGML  320

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             +SHPWRPQRGLPER+VS+LRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV+NWFINARV
Sbjct  321   ESHPWRPQRGLPERAVSILRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVANWFINARV  380

Query  786   RLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSG-------------RERLDKKPNV  646
             RLWKPMVEEMY EE+K+++    S+  S       S               +R ++KP+ 
Sbjct  381   RLWKPMVEEMYAEEMKDEEGSGQSTQASNPQNPNPSSYTSEVRGGGGGGVEDRGEQKPSR  440

Query  645   VRL--DSECISSLINIPAKAGG----DHHQ-----FGAV-ELDFSPYTHNSGGAVGYRPG  502
              +L  D+  ++S+++I     G    DHH      FG + +LDF  Y            G
Sbjct  441   AQLLHDAGSLASVVSIGHGGAGRTMVDHHHHQSLNFGMMDQLDFDAYEAAG--------G  492

Query  501   ERKTggggGVSLTLGLQQ-----HGGSGIGLAFSPTSQNS-------LFYPRDQIGDCPP  358
              +  G GGGVSLTLGLQQ     H G  +  A +    NS       LF    +     P
Sbjct  493   GQGFGAGGGVSLTLGLQQQHADPHDGVNVAFAAAAAPPNSSGVAAEYLFMGGGEHQQQLP  552

Query  357   --VQY-SLLDGEGQNLPYRNL----MGSQLLHDLAG  271
                Q+ ++++G+  +  YR L     G  LLHDLAG
Sbjct  553   QTAQFGAVMEGDAASH-YRGLSATAAGFHLLHDLAG  587



>ref|XP_010680937.1| PREDICTED: BEL1-like homeodomain protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=817

 Score =   290 bits (743),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 186/264 (70%), Gaps = 20/264 (8%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTT-------------------  1351
             +R+SKY  PAQ+LL+EFC VG  Q  +PK   Q   + + T                   
Sbjct  380   LRNSKYAKPAQDLLEEFCSVGRGQLKKPKLGRQNSSNQNPTMSGSGGGGGGGGGAGSSSS  439

Query  1350  SSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYS  1171
             +     L     +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G GAA  Y+
Sbjct  440   TKDPPQLSPSDRIEHQRRKVKLLAMLDEVDRRYNHYCEQMQMVVNSFDLVMGYGAAIPYT  499

Query  1170  ALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQK  991
             ALA + MSRHFRCL+DAI  QLK + + + EK+ +++  G TKGETPRLK+++Q+LRQQ+
Sbjct  500   ALAQKAMSRHFRCLKDAIQVQLKHSCEVLGEKDPTTSL-GITKGETPRLKVLEQSLRQQR  558

Query  990   AIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVS  811
             A  Q+ MMD   WRPQRGLPERSV+VLRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVS
Sbjct  559   AFHQMGMMDQEAWRPQRGLPERSVNVLRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVS  618

Query  810   NWFINARVRLWKPMVEEMYLEEVK  739
             NWFINARVRLWKPM+EEMY +E K
Sbjct  619   NWFINARVRLWKPMIEEMYQQEAK  642



>ref|XP_008813264.1| PREDICTED: BEL1-like homeodomain protein 4 [Phoenix dactylifera]
Length=748

 Score =   289 bits (739),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 191/275 (69%), Gaps = 36/275 (13%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHSLGSLHF-------  1315
             +R++KY   AQELL+EFC VG +Q     + S+  +  H  SS N +L  +H        
Sbjct  325   LRNAKYARAAQELLEEFCSVGRSQ----LKGSRIGR--HAGSSSNPNLKPIHGGGGGASS  378

Query  1314  ----------------------LELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAV  1201
                                    E Q+ K+KL+ +LDEVDRRY HY DQM  VV+SF++V
Sbjct  379   SAAAAGSSSSSKDLPPLSPADRFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVVNSFDSV  438

Query  1200  AGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLK  1021
              G GAAT Y+ALA + MSRHFRCL+DAI  QLK   + + EKE+ S++ G TKGETPRL+
Sbjct  439   MGFGAATPYTALAQKAMSRHFRCLKDAIAEQLKQTCELLGEKEAGSSS-GLTKGETPRLR  497

Query  1020  MIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILAR  841
             +IDQ+LRQQ+A  Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LAR
Sbjct  498   LIDQSLRQQRAFHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLAR  557

Query  840   QTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKE  736
             QTGLSR+QVSNWFINARVRLWKPMVEEMY +E  E
Sbjct  558   QTGLSRNQVSNWFINARVRLWKPMVEEMYQQEATE  592



>ref|XP_007156003.1| hypothetical protein PHAVU_003G250500g [Phaseolus vulgaris]
 ref|XP_007156004.1| hypothetical protein PHAVU_003G250500g [Phaseolus vulgaris]
 gb|ESW27997.1| hypothetical protein PHAVU_003G250500g [Phaseolus vulgaris]
 gb|ESW27998.1| hypothetical protein PHAVU_003G250500g [Phaseolus vulgaris]
Length=778

 Score =   289 bits (740),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/273 (55%), Positives = 192/273 (70%), Gaps = 14/273 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY+  AQELL+EFC VG  Q  + K   Q         +                 
Sbjct  354   LRNSKYIKAAQELLEEFCSVGRGQFKKNKFNRQLSNPSSNHGASGGGGGASSSLSKDVPP  413

Query  1332  LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRV  1153
             L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G G+A  Y+ALA + 
Sbjct  414   LSAADRIEHQRRKVKLLTMLDEVDRRYSHYCEQMHMVVNSFDMVMGFGSAVPYTALAQKA  473

Query  1152  MSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLT  973
             MSRHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRLK+++Q+LRQQ+A  Q+ 
Sbjct  474   MSRHFRCLKDAITAQLKHSCELLGEKDGAGNS-GLTKGETPRLKLLEQSLRQQRAFHQMG  532

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
             MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINA
Sbjct  533   MMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINA  592

Query  792   RVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAA  694
             RVRLWKPMVE+MY +E+KE +      +G++++
Sbjct  593   RVRLWKPMVEDMYQQELKEAEGAEDEREGNQSS  625



>ref|XP_011099269.1| PREDICTED: BEL1-like homeodomain protein 4 [Sesamum indicum]
Length=765

 Score =   289 bits (739),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 189/268 (71%), Gaps = 23/268 (9%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQ----------------  1342
             +R+SKY   AQELL+EFC VG  Q  + K   Q   + + +S+                 
Sbjct  356   LRNSKYAKAAQELLEEFCSVGRGQFKKNKFGKQNNNNGNPSSNPSAGATSGGGAGGGNSS  415

Query  1341  -----NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATV  1177
                  N  L +   LE Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G GAA  
Sbjct  416   SSSKDNPPLSAADRLEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDMVMGFGAAVP  475

Query  1176  YSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQ  997
             Y+ LA + MSRHFRCL+DAI AQLK + + + EK++ ++  G TKGETPRL++++Q+LRQ
Sbjct  476   YTCLAQKAMSRHFRCLKDAIAAQLKHSCELLGEKDAGTS--GVTKGETPRLRILEQSLRQ  533

Query  996   QKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
             Q+A  Q+ MMD   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+Q
Sbjct  534   QRAFHQMGMMDQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQ  593

Query  816   VSNWFINARVRLWKPMVEEMYLEEVKEQ  733
             VSNWFINARVRLWKPMVEEMY +E K++
Sbjct  594   VSNWFINARVRLWKPMVEEMYQQEAKDE  621



>gb|KHM99953.1| Zinc finger CCCH domain-containing protein 1 [Glycine soja]
Length=839

 Score =   290 bits (743),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 183/220 (83%), Gaps = 7/220 (3%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDE-PKRKS-----QWQQDDHTT-SSQNHSLGSL  1321
             F I++SK+L PAQ LL EFC +GT ++D  PK+K      QW++ +    SS+NHSL SL
Sbjct  239   FLIKNSKFLVPAQVLLNEFCSLGTKENDVLPKQKCSQKNKQWEEGNSGGGSSKNHSLSSL  298

Query  1320  HFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRH  1141
              ++ELQK K+KLL +L+EVDRRYKHYR+QM AVVSSFEAVAG+GAATVYSALA + MSRH
Sbjct  299   EYVELQKRKTKLLAMLEEVDRRYKHYRNQMKAVVSSFEAVAGNGAATVYSALALKAMSRH  358

Query  1140  FRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDS  961
             FRCL+D I+ +++A +K M EK+  +A PG T+GETPRL+++DQ+LRQQ+A QQ+++M++
Sbjct  359   FRCLKDGIMDEIEATRKGMGEKDHVAAVPGTTRGETPRLRIVDQSLRQQRAFQQISIMET  418

Query  960   HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILAR  841
             HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHIL +
Sbjct  419   HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILMK  458



>gb|EMS53609.1| BEL1-like homeodomain protein 2 [Triticum urartu]
Length=288

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 190/254 (75%), Gaps = 15/254 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-----------LG  1327
             +RSS++L PAQ+LL+ +C +    + +  + +Q QQ +     +  S           + 
Sbjct  20    LRSSRFLLPAQQLLQGYCSLPVDITPKRAKPAQTQQQEDGAGGEASSSSTSGWTPSPQIQ  79

Query  1326  SLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMS  1147
             ++  LEL++ K +L  +L+EVDRRY+ Y +QM  +   FEAVAG+ AA+ Y+A+A+R +S
Sbjct  80    AMEALELKRLKDRLYVMLEEVDRRYRRYCEQMRGLAGGFEAVAGERAASGYTAVAARTIS  139

Query  1146  RHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQL--T  973
             RHFR LRD I+AQL+A +KA+ EK+ S   PG T+G+TPRLK++DQ +RQQKA+ Q    
Sbjct  140   RHFRSLRDGIVAQLQAVRKALGEKDVSP--PGMTRGDTPRLKVLDQCIRQQKAMHQNGGM  197

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
             MMDSHPWRPQRGLPER+V++LRAWLFEHFL+PYPSDVDKHILARQTGLSRSQVSNWFINA
Sbjct  198   MMDSHPWRPQRGLPERAVTILRAWLFEHFLNPYPSDVDKHILARQTGLSRSQVSNWFINA  257

Query  792   RVRLWKPMVEEMYL  751
             RVRLWKPMVEE+ +
Sbjct  258   RVRLWKPMVEEITI  271



>ref|XP_010938938.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
4 [Elaeis guineensis]
Length=747

 Score =   288 bits (737),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 171/361 (47%), Positives = 221/361 (61%), Gaps = 30/361 (8%)
 Frame = -2

Query  1521  GKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCV--------------GTTQSDEPKR  1384
             G+P  +G+ +      +R+SKY    +ELL+EFC V              G++ +  P  
Sbjct  312   GQPVRMGYGTTAVVNVLRNSKYARAVRELLEEFCSVVRGQLKGSRIGMNRGSSSNPNPSH  371

Query  1383  KSQWQQDDHTTSSQNHS-----LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVV  1219
                         + + S     L      E Q+ K+KL+ +LDEVDRRY HY DQM  VV
Sbjct  372   GVGGGASSSVAGASSSSKDLPPLCPADRFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVV  431

Query  1218  SSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKG  1039
             + F++V G GAAT Y+ALA + MSRHFRCL+DAI AQLK   + + EKE+ S++ G TK 
Sbjct  432   NCFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQLKQTCELLGEKEAGSSS-GLTKA  490

Query  1038  ETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVD  859
             ETPRL+++D +LRQQKA QQ+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD D
Sbjct  491   ETPRLRLVDPSLRQQKAFQQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDAD  550

Query  858   KHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGS  679
             KH+LARQTGLSRSQVSNWFINARVRLWKPMVEEMY +E KE+   +G  + + A+   G+
Sbjct  551   KHLLARQTGLSRSQVSNWFINARVRLWKPMVEEMYQQEAKEE---VGERERNEASHHQGA  607

Query  678   GRERLDKKPNVVRLDSECISSLINIPAKAGGD---HHQFGAVELDFSP---YTHNSGGAV  517
                 L ++P   RL +   S     PA        HH F     + +P     H+S G  
Sbjct  608   LSPTL-QQPQGQRLGTGAPSESDPYPAAPPASQHHHHLFATSSSNENPPPAVAHSSNGGA  666

Query  516   G  514
             G
Sbjct  667   G  667



>ref|XP_003611874.1| BEL1-like homeodomain protein [Medicago truncatula]
 gb|AES94832.1| BEL1-related homeotic protein [Medicago truncatula]
Length=751

 Score =   288 bits (737),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/263 (57%), Positives = 188/263 (71%), Gaps = 17/263 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQ-----------DDHTTSSQNHS--  1333
             +R+SKY+ P QELL+EFC VG  Q  +  + ++              D   +SS   +  
Sbjct  339   LRNSKYMKPTQELLQEFCSVGRGQFIKKTKFNRQNSSNPNNCSSNVGDSIPSSSSKDTPP  398

Query  1332  --LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALAS  1159
               L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ + G GAA  Y+ALA 
Sbjct  399   LPLSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDVMMGFGAAVPYTALAQ  458

Query  1158  RVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQ  979
             + MSRHFRCL+DAI  Q+K + + + EKE +    G TKGETPRLK+++Q+LRQQ+A  Q
Sbjct  459   KAMSRHFRCLKDAITTQVKQSCELLGEKEGAGG--GLTKGETPRLKVLEQSLRQQRAFHQ  516

Query  978   LTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  799
             + MMD   WRPQRGLP+RSV+VLRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFI
Sbjct  517   MGMMDQEAWRPQRGLPDRSVNVLRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFI  576

Query  798   NARVRLWKPMVEEMYLEEVKEQD  730
             NARVRLWKPMVEEMY +E+ E +
Sbjct  577   NARVRLWKPMVEEMYQQELNEAE  599



>ref|XP_011009913.1| PREDICTED: BEL1-like homeodomain protein 4 [Populus euphratica]
 ref|XP_011009914.1| PREDICTED: BEL1-like homeodomain protein 4 [Populus euphratica]
Length=826

 Score =   290 bits (741),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/259 (56%), Positives = 186/259 (72%), Gaps = 12/259 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-----------LG  1327
             +R+SKY+ PAQELL+EFC VG  Q  + K   Q        +                L 
Sbjct  383   LRNSKYVRPAQELLEEFCSVGRGQLKKSKFGRQNTNPSSNNNPGGGGGSSSSTKDPLPLS  442

Query  1326  SLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMS  1147
             +   +E Q+ K KLL +LDEVD+RY HY +QM  VV+SF+ + G GAA  Y+ALA + MS
Sbjct  443   AADRIEHQRKKVKLLSMLDEVDKRYNHYCEQMQMVVNSFDLIMGFGAAVPYTALAQKAMS  502

Query  1146  RHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMM  967
             RHFRCL++AI AQLK + + + +K+ +  +   TKGETPRLK+++Q+LRQQ+A  Q+ MM
Sbjct  503   RHFRCLKEAISAQLKHSCELLGDKDGAGTS-AITKGETPRLKLLEQSLRQQRAFHQMGMM  561

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             +   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARV
Sbjct  562   EQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARV  621

Query  786   RLWKPMVEEMYLEEVKEQD  730
             RLWKPMVEEMY +E KE++
Sbjct  622   RLWKPMVEEMYQQEAKEEE  640



>ref|XP_009376500.1| PREDICTED: BEL1-like homeodomain protein 2 [Pyrus x bretschneideri]
Length=767

 Score =   288 bits (737),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/261 (57%), Positives = 185/261 (71%), Gaps = 22/261 (8%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQN---------------  1339
             +R+SKY+  AQELL+EFC VG  Q  + K         +TT++ +               
Sbjct  323   LRNSKYVKAAQELLEEFCSVGRGQLKKSKFGGSTSGRHNTTTNPSSNPAGTSGSGGGASS  382

Query  1338  ------HSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATV  1177
                   H L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV++F+ V G GAA  
Sbjct  383   SLLKDVHPLSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNAFDLVMGFGAAVP  442

Query  1176  YSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQ  997
             Y+ALA + MSRHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRLK+++Q+LRQ
Sbjct  443   YTALAQKAMSRHFRCLKDAITAQLKHSCELLGEKDGAGTS-GITKGETPRLKLLEQSLRQ  501

Query  996   QKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
             Q+A  Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+Q
Sbjct  502   QRAFHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQ  561

Query  816   VSNWFINARVRLWKPMVEEMY  754
             VSNWFINARVRLWKPMVEEMY
Sbjct  562   VSNWFINARVRLWKPMVEEMY  582



>ref|XP_009376501.1| PREDICTED: BEL1-like homeodomain protein 4 [Pyrus x bretschneideri]
Length=719

 Score =   287 bits (734),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/261 (57%), Positives = 185/261 (71%), Gaps = 22/261 (8%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQN---------------  1339
             +R+SKY+  AQELL+EFC VG  Q  + K         +TT++ +               
Sbjct  323   LRNSKYVKAAQELLEEFCSVGRGQLKKSKFGGSTSGRHNTTTNPSSNPAGTSGSGGGASS  382

Query  1338  ------HSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATV  1177
                   H L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV++F+ V G GAA  
Sbjct  383   SLLKDVHPLSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNAFDLVMGFGAAVP  442

Query  1176  YSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQ  997
             Y+ALA + MSRHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRLK+++Q+LRQ
Sbjct  443   YTALAQKAMSRHFRCLKDAITAQLKHSCELLGEKDGAGTS-GITKGETPRLKLLEQSLRQ  501

Query  996   QKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
             Q+A  Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+Q
Sbjct  502   QRAFHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQ  561

Query  816   VSNWFINARVRLWKPMVEEMY  754
             VSNWFINARVRLWKPMVEEMY
Sbjct  562   VSNWFINARVRLWKPMVEEMY  582



>ref|XP_002310774.2| hypothetical protein POPTR_0007s12170g [Populus trichocarpa]
 ref|XP_006380743.1| hypothetical protein POPTR_0007s12170g [Populus trichocarpa]
 gb|EEE91224.2| hypothetical protein POPTR_0007s12170g [Populus trichocarpa]
 gb|ERP58540.1| hypothetical protein POPTR_0007s12170g [Populus trichocarpa]
Length=824

 Score =   289 bits (740),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 153/281 (54%), Positives = 192/281 (68%), Gaps = 14/281 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-----------LG  1327
             +R+SKY+  AQELL+EFC VG  Q  + K   Q        +                L 
Sbjct  389   LRNSKYVKAAQELLEEFCSVGRGQFKKSKFGRQNTNPSSNNNPGGGGGSSSSTKDLPPLS  448

Query  1326  SLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMS  1147
             +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G G+A  Y+ALA + MS
Sbjct  449   AADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGSAVPYTALAQKAMS  508

Query  1146  RHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMM  967
             RHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRLK+++Q+LRQQ+A  Q+ MM
Sbjct  509   RHFRCLKDAIAAQLKLSCELLGEKDGAGTS-GITKGETPRLKLLEQSLRQQRAFHQMGMM  567

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             +   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARV
Sbjct  568   EQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARV  627

Query  786   RLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERL  664
             RLWKPMVE+MY +E KE +   G+ D  R   +  S    L
Sbjct  628   RLWKPMVEDMYQQESKEDE--PGAEDRERKQANNNSNNSGL  666



>ref|XP_009379163.1| PREDICTED: BEL1-like homeodomain protein 2 [Pyrus x bretschneideri]
 ref|XP_009379164.1| PREDICTED: BEL1-like homeodomain protein 2 [Pyrus x bretschneideri]
Length=809

 Score =   289 bits (739),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 150/265 (57%), Positives = 188/265 (71%), Gaps = 22/265 (8%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPK--RKSQWQQDDHTTSSQNHS-----------  1333
             +R+SKY+  AQELL+EFC VG  Q  + K    +  +Q+  T  S N +           
Sbjct  366   LRNSKYVKAAQELLEEFCSVGRGQLKKNKFGGSTSGRQNTTTNPSSNQASGGGGGGGTSS  425

Query  1332  --------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATV  1177
                     L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV++F+ V G GAA  
Sbjct  426   SSSKDVPPLSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNAFDLVMGFGAAVP  485

Query  1176  YSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQ  997
             Y+ALA + MSRHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRLK+++Q+LRQ
Sbjct  486   YTALAQKAMSRHFRCLKDAITAQLKHSCELIGEKDGAGTS-GITKGETPRLKLLEQSLRQ  544

Query  996   QKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
             Q+A  Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+Q
Sbjct  545   QRAFHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQ  604

Query  816   VSNWFINARVRLWKPMVEEMYLEEV  742
             VSNWFINARVRLWKPMVEEMY +E 
Sbjct  605   VSNWFINARVRLWKPMVEEMYQQEA  629



>dbj|BAJ95083.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=807

 Score =   289 bits (739),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 182/262 (69%), Gaps = 17/262 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQ----------------SDEPKRKSQWQQDDHTTSSQ  1342
             +R+SKY   AQELL EFC VG  Q                S      S   Q   + S +
Sbjct  396   LRNSKYTRAAQELLDEFCSVGRGQTIKGGGRGGSSSNPNASKGGPSSSGAAQSPSSASKE  455

Query  1341  NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
                L      E Q+ K+KL+ +LDEVDRRY HY DQM  VV+ F++V G GAAT Y+ALA
Sbjct  456   PPQLSPADRFEQQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALA  515

