BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17712_g1_i1 len=757 path=[1:0-523 525:524-561 563:562-756]

Length=757
                                                                      Score     E

gb|KHN00899.1|  hypothetical protein glysoja_000567                   69.3    3e-12   
ref|XP_006606277.1|  PREDICTED: uncharacterized protein LOC100787944  69.3    3e-12   
ref|XP_009779528.1|  PREDICTED: uncharacterized protein LOC104228701  67.4    1e-11   
ref|XP_009614317.1|  PREDICTED: uncharacterized protein LOC104107268  67.4    1e-11   
ref|XP_010528042.1|  PREDICTED: uncharacterized protein LOC104805244  67.4    2e-11   
ref|XP_004238965.1|  PREDICTED: uncharacterized protein LOC101265638  67.4    2e-11   
ref|XP_006362532.1|  PREDICTED: uncharacterized protein LOC102583688  67.0    2e-11   
ref|XP_006589380.1|  PREDICTED: uncharacterized protein LOC100795632  67.0    2e-11   
gb|KCW64774.1|  hypothetical protein EUGRSUZ_G02348                   68.2    2e-11   
ref|XP_010066745.1|  PREDICTED: uncharacterized protein LOC104453818  66.6    3e-11   
ref|XP_010647948.1|  PREDICTED: uncharacterized protein LOC100261046  65.9    6e-11   
ref|XP_011021667.1|  PREDICTED: uncharacterized protein LOC105123669  65.5    9e-11   
ref|XP_011008555.1|  PREDICTED: uncharacterized protein LOC105113898  65.1    9e-11   
ref|XP_010265261.1|  PREDICTED: uncharacterized protein LOC104603042  64.7    1e-10   
ref|XP_010495138.1|  PREDICTED: uncharacterized protein LOC104772194  64.3    2e-10   
ref|XP_010458776.1|  PREDICTED: uncharacterized protein LOC104739980  64.3    2e-10   
ref|XP_002892734.1|  hypothetical protein ARALYDRAFT_888682           64.7    2e-10   
ref|XP_006484409.1|  PREDICTED: uncharacterized protein LOC102621984  63.9    2e-10   
ref|XP_006378500.1|  hypothetical protein POPTR_0010s13975g           65.5    3e-10   
ref|NP_683303.1|  ROTUNDIFOLIA like 17                                63.9    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009614875.1|  PREDICTED: uncharacterized protein LOC104107703  63.9    3e-10   
ref|XP_006303810.1|  hypothetical protein CARUB_v10012257mg           64.7    3e-10   
ref|XP_004496201.1|  PREDICTED: uncharacterized protein LOC101492970  63.9    3e-10   
gb|KHN10788.1|  hypothetical protein glysoja_034134                   63.9    4e-10   
ref|XP_008243168.1|  PREDICTED: uncharacterized protein LOC103341433  63.5    4e-10   
ref|XP_010044296.1|  PREDICTED: uncharacterized protein LOC104433305  63.5    4e-10   
ref|XP_010262893.1|  PREDICTED: uncharacterized protein LOC104601299  63.5    4e-10   
ref|XP_006573267.1|  PREDICTED: uncharacterized protein LOC100779124  63.5    4e-10   
ref|XP_004135115.1|  PREDICTED: uncharacterized protein LOC101204271  63.5    4e-10   
ref|XP_003544703.2|  PREDICTED: uncharacterized protein LOC100781224  63.5    4e-10   
ref|XP_004237033.1|  PREDICTED: uncharacterized protein LOC101245150  63.5    5e-10   
gb|KFK43588.1|  hypothetical protein AALP_AA1G145700                  63.2    6e-10   
ref|XP_009148533.1|  PREDICTED: uncharacterized protein LOC103871949  63.2    6e-10   
ref|XP_004159302.1|  PREDICTED: uncharacterized protein LOC101223778  62.8    8e-10   
ref|XP_008446557.1|  PREDICTED: uncharacterized protein LOC103489253  62.8    9e-10   
ref|XP_009794143.1|  PREDICTED: uncharacterized protein LOC104240939  62.4    9e-10   
ref|XP_003535972.2|  PREDICTED: uncharacterized protein LOC100791775  62.4    1e-09   
ref|XP_009617874.1|  PREDICTED: uncharacterized protein LOC104110136  62.4    1e-09   
ref|XP_011070836.1|  PREDICTED: uncharacterized protein LOC105156416  61.6    2e-09   
ref|XP_004138925.1|  PREDICTED: uncharacterized protein LOC101205568  61.2    4e-09   
ref|XP_006366066.1|  PREDICTED: uncharacterized protein LOC102587807  60.8    4e-09   
ref|XP_009110593.1|  PREDICTED: uncharacterized protein LOC103836116  60.5    5e-09   
ref|XP_009794144.1|  PREDICTED: uncharacterized protein LOC104240940  60.5    5e-09   
ref|XP_009152117.1|  PREDICTED: uncharacterized protein LOC103875355  60.5    6e-09   
ref|NP_850631.2|  protein rotundifolia like 16                        60.1    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008441687.1|  PREDICTED: uncharacterized protein LOC103485763  60.1    8e-09   
ref|XP_010514189.1|  PREDICTED: uncharacterized protein LOC104790185  59.7    1e-08   
ref|XP_003614422.1|  DVL5                                             59.7    1e-08   
ref|XP_009784211.1|  PREDICTED: uncharacterized protein LOC104232654  58.2    4e-08   
ref|XP_010660503.1|  PREDICTED: uncharacterized protein LOC100263434  58.2    4e-08   
ref|NP_001077795.1|  protein ROTUNDIFOLIA like 15                     58.2    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490276.1|  PREDICTED: uncharacterized protein LOC101490991  58.2    5e-08   
ref|XP_009105433.1|  PREDICTED: uncharacterized protein LOC103831294  58.2    5e-08   
ref|XP_004492010.1|  PREDICTED: uncharacterized protein LOC101507158  57.8    5e-08   
ref|XP_010415515.1|  PREDICTED: uncharacterized protein LOC104701516  57.8    5e-08   
ref|XP_007139330.1|  hypothetical protein PHAVU_008G020300g           58.5    5e-08   
ref|XP_007033329.1|  ROTUNDIFOLIA like 21                             57.8    7e-08   
ref|XP_006485757.1|  PREDICTED: uncharacterized protein LOC102616705  57.8    7e-08   
ref|XP_010663564.1|  PREDICTED: uncharacterized protein LOC100262942  57.4    8e-08   
ref|XP_010695825.1|  PREDICTED: uncharacterized protein LOC104908402  57.4    8e-08   
gb|EPS58953.1|  hypothetical protein M569_15859                       57.8    9e-08   
ref|XP_006482297.1|  PREDICTED: uncharacterized protein LOC102623751  57.0    9e-08   
ref|XP_011021202.1|  PREDICTED: uncharacterized protein LOC105123349  57.0    1e-07   
ref|XP_006585833.1|  PREDICTED: uncharacterized protein LOC100793631  57.0    1e-07   
ref|XP_008341863.1|  PREDICTED: uncharacterized protein LOC103404704  57.0    1e-07   
ref|XP_009349278.1|  PREDICTED: uncharacterized protein LOC103940822  56.6    1e-07   
ref|XP_009620469.1|  PREDICTED: uncharacterized protein LOC104112295  56.6    1e-07   
ref|XP_011004423.1|  PREDICTED: uncharacterized protein LOC105110917  56.6    2e-07   
ref|XP_010317140.1|  PREDICTED: uncharacterized protein LOC104645948  56.2    2e-07   
ref|XP_006344831.1|  PREDICTED: uncharacterized protein LOC102601800  56.2    2e-07   
gb|ABK93760.1|  unknown                                               56.2    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006384216.1|  hypothetical protein POPTR_0004s10280g           57.8    2e-07   
gb|KFK41318.1|  hypothetical protein AALP_AA2G114500                  56.2    2e-07   
gb|KHN17965.1|  hypothetical protein glysoja_035051                   55.8    3e-07   
ref|XP_011099284.1|  PREDICTED: uncharacterized protein LOC105177738  56.2    3e-07   
ref|XP_011077282.1|  PREDICTED: uncharacterized protein LOC105161330  55.8    3e-07   
ref|XP_008230382.1|  PREDICTED: uncharacterized protein LOC103329662  57.4    3e-07   
ref|XP_010032613.1|  PREDICTED: uncharacterized protein LOC104422085  55.5    5e-07   
gb|KHN13813.1|  hypothetical protein glysoja_016097                   55.8    1e-06   
ref|XP_010316187.1|  PREDICTED: uncharacterized protein LOC104645697  54.3    1e-06   
ref|XP_003520041.1|  PREDICTED: uncharacterized protein LOC100806978  54.7    1e-06   
ref|XP_009418440.1|  PREDICTED: uncharacterized protein LOC103998642  53.9    1e-06   
ref|XP_006602998.1|  PREDICTED: uncharacterized protein LOC100804662  55.1    2e-06   
ref|XP_010470844.1|  PREDICTED: uncharacterized protein LOC104750702  53.5    2e-06   
ref|XP_010061863.1|  PREDICTED: uncharacterized protein LOC104449413  53.5    3e-06   
ref|XP_007046310.1|  Serine/threonine-protein kinase STN7             57.8    3e-06   