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQ  982
              + MSRHFRCL+DAI AQL+   + + EK++ +++ G TKGETPRL+ IDQ+LRQQ+A  
Sbjct  516   QKAMSRHFRCLKDAIAAQLRHTCELLGEKDAGTSS-GLTKGETPRLRAIDQSLRQQRAFH  574

Query  981   QLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  802
              + MM+   WRPQRGLPERSVS+LR+WLFEHFLHPYPSD DKH+LARQTGLSR+QVSNW 
Sbjct  575   HMGMMEQEAWRPQRGLPERSVSILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWL  634

Query  801   INARVRLWKPMVEEMYLEEVKE  736
             INARVRLWKPM+EEMY +E KE
Sbjct  635   INARVRLWKPMIEEMYQQETKE  656



>ref|XP_006599397.1| PREDICTED: BEL1-like homeodomain protein 2-like [Glycine max]
Length=777

 Score =   288 bits (736),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 182/256 (71%), Gaps = 12/256 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-----------LG  1327
             +R+SKY   AQELL+EFC VG  Q  + K   Q                         L 
Sbjct  369   LRNSKYAKAAQELLEEFCSVGRGQFKKNKFNRQLSNPSSNLRGSGGGASSSSSKDVPPLS  428

Query  1326  SLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMS  1147
             +   +E Q+ K KLL +LDEVDRRY HY +QM  VV++F+ V G GAA  Y+ALA + MS
Sbjct  429   AADRIEHQRRKVKLLTMLDEVDRRYSHYCEQMHMVVNAFDMVMGFGAAVPYTALAQKAMS  488

Query  1146  RHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMM  967
             RHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRLKM++Q+LRQQ+A  Q+ MM
Sbjct  489   RHFRCLKDAITAQLKHSCEVLGEKDGAGNS-GLTKGETPRLKMLEQSLRQQRAFHQMGMM  547

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             +   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARV
Sbjct  548   EQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARV  607

Query  786   RLWKPMVEEMYLEEVK  739
             RLWKPMVE+MY +E+K
Sbjct  608   RLWKPMVEDMYQQELK  623



>ref|XP_002466514.1| hypothetical protein SORBIDRAFT_01g009130 [Sorghum bicolor]
 gb|EER93512.1| hypothetical protein SORBIDRAFT_01g009130 [Sorghum bicolor]
Length=770

 Score =   287 bits (735),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 150/283 (53%), Positives = 190/283 (67%), Gaps = 21/283 (7%)
 Frame = -2

Query  1524  LGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQ-------------------  1402
             LG+  ++G+        +R+SKY   AQELL+EFC VG  Q                   
Sbjct  345   LGQQLHVGYGPAGVAGVLRNSKYTRAAQELLEEFCSVGRGQIKGGARGGRGASASNPNAS  404

Query  1401  -SDEPKRKSQWQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTA  1225
                     S   Q   + S +   L      E Q+ K+KL+ +LDEVDRRY HY DQM  
Sbjct  405   NKQGGASSSGAAQSPSSASKEPPQLSPADRFEHQRKKAKLISMLDEVDRRYNHYCDQMQM  464

Query  1224  VVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGAT  1045
             VV+ F++V G GAAT Y+ALA + MSRHFRCL+DAI AQL+   + + EK++ +++ G T
Sbjct  465   VVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQLRTTCELLGEKDAGTSS-GLT  523

Query  1044  KGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSD  865
             KGETPRL+ IDQ+LRQQ+A   + MM+   WRPQRGLPERSV++LR+WLFEHFLHPYPSD
Sbjct  524   KGETPRLRAIDQSLRQQRAFHHMGMMEQEAWRPQRGLPERSVNILRSWLFEHFLHPYPSD  583

Query  864   VDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKE  736
              DKH+LARQTGLSR+QVSNWFINARVRLWKPM+EEMY +E +E
Sbjct  584   ADKHLLARQTGLSRNQVSNWFINARVRLWKPMIEEMYQQECRE  626



>ref|XP_009776283.1| PREDICTED: BEL1-like homeodomain protein 2 [Nicotiana sylvestris]
Length=771

 Score =   287 bits (735),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 148/271 (55%), Positives = 190/271 (70%), Gaps = 37/271 (14%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY   AQELL+EFC VG         + ++++++  T++  +S             
Sbjct  347   LRNSKYAKAAQELLEEFCSVG---------RGKFKKNNKATAANPNSNNPSGGTNGGGGN  397

Query  1332  -------------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGD  1192
                          L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G 
Sbjct  398   NNTSSSSSKDLPPLSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGF  457

Query  1191  GAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMID  1012
             GAA  Y+ALA + MSRHFRCL+DAI AQLK + + + +K++ ++  G TKGETPRLKM++
Sbjct  458   GAAIPYTALAQKAMSRHFRCLKDAITAQLKHSCELLGDKDAGTS--GLTKGETPRLKMLE  515

Query  1011  QTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  832
             Q+LRQQ+A  Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTG
Sbjct  516   QSLRQQRAFHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTG  575

Query  831   LSRSQVSNWFINARVRLWKPMVEEMYLEEVK  739
             LSR+QVSNWFINARVRLWKPMVEEMY +E K
Sbjct  576   LSRNQVSNWFINARVRLWKPMVEEMYQQEAK  606



>ref|XP_010254984.1| PREDICTED: BEL1-like homeodomain protein 4 [Nelumbo nucifera]
Length=813

 Score =   288 bits (738),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 183/251 (73%), Gaps = 12/251 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG----------TTQSDEPKRKSQWQQDDHTTSSQN-HSLG  1327
             +R SKY+  AQELL+EFC VG            QS  P            +SS++   L 
Sbjct  374   LRHSKYVKAAQELLEEFCSVGRGQLKNNRLGKHQSTNPNPNQGTSAGGSPSSSKDLPPLP  433

Query  1326  SLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMS  1147
             +   +E Q+ K KL+ +LDEVDRRY HY +QM  VV+SF++V G GAAT Y+ALA + MS
Sbjct  434   ATERIEHQRRKVKLMSMLDEVDRRYNHYCEQMHMVVNSFDSVMGFGAATPYTALAQKAMS  493

Query  1146  RHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMM  967
             RHFRCL+DAI AQLK   + + EK+   A+ G TKGETPRL++++Q+LRQQ+A  Q+ MM
Sbjct  494   RHFRCLKDAIAAQLKHTCEVLGEKDGVGAS-GVTKGETPRLRLLEQSLRQQRAFHQMGMM  552

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             +   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARV
Sbjct  553   EQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARV  612

Query  786   RLWKPMVEEMY  754
             RLWKPMVEEMY
Sbjct  613   RLWKPMVEEMY  623



>ref|XP_008675423.1| PREDICTED: BEL1-related homeotic protein 14 isoform X1 [Zea mays]
 ref|XP_008675432.1| PREDICTED: BEL1-related homeotic protein 14 isoform X1 [Zea mays]
 ref|XP_008675437.1| PREDICTED: BEL1-related homeotic protein 14 isoform X1 [Zea mays]
 ref|XP_008675441.1| PREDICTED: BEL1-related homeotic protein 14 isoform X1 [Zea mays]
 ref|XP_008675447.1| PREDICTED: BEL1-related homeotic protein 14 isoform X1 [Zea mays]
 ref|XP_008675456.1| PREDICTED: BEL1-related homeotic protein 14 isoform X1 [Zea mays]
 ref|XP_008675463.1| PREDICTED: BEL1-related homeotic protein 14 isoform X1 [Zea mays]
 gb|ACG30098.1| BEL1-related homeotic protein 14 [Zea mays]
 tpg|DAA43037.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
isoform 1 [Zea mays]
 tpg|DAA43038.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
isoform 2 [Zea mays]
Length=620

 Score =   283 bits (725),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 217/484 (45%), Positives = 283/484 (58%), Gaps = 98/484 (20%)
 Frame = -2

Query  1491  QDYFFQIRSSKYLGPAQELLKEFCCV------------GTTQSDEPKRKSQWQQDDHTTS  1348
             Q + + +RSS++L PAQ++L+EFC +                +++P  + Q QQ+D   +
Sbjct  158   QQHAWHLRSSRFLVPAQQVLQEFCSLPVDSSSAAASSKRAKAANKPASQQQQQQEDGGGA  217

Query  1347  SQNHS---------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAG  1195
               + S         + ++  LELQ+ K KL  +L+EVDRRY+ Y +QM A+   FEAVAG
Sbjct  218   EGSSSSASWAPSPQIQAMDALELQRLKDKLYIMLEEVDRRYRRYCEQMRALAGGFEAVAG  277

Query  1194  DGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMI  1015
             + AA  Y+ALASR +SRHFR LRD ++AQL+AA++A+ EK+ +   PG T+G+TPRL+++
Sbjct  278   ERAAAAYTALASRTISRHFRSLRDGVVAQLQAARRALGEKDVAV--PGMTRGDTPRLRVL  335

Query  1014  DQTLRQQKAIQQLT-MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             DQ +RQ KA+ Q   MM+SHPWRPQRGLPER+V++LRAWLFEHFLHPYPSDVDKHILARQ
Sbjct  336   DQCIRQHKALTQAAGMMESHPWRPQRGLPERAVTILRAWLFEHFLHPYPSDVDKHILARQ  395

Query  837   TGLSRSQVSNWFINARVRLWKPMVEEMYLEEVK---------------EQDNIMGSSDG-  706
             TGLSRSQVSNWFINARVRLWKPMVEEMY+EE+K                 +N   SS G 
Sbjct  396   TGLSRSQVSNWFINARVRLWKPMVEEMYVEEMKAEGQDGGGQQQVGVAVANNPNPSSAGH  455

Query  705   -SRAA----VDGGSGRERLDKKPNVVRL--DSECISSLINIPAKAGGDHHQFGAVE-LDF  550
              S AA         G   +D+KP   +L  D+  ++S++NI    GG    FG ++ LDF
Sbjct  456   ASEAAEDDGRGDSGGGAVVDRKPTRAQLLHDAGSLASVVNI---GGGSRAGFGIMDHLDF  512

Query  549   SPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQH------GGSGIGLAFS---PTSQNS  397
               Y  +  GA               VSLTLGLQQH      G  G+ +AF    P   + 
Sbjct  513   DAYGGHHAGA---------------VSLTLGLQQHDSHADGGAGGVNIAFGAPPPAHHHG  557

Query  396   -LFYPRDQI------GDCPP-----VQYS----LLDGE---GQNLPYRNLMGS---QLLH  283
              LF P          G   P     VQ+S     +DGE   GQ   YR L G     LL 
Sbjct  558   YLFAPTAAAAGHQMGGGVHPGLHHHVQFSGAGAGIDGEAAHGQEH-YRGLQGGGGFHLLR  616

Query  282   DLAG  271
             DLAG
Sbjct  617   DLAG  620



>ref|XP_007047070.1| BEL1-like homeodomain protein 2 isoform 1 [Theobroma cacao]
 gb|EOX91227.1| BEL1-like homeodomain protein 2 isoform 1 [Theobroma cacao]
Length=824

 Score =   288 bits (737),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 191/263 (73%), Gaps = 22/263 (8%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY+  AQELL+EFC VG  Q     +K+++ +++   SS   S             
Sbjct  368   LRNSKYVKAAQELLEEFCSVGRGQF----KKNKFGRNNTNPSSNPGSSGGGGGGSSSSTK  423

Query  1332  ----LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSAL  1165
                 L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G G+A  Y+AL
Sbjct  424   DLPPLSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGSAVPYTAL  483

Query  1164  ASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAI  985
             A + MSRHFRCL+DA+ AQLK + + + EK+ +  + G TKGETPRLKM++Q+LRQQ+A 
Sbjct  484   AQKAMSRHFRCLKDAVSAQLKHSCEVLGEKDGAGTS-GITKGETPRLKMLEQSLRQQRAF  542

Query  984   QQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNW  805
              Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNW
Sbjct  543   HQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNW  602

Query  804   FINARVRLWKPMVEEMYLEEVKE  736
             FINARVRLWKPMVEEMY +E KE
Sbjct  603   FINARVRLWKPMVEEMYQQETKE  625



>ref|XP_009411323.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
Length=687

 Score =   285 bits (729),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 151/279 (54%), Positives = 189/279 (68%), Gaps = 22/279 (8%)
 Frame = -2

Query  1521  GKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPK----RKSQWQQDDHT  1354
             G+  ++G+ S      +R+SKY  P QELL+EFC VG  Q    K    R      + + 
Sbjct  275   GQQSHMGYGSMGLVNVLRNSKYAKPGQELLEEFCSVGKGQLKGSKAGRHRGGSSNPNCNP  334

Query  1353  TSSQNHS-----------------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTA  1225
             T                       L      E Q+ K+KL+ +LDEVDRRY HY DQM  
Sbjct  335   TGGGGSGGASSSAAASSSSKDVPPLAPADRFEHQRKKAKLISMLDEVDRRYNHYCDQMQM  394

Query  1224  VVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGAT  1045
             VV+SF++V G GAAT Y++LA + MSRHFRCL+DAI AQLK   + + EKES++ + G T
Sbjct  395   VVNSFDSVMGFGAATPYTSLAQKAMSRHFRCLKDAIAAQLKQTCELLGEKESATGS-GIT  453

Query  1044  KGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSD  865
             KG+TPRL+++DQTLRQQ+A  Q+ MM+   WRPQRGLP+RSV +LR WLFEHFLHPYPSD
Sbjct  454   KGDTPRLRLLDQTLRQQRAFNQMGMMEQEAWRPQRGLPDRSVHILRGWLFEHFLHPYPSD  513

Query  864   VDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLE  748
              DKH+LARQTGLSR+QVSNWFINARVRLWKPMVE+MYL+
Sbjct  514   ADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEDMYLQ  552



>gb|EYU44317.1| hypothetical protein MIMGU_mgv1a001716mg [Erythranthe guttata]
Length=769

 Score =   286 bits (733),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 151/272 (56%), Positives = 189/272 (69%), Gaps = 32/272 (12%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +RSSKY   AQELL+EFC VG        +KS++++  +  +  N S             
Sbjct  363   LRSSKYAKAAQELLEEFCSVGRGHF----KKSKFRKGQNNNNGSNPSAGGAATSGAAAAG  418

Query  1332  -------------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGD  1192
                          L +   LE Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G 
Sbjct  419   GGNSSSSSKDIPPLSAGDRLEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDMVMGF  478

Query  1191  GAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMID  1012
             GAA  Y+ LA + MSRHFRCL+DAI AQLK + + + EK++ ++  G TKGETPRL+M++
Sbjct  479   GAAVPYTCLAQKAMSRHFRCLKDAIAAQLKNSCELLGEKDAGTS--GVTKGETPRLRMLE  536

Query  1011  QTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  832
             Q+LRQQ+A  Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTG
Sbjct  537   QSLRQQRAFHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTG  596

Query  831   LSRSQVSNWFINARVRLWKPMVEEMYLEEVKE  736
             LSR+QVSNWFINARVRLWKPMVEEMY +E K+
Sbjct  597   LSRNQVSNWFINARVRLWKPMVEEMYQQEAKD  628



>ref|NP_001148063.1| homeodomain protein JUBEL1 [Zea mays]
 gb|ACG29619.1| homeodomain protein JUBEL1 [Zea mays]
Length=755

 Score =   286 bits (732),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/294 (53%), Positives = 196/294 (67%), Gaps = 24/294 (8%)
 Frame = -2

Query  1524  LGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQ----------  1375
             LG+  ++G+        +R+SKY   AQELL+EFC VG  Q     R +           
Sbjct  337   LGQQLHVGYGPAGVAGVLRNSKYTRAAQELLEEFCSVGRGQIKGGGRGASASNPNNNPGN  396

Query  1374  ----------WQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTA  1225
                        Q      + +   L      E Q+ K+KL+ +LDEVDRRY HY DQM  
Sbjct  397   KGGASSSGAAAQSPSSAPNKEPPQLSPADRFEQQRKKAKLISMLDEVDRRYNHYCDQMQM  456

Query  1224  VVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGAT  1045
             VV+ F++V G GAAT Y+ALA + MSRHFRCL+DAI AQL+A  + + EK++ +++ G T
Sbjct  457   VVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQLRATCELLGEKDAGTSS-GLT  515

Query  1044  KGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSD  865
             KGETPRL+ IDQ+LRQQ+A   + MM+   WRPQRGLPERSV++LR+WLFEHFLHPYPSD
Sbjct  516   KGETPRLRAIDQSLRQQRAFHHMGMMEQEAWRPQRGLPERSVNILRSWLFEHFLHPYPSD  575

Query  864   VDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGS  703
              DKH+LARQTGLSR+QVSNWFINARVRLWKPM+EEMY +E +E D   GSS G 
Sbjct  576   ADKHLLARQTGLSRNQVSNWFINARVRLWKPMIEEMYQQECRELD---GSSAGG  626



>ref|XP_006651784.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
2-like [Oryza brachyantha]
Length=710

 Score =   285 bits (729),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 184/262 (70%), Gaps = 17/262 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCV---------GTTQSDEPKRKSQWQ-------QDDHTTSSQ  1342
             +R+SKY   AQELL+EFC V         G   +  PK             Q   + S +
Sbjct  353   LRNSKYTRAAQELLEEFCSVCRGQIKGGRGAASAPNPKASKGGGASSSGAAQSPTSASKE  412

Query  1341  NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
                L      E Q+ K+KL+ +LDEVDRRY HY DQM  VV+ F++V G GAAT Y+ALA
Sbjct  413   PPQLSPADRFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALA  472

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQ  982
              + MSRHFRCL+DAI AQL+   + + EK++ +++ G TKGETPRL+ IDQ+LRQQ+A  
Sbjct  473   QKAMSRHFRCLKDAIAAQLRHTCELLGEKDAGTSS-GLTKGETPRLRAIDQSLRQQRAFH  531

Query  981   QLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  802
              + +M+   WRPQRGLPERSV++LR+WLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWF
Sbjct  532   HMGIMEQEAWRPQRGLPERSVNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWF  591

Query  801   INARVRLWKPMVEEMYLEEVKE  736
             INARVRLWKPM+EEMY +E KE
Sbjct  592   INARVRLWKPMIEEMYQQECKE  613



>ref|NP_001048808.1| Os03g0124000 [Oryza sativa Japonica Group]
 gb|ABF93732.1| Associated with HOX family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10722.1| Os03g0124000 [Oryza sativa Japonica Group]
Length=591

 Score =   282 bits (721),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 187/385 (49%), Positives = 249/385 (65%), Gaps = 61/385 (16%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCC--VGTTQSDEPKRKSQWQQDDH-----------TTSSQN  1339
             + +RSS++L P Q+LL+EFC   V +T+     + +  Q+D             T S Q 
Sbjct  142   WHLRSSRFLLPTQQLLQEFCSLPVDSTKRGNGAKAATQQEDGRGDGSSSSSASWTPSPQ-  200

Query  1338  HSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALAS  1159
               + ++  LELQ+ K KL  +L+EVDRRY+ Y +QM AV   FEAVAG+ AA  Y+A+A+
Sbjct  201   --IQAMEALELQRLKDKLYIMLEEVDRRYRRYCEQMRAVAGGFEAVAGERAAGAYTAVAA  258

Query  1158  RVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQ  979
             R +SRHFR LRD I+AQL+AA+KA+ EK+ S+A  G T+G+TPRL++IDQ +R  K++Q 
Sbjct  259   RTISRHFRSLRDGIVAQLQAARKALGEKDVSAA--GTTRGQTPRLRVIDQCIRHHKSLQG  316

Query  978   LTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  799
             +  MDSHPWRPQRGLP+R+V++LRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI
Sbjct  317   VAAMDSHPWRPQRGLPDRAVTILRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  376

Query  798   NARVRLWKPMVEEMYLEEVKEQ------------------DNIMGSSDGSRAAVDGGSGR  673
             NARVRLWKPMVEEMY+EE+K Q                   +   +  G +  V  G G 
Sbjct  377   NARVRLWKPMVEEMYVEEMKGQDGGDGSGGQGSLNPKPTCSHASEARGGQQLVVGDGDGG  436

Query  672   ERLDKKPNVVRL--DSECISSLINIPAKAGGDH----HQ---FGAVE-LDFSPY--THNS  529
             E   +KP   +L  D+  ++S++N+   AG       HQ   FG ++ LDF  Y  +H+ 
Sbjct  437   E---QKPTRAQLRHDAGSLASVVNVDVAAGAGGVARLHQAENFGIMDHLDFDAYDDSHH-  492

Query  528   GGAVGYRPGERKTggggGVSLTLGL  454
                      +++ GG GGVSLTLGL
Sbjct  493   ---------QQQHGGFGGVSLTLGL  508



>tpg|DAA51178.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
Length=755

 Score =   286 bits (732),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 155/294 (53%), Positives = 196/294 (67%), Gaps = 24/294 (8%)
 Frame = -2

Query  1524  LGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQ----------  1375
             LG+  ++G+        +R+SKY   AQELL+EFC VG  Q     R +           
Sbjct  337   LGQQLHVGYGPAGVAGVLRNSKYTRAAQELLEEFCSVGRGQIKGGGRGASASNPNNNPGN  396