ref|XP_006400132.1|  hypothetical protein EUTSA_v10015386mg           52.4    8e-06   
ref|XP_009409906.1|  PREDICTED: uncharacterized protein LOC103992053  52.0    9e-06   
ref|NP_001077782.1|  ROTUNDIFOLIA like 21 protein                     51.6    9e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ACG41949.1|  hypothetical protein                                  51.6    1e-05   Zea mays [maize]
ref|XP_004968856.1|  PREDICTED: uncharacterized protein LOC101776509  51.6    1e-05   
gb|ACG39256.1|  hypothetical protein                                  51.6    1e-05   Zea mays [maize]
ref|XP_009121526.1|  PREDICTED: uncharacterized protein LOC103846365  51.6    1e-05   
ref|XP_008786558.1|  PREDICTED: uncharacterized protein LOC103704860  51.6    1e-05   
ref|XP_009105265.1|  PREDICTED: uncharacterized protein LOC103831158  50.8    2e-05   
ref|XP_008461574.1|  PREDICTED: uncharacterized protein LOC103500144  50.8    2e-05   
ref|XP_010692497.1|  PREDICTED: uncharacterized protein LOC104905605  50.8    2e-05   
ref|XP_008791239.1|  PREDICTED: uncharacterized protein LOC103708195  50.8    2e-05   
ref|XP_008367022.1|  PREDICTED: uncharacterized protein LOC103430650  50.8    2e-05   
gb|ABD96875.1|  DVL protein                                           50.8    3e-05   Tarenaya spinosa
ref|XP_004968854.1|  PREDICTED: uncharacterized protein LOC101775702  50.4    3e-05   
ref|XP_008361738.1|  PREDICTED: uncharacterized protein LOC103425437  50.4    3e-05   
ref|XP_009357032.1|  PREDICTED: uncharacterized protein LOC103947798  50.4    3e-05   
ref|XP_011085549.1|  PREDICTED: uncharacterized protein LOC105167491  49.7    6e-05   
ref|XP_003577968.1|  PREDICTED: uncharacterized protein LOC100841681  49.7    6e-05   
ref|XP_009131515.1|  PREDICTED: uncharacterized protein LOC103856177  49.7    7e-05   
ref|XP_009623676.1|  PREDICTED: uncharacterized protein LOC104114844  49.3    8e-05   
ref|XP_009336624.1|  PREDICTED: uncharacterized protein LOC103929192  49.3    9e-05   
gb|ABD96922.1|  hypothetical protein                                  49.3    9e-05   Tarenaya spinosa
ref|XP_006346874.1|  PREDICTED: uncharacterized protein LOC102588676  49.3    9e-05   
dbj|BAD36506.1|  hypothetical protein                                 49.3    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ACG26308.1|  hypothetical protein                                  48.1    2e-04   Zea mays [maize]
ref|XP_002873751.1|  hypothetical protein ARALYDRAFT_909580           48.1    3e-04   
ref|XP_004956523.1|  PREDICTED: uncharacterized protein LOC101762634  47.8    3e-04   
ref|NP_001078094.1|  protein rotundifolia like 19                     47.8    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008380323.1|  PREDICTED: uncharacterized protein LOC103443281  47.8    3e-04   
ref|XP_010238041.1|  PREDICTED: uncharacterized protein LOC100842284  47.4    4e-04   
ref|XP_004956522.1|  PREDICTED: uncharacterized protein LOC101762237  47.4    4e-04   
ref|NP_001175756.1|  Os09g0306500                                     47.0    5e-04   
ref|XP_002462161.1|  hypothetical protein SORBIDRAFT_02g020768        47.4    5e-04   Sorghum bicolor [broomcorn]
ref|XP_009799695.1|  PREDICTED: uncharacterized protein LOC104245734  47.0    5e-04   
ref|XP_004503578.1|  PREDICTED: uncharacterized protein LOC101512326  47.0    6e-04   
gb|ACY95284.1|  unknown                                               47.0    6e-04   Zea mays [maize]
gb|ACG49134.1|  hypothetical protein                                  47.0    6e-04   Zea mays [maize]
ref|XP_009357749.1|  PREDICTED: uncharacterized protein LOC103948440  47.8    7e-04   
ref|NP_001078592.1|  protein rotundifolia like 18                     46.6    9e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KGN52048.1|  hypothetical protein Csa_5G608360                     46.6    9e-04   



>gb|KHN00899.1| hypothetical protein glysoja_000567, partial [Glycine soja]
Length=47

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SSRGLGGALREQRARLYIIRRCVVMLLCWHD
Sbjct  14   RRLSSRGLGGALREQRARLYIIRRCVVMLLCWHD  47



>ref|XP_006606277.1| PREDICTED: uncharacterized protein LOC100787944 [Glycine max]
Length=46

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SSRGLGGALREQRARLYIIRRCVVMLLCWHD
Sbjct  13   RRLSSRGLGGALREQRARLYIIRRCVVMLLCWHD  46



>ref|XP_009779528.1| PREDICTED: uncharacterized protein LOC104228701 [Nicotiana sylvestris]
Length=46

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RRISSRG+GG LREQRA+LYIIRRCVVMLLCWHD
Sbjct  13   RRISSRGVGGVLREQRAKLYIIRRCVVMLLCWHD  46



>ref|XP_009614317.1| PREDICTED: uncharacterized protein LOC104107268 [Nicotiana tomentosiformis]
Length=46

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RRISSRG+GG LREQRA+LYIIRRCVVMLLCWHD
Sbjct  13   RRISSRGVGGVLREQRAKLYIIRRCVVMLLCWHD  46



>ref|XP_010528042.1| PREDICTED: uncharacterized protein LOC104805244 [Tarenaya hassleriana]
 ref|XP_010556386.1| PREDICTED: uncharacterized protein LOC104825713 [Tarenaya hassleriana]
Length=46

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SSRGLGG LREQRA+LYIIRRCVVMLLCWHD
Sbjct  13   RRVSSRGLGGVLREQRAKLYIIRRCVVMLLCWHD  46



>ref|XP_004238965.1| PREDICTED: uncharacterized protein LOC101265638 [Solanum lycopersicum]
Length=46

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RRISSRG+GG LREQRA+LYIIRRCVVMLLCWHD
Sbjct  13   RRISSRGVGGVLREQRAKLYIIRRCVVMLLCWHD  46



>ref|XP_006362532.1| PREDICTED: uncharacterized protein LOC102583688 [Solanum tuberosum]
Length=46

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RRISSRG+GG LREQRA+LYIIRRCVVMLLCWHD
Sbjct  13   RRISSRGVGGVLREQRAKLYIIRRCVVMLLCWHD  46



>ref|XP_006589380.1| PREDICTED: uncharacterized protein LOC100795632 [Glycine max]
Length=46

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SSRGLGGALRE+RARLYIIRRCVVMLLCWHD
Sbjct  13   RRLSSRGLGGALRERRARLYIIRRCVVMLLCWHD  46



>gb|KCW64774.1| hypothetical protein EUGRSUZ_G02348 [Eucalyptus grandis]
Length=93

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SSRG GGALREQ+A+LYIIRRCVVMLLCWHD
Sbjct  60   RRLSSRGPGGALREQKAKLYIIRRCVVMLLCWHD  93



>ref|XP_010066745.1| PREDICTED: uncharacterized protein LOC104453818 [Eucalyptus grandis]
Length=47

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SSRG GGALREQ+A+LYIIRRCVVMLLCWHD
Sbjct  14   RRLSSRGPGGALREQKAKLYIIRRCVVMLLCWHD  47



>ref|XP_010647948.1| PREDICTED: uncharacterized protein LOC100261046 [Vitis vinifera]
Length=46

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+S++GLGG LREQRARLYIIRRCVVMLLCWHD
Sbjct  13   RRLSNKGLGGVLREQRARLYIIRRCVVMLLCWHD  46



>ref|XP_011021667.1| PREDICTED: uncharacterized protein LOC105123669 [Populus euphratica]
Length=46

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RRISS+GLG  LREQRARLYIIRRCVVML+CWHD
Sbjct  13   RRISSKGLGAVLREQRARLYIIRRCVVMLICWHD  46



>ref|XP_011008555.1| PREDICTED: uncharacterized protein LOC105113898 [Populus euphratica]
Length=46

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RRISS+GLG  LREQRARLYIIRRCVVML+CWHD
Sbjct  13   RRISSKGLGAVLREQRARLYIIRRCVVMLVCWHD  46



>ref|XP_010265261.1| PREDICTED: uncharacterized protein LOC104603042 [Nelumbo nucifera]
Length=46

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SSRGLGG LREQR RLYIIRRCV+MLLCWHD
Sbjct  13   RRLSSRGLGGILREQRGRLYIIRRCVIMLLCWHD  46



>ref|XP_010495138.1| PREDICTED: uncharacterized protein LOC104772194 [Camelina sativa]
 ref|XP_010476319.1| PREDICTED: uncharacterized protein LOC104755606 [Camelina sativa]
Length=47