Query  1374  ----------WQQDDHTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTA  1225
                        Q      + +   L      E Q+ K+KL+ +LDEVDRRY HY DQM  
Sbjct  397   KGGASSSGAAAQSPSSAPNKEPPQLSPADRFEQQRKKAKLISMLDEVDRRYNHYCDQMQM  456

Query  1224  VVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGAT  1045
             VV+ F++V G GAAT Y+ALA + MSRHFRCL+DAI AQL+A  + + EK++ +++ G T
Sbjct  457   VVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQLRATCELLGEKDAGTSS-GLT  515

Query  1044  KGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSD  865
             KGETPRL+ IDQ+LRQQ+A   + MM+   WRPQRGLPERSV++LR+WLFEHFLHPYPSD
Sbjct  516   KGETPRLRAIDQSLRQQRAFHHMGMMEQEAWRPQRGLPERSVNILRSWLFEHFLHPYPSD  575

Query  864   VDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGS  703
              DKH+LARQTGLSR+QVSNWFINARVRLWKPM+EEMY +E +E D   GSS G 
Sbjct  576   ADKHLLARQTGLSRNQVSNWFINARVRLWKPMIEEMYQQECRELD---GSSAGG  626



>ref|XP_009400050.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=732

 Score =   285 bits (730),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 151/284 (53%), Positives = 188/284 (66%), Gaps = 29/284 (10%)
 Frame = -2

Query  1521  GKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPK----RKSQWQQDDHT  1354
             G+P ++G+ +      +R+SKY   AQ+LL+EFC VG  QS   +    R   +   D  
Sbjct  296   GEPAHMGYGAMAAVNVLRNSKYARAAQQLLEEFCSVGRGQSKATRVGRQRGGGFSNPDAN  355

Query  1353  TSSQ------------------------NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKH  1246
              S                            +L S    E Q+ K+KL+ +LDEVDRRY H
Sbjct  356   PSVAGAAGGGGGASTSAAASSSSSKPDITTTLSSADKFEYQRKKAKLISMLDEVDRRYNH  415

Query  1245  YRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekess  1066
             Y DQM  VV+SF++V G GAA  Y+ALA + MSRHFRCL+DAI  QLK   + + +KE +
Sbjct  416   YCDQMQMVVNSFDSVMGFGAAAPYTALAQKAMSRHFRCLKDAIATQLKQTCELLGDKEGA  475

Query  1065  saAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHF  886
             S + G TKGETPRL+ IDQ LRQQ+A  Q+ MM+   WRPQRGLPERSV++LR+WLFEHF
Sbjct  476   SGS-GITKGETPRLRFIDQNLRQQRAFHQMGMMEQEAWRPQRGLPERSVNILRSWLFEHF  534

Query  885   LHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMY  754
             LHPYPSD DKH+LARQTGLSR+QVSNWFINARVRLWKPMVE+MY
Sbjct  535   LHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEDMY  578



>ref|XP_009769608.1| PREDICTED: BEL1-like homeodomain protein 4 [Nicotiana sylvestris]
Length=752

 Score =   286 bits (731),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/261 (56%), Positives = 192/261 (74%), Gaps = 26/261 (10%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQN---------------  1339
             +R+SKY   AQELL+EFC VG +Q     +K++  ++++TT+S N               
Sbjct  321   LRNSKYAKAAQELLEEFCSVGRSQL---FKKNKVSRNNNTTTSSNPNFNNPSGSNNNNNN  377

Query  1338  -----HSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVY  1174
                    L +   +E Q+ K KLL + DEVD+RY HY +QM  VV+SF+ V G GAA  Y
Sbjct  378   SSKDLSPLSAADRIEHQRRKVKLLSMFDEVDKRYNHYCEQMQTVVNSFDLVMGFGAAAPY  437

Query  1173  SALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQ  994
             +ALA + MSRHF+CL+DAI AQLK + + + EK+++++  G TKGETPRLK+++++LRQQ
Sbjct  438   TALAQKAMSRHFKCLKDAIAAQLKHSCELLGEKDATTS--GLTKGETPRLKLLEKSLRQQ  495

Query  993   -KAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
              +AI Q+ MMD+  WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+Q
Sbjct  496   QRAIHQMGMMDAEAWRPQRGLPERSVTILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQ  555

Query  816   VSNWFINARVRLWKPMVEEMY  754
             VSNWFINARVRLWKPMVE+MY
Sbjct  556   VSNWFINARVRLWKPMVEDMY  576



>ref|XP_008778978.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X1 [Phoenix 
dactylifera]
Length=732

 Score =   285 bits (729),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 152/270 (56%), Positives = 192/270 (71%), Gaps = 28/270 (10%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+S+Y    +ELL+EFC +G  Q     + S+  ++  ++S+ N S             
Sbjct  316   LRNSRYARAVRELLEEFCSIGRGQ----LKGSRIGRNRGSSSNPNPSHGGGGGVSSSVAG  371

Query  1332  ----------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAA  1183
                       L      E Q+ K+KL+ +LDEVDRRY +Y DQM  VV+SF++V G GAA
Sbjct  372   SSSSSKDLPPLSPADRFEHQRKKAKLISMLDEVDRRYNNYCDQMQMVVNSFDSVMGFGAA  431

Query  1182  TVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTL  1003
             + Y+ALA + MSRHFRCL+DAI AQLK   + + EKE+ S++ G TKGETPRL+++DQ+L
Sbjct  432   SPYTALAQKAMSRHFRCLKDAIAAQLKQTCELLGEKEAGSSS-GLTKGETPRLRLVDQSL  490

Query  1002  RQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSR  823
             RQQKA QQ+ MM+   WRPQRGLPERSV+VLRAWLFEHFLHPYPSD DKH+LARQTGLSR
Sbjct  491   RQQKAFQQMGMMEQEAWRPQRGLPERSVNVLRAWLFEHFLHPYPSDADKHLLARQTGLSR  550

Query  822   SQVSNWFINARVRLWKPMVEEMYLEEVKEQ  733
             +QVSNWFINARVRLWKPMVEEMY +E K Q
Sbjct  551   NQVSNWFINARVRLWKPMVEEMYQQEAKAQ  580



>ref|XP_006283322.1| hypothetical protein CARUB_v10004359mg [Capsella rubella]
 gb|EOA16220.1| hypothetical protein CARUB_v10004359mg [Capsella rubella]
Length=446

 Score =   277 bits (708),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 180/246 (73%), Gaps = 24/246 (10%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEP------------KRKSQW--------QQDD  1360
             FQI SSKYL PAQELL EFC +G  +SDE             K++  W        QQD 
Sbjct  190   FQIGSSKYLSPAQELLSEFCSLGVKESDEEVMMMKNKRKQKGKQQEDWDTSHNNNDQQDQ  249

Query  1359  H-TTSSQNH--SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDG  1189
               TTSS+ H   L SL F+ELQK K+KLL +L+E+ RRY HYR+QM    +SFEA  G G
Sbjct  250   SATTSSKKHVPPLHSLEFMELQKRKAKLLSMLEELKRRYGHYREQMRVAAASFEAAVGVG  309

Query  1188  AATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPG-ATKGETPRLKMID  1012
             AA VY+ALASR MSRHFRCL+D ++ Q++A  +A+ E+E  S A   A +GETPRL+++D
Sbjct  310   AAEVYTALASRAMSRHFRCLKDGLVGQIQATSQALGEREEDSRAVSIAARGETPRLRLLD  369

Query  1011  QTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  832
             Q LRQQK+ +Q+T++D+HPWRPQRGLPER+V+ LRAWLFEHFLHPYPSDVDKHILARQTG
Sbjct  370   QALRQQKSYRQMTLVDAHPWRPQRGLPERAVTTLRAWLFEHFLHPYPSDVDKHILARQTG  429

Query  831   LSRSQV  814
             LSRSQV
Sbjct  430   LSRSQV  435



>gb|EAY88336.1| hypothetical protein OsI_09793 [Oryza sativa Indica Group]
Length=591

 Score =   281 bits (718),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 188/386 (49%), Positives = 251/386 (65%), Gaps = 63/386 (16%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCC--VGTTQSDEPKRKSQWQQDDH-----------TTSSQN  1339
             + +RSS++L PAQ+LL+EFC   V +T+     + +  Q+D             T S Q 
Sbjct  142   WHLRSSRFLLPAQQLLQEFCSLPVDSTKRGNGAKAATQQEDGRGDGSSSSSASWTPSPQ-  200

Query  1338  HSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALAS  1159
               + ++  LELQ+ K KL  +L+EVDRRY+ Y +QM AV   FEAVAG+ AA  Y+A+A+
Sbjct  201   --IQAMEALELQRLKDKLYIMLEEVDRRYRRYCEQMRAVAGGFEAVAGERAAGAYTAVAA  258

Query  1158  RVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQ  979
             R +SRHFR LRD I+AQL+AA+KA+ EK+ S+A  G T+G+TPRL++IDQ +R  K++Q 
Sbjct  259   RTISRHFRSLRDGIVAQLQAARKALGEKDVSAA--GTTRGQTPRLRVIDQCIRHHKSLQG  316

Query  978   LTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  799
             +  MDSHPWRPQRGLP+R+V++LRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI
Sbjct  317   VAAMDSHPWRPQRGLPDRAVTILRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  376

Query  798   NARVRLWKPMVEEMYLEEVKEQ------------------DNIMGSSDGSRAAV-DGGSG  676
             NARVRLWKPMVEEMY+EE+K Q                   +   +  G +  V DG  G
Sbjct  377   NARVRLWKPMVEEMYVEEMKGQDGGDGSGGQGSLNPKPTCSHASEARGGQQLVVGDGDDG  436

Query  675   RERLDKKPNVVRL--DSECISSLINIPAKAGGDH----HQ---FGAVE-LDFSPY--THN  532
                 ++KP   +L  D+  ++S++N+   AG       HQ   FG ++ LDF  Y  +H+
Sbjct  437   ----EQKPTRAQLRHDAGSLASVVNVDVAAGAGGVARLHQAENFGIMDHLDFDAYDDSHH  492

Query  531   SGGAVGYRPGERKTggggGVSLTLGL  454
                       +++ GG GGVSLTLGL
Sbjct  493   ----------QQQHGGFGGVSLTLGL  508



>ref|XP_006425771.1| hypothetical protein CICLE_v10024897mg [Citrus clementina]
 ref|XP_006466698.1| PREDICTED: BEL1-like homeodomain protein 2-like [Citrus sinensis]
 gb|ESR39011.1| hypothetical protein CICLE_v10024897mg [Citrus clementina]
Length=831

 Score =   286 bits (733),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 190/267 (71%), Gaps = 24/267 (9%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY   AQELL+EFC VG  Q     +KS++ +++   SS +               
Sbjct  394   LRNSKYAKAAQELLEEFCSVGRGQF----KKSKFGKNNTNPSSSSGGGGGGAGCGGSSSS  449

Query  1332  ------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYS  1171
                   L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G GAA  Y+
Sbjct  450   TKDLAPLSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVTSFDLVMGFGAAVPYT  509

Query  1170  ALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQK  991
             ALA + MSRHFRCL+DAI  QLK + + + EK+ +  + G TKGETPRLK+++Q+LRQQ+
Sbjct  510   ALAQKAMSRHFRCLKDAIATQLKQSCELLGEKDVAGTS-GITKGETPRLKLLEQSLRQQR  568

Query  990   AIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVS  811
             A  Q+ MM+   WRPQRGLPERSV++LR+WLFEHFLHPYPSD DKH+LARQTGLSR+QVS
Sbjct  569   AFHQMGMMEQEAWRPQRGLPERSVNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVS  628

Query  810   NWFINARVRLWKPMVEEMYLEEVKEQD  730
             NWFINARVRLWKPMVEEMY +E KE +
Sbjct  629   NWFINARVRLWKPMVEEMYQQEAKEAE  655



>ref|XP_008344278.1| PREDICTED: BEL1-like homeodomain protein 2 [Malus domestica]
Length=809

 Score =   286 bits (732),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 188/265 (71%), Gaps = 22/265 (8%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPK--RKSQWQQDDHTTSSQNHS-----------  1333
             +R+SKY+  AQELL+EFC VG  Q  + K    +  +Q+  T  S N +           
Sbjct  364   LRNSKYVKAAQELLEEFCSVGRGQLKKNKFGGSTSGRQNTTTNPSSNPASGGGGDGGASS  423

Query  1332  --------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATV  1177
                     L +   +E Q+ K KLL ++DEVDRRY HY +QM  VV++F+ V G GAA  
Sbjct  424   SSSKDVPPLSAADRIEHQRRKVKLLSMIDEVDRRYNHYCEQMQMVVNAFDLVMGFGAAVP  483

Query  1176  YSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQ  997
             Y+ALA + MSRHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRLK+++Q+LRQ
Sbjct  484   YTALAQKAMSRHFRCLKDAIAAQLKHSCELIGEKDGAGTS-GITKGETPRLKLLEQSLRQ  542

Query  996   QKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
             Q+A  Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+Q
Sbjct  543   QRAFHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQ  602

Query  816   VSNWFINARVRLWKPMVEEMYLEEV  742
             VSNWFINARVRLWKPMVEEMY +E 
Sbjct  603   VSNWFINARVRLWKPMVEEMYQQEA  627



>gb|AAF43095.1|AF053769_1 homeodomain protein [Malus domestica]
Length=809

 Score =   286 bits (732),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 188/265 (71%), Gaps = 22/265 (8%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPK--RKSQWQQDDHTTSSQNHS-----------  1333
             +R+SKY+  AQELL+EFC VG  Q  + K    +  +Q+  T  S N +           
Sbjct  364   LRNSKYVKAAQELLEEFCSVGRGQLKKNKFGGSTSGRQNTTTNPSSNPASGGGGDGGASS  423

Query  1332  --------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATV  1177
                     L +   +E Q+ K KLL ++DEVDRRY HY +QM  VV++F+ V G GAA  
Sbjct  424   SSSKDVPPLSAADRIEHQRRKVKLLSMIDEVDRRYNHYCEQMQMVVNAFDLVMGFGAAVP  483

Query  1176  YSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQ  997
             Y+ALA + MSRHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRLK+++Q+LRQ
Sbjct  484   YTALAQKAMSRHFRCLKDAIAAQLKHSCELIGEKDGAGTS-GITKGETPRLKLLEQSLRQ  542

Query  996   QKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
             Q+A  Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+Q
Sbjct  543   QRAFHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQ  602

Query  816   VSNWFINARVRLWKPMVEEMYLEEV  742
             VSNWFINARVRLWKPMVEEMY +E 
Sbjct  603   VSNWFINARVRLWKPMVEEMYQQEA  627



>ref|XP_002306443.2| hypothetical protein POPTR_0005s13780g [Populus trichocarpa]
 gb|EEE93439.2| hypothetical protein POPTR_0005s13780g [Populus trichocarpa]
Length=825

 Score =   286 bits (732),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 185/259 (71%), Gaps = 12/259 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-----------LG  1327
             +R+SKY+  AQELL+EFC VG  Q  + K   Q        +                L 
Sbjct  382   LRNSKYVRAAQELLEEFCSVGRGQFKKSKFGRQNTNPSSNNNPGGGGGSSSSTKDPLPLS  441

Query  1326  SLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMS  1147
             +   +E Q+ K KLL +LDEVD+RY HY +QM  VV+SF+ + G GAA  Y+ALA + MS
Sbjct  442   AADRIEHQRKKVKLLSMLDEVDKRYNHYCEQMQMVVNSFDLIMGFGAAVPYTALAQKAMS  501

Query  1146  RHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMM  967
             RHFRCL++AI AQLK + + + +K+ +  +   TKGETPRLK+++Q+LRQQ+A  Q+ MM
Sbjct  502   RHFRCLKEAISAQLKHSCELVGDKDGAGTS-AITKGETPRLKLLEQSLRQQRAFNQMGMM  560

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             +   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARV
Sbjct  561   EQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARV  620

Query  786   RLWKPMVEEMYLEEVKEQD  730
             RLWKPMVEEMY +E KE++
Sbjct  621   RLWKPMVEEMYQQEAKEEE  639



>ref|XP_006411954.1| hypothetical protein EUTSA_v10024509mg [Eutrema salsugineum]
 gb|ESQ53407.1| hypothetical protein EUTSA_v10024509mg [Eutrema salsugineum]
Length=739

 Score =   283 bits (725),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/251 (57%), Positives = 187/251 (75%), Gaps = 11/251 (4%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSS---------QNHS-LGS  1324
             +R+S+Y   AQELL+EFC VG   S + K ++    +    +          ++HS L +
Sbjct  315   LRNSRYTMAAQELLEEFCSVGRGFSKKSKLRNSSNPNTSGGAGGSPSSAGAIKDHSPLSA  374

Query  1323  LHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSR  1144
                +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + MSR
Sbjct  375   SDRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGHGAALPYTALAQKAMSR  434

Query  1143  HFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAIQQLTMM  967
             HFRCL+DA+ AQLK + + + +K+++  ++ G TKGETPRL++++Q+LRQQ+A  Q+ MM
Sbjct  435   HFRCLKDAVAAQLKQSCELLGDKDAAGISSSGLTKGETPRLRLLEQSLRQQRAFHQMGMM  494

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             +   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARV
Sbjct  495   EQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARV  554

Query  786   RLWKPMVEEMY  754
             RLWKPMVEEMY
Sbjct  555   RLWKPMVEEMY  565



>ref|XP_010531191.1| PREDICTED: BEL1-like homeodomain protein 4 [Tarenaya hassleriana]
Length=746

 Score =   283 bits (725),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 145/260 (56%), Positives = 187/260 (72%), Gaps = 15/260 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHT-------------TSSQNHS  1333
             +R+SKY   AQELL+EFC VG     + K  ++   +  T              ++++H 
Sbjct  332   LRNSKYTKAAQELLEEFCSVGRGHFKKNKFGNRNSSNPTTSGGAGGGGSSSSAVATKDHP  391

Query  1332  -LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASR  1156
              L +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA +
Sbjct  392   PLSAADRIEHQRRKVKLLSMLEEVDRRYSHYCEQMQMVVNSFDLVMGYGAAVPYTALAQK  451

Query  1155  VMSRHFRCLRDAILAQLka-akkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQ  979
              MSRHFRCL+DAI  QL+  +   + EK+ + ++ G TKGETPRL++++Q+LRQQ+A  Q
Sbjct  452   AMSRHFRCLKDAISGQLRHPSISQLGEKDVAGSSSGLTKGETPRLRLLEQSLRQQRAFHQ  511

Query  978   LTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  799
             + MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFI
Sbjct  512   MGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFI  571

Query  798   NARVRLWKPMVEEMYLEEVK  739
             NARVRLWKPMVEEMY +E K
Sbjct  572   NARVRLWKPMVEEMYQQEAK  591



>emb|CDY46061.1| BnaA09g41850D [Brassica napus]
Length=608

 Score =   280 bits (716),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 181/254 (71%), Gaps = 11/254 (4%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGT----------TQSDEPKRKSQWQQDDHTTSSQNHS  1333
              + +R+SKY  PAQELL+EFC VG             S+               ++ N  
Sbjct  214   IYTLRNSKYTKPAQELLEEFCSVGRGHFKKNKLSRNNSNPNTSGGGGSSSSPGVANDNPP  273

Query  1332  LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRV  1153
             L     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ LA + 
Sbjct  274   LSPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAIPYTTLAQKA  333

Query  1152  MSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAIQQL  976
             MSRHFRCL+DA+L QLK + + + EKE+S +A+ G TKGETPRL++++Q+LRQQ+A   +
Sbjct  334   MSRHFRCLKDAVLVQLKRSCELLGEKETSGAASSGLTKGETPRLRLLEQSLRQQRAFHHM  393

Query  975   TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFIN  796
              MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTGLSR+QVSNWFIN
Sbjct  394   GMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFIN  453

Query  795   ARVRLWKPMVEEMY  754
             ARVRLWKPMVEEMY
Sbjct  454   ARVRLWKPMVEEMY  467



>ref|XP_009117270.1| PREDICTED: BEL1-like homeodomain protein 4 [Brassica rapa]
Length=608

 Score =   280 bits (715),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 181/254 (71%), Gaps = 11/254 (4%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGT----------TQSDEPKRKSQWQQDDHTTSSQNHS  1333
              + +R+SKY  PAQELL+EFC VG             S+               ++ N  
Sbjct  214   IYTLRNSKYTKPAQELLEEFCSVGRGHFKKNKLSRNNSNPNTSGGGGSSSSPGVANDNPP  273

Query  1332  LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRV  1153
             L     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ LA + 
Sbjct  274   LSPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAIPYTTLAQKA  333

Query  1152  MSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAIQQL  976
             MSRHFRCL+DA+L QLK + + + EKE+S +A+ G TKGETPRL++++Q+LRQQ+A   +
Sbjct  334   MSRHFRCLKDAVLVQLKRSCELLGEKETSGAASSGLTKGETPRLRLLEQSLRQQRAFHHM  393

Query  975   TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFIN  796
              MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTGLSR+QVSNWFIN
Sbjct  394   GMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNWFIN  453

Query  795   ARVRLWKPMVEEMY  754
             ARVRLWKPMVEEMY
Sbjct  454   ARVRLWKPMVEEMY  467



>ref|XP_004233410.1| PREDICTED: BEL1-like homeodomain protein 2 [Solanum lycopersicum]
 ref|XP_010317146.1| PREDICTED: BEL1-like homeodomain protein 2 [Solanum lycopersicum]
Length=633