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SS+GLG  L+EQRA+LYIIRRCVVMLLCWHD
Sbjct  14   RRVSSKGLGAVLKEQRAKLYIIRRCVVMLLCWHD  47



>ref|XP_010458776.1| PREDICTED: uncharacterized protein LOC104739980 [Camelina sativa]
Length=47

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SS+GLG  L+EQRA+LYIIRRCVVMLLCWHD
Sbjct  14   RRVSSKGLGAVLKEQRAKLYIIRRCVVMLLCWHD  47



>ref|XP_002892734.1| hypothetical protein ARALYDRAFT_888682 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68993.1| hypothetical protein ARALYDRAFT_888682 [Arabidopsis lyrata subsp. 
lyrata]
Length=61

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SS+GLG  L+EQRA+LYIIRRCVVMLLCWHD
Sbjct  28   RRVSSKGLGAVLKEQRAKLYIIRRCVVMLLCWHD  61



>ref|XP_006484409.1| PREDICTED: uncharacterized protein LOC102621984 [Citrus sinensis]
Length=47

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            R +SSRG GG LREQRA+LYIIRRCVVMLLCWHD
Sbjct  14   RSLSSRGFGGVLREQRAKLYIIRRCVVMLLCWHD  47



>ref|XP_006378500.1| hypothetical protein POPTR_0010s13975g [Populus trichocarpa]
 gb|ERP56297.1| hypothetical protein POPTR_0010s13975g [Populus trichocarpa]
Length=111

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RRISS+GLG  LREQRARLYIIRRCVVML+CWHD
Sbjct  78   RRISSKGLGAVLREQRARLYIIRRCVVMLVCWHD  111



>ref|NP_683303.1| ROTUNDIFOLIA like 17 [Arabidopsis thaliana]
 gb|AAD31077.1|AC007357_26 EST gb|T21221 comes from this gene [Arabidopsis thaliana]
 gb|AAK17166.1|AF325098_1 unknown protein [Arabidopsis thaliana]
 gb|AAM67252.1| unknown [Arabidopsis thaliana]
 gb|AAP13819.1| DVL4 [Arabidopsis thaliana]
 dbj|BAD95444.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABF47114.1| At1g13245 [Arabidopsis thaliana]
 gb|AEE28989.1| ROTUNDIFOLIA like 17 [Arabidopsis thaliana]
Length=41

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SS+GLG  L+EQRA+LYIIRRCVVMLLCWHD
Sbjct  8    RRVSSKGLGAVLKEQRAKLYIIRRCVVMLLCWHD  41



>ref|XP_009614875.1| PREDICTED: uncharacterized protein LOC104107703 [Nicotiana tomentosiformis]
Length=47

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  622  ISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            ISSRGLGG LR+QRARLYII+RCVVMLLCWHD
Sbjct  16   ISSRGLGGVLRQQRARLYIIKRCVVMLLCWHD  47



>ref|XP_006303810.1| hypothetical protein CARUB_v10012257mg [Capsella rubella]
 gb|EOA36708.1| hypothetical protein CARUB_v10012257mg [Capsella rubella]
Length=86

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SS+GLG  L+EQRA+LYIIRRCVVMLLCWHD
Sbjct  53   RRVSSKGLGAVLKEQRAKLYIIRRCVVMLLCWHD  86



>ref|XP_004496201.1| PREDICTED: uncharacterized protein LOC101492970 [Cicer arietinum]
Length=51

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  622  ISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
             SSRGLGG L+EQRARLYIIRRCVVMLLCWHD
Sbjct  20   TSSRGLGGVLKEQRARLYIIRRCVVMLLCWHD  51



>gb|KHN10788.1| hypothetical protein glysoja_034134, partial [Glycine soja]
Length=50

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 1/35 (3%)
 Frame = -1

Query  628  RRISS-RGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RRISS RG+GG LREQRARLYIIRRCVVMLLCWHD
Sbjct  16   RRISSNRGIGGVLREQRARLYIIRRCVVMLLCWHD  50



>ref|XP_008243168.1| PREDICTED: uncharacterized protein LOC103341433 [Prunus mume]
Length=48

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  619  SSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            SS+GLGG LREQRARLYIIRRCVVMLLCWHD
Sbjct  18   SSKGLGGVLREQRARLYIIRRCVVMLLCWHD  48



>ref|XP_010044296.1| PREDICTED: uncharacterized protein LOC104433305 [Eucalyptus grandis]
Length=48

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR SSRG+GGA+RE+RARLYIIRRC+VMLLCWHD
Sbjct  15   RRASSRGVGGAIRERRARLYIIRRCIVMLLCWHD  48



>ref|XP_010262893.1| PREDICTED: uncharacterized protein LOC104601299 [Nelumbo nucifera]
Length=46

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+S RGLGG LREQR RLYIIRRCV+MLLCWHD
Sbjct  13   RRLSGRGLGGILREQRGRLYIIRRCVIMLLCWHD  46



>ref|XP_006573267.1| PREDICTED: uncharacterized protein LOC100779124 [Glycine max]
 ref|XP_006574883.1| PREDICTED: uncharacterized protein LOC100802712 [Glycine max]
 gb|KHN05858.1| hypothetical protein glysoja_033596 [Glycine soja]
Length=47

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 1/35 (3%)
 Frame = -1

Query  628  RRISS-RGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RRISS RG+GG LREQRARLYIIRRCVVMLLCWHD
Sbjct  13   RRISSNRGIGGVLREQRARLYIIRRCVVMLLCWHD  47



>ref|XP_004135115.1| PREDICTED: uncharacterized protein LOC101204271 [Cucumis sativus]
Length=44

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR SSRGLGG +R+QRARLYIIRRCVVMLLCWHD
Sbjct  11   RRGSSRGLGGVVRQQRARLYIIRRCVVMLLCWHD  44



>ref|XP_003544703.2| PREDICTED: uncharacterized protein LOC100781224 [Glycine max]
Length=46

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SSRGLGGALREQRARLYII+RC+VMLL WHD
Sbjct  13   RRLSSRGLGGALREQRARLYIIKRCLVMLLYWHD  46



>ref|XP_004237033.1| PREDICTED: uncharacterized protein LOC101245150 [Solanum lycopersicum]
Length=53

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  622  ISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            ISSRGLGG LREQRA+LYIIRRCVVMLLCW+D
Sbjct  22   ISSRGLGGVLREQRAKLYIIRRCVVMLLCWND  53



>gb|KFK43588.1| hypothetical protein AALP_AA1G145700 [Arabis alpina]
Length=47

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SSRGLG  L+EQRA+LYIIRRCVVMLLCW+D
Sbjct  14   RRVSSRGLGAVLKEQRAKLYIIRRCVVMLLCWND  47



>ref|XP_009148533.1| PREDICTED: uncharacterized protein LOC103871949 [Brassica rapa]
Length=47

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SSRGLG  L+EQRA+LYIIRRCVVMLLCW+D
Sbjct  14   RRVSSRGLGAVLKEQRAKLYIIRRCVVMLLCWND  47



>ref|XP_004159302.1| PREDICTED: uncharacterized protein LOC101223778 [Cucumis sativus]
Length=48

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR SSRGLGG +R+QRARLYIIRRCVVMLLCWHD
Sbjct  15   RRGSSRGLGGVVRQQRARLYIIRRCVVMLLCWHD  48



>ref|XP_008446557.1| PREDICTED: uncharacterized protein LOC103489253 [Cucumis melo]
Length=49

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR SSRGLGG +R+QRARLYIIRRCVVMLLCWHD
Sbjct  16   RRGSSRGLGGVVRQQRARLYIIRRCVVMLLCWHD  49



>ref|XP_009794143.1| PREDICTED: uncharacterized protein LOC104240939 [Nicotiana sylvestris]
Length=47

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  622  ISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            ISSRGLGG +R+Q+ARLYII+RCVVMLLCWHD
Sbjct  16   ISSRGLGGVIRQQKARLYIIKRCVVMLLCWHD  47



>ref|XP_003535972.2| PREDICTED: uncharacterized protein LOC100791775 [Glycine max]
Length=46

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SSRGLGGALR+QRARLYIIRRCVVMLL WH+
Sbjct  13   RRLSSRGLGGALRQQRARLYIIRRCVVMLLWWHN  46



>ref|XP_009617874.1| PREDICTED: uncharacterized protein LOC104110136 [Nicotiana tomentosiformis]
Length=47

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  622  ISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            ISSRGLGG  R+Q+ARLYII+RCVVMLLCWHD
Sbjct  16   ISSRGLGGVFRQQKARLYIIKRCVVMLLCWHD  47



>ref|XP_011070836.1| PREDICTED: uncharacterized protein LOC105156416 [Sesamum indicum]
Length=44

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +RISSRGL G  REQRA+LYIIRRCVVMLLC+HD
Sbjct  11   KRISSRGLSGVFREQRAKLYIIRRCVVMLLCYHD  44



>ref|XP_004138925.1| PREDICTED: uncharacterized protein LOC101205568 [Cucumis sativus]
 ref|XP_004159993.1| PREDICTED: uncharacterized LOC101205568 [Cucumis sativus]
Length=50