 Score =   280 bits (717),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 162/369 (44%), Positives = 220/369 (60%), Gaps = 34/369 (9%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNH--------------  1336
             +R+SKY+   QELL+EFCCVG  Q  +   K        T +                  
Sbjct  267   LRNSKYVKATQELLEEFCCVGKGQLFKKINKVSRNITSPTINPSGSNNNNSSSSKDIIPP  326

Query  1335  SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASR  1156
             +L +   L+ Q+ K KLL ++DEVD+RY HY +QM  VV+SF+ V G GAA  Y++LA +
Sbjct  327   NLSTADRLDHQRRKVKLLSMIDEVDKRYNHYCEQMQMVVNSFDLVMGFGAAVPYTSLAHK  386

Query  1155  VMSRHFRCLRDAILAQLkaakkam-aekesssaAPGATKGETPRLKMIDQTLRQQKAIQQ  979
              MSRHF+CL+D + AQLK   +A+  +  S++ + G TKGETPRLK+++Q LRQQ+A QQ
Sbjct  387   AMSRHFKCLKDGVGAQLKKTCEALGEKDVSNTTSSGLTKGETPRLKLLEQNLRQQRAFQQ  446

Query  978   L-TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  802
             +  +M+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLS++QV+NWF
Sbjct  447   MGIVMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSKNQVANWF  506

Query  801   INARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERL---------DKKPN  649
             INARVRLWKPMVEEMY  E  E D+ M S +  R   D  +   ++         +  P+
Sbjct  507   INARVRLWKPMVEEMYQREANEDDD-MNSRNTQRPTPDITTTNSKITETKSAAATENDPS  565

Query  648   VVRLDSECISSLINIPAKAGGDHHQFGAVELDFSPYTHNSGGAVGYRPGERKTggggGVS  469
             +    S  + + +N       + H+ GA         ++    +G +     T     VS
Sbjct  566   MNTHYSSSMQTQLNNSPTIQHESHRSGA--------EYDGTTDIGSKIMTFGTTTPADVS  617

Query  468   LTLGLQQHG  442
             LTLGL   G
Sbjct  618   LTLGLHHAG  626



>emb|CDX69252.1| BnaC01g02010D [Brassica napus]
Length=667

 Score =   281 bits (719),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 190/266 (71%), Gaps = 18/266 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG----------------TTQSDEPKRKSQWQQDDHTTSSQ  1342
             +R+S+Y   AQELL+EFC VG                T+  D               +S+
Sbjct  249   LRNSRYTKVAQELLEEFCSVGRGFSKKNKPKNKSNPNTSGGDGSSSGGAGGSPSSAGASK  308

Query  1341  NHS-LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSAL  1165
             +H  L +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+AL
Sbjct  309   DHPPLSASDRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGHGAAIPYTAL  368

Query  1164  ASRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKA  988
             A + MSRHFRCL+DA+ AQL+ + + + EK+++  ++ G TKG+TPRL++++Q+LRQQ+A
Sbjct  369   AQKAMSRHFRCLKDAVAAQLRQSCELLGEKDAAGLSSSGLTKGDTPRLRLLEQSLRQQRA  428

Query  987   IQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN  808
               Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSN
Sbjct  429   FHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSN  488

Query  807   WFINARVRLWKPMVEEMYLEEVKEQD  730
             WFINARVRLWKPMVEEMY +E KE++
Sbjct  489   WFINARVRLWKPMVEEMYQQESKERE  514



>ref|XP_002281889.1| PREDICTED: BEL1-like homeodomain protein 4 [Vitis vinifera]
Length=676

 Score =   281 bits (719),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 187/269 (70%), Gaps = 15/269 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY   AQELL+EFC VG       +R       +        +             
Sbjct  266   LRNSKYAKAAQELLEEFCSVGREHYKNQRRGKHSINPNSDPGGGGGAAASGSSSSVKDLA  325

Query  1332  -LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASR  1156
              L +   +E Q+ K KLL +LDEVD RY HY +Q+  VV+SF++  G GAA  Y+ LA +
Sbjct  326   PLSAADKIEHQRRKIKLLSMLDEVDSRYNHYCEQIQVVVNSFDSKMGFGAANPYTTLARK  385

Query  1155  VMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQL  976
              MSRHFRC++DAILAQLK + + + EK+  +A+ G +KGETPRL+++DQ+LRQQ+A+ Q+
Sbjct  386   AMSRHFRCMKDAILAQLKISCELLGEKDVMAAS-GLSKGETPRLRLLDQSLRQQRALHQM  444

Query  975   TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFIN  796
              MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+L+RQTGLSR+QVSNWFIN
Sbjct  445   GMMEPEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLSRQTGLSRNQVSNWFIN  504

Query  795   ARVRLWKPMVEEMYLEEVKEQDNIMGSSD  709
             ARVRLWKPMVEEMY ++ KE++    S D
Sbjct  505   ARVRLWKPMVEEMYQQDAKEEEAAASSED  533



>ref|XP_007047071.1| BEL1-like homeodomain protein 2 isoform 2 [Theobroma cacao]
 gb|EOX91228.1| BEL1-like homeodomain protein 2 isoform 2 [Theobroma cacao]
Length=825

 Score =   283 bits (725),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 151/264 (57%), Positives = 191/264 (72%), Gaps = 23/264 (9%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY+  AQELL+EFC VG  Q     +K+++ +++   SS   S             
Sbjct  368   LRNSKYVKAAQELLEEFCSVGRGQF----KKNKFGRNNTNPSSNPGSSGGGGGGSSSSTK  423

Query  1332  ----LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSAL  1165
                 L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G G+A  Y+AL
Sbjct  424   DLPPLSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGSAVPYTAL  483

Query  1164  ASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAI  985
             A + MSRHFRCL+DA+ AQLK + + + EK+ +  + G TKGETPRLKM++Q+LRQQ+A 
Sbjct  484   AQKAMSRHFRCLKDAVSAQLKHSCEVLGEKDGAGTS-GITKGETPRLKMLEQSLRQQRAF  542

Query  984   QQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ-VSN  808
              Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+Q VSN
Sbjct  543   HQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVVSN  602

Query  807   WFINARVRLWKPMVEEMYLEEVKE  736
             WFINARVRLWKPMVEEMY +E KE
Sbjct  603   WFINARVRLWKPMVEEMYQQETKE  626



>ref|XP_004148064.1| PREDICTED: uncharacterized protein LOC101212977 [Cucumis sativus]
Length=644

 Score =   279 bits (714),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 182/264 (69%), Gaps = 19/264 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQ-----------------SDEPKRKSQWQQDDHTTSS  1345
             +R+SKY+  AQELL+EFC VG  Q                 S              +T  
Sbjct  244   LRNSKYIKAAQELLEEFCSVGRGQFKKNNHNNKSNLPSNSNSHGGGGGDGAGVSSSSTKD  303

Query  1344  QNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSAL  1165
                SL +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G  AA  Y+AL
Sbjct  304   HQPSLSATDRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDEVMGFRAAVPYTAL  363

Query  1164  ASRVMSRHFRCLRDAILAQLkaakkamaeke--sssaAPGATKGETPRLKMIDQTLRQQK  991
             A + MSRHFRCL+DAI +QLK + + + EK+   +  A G TKGETPRLK+++Q+LRQQ+
Sbjct  364   AQKAMSRHFRCLKDAISSQLKHSCEMLGEKDGGVTGRASGITKGETPRLKLLEQSLRQQR  423

Query  990   AIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVS  811
             A  Q+ +M+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVS
Sbjct  424   AFHQMGIMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVS  483

Query  810   NWFINARVRLWKPMVEEMYLEEVK  739
             NWFINARVRLWKPMVEEMY +E K
Sbjct  484   NWFINARVRLWKPMVEEMYQQEAK  507



>ref|XP_004981881.1| PREDICTED: BEL1-like homeodomain protein 2-like isoform X1 [Setaria 
italica]
Length=748

 Score =   281 bits (720),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 152/293 (52%), Positives = 196/293 (67%), Gaps = 24/293 (8%)
 Frame = -2

Query  1524  LGKPENLGHPSQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSS  1345
             LG+  ++G+        +R+SKY   AQELL+EFC VG  Q     R  +     +  +S
Sbjct  326   LGQQLHVGYGPAGVAGVLRNSKYTRAAQELLEEFCSVGRGQIKGGARGGRGASASNPNAS  385

Query  1344  QNHS--------------------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTA  1225
             +                       L      E Q+ K+KL+ +LDEVDRRY HY DQM  
Sbjct  386   KAGGASSSGAAQSPSSASKQEPPQLSPADRFEHQRKKAKLISMLDEVDRRYNHYCDQMQM  445

Query  1224  VVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGAT  1045
             VV+ F++V G GAAT Y+ALA + MSRHFRCL+DAI +QL+   + + EK++ +++ G T
Sbjct  446   VVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIASQLRHTCELLGEKDAGTSS-GLT  504

Query  1044  KGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSD  865
             KGETPRL+ IDQ+LRQQ+A   + MM+   WRPQRGLPERSV++LR+WLFEHFLHPYPSD
Sbjct  505   KGETPRLRAIDQSLRQQRAFHHMGMMEQEAWRPQRGLPERSVNILRSWLFEHFLHPYPSD  564

Query  864   VDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDG  706
              DKH+LARQTGLSR+QVSNWFINARVRLWKPM+EEMY +E +E   + GSS G
Sbjct  565   ADKHLLARQTGLSRNQVSNWFINARVRLWKPMIEEMYQQECRE---LEGSSAG  614



>ref|XP_008457795.1| PREDICTED: BEL1-like homeodomain protein 4 [Cucumis melo]
 ref|XP_008457796.1| PREDICTED: BEL1-like homeodomain protein 4 [Cucumis melo]
Length=674

 Score =   280 bits (715),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 146/273 (53%), Positives = 187/273 (68%), Gaps = 37/273 (14%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDH---------------------  1357
             +R+SKY+   QELL+EFC VG         + Q+++++H                     
Sbjct  246   LRNSKYIKATQELLEEFCSVG---------RGQFKKNNHHNKSNLPSNSNSHGGGGGDGA  296

Query  1356  -----TTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGD  1192
                  +T     SL +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G 
Sbjct  297   GVSSSSTKDHQPSLSATDRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDEVMGF  356

Query  1191  GAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaeke--sssaAPGATKGETPRLKM  1018
              AA  Y+ALA + MSRHFRCL+DAI +QL+ + + + EK+   +  A G TKGETPRLK+
Sbjct  357   RAAVPYTALAQKAMSRHFRCLKDAISSQLRHSCEMLGEKDGGVTGRASGITKGETPRLKL  416

Query  1017  IDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQ  838
             ++Q+LRQQ+A  Q+ +M+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQ
Sbjct  417   LEQSLRQQRAFHQMGIMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQ  476

Query  837   TGLSRSQVSNWFINARVRLWKPMVEEMYLEEVK  739
             TGLSR+QVSNWFINARVRLWKPMVEEMY +E K
Sbjct  477   TGLSRNQVSNWFINARVRLWKPMVEEMYQQEAK  509



>gb|KGN62029.1| hypothetical protein Csa_2G287110 [Cucumis sativus]
Length=655

 Score =   279 bits (714),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 182/264 (69%), Gaps = 19/264 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQ-----------------SDEPKRKSQWQQDDHTTSS  1345
             +R+SKY+  AQELL+EFC VG  Q                 S              +T  
Sbjct  244   LRNSKYIKAAQELLEEFCSVGRGQFKKNNHNNKSNLPSNSNSHGGGGGDGAGVSSSSTKD  303

Query  1344  QNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSAL  1165
                SL +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G  AA  Y+AL
Sbjct  304   HQPSLSATDRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDEVMGFRAAVPYTAL  363

Query  1164  ASRVMSRHFRCLRDAILAQLkaakkamaeke--sssaAPGATKGETPRLKMIDQTLRQQK  991
             A + MSRHFRCL+DAI +QLK + + + EK+   +  A G TKGETPRLK+++Q+LRQQ+
Sbjct  364   AQKAMSRHFRCLKDAISSQLKHSCEMLGEKDGGVTGRASGITKGETPRLKLLEQSLRQQR  423

Query  990   AIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVS  811
             A  Q+ +M+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVS
Sbjct  424   AFHQMGIMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVS  483

Query  810   NWFINARVRLWKPMVEEMYLEEVK  739
             NWFINARVRLWKPMVEEMY +E K
Sbjct  484   NWFINARVRLWKPMVEEMYQQEAK  507



>ref|XP_009629330.1| PREDICTED: BEL1-like homeodomain protein 4 [Nicotiana tomentosiformis]
Length=771

 Score =   282 bits (721),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 185/262 (71%), Gaps = 19/262 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY   AQELL+EFC VG  +  +  + +    + +  S   +              
Sbjct  352   LRNSKYAKAAQELLEEFCSVGRGKFKKNNKAAAANPNSNNPSGGTNGGGGNNNTSSSSSK  411

Query  1332  ----LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSAL  1165
                 L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G GAA  Y+AL
Sbjct  412   DVPPLSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAIPYTAL  471

Query  1164  ASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAI  985
             A + MSRHFRCL+DAI AQLK + + + +K+  ++  G TKGETPRLKM++Q+LRQQ+A 
Sbjct  472   AQKAMSRHFRCLKDAITAQLKHSCELLGDKDGGTS--GLTKGETPRLKMLEQSLRQQRAF  529

Query  984   QQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNW  805
              Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNW
Sbjct  530   HQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNW  589

Query  804   FINARVRLWKPMVEEMYLEEVK  739
             FINARVRLWKPMVEEMY +E K
Sbjct  590   FINARVRLWKPMVEEMYQQEAK  611



>ref|XP_004142028.1| PREDICTED: homeobox protein BEL1 homolog [Cucumis sativus]
Length=657

 Score =   278 bits (712),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 172/364 (47%), Positives = 221/364 (61%), Gaps = 48/364 (13%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY+ PAQELL+EFC VG  Q  + K  ++   +  + ++   +             
Sbjct  299   LRNSKYVKPAQELLEEFCSVGKVQLKKNKFNTKPNPNTESATNATATTSAAATGGSTSKD  358

Query  1332  ---LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
                L +   +E Q+ K KLL +LDEV+RRY  YR+QM  VV+SF+ V G GAA  Y+ L 
Sbjct  359   QPPLSAADRIEHQRRKVKLLSMLDEVERRYNLYREQMQMVVNSFDLVMGFGAAAPYTTLT  418

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQ  982
              + MSRHFRCL+DAI  QLK + +A+ EK  +  + G TKGETPRLK+++Q+LRQQ+A  
Sbjct  419   QKAMSRHFRCLKDAIAEQLKQSYEALGEKGGNGGS-GITKGETPRLKLLEQSLRQQRAFH  477

Query  981   QLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  802
             Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DK +LARQTGLSR+QVSNWF
Sbjct  478   QMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKLLLARQTGLSRNQVSNWF  537

Query  801   INARVRLWKPMVEEMY-LEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPNVVRLDSEC  625
             INARVRLWKPMVEEMY LEEV                 +  +G +  D   +V R  S  
Sbjct  538   INARVRLWKPMVEEMYQLEEV---------------GAEYTAGHDYSDLH-DVWRHGS--  579

Query  624   ISSLINIPAKAGGDHHQ-FGAVELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQ  448
                       +G DH Q +G +  D +     S G    R G   T   G VSLTLGL+ 
Sbjct  580   ----------SGSDHQQHYGTMPEDVTAAADMSPGPTLIRFGTTNT-ATGDVSLTLGLRH  628

Query  447   HGGS  436
              G +
Sbjct  629   AGNT  632



>ref|XP_011074481.1| PREDICTED: BEL1-like homeodomain protein 4 [Sesamum indicum]
Length=625

 Score =   278 bits (710),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 187/260 (72%), Gaps = 13/260 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSS------------QNHSL  1330
             +R+S+YL  AQELL+EFC VG  Q    K K+Q +  +    S             +H L
Sbjct  261   LRNSRYLRAAQELLEEFCSVGRGQLKNQKIKNQDRNPNSVPDSGGVATGPSSSKDHHHPL  320

Query  1329  GSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVM  1150
                   + Q+ K KLL +LDEVD RY  Y +QM A+V SF+++ G G A VY+ LA + M
Sbjct  321   AHAERTDHQRRKIKLLAMLDEVDTRYLRYCEQMQAMVYSFDSIVGQGGAAVYTGLARKAM  380

Query  1149  SRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTM  970
             SRHFRC++DAI+ ++K + +A+ EK+ +  + G TKGETPRLK+++Q  RQQKA+Q + M
Sbjct  381   SRHFRCMKDAIIGEVKVSCEALGEKDVNVGS-GLTKGETPRLKLLEQKYRQQKALQHMGM  439

Query  969   MDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINAR  790
             +D   WRPQRGLPER+V++LR+WLFEHFLHPYPS+ DKH+L+RQTGLS++QVSNWFINAR
Sbjct  440   LDPESWRPQRGLPERAVNILRSWLFEHFLHPYPSEADKHLLSRQTGLSKNQVSNWFINAR  499

Query  789   VRLWKPMVEEMYLEEVKEQD  730
             VRLWKPMVE+MY +E ++QD
Sbjct  500   VRLWKPMVEQMYQQEFQDQD  519



>ref|XP_010417119.1| PREDICTED: BEL1-like homeodomain protein 4 [Camelina sativa]
Length=645

 Score =   278 bits (711),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 183/260 (70%), Gaps = 17/260 (7%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHT----------------T  1351
              + +R+SKY  PAQELL+EFC VG     + K        + T                T
Sbjct  248   IYTLRNSKYTKPAQELLEEFCSVGRGHFKKNKLSRNNSNPNTTGGGGGGGGGGSSSSAGT  307

Query  1350  SSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYS  1171
             ++ N  L     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+
Sbjct  308   ANDNPPLSPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAVPYT  367

Query  1170  ALASRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQ  994
              LA + MSRHFRCL+DA+  QLK + + + +KE++ +A+ G TKGETPRL++++Q+LRQQ
Sbjct  368   TLAQKAMSRHFRCLKDAVAVQLKRSCELLGDKEAAGAASSGLTKGETPRLRLLEQSLRQQ  427

Query  993   KAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV  814
             +A   + MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTGLSR+QV
Sbjct  428   RAFHHMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQV  487

Query  813   SNWFINARVRLWKPMVEEMY  754
             SNWFINARVRLWKPMVEEMY
Sbjct  488   SNWFINARVRLWKPMVEEMY  507



>ref|XP_010230386.1| PREDICTED: BEL1-like homeodomain protein 4 [Brachypodium distachyon]
Length=797

 Score =   281 bits (720),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 180/268 (67%), Gaps = 23/268 (9%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG----------------------TTQSDEPKRKSQWQQDD  1360
             +R+SKY   AQELL EFC VG                                +  Q   
Sbjct  364   LRNSKYTRAAQELLDEFCSVGRGGQTIKAAGRAGAGASNPNASKGGGGASSSGAGAQSPS  423

Query  1359  HTTSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAAT  1180
               +  +   L      E Q+ K+KL+ +LDEVDRRY HY DQM  VV+ F++V G GAAT
Sbjct  424   SASKMEPPQLSPADRFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAAT  483

Query  1179  VYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLR  1000
              Y+ALA + MSRHFRCL+DAI +QL+   + + EK++ +++ G TKGETPRL+ IDQ+LR
Sbjct  484   PYTALAQKAMSRHFRCLKDAIASQLRHTCELLGEKDAGTSS-GLTKGETPRLRAIDQSLR  542

Query  999   QQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRS  820
             QQ+A   + MM+   WRPQRGLPERSVS+LR+WLFEHFLHPYPSD DKH+LARQTGLSR+
Sbjct  543   QQRAFHHMGMMEQEAWRPQRGLPERSVSILRSWLFEHFLHPYPSDADKHLLARQTGLSRN  602

Query  819   QVSNWFINARVRLWKPMVEEMYLEEVKE  736
             QVSNWFINARVRLWKPM+EEMY +E KE
Sbjct  603   QVSNWFINARVRLWKPMIEEMYQQETKE  630



>ref|XP_010029855.1| PREDICTED: BEL1-like homeodomain protein 4 [Eucalyptus grandis]
 ref|XP_010029856.1| PREDICTED: BEL1-like homeodomain protein 4 [Eucalyptus grandis]
 ref|XP_010029858.1| PREDICTED: BEL1-like homeodomain protein 4 [Eucalyptus grandis]
 ref|XP_010029859.1| PREDICTED: BEL1-like homeodomain protein 4 [Eucalyptus grandis]
 ref|XP_010029860.1| PREDICTED: BEL1-like homeodomain protein 4 [Eucalyptus grandis]
 ref|XP_010029861.1| PREDICTED: BEL1-like homeodomain protein 4 [Eucalyptus grandis]
 gb|KCW56821.1| hypothetical protein EUGRSUZ_I02488 [Eucalyptus grandis]
Length=815

 Score =   282 bits (721),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 189/269 (70%), Gaps = 22/269 (8%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+S+YL  AQELL+EFC VG     + K        + +++  N++             
Sbjct  385   LRNSRYLKAAQELLEEFCSVGRGHFKKGKFGRNTSSSNPSSNPSNNNTSSASAVGGGASS  444

Query  1332  --------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATV  1177
                     L +   +E Q+ K KLL +LDEV+RRY HY +QM  VV+ F+ V G GAA  
Sbjct  445   SSSKDVPPLSAADRMEHQRRKVKLLSMLDEVERRYNHYCEQMQMVVNMFDLVMGYGAAVP  504

Query  1176  YSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQ  997
             Y+ALA + MSRHFRCL+DAI AQLK + + + EK+ + ++ G TKGETPRLK++DQ+LRQ
Sbjct  505   YTALAQKAMSRHFRCLKDAIAAQLKHSCELLGEKDGAGSS-GITKGETPRLKLLDQSLRQ  563

Query  996   QKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
             Q+A  Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+Q
Sbjct  564   QRAFHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQ  623

Query  816   VSNWFINARVRLWKPMVEEMYLEEVKEQD  730
             VSNWFINARVRLWKPMVEEMY +E KE D
Sbjct  624   VSNWFINARVRLWKPMVEEMYQQESKEGD  652



>ref|XP_010472371.1| PREDICTED: BEL1-like homeodomain protein 4 [Camelina sativa]
Length=642

 Score =   278 bits (711),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 183/260 (70%), Gaps = 17/260 (7%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHT----------------T  1351
              + +R+SKY  PAQELL+EFC VG     + K        + T                T
Sbjct  248   IYTLRNSKYTKPAQELLEEFCSVGRGHFKKNKLSRNNSNPNTTGGGGGGGGGGSSSSAGT  307

Query  1350  SSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYS  1171
             ++ N  L     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+
Sbjct  308   ANDNPPLSPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAVPYT  367

Query  1170  ALASRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQ  994
              LA + MSRHFRCL+DA+  QLK + + + +KE++ +A+ G TKGETPRL++++Q+LRQQ
Sbjct  368   TLAQKAMSRHFRCLKDAVAVQLKRSCELLGDKEAAGAASSGLTKGETPRLRLLEQSLRQQ  427

Query  993   KAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV  814
             +A   + MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTGLSR+QV
Sbjct  428   RAFHHMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQV  487

Query  813   SNWFINARVRLWKPMVEEMY  754
             SNWFINARVRLWKPMVEEMY
Sbjct  488   SNWFINARVRLWKPMVEEMY  507



>ref|XP_010429329.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X2 [Camelina 
sativa]
Length=641

 Score =   278 bits (710),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 183/260 (70%), Gaps = 17/260 (7%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHT----------------T  1351
              + +R+SKY  PAQELL+EFC VG     + K        + T                T
Sbjct  247   IYTLRNSKYTKPAQELLEEFCSVGRGHFKKNKLSRNNSNPNTTGGGGGGVGGGSSSSAGT  306

Query  1350  SSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYS  1171
             ++ N  L     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+
Sbjct  307   ANDNPPLSPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAVPYT  366

Query  1170  ALASRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQ  994
              LA + MSRHFRCL+DA+  QLK + + + +KE++ +A+ G TKGETPRL++++Q+LRQQ
Sbjct  367   TLAQKAMSRHFRCLKDAVAVQLKRSCELLGDKEAAGAASSGLTKGETPRLRLLEQSLRQQ  426

Query  993   KAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV  814
             +A   + MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTGLSR+QV
Sbjct  427   RAFHHMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQV  486

Query  813   SNWFINARVRLWKPMVEEMY  754
             SNWFINARVRLWKPMVEEMY
Sbjct  487   SNWFINARVRLWKPMVEEMY  506



>gb|ABF98709.1| homeodomain protein JUBEL1, putative, expressed [Oryza sativa 
Japonica Group]
Length=790

 Score =   281 bits (719),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 150/278 (54%), Positives = 191/278 (69%), Gaps = 17/278 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY   AQELL+EFC VG  Q      +     + +++ +   S             
Sbjct  374   LRNSKYTRAAQELLEEFCSVGRGQIKGGGGRGSAPNNPNSSKAAASSSGAAQSPSSASKE  433

Query  1332  ---LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
                L      E Q+ K+KL+ +LDEVDRRY HY DQM  VV+ F++V G GAAT Y+ALA
Sbjct  434   PPQLSPADRFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALA  493

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQ  982
              + MSRHFRCL+DAI AQL+   +A+ EK++ + + G TKGETPRL+ IDQ+LRQQ+A  
Sbjct  494   QKAMSRHFRCLKDAIAAQLRGTCEALGEKDAGTGS-GLTKGETPRLRAIDQSLRQQRAFH  552

Query  981   QLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  802
              + +M+   WRPQRGLPERSV++LR+WLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWF
Sbjct  553   HMGIMEQEAWRPQRGLPERSVNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWF  612

Query  801   INARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVD  688
             INARVRLWKPM+EEMY +E KE +   G+ D    A D
Sbjct  613   INARVRLWKPMIEEMYQQECKELEGSSGAGDDPSGADD  650



>gb|AAD51349.1| bel1-like homeodomain 2 [Arabidopsis thaliana]
 gb|AAK91472.1| AT4g36870/C7A10_490 [Arabidopsis thaliana]
Length=739

 Score =   280 bits (716),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 183/253 (72%), Gaps = 13/253 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG-----------TTQSDEPKRKSQWQQDDHTTSSQNHS-L  1330
             +R+S+Y   AQELL+EFC VG           ++  +               +++ H  L
Sbjct  313   LRNSRYTTAAQELLEEFCSVGRGFLKKNKLGNSSNPNTCGGDGGGSSPSSAGANKEHPPL  372

Query  1329  GSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVM  1150
              +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + M
Sbjct  373   SASDRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGHGAALPYTALAQKAM  432

Query  1149  SRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAIQQLT  973
             SRHFRCL+DA+ AQLK + + + +K+++  ++ G TKGETPRL++++Q+LRQQ+A  Q+ 
Sbjct  433   SRHFRCLKDAVAAQLKQSCELLGDKDAAGISSSGLTKGETPRLRLLEQSLRQQRAFHQMG  492

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
             MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINA
Sbjct  493   MMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINA  552

Query  792   RVRLWKPMVEEMY  754
             RVRLWKPMVEEMY
Sbjct  553   RVRLWKPMVEEMY  565



>ref|XP_006283200.1| hypothetical protein CARUB_v10004235mg [Capsella rubella]
 gb|EOA16098.1| hypothetical protein CARUB_v10004235mg [Capsella rubella]
Length=663

 Score =   278 bits (711),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 184/259 (71%), Gaps = 14/259 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG------------TTQSDEPKRKSQWQQDDHTTSSQNH-S  1333
             +R S+Y   AQELL+EFC VG            +  +                + ++H +
Sbjct  245   LRHSRYTTSAQELLEEFCSVGRGFLKKNKQKNNSNPNASGGDGGGGSSPSSAGAIKDHPT  304

Query  1332  LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRV  1153
             L +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + 
Sbjct  305   LSASDRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGQGAALPYTALAQKA  364

Query  1152  MSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAIQQL  976
             MSRHFRCL+DA+ AQLK + + + +K+ +  ++ G TKGETPRL++++Q+LRQQ+A  Q+
Sbjct  365   MSRHFRCLKDAVAAQLKQSCELLGDKDGAGMSSSGLTKGETPRLRLLEQSLRQQRAFHQM  424

Query  975   TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFIN  796
              MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFIN
Sbjct  425   GMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFIN  484

Query  795   ARVRLWKPMVEEMYLEEVK  739
             ARVRLWKPMVEEMY +E K
Sbjct  485   ARVRLWKPMVEEMYQQESK  503



>ref|XP_002269670.2| PREDICTED: BEL1-like homeodomain protein 2 [Vitis vinifera]
Length=798

 Score =   281 bits (718),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/253 (58%), Positives = 181/253 (72%), Gaps = 14/253 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG-------------TTQSDEPKRKSQWQQDDHTTSSQNHS  1333
             +R+SKY+  AQELL+EFC VG             T  +  P   S       ++S     
Sbjct  363   MRNSKYVKAAQELLEEFCSVGRGQFKKNKFGRHNTNPNSNPGGGSAGGGGSSSSSKDLPP  422

Query  1332  LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRV  1153
             L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + 
Sbjct  423   LSAADRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAVPYTALAQKA  482

Query  1152  MSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLT  973
             MSRHFRCL+DAI  QLK + + + EK+ S  + G TKGETPRL++++Q+LRQQ+A  Q+ 
Sbjct  483   MSRHFRCLKDAIAVQLKHSCELLGEKDPSGTS-GVTKGETPRLRLLEQSLRQQRAFHQMG  541

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
             MM+   WRPQRGLPERSV++LR+WLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINA
Sbjct  542   MMEQEAWRPQRGLPERSVNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINA  601

Query  792   RVRLWKPMVEEMY  754
             RVRLWKPMVEEMY
Sbjct  602   RVRLWKPMVEEMY  614



>gb|ACU01957.1| aintegumenta-like protein [Santalum album]
Length=299

 Score =   266 bits (680),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 173/313 (55%), Positives = 201/313 (64%), Gaps = 32/313 (10%)
 Frame = -2

Query  1158  RVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQ  979
             R MSRHFR LRD I+ Q+KA  K + E+ S+   PG T+GETPRL++++QT+RQQKA QQ
Sbjct  2     RAMSRHFRRLRDGIVGQIKATNKVLGEEASAIR-PGTTRGETPRLRVLEQTIRQQKAFQQ  60

Query  978   LTMMDSH--PWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNW  805
             L M++     WRPQRGLPE+SVSVLR+WLFEHFLHPYPSDVDKHILARQTGLSRSQVSNW
Sbjct  61    LNMVEGSLIAWRPQRGLPEQSVSVLRSWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNW  120

Query  804   FINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPNVVRLDSEC  625
             FINARVRLWKPMVEEMYLEE K+      +S  S A       +   D KP    L  E 
Sbjct  121   FINARVRLWKPMVEEMYLEETKDHQQPPETSSPSNA-------KPTQDLKPKPDELMGEA  173

Query  624   ISSLINIPAKAGGDHHQFGAVELDFSPYT--HNSGGAVGYRPGE------RKTggggGVS  469
             +  +             FG VELDF+ Y   + SG    Y              GGGGVS
Sbjct  174   VGIV------EPPPPPPFGTVELDFTNYNQQYGSGLVSSYLNNNNANPNFGGVSGGGGVS  227

Query  468   LTL-----GLQQHGGSGIGLAFSPTSQNSLFYPRDQIGDCPPVQYSLLDG--EGQNLPYR  310
             LTL          G  G+ LAFSP SQ+SLFY R  I D   VQY +L+G  + QNLPYR
Sbjct  228   LTLGLQQQQGGGRGDGGVSLAFSP-SQSSLFYSRGHIEDRGSVQYPILEGANDTQNLPYR  286

Query  309   NLMGSQLLHDLAG  271
             NLMG+QLLHDLAG
Sbjct  287   NLMGAQLLHDLAG  299



>ref|XP_003572007.1| PREDICTED: BEL1-like homeodomain protein 4 [Brachypodium distachyon]
Length=606

 Score =   276 bits (705),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 185/371 (50%), Positives = 235/371 (63%), Gaps = 33/371 (9%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCV--GTTQSDEPKRKSQWQQDDHTTSSQNHSLGSLHF---  1315
             + +R S++L P Q+LL+EFC +   TT S  PKR  Q +  +   SS +    S      
Sbjct  149   WHLRGSRFLLPTQQLLQEFCSIPAETTASKAPKRPEQEENPNGGGSSASWPAPSAQIQAT  208

Query  1314  --LELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRH  1141
                ELQ+ K+KL  +L+EVDRRY+ YR+QM AV  SFEA AG  AA  Y+  A+R +S+H
Sbjct  209   DAAELQRLKAKLYSMLEEVDRRYRRYREQMRAVAGSFEAAAGRAAAAAYTRTAARTISKH  268

Query  1140  FRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDS  961
             FR LRD + AQ +A + A+ EK  ++A PG TKGETPRL+ +DQ LRQ KA Q   +++S
Sbjct  269   FRTLRDGVAAQARAVRVALGEKVDAAAPPGMTKGETPRLRALDQCLRQHKAYQS-GVLES  327

Query  960   HPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRL  781
              PWRPQRGLPER+VSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRL
Sbjct  328   QPWRPQRGLPERAVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRL  387

Query  780   WKPMVEEMYLEEVKE-QDNIMGSSDGSRAAVDGGSGRERL----------------DKKP  652
             WKPMVEEMY EE+K+ +D   G+ +   A +   SG + L                ++KP
Sbjct  388   WKPMVEEMYAEEMKDKEDGSGGAGEQYSAQLQASSGDQLLGNHNTAAAGSYGGGGGEQKP  447

Query  651   NVVRL-DSECISSLINIPAKAGGDHHQFGAVELDFSPYTHNSGGAVGY---RPGERKTgg  484
                +L D+  ++S+++I    G  H Q  +  LDF   T +  G   Y          G 
Sbjct  448   TRAQLHDAGSLASVVSI----GRVHQQQQSQSLDFGMSTMDDDGFDAYDAGGGVHGFGGH  503

Query  483   ggGVSLTLGLQ  451
             GG VSLTLGLQ
Sbjct  504   GGAVSLTLGLQ  514



>emb|CDY62523.1| BnaC04g56300D [Brassica napus]
Length=648

 Score =   276 bits (707),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 186/263 (71%), Gaps = 20/263 (8%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTS---------------  1348
              + +R+SKY  PAQELL+EFC VG   + +  + S+   + +T+                
Sbjct  241   IYTLRNSKYTKPAQELLEEFCSVGRGHNFKKNKLSRNNSNPNTSGCGGGGGGGGGGSSSS  300

Query  1347  ----SQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAAT  1180
                 + N  L     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA 
Sbjct  301   AGAANDNPPLSPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAV  360

Query  1179  VYSALASRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTL  1003
              Y+ LA + MSRHFRCL+DA+  QLK + + + +KES+ +A+ G TKGETPRL++++Q+L
Sbjct  361   PYTTLAQKAMSRHFRCLKDAVAVQLKRSCELLGDKESAGAASSGLTKGETPRLRLLEQSL  420

Query  1002  RQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSR  823
             RQQ+A   + MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTGLSR
Sbjct  421   RQQRAFHHMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTGLSR  480

Query  822   SQVSNWFINARVRLWKPMVEEMY  754
             +QVSNWFINARVRLWKPMVEEMY
Sbjct  481   NQVSNWFINARVRLWKPMVEEMY  503



>ref|XP_006283201.1| hypothetical protein CARUB_v10004235mg [Capsella rubella]
 gb|EOA16099.1| hypothetical protein CARUB_v10004235mg [Capsella rubella]
Length=727

 Score =   278 bits (712),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 184/259 (71%), Gaps = 14/259 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG------------TTQSDEPKRKSQWQQDDHTTSSQNH-S  1333
             +R S+Y   AQELL+EFC VG            +  +                + ++H +
Sbjct  309   LRHSRYTTSAQELLEEFCSVGRGFLKKNKQKNNSNPNASGGDGGGGSSPSSAGAIKDHPT  368

Query  1332  LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRV  1153
             L +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + 
Sbjct  369   LSASDRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGQGAALPYTALAQKA  428

Query  1152  MSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAIQQL  976
             MSRHFRCL+DA+ AQLK + + + +K+ +  ++ G TKGETPRL++++Q+LRQQ+A  Q+
Sbjct  429   MSRHFRCLKDAVAAQLKQSCELLGDKDGAGMSSSGLTKGETPRLRLLEQSLRQQRAFHQM  488

Query  975   TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFIN  796
              MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFIN
Sbjct  489   GMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFIN  548

Query  795   ARVRLWKPMVEEMYLEEVK  739
             ARVRLWKPMVEEMY +E K
Sbjct  549   ARVRLWKPMVEEMYQQESK  567



>ref|XP_008440170.1| PREDICTED: BEL1-like homeodomain protein 4 [Cucumis melo]
Length=692

 Score =   277 bits (709),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 172/387 (44%), Positives = 227/387 (59%), Gaps = 41/387 (11%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY+ PAQELL+EFC VG  Q    K K   + + +T S+   +             
Sbjct  297   LRNSKYVKPAQELLEEFCSVGKVQLK--KNKFNIKPNPNTESATTATTSAAATGGSTSKD  354

Query  1332  ---LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
                L +   +E Q+ K KLL +LDEV+RRY  YR+QM  VV+SF+ V G GAA  Y+ L 
Sbjct  355   QPPLSAADRIEHQRRKVKLLSMLDEVERRYNLYREQMQMVVNSFDLVMGFGAAAPYTTLT  414

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQ  982
              + MSRHFRCL+DAI  QLK + +A+ EK  +  + G TKGETPRLK+++Q+LRQQ+A  
Sbjct  415   QKAMSRHFRCLKDAIAEQLKQSYEALGEKGGNGGS-GITKGETPRLKLLEQSLRQQRAFH  473

Query  981   QLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  802
             Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DK +LARQTGLSR+QVSNWF
Sbjct  474   QMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKLLLARQTGLSRNQVSNWF  533

Query  801   INARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRERLDKKPNVVRLDSECI  622
             INARVRLWKPMVEEMY  E K  D    S + +    +  +      +   +    +   
Sbjct  534   INARVRLWKPMVEEMYQLEGKV-DTDQQSQEDTPQNNNNNNNNNNKTQNNAITNPQNPTT  592

Query  621   SSLINIPAK------------------AGGDHHQ--FGAVELDFSPYTHNSGGAVGYRPG  502
             +++  + A+                  +G DHHQ  +G +  D +     + G    R G
Sbjct  593   AAVEEVAAEFAAGHDYSDLHDVWRHGSSGSDHHQQHYGTMSEDVTAAADMNPGPTLIRFG  652

Query  501   ERKTggggGVSLTLGLQQHGGSGIGLA  421
                T   G VSLTLGL+  G +    A
Sbjct  653   TTNT-ATGDVSLTLGLRHAGNTSAAAA  678



>ref|XP_010548375.1| PREDICTED: BEL1-like homeodomain protein 4 [Tarenaya hassleriana]
 ref|XP_010548376.1| PREDICTED: BEL1-like homeodomain protein 4 [Tarenaya hassleriana]
Length=756

 Score =   279 bits (713),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 188/262 (72%), Gaps = 26/262 (10%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSS-----------------  1345
             +R+SKY   AQELL+EFC VG        +KS++ ++    ++                 
Sbjct  342   LRNSKYTKAAQELLEEFCSVGRGHF----KKSKYGRNTANPTTSGGGSGGGGGGGSSSPA  397

Query  1344  ----QNHS-LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAAT  1180
                 ++H  L +   +E Q+ K KLL +++EVDRRY HY +QM  V++SF+ V G GAA 
Sbjct  398   AAAGKDHPPLSAADRIEHQRRKVKLLSMVEEVDRRYNHYCEQMQMVMNSFDLVMGYGAAV  457

Query  1179  VYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLR  1000
              Y+ALA + MSRHFRCL+DA+ AQL+ + + + EK+++ +A G TKGETPRL++++Q+LR
Sbjct  458   PYTALAQKAMSRHFRCLKDAVSAQLRHSCELLGEKDAAGSASGLTKGETPRLRLLEQSLR  517

Query  999   QQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRS  820
             QQ+A  Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+
Sbjct  518   QQRAFHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRN  577

Query  819   QVSNWFINARVRLWKPMVEEMY  754
             QVSNWFINARVRLWKPMVEEMY
Sbjct  578   QVSNWFINARVRLWKPMVEEMY  599



>gb|KHN36166.1| BEL1-like homeodomain protein 2 [Glycine soja]
Length=701

 Score =   278 bits (710),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 181/252 (72%), Gaps = 3/252 (1%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHSLGSLHFLELQKTK  1294
             +R+SKY+  AQELL+EFC VG  Q  + K   Q    +        S  S          
Sbjct  272   LRNSKYVKAAQELLEEFCSVGRGQFKKSKFNRQNSNPNSNPGGGGSSPSSKDAPPPPPPL  331

Query  1293  S---KLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRD  1123
             S   ++ H   +VDRRY HY +QM  VV+SF+ + G GAA  Y+ALA + MSRHFRCL++
Sbjct  332   SAADRIEHQRRKVDRRYNHYCEQMQMVVNSFDLMMGFGAAVPYTALAQKAMSRHFRCLKE  391

Query  1122  AILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQ  943
             AI AQLK + + + +K+ + ++ G TKGETPRLKM++Q+LRQQ+A  Q+ MM+   WRPQ
Sbjct  392   AITAQLKQSCEVLGDKDGAGSSGGLTKGETPRLKMLEQSLRQQRAFHQMGMMEQEAWRPQ  451

Query  942   RGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVE  763
             RGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARVRLWKPMVE
Sbjct  452   RGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVE  511

Query  762   EMYLEEVKEQDN  727
             EMY +E+KE ++
Sbjct  512   EMYQQELKEAES  523



>ref|XP_011085539.1| PREDICTED: BEL1-like homeodomain protein 4 [Sesamum indicum]
 ref|XP_011085540.1| PREDICTED: BEL1-like homeodomain protein 4 [Sesamum indicum]
Length=738