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -1

Query  616  SRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            SRG GG LREQRA+LYIIRRCVVMLLCWHD
Sbjct  21   SRGFGGVLREQRAKLYIIRRCVVMLLCWHD  50



>ref|XP_006366066.1| PREDICTED: uncharacterized protein LOC102587807 [Solanum tuberosum]
Length=51

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  622  ISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            ISSRGLG  LREQRA+LYIIRRCVVMLLCW+D
Sbjct  20   ISSRGLGRVLREQRAKLYIIRRCVVMLLCWND  51



>ref|XP_009110593.1| PREDICTED: uncharacterized protein LOC103836116 [Brassica rapa]
Length=45

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SSRGLG  L+EQRA+L+IIRRCVVMLLCW+D
Sbjct  12   RRVSSRGLGAVLKEQRAKLHIIRRCVVMLLCWND  45



>ref|XP_009794144.1| PREDICTED: uncharacterized protein LOC104240940 [Nicotiana sylvestris]
Length=47

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  622  ISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            ISSRGL G LR+QRARLYII+RCVVMLLCWHD
Sbjct  16   ISSRGLRGVLRQQRARLYIIKRCVVMLLCWHD  47



>ref|XP_009152117.1| PREDICTED: uncharacterized protein LOC103875355 [Brassica rapa]
Length=40

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 1/35 (3%)
 Frame = -1

Query  628  RRIS-SRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+S SRGLGG LREQRARLYII+RCVVMLLCW D
Sbjct  6    RRVSNSRGLGGVLREQRARLYIIKRCVVMLLCWQD  40



>ref|NP_850631.2| protein rotundifolia like 16 [Arabidopsis thaliana]
 ref|XP_009114116.1| PREDICTED: uncharacterized protein LOC103839365 [Brassica rapa]
 ref|XP_010502449.1| PREDICTED: uncharacterized protein LOC104779764 [Camelina sativa]
 ref|XP_010425222.1| PREDICTED: uncharacterized protein LOC104710338 [Camelina sativa]
 tpg|DAA02277.1| TPA_exp: DVL6 [Arabidopsis thaliana]
 gb|AEE77058.1| protein rotundifolia like 16 [Arabidopsis thaliana]
 gb|KFK35072.1| hypothetical protein AALP_AA5G231700 [Arabis alpina]
Length=40

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  619  SSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            SSRGLGG LREQRA+LYII+RCVVMLLCW D
Sbjct  10   SSRGLGGVLREQRAKLYIIKRCVVMLLCWQD  40



>ref|XP_008441687.1| PREDICTED: uncharacterized protein LOC103485763 [Cucumis melo]
Length=50

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -1

Query  619  SSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
             SRG GG LREQRA+LYIIRRCVVMLLCWHD
Sbjct  20   PSRGFGGVLREQRAKLYIIRRCVVMLLCWHD  50



>ref|XP_010514189.1| PREDICTED: uncharacterized protein LOC104790185 [Camelina sativa]
Length=40

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 1/35 (3%)
 Frame = -1

Query  628  RRIS-SRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+S SRGLGG LREQRA+LYII+RCVVMLLCW D
Sbjct  6    RRVSGSRGLGGVLREQRAKLYIIKRCVVMLLCWQD  40



>ref|XP_003614422.1| DVL5 [Medicago truncatula]
Length=61

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  619  SSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            S++G GG LREQRARLYIIRRCV+MLLCWH+
Sbjct  31   SNKGFGGVLREQRARLYIIRRCVIMLLCWHE  61



>ref|XP_009784211.1| PREDICTED: uncharacterized protein LOC104232654 [Nicotiana sylvestris]
Length=47

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +R+SSR LG  L+EQR RLYI+RRCVVMLLCWHD
Sbjct  14   KRMSSRKLGKFLKEQRGRLYIVRRCVVMLLCWHD  47



>ref|XP_010660503.1| PREDICTED: uncharacterized protein LOC100263434 [Vitis vinifera]
Length=49

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+SS  LGG LREQ+ RLYII RCVVMLLCWHD
Sbjct  16   RRLSSGKLGGFLREQKGRLYIISRCVVMLLCWHD  49



>ref|NP_001077795.1| protein ROTUNDIFOLIA like 15 [Arabidopsis thaliana]
 ref|NP_001154459.1| protein ROTUNDIFOLIA like 15 [Arabidopsis thaliana]
 gb|AAP13820.1| DVL5 [Arabidopsis thaliana]
 gb|AEE34844.1| protein ROTUNDIFOLIA like 15 [Arabidopsis thaliana]
 gb|AEE34845.1| protein ROTUNDIFOLIA like 15 [Arabidopsis thaliana]
Length=46