 Score =   278 bits (711),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 186/264 (70%), Gaps = 19/264 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY   AQELL+EFC VG  Q    K  +  +  +   S    +             
Sbjct  317   LRNSKYAKAAQELLEEFCSVGRGQFKRSKFGNSNRNPNSNPSGGGGATSGGSGGGNTSSS  376

Query  1332  -----LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSA  1168
                  L S   LE Q+ K KLL +LDEVDRRY HY DQM  VV+SF+ V G GAA  Y+ 
Sbjct  377   KDLPPLSSSERLEHQRRKVKLLSMLDEVDRRYNHYCDQMQMVVNSFDMVMGLGAAVPYTC  436

Query  1167  LASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKA  988
             LA + MSRHFRCL+DAI +QLK + + + EK++++A+ G TKGETPRL++++Q+LRQQ+A
Sbjct  437   LAQKAMSRHFRCLKDAIASQLKHSCEVLGEKDAAAAS-GLTKGETPRLRILEQSLRQQRA  495

Query  987   IQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN  808
               Q+ MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DK +LARQTGLSR+QVSN
Sbjct  496   FNQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKLLLARQTGLSRNQVSN  555

Query  807   WFINARVRLWKPMVEEMYLEEVKE  736
             WFINARVRLWKPMVEEMY +E KE
Sbjct  556   WFINARVRLWKPMVEEMYQQEAKE  579



>ref|XP_006293804.1| hypothetical protein CARUB_v10022787mg [Capsella rubella]
 ref|XP_006293805.1| hypothetical protein CARUB_v10022787mg [Capsella rubella]
 gb|EOA26702.1| hypothetical protein CARUB_v10022787mg [Capsella rubella]
 gb|EOA26703.1| hypothetical protein CARUB_v10022787mg [Capsella rubella]
Length=671

 Score =   276 bits (707),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 181/261 (69%), Gaps = 18/261 (7%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVG-----------------TTQSDEPKRKSQWQQDDHT  1354
              + +R+SKY  PAQELL+EFC VG                 TT                 
Sbjct  260   IYTLRNSKYTKPAQELLEEFCSVGRGHIKKNKLSRNNSNPNTTGGGGGGGGGGGSSSSAG  319

Query  1353  TSSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVY  1174
             T++ +  +     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y
Sbjct  320   TANDSPPISPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAVPY  379

Query  1173  SALASRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQ  997
             + LA + MSRHFRCL+DA+ AQLK + + + +KE + +A+ G TKGETPRL++++Q+LRQ
Sbjct  380   TTLAQKAMSRHFRCLKDAVAAQLKRSCELLGDKEGAGAASSGLTKGETPRLRLLEQSLRQ  439

Query  996   QKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
             Q+A   + MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTGLSR+Q
Sbjct  440   QRAFHHMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQ  499

Query  816   VSNWFINARVRLWKPMVEEMY  754
             VSNWFINARVRLWKPMVEEMY
Sbjct  500   VSNWFINARVRLWKPMVEEMY  520



>ref|NP_195405.4| BEL1-like homeodomain protein 2 [Arabidopsis thaliana]
 ref|NP_001031797.4| BEL1-like homeodomain protein 2 [Arabidopsis thaliana]
 sp|Q9SW80.3|BLH2_ARATH RecName: Full=BEL1-like homeodomain protein 2; Short=BEL1-like 
protein 2; AltName: Full=Protein SAWTOOTH 1 [Arabidopsis thaliana]
 gb|AEE86711.1| BEL1-like homeodomain protein 2 [Arabidopsis thaliana]
 gb|AEE86712.1| BEL1-like homeodomain protein 2 [Arabidopsis thaliana]
Length=739

 Score =   278 bits (711),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 182/253 (72%), Gaps = 13/253 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG-----------TTQSDEPKRKSQWQQDDHTTSSQNHS-L  1330
             +R+S+Y   AQELL+EFC VG           ++  +               +++ H  L
Sbjct  313   LRNSRYTTAAQELLEEFCSVGRGFLKKNKLGNSSNPNTCGGDGGGSSPSSAGANKEHPPL  372

Query  1329  GSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVM  1150
              +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + M
Sbjct  373   SASDRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGHGAALPYTALAQKAM  432

Query  1149  SRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAIQQLT  973
             SRHFRCL+DA+ AQLK + + + +K+++  ++ G TKGETPRL++++Q+LRQ +A  Q+ 
Sbjct  433   SRHFRCLKDAVAAQLKQSCELLGDKDAAGISSSGLTKGETPRLRLLEQSLRQNRAFHQMG  492

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
             MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINA
Sbjct  493   MMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINA  552

Query  792   RVRLWKPMVEEMY  754
             RVRLWKPMVEEMY
Sbjct  553   RVRLWKPMVEEMY  565



>ref|XP_006404859.1| hypothetical protein EUTSA_v10000076mg [Eutrema salsugineum]
 dbj|BAJ33897.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46312.1| hypothetical protein EUTSA_v10000076mg [Eutrema salsugineum]
Length=651

 Score =   275 bits (704),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 185/271 (68%), Gaps = 24/271 (9%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTT----------------  1351
              + +R+SKY  PAQELL+EFC VG     + K  S+   + +T+                
Sbjct  237   IYTLRNSKYTKPAQELLEEFCSVGRGHFKKNKL-SRNNSNPNTSGCGGGGGGGGGGGGGS  295

Query  1350  ------SSQNHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDG  1189
                   ++ N  L     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G G
Sbjct  296   SLSAGAANDNPPLSPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYG  355

Query  1188  AATVYSALASRVMSRHFRCLRDAILAQLkaakkam-aekesssaAPGATKGETPRLKMID  1012
             AA  Y+ LA + MSRHFRCL+DA+  QLK + + +  +  +  A+ G TKGETPRL++++
Sbjct  356   AAVPYTTLAQKAMSRHFRCLKDAVAIQLKRSCELLGDKDAAGGASTGLTKGETPRLRLLE  415

Query  1011  QTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTG  832
             Q+LRQQ+A   + MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTG
Sbjct  416   QSLRQQRAFHHMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTG  475

Query  831   LSRSQVSNWFINARVRLWKPMVEEMYLEEVK  739
             LSR+QVSNWFINARVRLWKPMVEEMY +E K
Sbjct  476   LSRNQVSNWFINARVRLWKPMVEEMYQQEAK  506



>ref|XP_002880524.1| hypothetical protein ARALYDRAFT_900861 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56783.1| hypothetical protein ARALYDRAFT_900861 [Arabidopsis lyrata subsp. 
lyrata]
Length=614

 Score =   274 bits (701),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 180/257 (70%), Gaps = 14/257 (5%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQSDEPK-------------RKSQWQQDDHTTSSQ  1342
              + +R+SKY  PAQELL+EFC VG     + K                        T++ 
Sbjct  223   IYTLRNSKYTKPAQELLEEFCSVGRGHFKKNKLSRNNSNPNTTGGGGGGGSSSSAGTAND  282

Query  1341  NHSLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
             N  L     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ LA
Sbjct  283   NPPLSPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAVPYTTLA  342

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAI  985
              + MSRHFRCL+DA+  QLK + + + +KE+  +A+ G TKGETPRL++++Q+LRQQ+A 
Sbjct  343   QKAMSRHFRCLKDAVAVQLKRSCELLGDKEAGGAASSGLTKGETPRLRLLEQSLRQQRAF  402

Query  984   QQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNW  805
               + MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTGLSR+QVSNW
Sbjct  403   HHMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNW  462

Query  804   FINARVRLWKPMVEEMY  754
             FINARVRLWKPMVEEMY
Sbjct  463   FINARVRLWKPMVEEMY  479



>ref|XP_004509227.1| PREDICTED: BEL1-like homeodomain protein 2-like [Cicer arietinum]
Length=772

 Score =   278 bits (711),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/261 (56%), Positives = 182/261 (70%), Gaps = 14/261 (5%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQ---SDEPKRKSQWQQDDHTTSSQNHS----------  1333
             +R+SKY+  AQELL+EFC VG  Q   ++   R+      +H  S    +          
Sbjct  344   LRNSKYVKAAQELLEEFCSVGRGQFKKNNNFARQLSNPNSNHGGSVGGGASSSSSKDVSP  403

Query  1332  LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRV  1153
             L     +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+          Y+ALA + 
Sbjct  404   LSPADRIEHQRRKVKLLTMLDEVDRRYNHYCEQMQMVVNSFDXXXXXXXXXXYTALAQKA  463

Query  1152  MSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLT  973
             MSRHFRCL+DAI AQLK + + + EK+    + G TKGETPRLK+++Q+LRQQ+A  Q+ 
Sbjct  464   MSRHFRCLKDAITAQLKHSCELLGEKDGVGTS-GLTKGETPRLKILEQSLRQQRAFHQMG  522

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
             MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DK +LARQTGLSR+QVSNWFINA
Sbjct  523   MMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKQLLARQTGLSRNQVSNWFINA  582

Query  792   RVRLWKPMVEEMYLEEVKEQD  730
             RVRLWKPMVE+MY EE+KE +
Sbjct  583   RVRLWKPMVEDMYQEELKEAE  603



>emb|CDX75604.1| BnaA01g00980D [Brassica napus]
Length=669

 Score =   275 bits (704),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/258 (55%), Positives = 183/258 (71%), Gaps = 18/258 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG----------------TTQSDEPKRKSQWQQDDHTTSSQ  1342
             +R+SKY   AQELL+EFC VG                T+  D               +S+
Sbjct  247   LRNSKYTKAAQELLEEFCSVGRGFSKKNKPKNKSNPNTSGGDGSSSGGAGGSPSSAGASK  306

Query  1341  NHS-LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSAL  1165
              H  L +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+AL
Sbjct  307   EHPPLSASDRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGHGAAIPYTAL  366

Query  1164  ASRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKA  988
             A + MSRHFRCL+DA+ AQL+ + + + EK+++  ++ G TKG+TPRL++++Q+LRQQ+A
Sbjct  367   AQKAMSRHFRCLKDAVAAQLRQSCELLGEKDAAGLSSSGLTKGDTPRLRLLEQSLRQQRA  426

Query  987   IQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN  808
               Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSN
Sbjct  427   FHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSN  486

Query  807   WFINARVRLWKPMVEEMY  754
             WFINARVRLWKPMVEEMY
Sbjct  487   WFINARVRLWKPMVEEMY  504



>ref|XP_004511995.1| PREDICTED: BEL1-like homeodomain protein 2-like [Cicer arietinum]
Length=723

 Score =   276 bits (706),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 187/266 (70%), Gaps = 18/266 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDE------PKRKSQWQQDDHTTSSQNHS------L  1330
             +R+SKY+  AQEL +EFC VG  +S+        K  S     DH ++S +        L
Sbjct  321   VRNSKYMKAAQELFQEFCSVGGGRSNHQFIIKNNKLNSNPNNGDHPSNSSSSKDTPLPPL  380

Query  1329  GSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVM  1150
              +   +E Q+ K KLL +LDEVDRRY +Y +QM  VV+SF+ + G GAA  Y+ALA + M
Sbjct  381   SASDRIEHQRRKVKLLSMLDEVDRRYNNYCEQMQMVVNSFDVMMGFGAAIPYTALAQKAM  440

Query  1149  SRHFRCLRDAILAQLkaakkamaekesssaAPGA-----TKGETPRLKMIDQTLRQQKAI  985
             SRHFRCL+DAI AQ+K + + + EKE       +     TKGETPRLK ++Q+LRQQ+A 
Sbjct  441   SRHFRCLKDAITAQVKHSSEVLGEKEGGGGGGNSLGAGLTKGETPRLKALEQSLRQQRAF  500

Query  984   QQLTM-MDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN  808
              Q+ M M+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSN
Sbjct  501   NQIGMNMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSN  560

Query  807   WFINARVRLWKPMVEEMYLEEVKEQD  730
             WFINARVRLWKPMVEEMY +E+ E +
Sbjct  561   WFINARVRLWKPMVEEMYQQELNEAE  586



>gb|KGN48456.1| hypothetical protein Csa_6G487770 [Cucumis sativus]
Length=696

 Score =   275 bits (704),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 145/261 (56%), Positives = 184/261 (70%), Gaps = 17/261 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY+ PAQELL+EFC VG  Q  + K  ++   +  + ++   +             
Sbjct  299   LRNSKYVKPAQELLEEFCSVGKVQLKKNKFNTKPNPNTESATNATATTSAAATGGSTSKD  358

Query  1332  ---LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
                L +   +E Q+ K KLL +LDEV+RRY  YR+QM  VV+SF+ V G GAA  Y+ L 
Sbjct  359   QPPLSAADRIEHQRRKVKLLSMLDEVERRYNLYREQMQMVVNSFDLVMGFGAAAPYTTLT  418

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQ  982
              + MSRHFRCL+DAI  QLK + +A+ EK  +  + G TKGETPRLK+++Q+LRQQ+A  
Sbjct  419   QKAMSRHFRCLKDAIAEQLKQSYEALGEKGGNGGS-GITKGETPRLKLLEQSLRQQRAFH  477

Query  981   QLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  802
             Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DK +LARQTGLSR+QVSNWF
Sbjct  478   QMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKLLLARQTGLSRNQVSNWF  537

Query  801   INARVRLWKPMVEEMYLEEVK  739
             INARVRLWKPMVEEMY  E K
Sbjct  538   INARVRLWKPMVEEMYQLEGK  558



>gb|KHN44516.1| BEL1-like homeodomain protein 2 [Glycine soja]
Length=600

 Score =   273 bits (697),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 140/247 (57%), Positives = 175/247 (71%), Gaps = 3/247 (1%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHSLGSLHFLELQ--K  1300
             +R+SKY   AQELL+EFC VG  Q  + K   Q                S    ++    
Sbjct  201   LRNSKYAKAAQELLEEFCSVGRGQFKKNKFNRQLSNPSSNLRGSGGGASSSSSKDVPPLS  260

Query  1299  TKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDA  1120
                ++ H   +VDRRY HY +QM  VV++F+ V G GAA  Y+ALA + MSRHFRCL+DA
Sbjct  261   AADRIEHQRRKVDRRYSHYCEQMHMVVNAFDMVMGFGAAVPYTALAQKAMSRHFRCLKDA  320

Query  1119  ILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQR  940
             I AQLK + + + EK+ +  + G TKGETPRLKM++Q+LRQQ+A  Q+ MM+   WRPQR
Sbjct  321   ITAQLKHSCEVLGEKDGAGNS-GLTKGETPRLKMLEQSLRQQRAFHQMGMMEQEAWRPQR  379

Query  939   GLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEE  760
             GLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARVRLWKPMVE+
Sbjct  380   GLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVED  439

Query  759   MYLEEVK  739
             MY +E+K
Sbjct  440   MYQQELK  446



>ref|XP_002522396.1| bel1 homeotic protein, putative [Ricinus communis]
 gb|EEF40080.1| bel1 homeotic protein, putative [Ricinus communis]
Length=562

 Score =   272 bits (695),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 184/269 (68%), Gaps = 25/269 (9%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY+  AQELL+EFC VG  Q  + K   Q           N S             
Sbjct  94    LRNSKYIKAAQELLEEFCSVGRGQFKKNKFSRQSTNPSSNNPGGNSSGGGSGGGGGGGSS  153

Query  1332  --------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATV  1177
                     L +   +E Q+ K KLL +LDEVDRRY HY +QM  VV+SF+ V G GAA  
Sbjct  154   SSTKDFPPLSASDRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAVP  213

Query  1176  YSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQ  997
             Y++LA + MSRHFRCL+DAI AQLK + + + EK+ +  + G TKGETPRL++++Q+LRQ
Sbjct  214   YTSLAQKAMSRHFRCLKDAIGAQLKHSCELLGEKDGAGTS-GITKGETPRLRLLEQSLRQ  272

Query  996   QKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
             Q+A  Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHP   D DKH+LARQTGLSR+Q
Sbjct  273   QRAFHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHP---DADKHLLARQTGLSRNQ  329

Query  816   VSNWFINARVRLWKPMVEEMYLEEVKEQD  730
             VSNWFINARVRLWKPMVEEMY +E K++D
Sbjct  330   VSNWFINARVRLWKPMVEEMYQQESKDED  358



>ref|XP_009141155.1| PREDICTED: BEL1-like homeodomain protein 2 [Brassica rapa]
 ref|XP_009141221.1| PREDICTED: BEL1-like homeodomain protein 2 [Brassica rapa]
Length=667

 Score =   275 bits (702),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 183/258 (71%), Gaps = 18/258 (7%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG----------------TTQSDEPKRKSQWQQDDHTTSSQ  1342
             +R+S+Y   AQELL+EFC VG                T+  D               +S+
Sbjct  245   LRNSRYTKAAQELLEEFCSVGRGFSKKNKPKNNSNPNTSGGDGSSSGGAGGSPSSAGASK  304

Query  1341  NHS-LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSAL  1165
              H  L +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+AL
Sbjct  305   EHPPLSASDRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGHGAAIPYTAL  364

Query  1164  ASRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKA  988
             A + MSRHFRCL+DA+ AQL+ + + + EK+++  ++ G TKG+TPRL++++Q+LRQQ+A
Sbjct  365   AQKAMSRHFRCLKDAVAAQLRQSCELLGEKDAAGLSSSGLTKGDTPRLRLLEQSLRQQRA  424

Query  987   IQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSN  808
               Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSN
Sbjct  425   FHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSN  484

Query  807   WFINARVRLWKPMVEEMY  754
             WFINARVRLWKPMVEEMY
Sbjct  485   WFINARVRLWKPMVEEMY  502



>gb|AAK43834.1|AF353092_1 BEL1-like homeobox 4 [Arabidopsis thaliana]
Length=627

 Score =   273 bits (699),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 181/257 (70%), Gaps = 14/257 (5%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQSDEPK-----------RKSQWQQDDHTTSSQNH  1336
              + +R+SKY  PAQELL+EFC VG     + K                     +  + N 
Sbjct  235   IYTLRNSKYTKPAQELLEEFCSVGRGHFKKNKLSRNNSNPNTTGGGGGGGSSSSAGTAND  294

Query  1335  S--LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
             S  L     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ LA
Sbjct  295   SPPLSPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAVPYTTLA  354

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAI  985
              + MSRHFRCL+DA+  QLK + + + +KE++ +A+ G TKGETPRL++++Q+LRQQ+A 
Sbjct  355   QKAMSRHFRCLKDAVAVQLKRSCELLGDKEAAGAASSGLTKGETPRLRLLEQSLRQQRAF  414

Query  984   QQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNW  805
               + MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTGLSR+QVSNW
Sbjct  415   HHMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNW  474

Query  804   FINARVRLWKPMVEEMY  754
             FINARVRLWKPMVEEMY
Sbjct  475   FINARVRLWKPMVEEMY  491



>gb|KHG13966.1| BEL1-like homeodomain protein 2 [Gossypium arboreum]
Length=674

 Score =   274 bits (701),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 186/267 (70%), Gaps = 10/267 (4%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHSLGSLHFLELQK--  1300
             +R+SKY   AQELL+EFC VG+ +    K+K      + +++  N    +       K  
Sbjct  272   LRNSKYTKLAQELLEEFCSVGSGRFK--KKKLGKNNINPSSNPSNDGTTTNGSSSSTKDL  329

Query  1299  ----TKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRC  1132
                    ++ H   +VDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + MSRHFRC
Sbjct  330   PPFSASDRIEHQRRKVDRRYNHYCEQMQTVVNSFDLVMGYGAAIPYTALAQKAMSRHFRC  389

Query  1131  LRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPW  952
             L+DAI +QLK + + + EK+    + G TKGETPRL+M++Q+LRQQKA  Q+ MM+   W
Sbjct  390   LKDAISSQLKHSCELLGEKDGVGTS-GITKGETPRLRMLEQSLRQQKAFHQIGMMEHEAW  448

Query  951   RPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKP  772
             RPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARVRLWKP
Sbjct  449   RPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKP  508

Query  771   MVEEMYLEEVKE-QDNIMGSSDGSRAA  694
             MVEEMY +E KE  DN  G+   + AA
Sbjct  509   MVEEMYQQESKEGGDNNKGTRTNNNAA  535



>ref|NP_179956.1| BEL1-like homeodomain 4 [Arabidopsis thaliana]
 ref|NP_850044.1| BEL1-like homeodomain 4 [Arabidopsis thaliana]
 ref|NP_001031404.1| BEL1-like homeodomain 4 [Arabidopsis thaliana]
 sp|Q94KL5.2|BLH4_ARATH RecName: Full=BEL1-like homeodomain protein 4; Short=BEL1-like 
protein 4; AltName: Full=Protein SAWTOOTH 2 [Arabidopsis thaliana]
 gb|AAC17087.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAL25593.1| At2g23760/F27L4.6 [Arabidopsis thaliana]
 gb|AAM98283.1| At2g23760/F27L4.6 [Arabidopsis thaliana]
 gb|AEC07486.1| BEL1-like homeodomain 4 [Arabidopsis thaliana]
 gb|AEC07487.1| BEL1-like homeodomain 4 [Arabidopsis thaliana]
 gb|AEC07488.1| BEL1-like homeodomain 4 [Arabidopsis thaliana]
Length=627

 Score =   273 bits (697),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 181/257 (70%), Gaps = 14/257 (5%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQSDEPK-----------RKSQWQQDDHTTSSQNH  1336
              + +R+SKY  PAQELL+EFC VG     + K                     +  + N 
Sbjct  235   IYTLRNSKYTKPAQELLEEFCSVGRGHFKKNKLSRNNSNPNTTGGGGGGGSSSSAGTAND  294

Query  1335  S--LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
             S  L     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ LA
Sbjct  295   SPPLSPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAVPYTTLA  354

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAI  985
              + MSRHFRCL+DA+  QLK + + + +KE++ +A+ G TKGETPRL++++Q+LRQQ+A 
Sbjct  355   QKAMSRHFRCLKDAVAVQLKRSCELLGDKEAAGAASSGLTKGETPRLRLLEQSLRQQRAF  414

Query  984   QQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNW  805
               + MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTGLSR+QVSNW
Sbjct  415   HHMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQVSNW  474

Query  804   FINARVRLWKPMVEEMY  754
             FINARVRLWKPMVEEMY
Sbjct  475   FINARVRLWKPMVEEMY  491



>ref|XP_011083914.1| PREDICTED: BEL1-like homeodomain protein 4 [Sesamum indicum]
Length=618

 Score =   272 bits (696),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/261 (52%), Positives = 183/261 (70%), Gaps = 15/261 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDH--------------TTSSQNH  1336
             +R+S+YL  AQELL+EFCCVG  Q    + K+Q    +               ++  Q+H
Sbjct  244   LRNSRYLSAAQELLQEFCCVGKGQLKNQRLKNQDGNPNSAMDGGGDAAAGPSSSSKDQHH  303

Query  1335  SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASR  1156
              +      E Q+ K KLL +LDEVD RY+ Y +QM A+V++F++  G GAA  Y+ LA  
Sbjct  304   PISPAERAEHQRRKMKLLTMLDEVDARYRRYCEQMQAIVNAFDSAVGRGAAAPYTGLAQT  363

Query  1155  VMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQL  976
              MSRHFRC++DAI  QLK   + + EK+      G T+GETPRLK+++Q  RQQK++Q++
Sbjct  364   AMSRHFRCIKDAIAGQLKETCEGLGEKDVGGGG-GLTRGETPRLKLLEQKYRQQKSLQRV  422

Query  975   TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFIN  796
              M+D   WRPQRGLP+ SV++LRAWLF+HFLHPYPS+ DKH+L+RQTGLS++QVSNWFIN
Sbjct  423   GMLDPESWRPQRGLPDGSVNILRAWLFDHFLHPYPSEADKHMLSRQTGLSKNQVSNWFIN  482

Query  795   ARVRLWKPMVEEMYLEEVKEQ  733
             ARVRLWKPMVEEMY +E +E+
Sbjct  483   ARVRLWKPMVEEMYQQEFREE  503



>gb|EEE51314.1| hypothetical protein OsJ_32275 [Oryza sativa Japonica Group]
Length=592

 Score =   271 bits (694),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 186/376 (49%), Positives = 238/376 (63%), Gaps = 55/376 (15%)
 Frame = -2

Query  1269  EVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakk  1090
             +VDRRY+ Y +QM A+ +SFEAVAG+ AA  Y+ LASR +SRHFR LRD ++AQL+A +K
Sbjct  229   QVDRRYRRYCEQMRALAASFEAVAGERAAASYTRLASRTISRHFRSLRDGVVAQLQAVRK  288

Query  1089  amaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVL  910
              + EK+++   PG TKGETPRL+++DQ LRQ KA Q   M++SHPWRPQRGLPER+VS+L
Sbjct  289   QLGEKDTAV--PGMTKGETPRLRVLDQCLRQHKAYQ-AGMLESHPWRPQRGLPERAVSIL  345

Query  909   RAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQD  730
             RAWLFEHFLHPYPSDVDKHILARQTGLSRSQV+NWFINARVRLWKPMVEEMY EE+K+++
Sbjct  346   RAWLFEHFLHPYPSDVDKHILARQTGLSRSQVANWFINARVRLWKPMVEEMYAEEMKDEE  405

Query  729   ------------NIMGSSDGSRAAVDGGSGRERLDKKPNVVRL--DSECISSLINIPAKA  592
                         N   SS  S     GG G +R ++KP+  +L  D+  ++S+++I    
Sbjct  406   GSGQSTQASNPQNPNPSSYTSEVRGGGGGGEDRGEQKPSRAQLLHDAGSLASVVSIGHGG  465

Query  591   GG----DHHQ-----FGAV-ELDFSPYTHNSGGAVGYRPGERKTggggGVSLTLGLQQ--  448
              G    DHH      FG + +LDF  Y            G +  G GGGVSLTLGLQQ  
Sbjct  466   AGRTMVDHHHHQSLNFGTMDQLDFDAYEAAG--------GGQGFGAGGGVSLTLGLQQQH  517

Query  447   ---HGGSGIGLAFSPTSQNS-------LFYPRDQIGDCPP--VQY-SLLDGEGQNLPYRN  307
                H G  +  A +    NS       LF    +     P   Q+ ++++G+  +  YR 
Sbjct  518   ADPHDGVNVAFAAAAAPPNSSGVAAEYLFMGGGEHQQQLPQTAQFGAVMEGDAASH-YRG  576

Query  306   L----MGSQLLHDLAG  271
             L     G  LLHDLAG
Sbjct  577   LSATAAGFHLLHDLAG  592



>ref|XP_002465020.1| hypothetical protein SORBIDRAFT_01g030620 [Sorghum bicolor]
 gb|EER92018.1| hypothetical protein SORBIDRAFT_01g030620 [Sorghum bicolor]
Length=634

 Score =   272 bits (696),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 200/475 (42%), Positives = 265/475 (56%), Gaps = 74/475 (16%)
 Frame = -2

Query  1479  FQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDD-----HTTSSQNHSLGSLHF  1315
             + +R S++L P Q+LL+EFC +    +       Q   +D      +TS+ +  + ++  
Sbjct  162   WHLRGSRFLRPTQQLLQEFCTLPVDTTTTAAASKQPASEDGVGVGSSTSAPSAQIHAMSA  221

Query  1314  LELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFR  1135
              ELQ+ K+KL  +L EV+RRY+ YR+QM AV  SFEAVAG+ AA  Y+ LASR +S+HFR
Sbjct  222   SELQRLKAKLYAMLQEVERRYRRYREQMRAVAGSFEAVAGEQAAVAYTRLASRTISKHFR  281

Query  1134  CLRDAILAQLkaakkamaekesssaAP---GATKGET-PRLKMIDQTLRQQKAIQQLTMM  967
              LRD + AQ++  ++A+ EK++    P   G  KGET PRL++IDQ LRQ +A Q   ++
Sbjct  282   SLRDGVAAQMQVVRRALGEKDADGGVPAAGGMVKGETTPRLRVIDQCLRQHRAYQA-GVL  340

Query  966   DSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  787
             +S PWRPQRGLPER+VS+LRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV
Sbjct  341   ESQPWRPQRGLPERAVSILRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARV  400

Query  786   RLWKPMVEEMYLEEVKEQDNIMGSSDGSRA--------------------------AVDG  685
             RLWKPMVEEMY EE+K+     G +  S A                           VD 
Sbjct  401   RLWKPMVEEMYSEEMKDPQEGGGGAACSNANNNSVNTSSYTSELGQQQLGHGGGASGVD-  459

Query  684   GSGRERLDKKPNVVRLDSECISSLINIPAKAGGDHHQFGAV------ELDFSPYTHN-SG  526
             G G ER   +  ++  D+  ++S+++I + +     Q  ++       LDF  Y  + + 
Sbjct  460   GRGGERKPTRAQLLVHDAGSLASVVSIGSSSRDQQQQMSSINFGMMDHLDFDAYNDDPTA  519

Query  525   GAVGYRPGERKTggggGVSLTLGLQQ------HGGSGIGLAFSPTSQNSLF---------  391
                G   G    GG GGVSLTLGLQ       HGG  I  A +  S    F         
Sbjct  520   AGPGGPAGGFGAGGSGGVSLTLGLQHQHADDPHGGVNIAFAGAAPSAAHEFLFMAGGGEQ  579

Query  390   --------YPRDQIGDCPPVQYSLLDGEGQNLP----YRNL---MGSQLLHDLAG  271
                     +P    G     Q+S    +G  +P    +R L    G QLLHDLAG
Sbjct  580   QMVAGGAVHPSHGHGHGHHGQFSAAGMQGDGVPSSHYHRGLSAATGFQLLHDLAG  634



>emb|CDY39669.1| BnaA04g13860D [Brassica napus]
Length=645

 Score =   273 bits (697),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 183/261 (70%), Gaps = 18/261 (7%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS----------  1333
              + +R+SKY  PAQELL+EFC VG     +  + S+   + +T+                
Sbjct  241   IYTLRNSKYTKPAQELLEEFCSVGRGHHFKKNKLSRNNSNPNTSGCGGGGGGGGSSSTAG  300

Query  1332  -------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVY  1174
                    L     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y
Sbjct  301   AANDSPPLSPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAVPY  360

Query  1173  SALASRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQ  997
             + LA + MSRHFRCL+DA+  QLK + + + +KES+ +A+ G TKGETPRL++++Q+LRQ
Sbjct  361   TTLAQKAMSRHFRCLKDAVAVQLKRSCELLGDKESAGAASSGLTKGETPRLRLLEQSLRQ  420

Query  996   QKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
             Q+A   + MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTGLSR+Q
Sbjct  421   QRAFHHMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQ  480

Query  816   VSNWFINARVRLWKPMVEEMY  754
             VSNWFINARVRLWKPMVEEMY
Sbjct  481   VSNWFINARVRLWKPMVEEMY  501



>ref|XP_009140492.1| PREDICTED: BEL1-like homeodomain protein 4 [Brassica rapa]
Length=645

 Score =   272 bits (696),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 183/261 (70%), Gaps = 18/261 (7%)
 Frame = -2

Query  1482  FFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS----------  1333
              + +R+SKY  PAQELL+EFC VG     +  + S+   + +T+                
Sbjct  241   IYTLRNSKYTKPAQELLEEFCSVGRGHHFKKNKLSRNNSNPNTSGCGGGGGGGGSSSTAG  300

Query  1332  -------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVY  1174
                    L     +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y
Sbjct  301   AANDSPPLSPADRIEHQRRKVKLLSMLEEVDRRYNHYCEQMQMVVNSFDQVMGYGAAVPY  360

Query  1173  SALASRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQ  997
             + LA + MSRHFRCL+DA+  QLK + + + +KES+ +A+ G TKGETPRL++++Q+LRQ
Sbjct  361   TTLAQKAMSRHFRCLKDAVAVQLKRSCELLGDKESAGAASSGLTKGETPRLRLLEQSLRQ  420

Query  996   QKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQ  817
             Q+A   + MM+   WRPQRGLPERSV++LRAWLFEHFL+PYPSD DKH+LARQTGLSR+Q
Sbjct  421   QRAFHHMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLNPYPSDADKHLLARQTGLSRNQ  480

Query  816   VSNWFINARVRLWKPMVEEMY  754
             VSNWFINARVRLWKPMVEEMY
Sbjct  481   VSNWFINARVRLWKPMVEEMY  501



>ref|XP_002869016.1| hypothetical protein ARALYDRAFT_328081 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45275.1| hypothetical protein ARALYDRAFT_328081 [Arabidopsis lyrata subsp. 
lyrata]
Length=726

 Score =   274 bits (700),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 184/263 (70%), Gaps = 32/263 (12%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+S+Y   AQELL+EFC VG         +   +++ H  SS  ++             
Sbjct  302   LRNSRYTTAAQELLEEFCSVG---------REFLKKNKHGNSSNPNTSGGDGGGGSSPPS  352

Query  1332  ---------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAAT  1180
                      L +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA 
Sbjct  353   AGAVKDHPPLSASDRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGHGAAL  412

Query  1179  VYSALASRVMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTL  1003
              Y+ALA + MSRHFRCL+DA+ AQLK + + + +K+++  ++ G TKGETP L++++Q+L
Sbjct  413   PYTALAQKAMSRHFRCLKDAVAAQLKQSCELLGDKDAAGISSSGLTKGETPWLRLLEQSL  472

Query  1002  RQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSR  823
             RQQ+A  Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR
Sbjct  473   RQQRAFHQMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSR  532

Query  822   SQVSNWFINARVRLWKPMVEEMY  754
             +QVSNWFINARVRLWKPMVEEMY
Sbjct  533   NQVSNWFINARVRLWKPMVEEMY  555



>ref|XP_010446733.1| PREDICTED: BEL1-like homeodomain protein 2 [Camelina sativa]
Length=747

 Score =   274 bits (700),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 181/255 (71%), Gaps = 15/255 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSS-------------QNHS  1333
             +R S++   AQELL+E C VG     + K K+    +                   ++H 
Sbjct  317   LRHSRFTTAAQELLEELCSVGRGFLKKNKLKNSSNPNTSGGDGGGGGSSPSSAGAIKDHP  376

Query  1332  -LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASR  1156
              L +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ + G GAA  Y+ALA +
Sbjct  377   PLSASDRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIIMGQGAALPYTALAQK  436

Query  1155  VMSRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAIQQ  979
              MSRHFRCL+DA+ AQLK + + + +K+ +  ++ G TKGETPRL++++Q+LRQQ+A  Q
Sbjct  437   AMSRHFRCLKDAVAAQLKQSCELLGDKDGAGMSSSGLTKGETPRLRLLEQSLRQQRAFHQ  496

Query  978   LTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFI  799
             + MM+   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFI
Sbjct  497   MGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFI  556

Query  798   NARVRLWKPMVEEMY  754
             NARVRLWKPMVEEMY
Sbjct  557   NARVRLWKPMVEEMY  571



>ref|XP_010936123.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X2 [Elaeis 
guineensis]
Length=350

 Score =   263 bits (671),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -2

Query  1272  DEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaak  1093
             +EVDRRY HY DQM  VV+SF++V G GAAT Y+ALA + MSRHFRCL+DAI  QLK   
Sbjct  9     NEVDRRYNHYCDQMQMVVNSFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAVQLKQTC  68

Query  1092  kamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSV  913
             + + +KE+ S + G TKGETPRL+ IDQTLRQQ+A  Q+ MM+   WRPQRGLPERSV++
Sbjct  69    ELLGDKEAGSGS-GLTKGETPRLRFIDQTLRQQRAFHQMGMMEQEAWRPQRGLPERSVNI  127

Query  912   LRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKE  736
             LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARVRLWKPMVEEMY +E KE
Sbjct  128   LRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEAKE  186



>emb|CAB16801.2| BEL1-like homeobox 2 protein (BLH2) [Arabidopsis thaliana]
 emb|CAB80353.1| BEL1-like homeobox 2 protein (BLH2) [Arabidopsis thaliana]
Length=638

 Score =   270 bits (691),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 181/253 (72%), Gaps = 14/253 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG-----------TTQSDEPKRKSQWQQDDHTTSSQNHS-L  1330
             +R+S+Y   AQELL+EFC VG           ++  +               +++ H  L
Sbjct  313   LRNSRYTTAAQELLEEFCSVGRGFLKKNKLGNSSNPNTCGGDGGGSSPSSAGANKEHPPL  372

Query  1329  GSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVM  1150
              +   +E Q+ K KLL +L+EVDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + M
Sbjct  373   SASDRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGHGAALPYTALAQKAM  432

Query  1149  SRHFRCLRDAILAQLkaakkamaekess-saAPGATKGETPRLKMIDQTLRQQKAIQQLT  973
             SRHFRCL+DA+ AQLK + + + +K+++  ++ G TKGETPRL++++Q+LRQ +A  Q+ 
Sbjct  433   SRHFRCLKDAVAAQLKQSCELLGDKDAAGISSSGLTKGETPRLRLLEQSLRQNRAFHQMG  492

Query  972   MMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINA  793
             M +   WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINA
Sbjct  493   M-EQEAWRPQRGLPERSVNILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINA  551

Query  792   RVRLWKPMVEEMY  754
             RVRLWKPMVEEMY
Sbjct  552   RVRLWKPMVEEMY  564



>gb|KHG00531.1| Homeobox BEL1 -like protein [Gossypium arboreum]
Length=431

 Score =   265 bits (676),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 162/273 (59%), Positives = 200/273 (73%), Gaps = 17/273 (6%)
 Frame = -2

Query  1662  KGLSLSLSSTNPSAIGFNSFDDLRLMaassssSRLNN---IQHDEDDRFLGKPENLG-HP  1495
             +GLSLSLSS+NP++IG  SF+ LR  + S+   + ++   I     D F GKP  +  H 
Sbjct  165   QGLSLSLSSSNPTSIGLQSFE-LRQTSHSNHDDQPDDMRFIGSSSRDGFFGKPAIVQQHQ  223

Query  1494  SQDYFFQIRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQ------WQQDDH-TTSSQNH  1336
             +Q   FQIR S+YL  AQELL EFC +G  Q D  K+K        W  DD   +SS+  
Sbjct  224   AQ---FQIRGSRYLNAAQELLNEFCSLGAKQLDTSKQKQTQKTTKQWDDDDGGASSSRKQ  280

Query  1335  SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASR  1156
             SL SL F ELQ+ K+K+L +L+EVDRRYK Y DQM AVVSSFEAVAG GAA+VYSALAS+
Sbjct  281   SLYSLDFTELQRRKTKMLSMLEEVDRRYKIYCDQMKAVVSSFEAVAGTGAASVYSALASK  340

Query  1155  VMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQL  976
              MSRHFRCLRD I +Q++A +KAM EK++ +  PG TKGETPRL+++DQ LRQQ+A QQ+
Sbjct  341   AMSRHFRCLRDGIASQIQATRKAMGEKDTVA--PGTTKGETPRLRILDQALRQQRAFQQM  398

Query  975   TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHP  877
             +MM+SHPWRPQRGLPERSVSVLRAWLFEHFLHP
Sbjct  399   SMMESHPWRPQRGLPERSVSVLRAWLFEHFLHP  431


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 8/81 (10%)
 Frame = -2

Query  1986  RSSSMVTNTGYWYSDSAMNTQIQSGHMMSQLQSFEPNPEIYNLSSGMEMMVGFPFKNL-Q  1810
             +S ++V++TG+ YSD +        H+++Q+Q FE NPEI+NL++GME M+GF  KNL Q
Sbjct  9     KSRNIVSSTGFCYSDVSSGNSTMQTHLVNQIQGFESNPEIFNLTTGME-MIGFA-KNLHQ  66

Query  1809  AQSD-----MWKPVPLSHSEN  1762
              Q D     MWK     H  N
Sbjct  67    QQGDTNNMIMWKGFSNKHGNN  87



>emb|CBI17588.3| unnamed protein product [Vitis vinifera]
Length=678

 Score =   270 bits (690),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 154/317 (49%), Positives = 199/317 (63%), Gaps = 42/317 (13%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVG-------------TTQSDEPKRKSQWQQDDHTTSSQNHS  1333
             +R+SKY+  AQELL+EFC VG             T  +  P   S       ++S     
Sbjct  264   MRNSKYVKAAQELLEEFCSVGRGQFKKNKFGRHNTNPNSNPGGGSAGGGGSSSSSKDLPP  323

Query  1332  LGSLHFLELQKTKSKLLHLLDE-------------------VDRRYKHYRDQMTAVVSSF  1210
             L +   +E Q+ K KLL +LDE                   VDRRY HY +QM  VV+SF
Sbjct  324   LSAADRIEHQRRKVKLLSMLDEAWKTNRKFRQVSMNILYTRVDRRYNHYCEQMQMVVNSF  383

Query  1209  EAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETP  1030
             + V G GAA  Y+ALA + MSRHFRCL+DAI  QLK + + + EK+ S  + G TKGETP
Sbjct  384   DLVMGFGAAVPYTALAQKAMSRHFRCLKDAIAVQLKHSCELLGEKDPSGTS-GVTKGETP  442

Query  1029  RLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHI  850
             RL++++Q+LRQQ+A  Q+ MM+   WRPQRGLPERSV++LR+WLFEHFLHPYPSD DKH+
Sbjct  443   RLRLLEQSLRQQRAFHQMGMMEQEAWRPQRGLPERSVNILRSWLFEHFLHPYPSDADKHL  502

Query  849   LARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGSGRE  670
             LARQTGLSR+QVSNWFINARVRLWKPMVEEMY +E KE++           + DG     
Sbjct  503   LARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQETKEEEGSEEREVNQLQSTDG-----  557

Query  669   RLDKKPNVVRLDSECIS  619
                  P+++ ++ +C S
Sbjct  558   ----DPSLIAINRQCFS  570



>ref|XP_006425770.1| hypothetical protein CICLE_v10024897mg [Citrus clementina]
 gb|ESR39010.1| hypothetical protein CICLE_v10024897mg [Citrus clementina]
Length=822

 Score =   272 bits (696),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 183/258 (71%), Gaps = 15/258 (6%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHSLGSLHFLELQKTK  1294
             +R+SKY   AQELL+EFC VG  Q     +KS++ +++   SS +   G         + 
Sbjct  394   LRNSKYAKAAQELLEEFCSVGRGQF----KKSKFGKNNTNPSSSSGGGGGGAGCGGSSSS  449

Query  1293  SKLL----------HLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSR  1144
             +K L          H   +VDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + MSR
Sbjct  450   TKDLAPLSAADRIEHQRRKVDRRYNHYCEQMQMVVTSFDLVMGFGAAVPYTALAQKAMSR  509

Query  1143  HFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMD  964
             HFRCL+DAI  QLK + + + EK+ +  + G TKGETPRLK+++Q+LRQQ+A  Q+ MM+
Sbjct  510   HFRCLKDAIATQLKQSCELLGEKDVAGTS-GITKGETPRLKLLEQSLRQQRAFHQMGMME  568

Query  963   SHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVR  784
                WRPQRGLPERSV++LR+WLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARVR
Sbjct  569   QEAWRPQRGLPERSVNILRSWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVR  628

Query  783   LWKPMVEEMYLEEVKEQD  730
             LWKPMVEEMY +E KE +
Sbjct  629   LWKPMVEEMYQQEAKEAE  646



>ref|XP_009404911.1| PREDICTED: BEL1-like homeodomain protein 1 [Musa acuminata subsp. 
malaccensis]
Length=674

 Score =   269 bits (687),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 144/279 (52%), Positives = 183/279 (66%), Gaps = 25/279 (9%)
 Frame = -2

Query  1464  SKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQ-----------------DDHTTSSQNH  1336
             SKYL  AQ+LL E   V      EP + +  +                  DD++   Q  
Sbjct  189   SKYLKAAQQLLDEVVNVEKGIKSEPAKGATSKDPADSSNAELKCLGAGATDDNSKEKQVA  248

Query  1335  SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASR  1156
              L +    ELQ  K+KL+++LDEV++RY+ Y  QM  V+SSFEAVAG G+A  Y+ALA R
Sbjct  249   DLTTAERQELQMKKAKLINMLDEVEQRYRQYHHQMQIVISSFEAVAGYGSARTYTALALR  308

Query  1155  VMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQL  976
              +S+ FRCLRDAI  Q++A  K++ E+E        +K    RL+ ID  LRQQ+A+QQL
Sbjct  309   TISKQFRCLRDAITGQIQATSKSLGEEE--------SKSGGSRLRFIDHHLRQQRALQQL  360

Query  975   TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFIN  796
              M+  + WRPQRGLPERSVSVLRAWLFEHFLHPYP D DK +LA+QTGL+RSQVSNWFIN
Sbjct  361   GMIQPNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKMMLAKQTGLTRSQVSNWFIN  420

Query  795   ARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGS  679
             ARVRLWKPMVEEMYLEE+K+Q+      + S++   G S
Sbjct  421   ARVRLWKPMVEEMYLEEIKDQEQNNSDENASKSDAHGSS  459



>ref|XP_010936122.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X1 [Elaeis 
guineensis]
Length=355

 Score =   259 bits (663),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 147/177 (83%), Gaps = 1/177 (1%)
 Frame = -2

Query  1266  VDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakka  1087
             VDRRY HY DQM  VV+SF++V G GAAT Y+ALA + MSRHFRCL+DAI  QLK   + 
Sbjct  16    VDRRYNHYCDQMQMVVNSFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAVQLKQTCEL  75

Query  1086  maekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLR  907
             + +KE+ S + G TKGETPRL+ IDQTLRQQ+A  Q+ MM+   WRPQRGLPERSV++LR
Sbjct  76    LGDKEAGSGS-GLTKGETPRLRFIDQTLRQQRAFHQMGMMEQEAWRPQRGLPERSVNILR  134

Query  906   AWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKE  736
             AWLFEHFLHPYPSD DKH+LARQTGLSR+QVSNWFINARVRLWKPMVEEMY +E KE
Sbjct  135   AWLFEHFLHPYPSDADKHLLARQTGLSRNQVSNWFINARVRLWKPMVEEMYQQEAKE  191



>ref|XP_004160487.1| PREDICTED: BEL1-like homeodomain protein 2-like, partial [Cucumis 
sativus]
Length=439

 Score =   262 bits (669),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 181/261 (69%), Gaps = 20/261 (8%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY+ PAQELL+EFC VG  Q  + K  ++   +  + ++   +             
Sbjct  164   LRNSKYVKPAQELLEEFCSVGKVQLKKNKFNTKPNPNTESATNATATTSAAATGGSTSKD  223

Query  1332  ---LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALA  1162
                L +   +E Q+ K KLL +LDEV+RRY  YR+QM  VV+SF+ V G GAA  Y+ L 
Sbjct  224   QPPLSAADRIEHQRRKVKLLSMLDEVERRYNLYREQMQMVVNSFDLVMGFGAAAPYTTLT  283

Query  1161  SRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQ  982
              + MSRHFRCL+DAI  QLK + +A+ EK  +  + G TKGETPRLK+++Q+LRQQ+A  
Sbjct  284   QKAMSRHFRCLKDAIAEQLKQSYEALGEKGGNGGS-GITKGETPRLKLLEQSLRQQRAFH  342

Query  981   QLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWF  802
             Q+ MM+   WRPQRGLPERSV++LRAWLFEHFLHP   D DK +LARQTGLSR+QVSNWF
Sbjct  343   QMGMMEQEAWRPQRGLPERSVNILRAWLFEHFLHP---DADKLLLARQTGLSRNQVSNWF  399

Query  801   INARVRLWKPMVEEMYLEEVK  739
             INARVRLWKPMVEEMY  E K
Sbjct  400   INARVRLWKPMVEEMYQLEGK  420



>gb|KHG14356.1| BEL1-like homeodomain protein 2 [Gossypium arboreum]
Length=785

 Score =   270 bits (691),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 183/254 (72%), Gaps = 10/254 (4%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHSLGSLHFLELQK--  1300
             IR+SKY+  AQ+LL+EFC VG       KR    + + + T +   S G        K  
Sbjct  357   IRNSKYVKAAQQLLEEFCSVGRGNF---KRNKSGRNNTNPTFNLPGSNGDGGSSSSTKDP  413

Query  1299  ----TKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRC  1132
                 T  ++ H   +VDRRY HY +QM  VV+SF+ V G GAA  Y+ALA + MSRHF+C
Sbjct  414   PPLSTADRIEHQRRKVDRRYNHYCEQMQTVVNSFDLVMGFGAAVPYTALAKKAMSRHFKC  473

Query  1131  LRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPW  952
             L+DAI AQLK + +A+ EK+ +  + G TKGETPRL++++Q+LRQQ+A  Q+ M++   W
Sbjct  474   LKDAITAQLKHSCEALGEKDGAGNS-GITKGETPRLRVLEQSLRQQRAFHQMGMVEQEAW  532

Query  951   RPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKP  772
             RPQRGLPERSV++LRAWLFEHFLHPYPSD DK +LARQTGLS++QVSNWFINARVRLWKP
Sbjct  533   RPQRGLPERSVNILRAWLFEHFLHPYPSDADKLLLARQTGLSKNQVSNWFINARVRLWKP  592

Query  771   MVEEMYLEEVKEQD  730
             MVE+MY +E+KE+D
Sbjct  593   MVEDMYQQEIKEED  606



>ref|XP_002306123.2| hypothetical protein POPTR_0004s16660g [Populus trichocarpa]
 gb|EEE86634.2| hypothetical protein POPTR_0004s16660g [Populus trichocarpa]
Length=605

 Score =   266 bits (680),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 182/270 (67%), Gaps = 7/270 (3%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCV--GTTQSDEPKRKSQWQQDDHTTSSQNHSLGSLHFLELQK  1300
             I +SKYL  AQ+LL E   V     Q D+ K ++  +   + +++    L      ELQ 
Sbjct  209   IPNSKYLKAAQQLLDEVVNVRKAIKQPDKEKNQTTSEHGLNKSTNSPSELSHAERQELQN  268

Query  1299  TKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASRVMSRHFRCLRDA  1120
               +KLL +LDEVDRRYK Y  QM  VVSSF+ ++G GAA  Y+ALA + +SRHFRCLRDA
Sbjct  269   KLTKLLSMLDEVDRRYKQYYHQMQIVVSSFDVISGCGAAKPYTALALQTISRHFRCLRDA  328

Query  1119  ILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQR  940
             I  Q+ A +K++ E+E+S  + G       RL+ +DQ LRQQ+A+ QL MM  H WRPQR
Sbjct  329   ITGQIHATRKSLGEQETSENSKGVG---ITRLRYVDQHLRQQRALHQLGMMQQHAWRPQR  385

Query  939   GLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFINARVRLWKPMVEE  760
             GLPE SVS+LRAWLFEHFLHPYP D DK +LARQTGL+RSQVSNWFINARVRLWKPMVEE
Sbjct  386   GLPESSVSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARVRLWKPMVEE  445

Query  759   MYLEEVKEQDNIMGSSDGSRAAVDGGSGRE  670
             MY EE+ + +  M S+  S  A     G E
Sbjct  446   MYKEELGDAE--MDSNSSSENAAKATKGEE  473



>ref|XP_009605853.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X2 [Nicotiana 
tomentosiformis]
Length=724

 Score =   268 bits (686),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 187/260 (72%), Gaps = 22/260 (8%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY   AQELL+EFC VG +Q  +  + S+      +++  +++             
Sbjct  297   LRNSKYAKAAQELLEEFCSVGRSQLFKKNKVSRNNNTTTSSNPNSNNPSRSNNHNTNSSS  356

Query  1332  ------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYS  1171
                   L +   +  Q+ K KLL + DEVD+RY HY +QM  VV+SF+ V G GAA  Y+
Sbjct  357   SKDLPPLSAADRIGHQRRKIKLLSMFDEVDKRYNHYCEQMQMVVNSFDLVMGFGAAAPYT  416

Query  1170  ALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQK  991
             ALA + MSRHF+CL+DAI AQLK + + + EK+++++  G TKGETPRLK+++++LRQQ+
Sbjct  417   ALAQKAMSRHFKCLKDAIAAQLKHSCELLGEKDTTTS--GLTKGETPRLKLLEKSLRQQQ  474

Query  990   -AIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV  814
              A  Q+ MMD+  WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QV
Sbjct  475   TAFHQMGMMDAEAWRPQRGLPERSVTILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQV  534

Query  813   SNWFINARVRLWKPMVEEMY  754
             SNWFINARVRLWKPMVE+MY
Sbjct  535   SNWFINARVRLWKPMVEDMY  554



>ref|XP_009605852.1| PREDICTED: BEL1-like homeodomain protein 4 isoform X1 [Nicotiana 
tomentosiformis]
Length=747

 Score =   269 bits (687),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 187/260 (72%), Gaps = 22/260 (8%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTSSQNHS-------------  1333
             +R+SKY   AQELL+EFC VG +Q  +  + S+      +++  +++             
Sbjct  320   LRNSKYAKAAQELLEEFCSVGRSQLFKKNKVSRNNNTTTSSNPNSNNPSRSNNHNTNSSS  379

Query  1332  ------LGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYS  1171
                   L +   +  Q+ K KLL + DEVD+RY HY +QM  VV+SF+ V G GAA  Y+
Sbjct  380   SKDLPPLSAADRIGHQRRKIKLLSMFDEVDKRYNHYCEQMQMVVNSFDLVMGFGAAAPYT  439

Query  1170  ALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQK  991
             ALA + MSRHF+CL+DAI AQLK + + + EK+++++  G TKGETPRLK+++++LRQQ+
Sbjct  440   ALAQKAMSRHFKCLKDAIAAQLKHSCELLGEKDTTTS--GLTKGETPRLKLLEKSLRQQQ  497

Query  990   -AIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQV  814
              A  Q+ MMD+  WRPQRGLPERSV++LRAWLFEHFLHPYPSD DKH+LARQTGLSR+QV
Sbjct  498   TAFHQMGMMDAEAWRPQRGLPERSVTILRAWLFEHFLHPYPSDADKHLLARQTGLSRNQV  557

Query  813   SNWFINARVRLWKPMVEEMY  754
             SNWFINARVRLWKPMVE+MY
Sbjct  558   SNWFINARVRLWKPMVEDMY  577



>ref|XP_009420594.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Musa acuminata subsp. malaccensis]
Length=669

 Score =   267 bits (682),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/279 (51%), Positives = 184/279 (66%), Gaps = 25/279 (9%)
 Frame = -2

Query  1464  SKYLGPAQELLKEFCCVGTTQSDE---------PKRKSQWQQDD--------HTTSSQNH  1336
             +KYL  AQ+LL E   VG    DE         P   S  +  D        +T++ +  
Sbjct  184   TKYLKAAQQLLDEVVNVGKGVKDEAAKGAPLKNPADSSNVELKDPGAGTSEGNTSAKRGA  243

Query  1335  SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAATVYSALASR  1156
              L +    ELQ  K+KL+++L+EV++RY+ Y  QM  VVSSFEAVAG G+A  Y+ALA R
Sbjct  244   DLTTAERQELQMKKAKLINMLEEVEQRYRQYHHQMQIVVSSFEAVAGYGSARTYTALALR  303

Query  1155  VMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTLRQQKAIQQL  976
              +S+ FRCLRDAI AQ++   K++ E++        +K    RL+ ID  LRQQ+A+QQL
Sbjct  304   TISKQFRCLRDAITAQIRETSKSLGEED--------SKSGGSRLRFIDHHLRQQRALQQL  355

Query  975   TMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSRSQVSNWFIN  796
              M+  + WRPQRGLPERSVS+LRAWLFEHFLHPYP D DK +LA+QTGL+RSQVSNWFIN
Sbjct  356   GMIQQNAWRPQRGLPERSVSILRAWLFEHFLHPYPKDSDKLMLAKQTGLTRSQVSNWFIN  415

Query  795   ARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVDGGS  679
             ARVRLWKPMVEEMYLEE+K+Q+      + S    +G S
Sbjct  416   ARVRLWKPMVEEMYLEELKDQEQNNSEENASNGDANGSS  454



>gb|KHG11905.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=653

 Score =   266 bits (679),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 149/278 (54%), Positives = 183/278 (66%), Gaps = 28/278 (10%)
 Frame = -2

Query  1467  SSKYLGPAQELLKEFCCVGTT--QSDEPKRKSQWQQDDHTTSSQNH--------------  1336
             SSKYL  AQELL E   V TT     E   K     ++H+ SS                 
Sbjct  156   SSKYLKAAQELLDEVVNVNTTGITKSELLAKKGGGGNNHSNSSSKAVGESSVVAGDGSGG  215

Query  1335  ---------SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAA  1183
                       L +    E+Q  K+KL+++LDEV++RY+ Y  QM  V SSFE  AG G+A
Sbjct  216   GEAGEKHPAELTTAEKQEIQMKKAKLINMLDEVEQRYRQYHHQMQIVTSSFEQAAGIGSA  275

Query  1182  TVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTL  1003
               Y+ALA + +S+ FRCL+DAI  Q++AA K++ E+E      GA K E  RLK +D  L
Sbjct  276   KTYTALALKTISKQFRCLKDAISDQIRAANKSLGEEEDGVG--GAAKIEGSRLKFVDHHL  333

Query  1002  RQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSR  823
             RQQ+A+QQL M+  + WRPQRGLPERSVSVLRAWLFEHFLHPYP D DKH+LA+QTGL+R
Sbjct  334   RQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTR  393

Query  822   SQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSD  709
             SQVSNWFINARVRLWKPMVEEMYLEE+KEQ+   G+SD
Sbjct  394   SQVSNWFINARVRLWKPMVEEMYLEEIKEQEQ-NGTSD  430



>gb|EMT28215.1| BEL1-like homeodomain protein 2 [Aegilops tauschii]
Length=599

 Score =   264 bits (675),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 183/305 (60%), Gaps = 60/305 (20%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQ------------------SDEPKRKSQWQQDDHTTS  1348
             +R+SKY   AQELL EFC VG  Q                  S      S   Q   + S
Sbjct  143   LRNSKYTRAAQELLDEFCSVGRGQTIKGGGRGAGGSSSNPNASKGGPSSSGAAQSPSSAS  202

Query  1347  SQNHSLGSLHFLELQKTKSKLLHLLDE-------------VDRRYKHYRDQMTAVVSSFE  1207
              +   L      E Q+ K+KL+ +LDE             VDRRY HY DQM  VV+ F+
Sbjct  203   KEPPQLSPADRFEQQRKKAKLISMLDEARRFVWELLEFGTVDRRYNHYCDQMQMVVNFFD  262

Query  1206  AVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPR  1027
             +V G GAAT Y+ALA + MSRHFRCL+DAI AQL+   + + EK++ +++ G TKGETPR
Sbjct  263   SVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQLRHTCELLGEKDAGTSS-GLTKGETPR  321

Query  1026  LKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHIL  847
             L+ IDQ+LRQQ+A   + MM+   WRPQRGLPERSVS+LR+WLFEHFLHPYPSD DKH+L
Sbjct  322   LRAIDQSLRQQRAFHHMGMMEQEAWRPQRGLPERSVSILRSWLFEHFLHPYPSDADKHLL  381

Query  846   ARQTGLSRSQ----------------------------VSNWFINARVRLWKPMVEEMYL  751
             ARQTGLSR+Q                            VSNWFINARVRLWKPM+EEMY 
Sbjct  382   ARQTGLSRNQFLENLHSFQFIYLSLLYLPGRGPFTGAPVSNWFINARVRLWKPMIEEMYQ  441

Query  750   EEVKE  736
             +E KE
Sbjct  442   QETKE  446



>gb|EEE59870.1| hypothetical protein OsJ_12461 [Oryza sativa Japonica Group]
Length=816

 Score =   269 bits (687),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 149/296 (50%), Positives = 190/296 (64%), Gaps = 35/296 (12%)
 Frame = -2

Query  1473  IRSSKYLGPAQELLKEFCCVGTTQSDEPKRKSQWQQDDHTTS----------------SQ  1342
             +R+SKY   AQELL+EFC VG  Q      +     + +++                  +
Sbjct  374   LRNSKYTRAAQELLEEFCSVGRGQIKGGGGRGSAPNNPNSSKAAASSSGAAQSPSSASKE  433

Query  1341  NHSLGSLHFLELQKTKSKLLHLLDE------------------VDRRYKHYRDQMTAVVS  1216
                L      E Q+ K+KL+ +LDE                  VDRRY HY DQM  VV+
Sbjct  434   PPQLSPADRFEHQRKKAKLISMLDEARVIRVASLPGEKVFYMGVDRRYNHYCDQMQMVVN  493

Query  1215  SFEAVAGDGAATVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGE  1036
              F++V G GAAT Y+ALA + MSRHFRCL+DAI AQL+   +A+ EK++ + + G TKGE
Sbjct  494   FFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQLRGTCEALGEKDAGTGS-GLTKGE  552

Query  1035  TPRLKMIDQTLRQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDK  856
             TPRL+ IDQ+LRQQ+A   + +M+   WRPQRGLPERSV++LR+WLFEHFLHPYPSD DK
Sbjct  553   TPRLRAIDQSLRQQRAFHHMGIMEQEAWRPQRGLPERSVNILRSWLFEHFLHPYPSDADK  612

Query  855   HILARQTGLSRSQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSDGSRAAVD  688
             H+LARQTGLSR+QVSNWFINARVRLWKPM+EEMY +E KE +   G+ D    A D
Sbjct  613   HLLARQTGLSRNQVSNWFINARVRLWKPMIEEMYQQECKELEGSSGAGDDPSGADD  668



>gb|KHG11906.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=680

 Score =   265 bits (678),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 149/278 (54%), Positives = 183/278 (66%), Gaps = 28/278 (10%)
 Frame = -2

Query  1467  SSKYLGPAQELLKEFCCVGTT--QSDEPKRKSQWQQDDHTTSSQNH--------------  1336
             SSKYL  AQELL E   V TT     E   K     ++H+ SS                 
Sbjct  183   SSKYLKAAQELLDEVVNVNTTGITKSELLAKKGGGGNNHSNSSSKAVGESSVVAGDGSGG  242

Query  1335  ---------SLGSLHFLELQKTKSKLLHLLDEVDRRYKHYRDQMTAVVSSFEAVAGDGAA  1183
                       L +    E+Q  K+KL+++LDEV++RY+ Y  QM  V SSFE  AG G+A
Sbjct  243   GEAGEKHPAELTTAEKQEIQMKKAKLINMLDEVEQRYRQYHHQMQIVTSSFEQAAGIGSA  302

Query  1182  TVYSALASRVMSRHFRCLRDAILAQLkaakkamaekesssaAPGATKGETPRLKMIDQTL  1003
               Y+ALA + +S+ FRCL+DAI  Q++AA K++ E+E      GA K E  RLK +D  L
Sbjct  303   KTYTALALKTISKQFRCLKDAISDQIRAANKSLGEEEDGVG--GAAKIEGSRLKFVDHHL  360

Query  1002  RQQKAIQQLTMMDSHPWRPQRGLPERSVSVLRAWLFEHFLHPYPSDVDKHILARQTGLSR  823
             RQQ+A+QQL M+  + WRPQRGLPERSVSVLRAWLFEHFLHPYP D DKH+LA+QTGL+R
Sbjct  361   RQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTR  420

Query  822   SQVSNWFINARVRLWKPMVEEMYLEEVKEQDNIMGSSD  709
             SQVSNWFINARVRLWKPMVEEMYLEE+KEQ+   G+SD
Sbjct  421   SQVSNWFINARVRLWKPMVEEMYLEEIKEQEQ-NGTSD  457



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6549674449995