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            R++ SRG+GG +REQ+A+LYIIRRCVVMLLCWHD
Sbjct  13   RKMWSRGVGGVVREQKAKLYIIRRCVVMLLCWHD  46



>ref|XP_004490276.1| PREDICTED: uncharacterized protein LOC101490991 [Cicer arietinum]
Length=44

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 1/34 (3%)
 Frame = -1

Query  625  RISSR-GLGGALREQRARLYIIRRCVVMLLCWHD  527
            R+SS  GLGG LREQRARLYIIRRCVVMLLCWH+
Sbjct  11   RLSSNIGLGGVLREQRARLYIIRRCVVMLLCWHE  44



>ref|XP_009105433.1| PREDICTED: uncharacterized protein LOC103831294 [Brassica rapa]
 emb|CDY33590.1| BnaC06g29620D [Brassica napus]
Length=46

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            R++ SRG+GG +REQ+A+LYIIRRCVVMLLCWHD
Sbjct  13   RKMWSRGVGGVVREQKAKLYIIRRCVVMLLCWHD  46



>ref|XP_004492010.1| PREDICTED: uncharacterized protein LOC101507158 [Cicer arietinum]
Length=46

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +++S + LGG L+EQ+ RLYIIRRCVVMLLCWHD
Sbjct  13   KKVSCKKLGGYLKEQKGRLYIIRRCVVMLLCWHD  46



>ref|XP_010415515.1| PREDICTED: uncharacterized protein LOC104701516 [Camelina sativa]
Length=46

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            R++ SRG+GG +REQ+A+LYIIRRCVVMLLCWHD
Sbjct  13   RKMWSRGVGGVVREQKAKLYIIRRCVVMLLCWHD  46



>ref|XP_007139330.1| hypothetical protein PHAVU_008G020300g [Phaseolus vulgaris]
 gb|ESW11324.1| hypothetical protein PHAVU_008G020300g [Phaseolus vulgaris]
Length=85

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +++S R LGG L+EQ+ RLYIIRRCVVMLLCWHD
Sbjct  52   KKVSCRRLGGYLKEQKGRLYIIRRCVVMLLCWHD  85



>ref|XP_007033329.1| ROTUNDIFOLIA like 21 [Theobroma cacao]
 gb|EOY04255.1| ROTUNDIFOLIA like 21 [Theobroma cacao]
Length=48

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            ++IS R LGG +REQ+ RLYIIRRCVVMLLCWHD
Sbjct  15   KKISCRRLGGYIREQKGRLYIIRRCVVMLLCWHD  48



>ref|XP_006485757.1| PREDICTED: uncharacterized protein LOC102616705 [Citrus sinensis]
Length=46

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            R++S +G+GG L+EQR RLYIIRRC+V LLCWHD
Sbjct  13   RKLSCKGVGGFLKEQRGRLYIIRRCIVTLLCWHD  46



>ref|XP_010663564.1| PREDICTED: uncharacterized protein LOC100262942 [Vitis vinifera]
Length=49

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -1

Query  619  SSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            S +GLGG L+EQR RLYIIRRC++MLLCWHD
Sbjct  19   SCKGLGGFLKEQRGRLYIIRRCIIMLLCWHD  49



>ref|XP_010695825.1| PREDICTED: uncharacterized protein LOC104908402 [Beta vulgaris 
subsp. vulgaris]
Length=46

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            R+  +RGL G +REQRARLYIIRRCVVMLLCWH+
Sbjct  13   RKFLNRGLSGMVREQRARLYIIRRCVVMLLCWHE  46



>gb|EPS58953.1| hypothetical protein M569_15859 [Genlisea aurea]
Length=63

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 1/34 (3%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RRI+ RG GG LREQRARLYIIRRCVVMLLC+HD
Sbjct  31   RRIA-RGFGGVLREQRARLYIIRRCVVMLLCYHD  63



>ref|XP_006482297.1| PREDICTED: uncharacterized protein LOC102623751 [Citrus sinensis]
Length=39

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            ++IS   LGG L+EQ+ RLYIIRRCVVMLLCWHD
Sbjct  6    KKISCTKLGGYLKEQKGRLYIIRRCVVMLLCWHD  39



>ref|XP_011021202.1| PREDICTED: uncharacterized protein LOC105123349 [Populus euphratica]
Length=45

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            ++IS R LGG LR+Q+ RLYIIRRCVVMLLCWHD
Sbjct  12   KKISCRRLGGYLRQQKGRLYIIRRCVVMLLCWHD  45



>ref|XP_006585833.1| PREDICTED: uncharacterized protein LOC100793631 [Glycine max]
Length=44

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +++S R LGG L+EQ+ RLYIIRRCVVMLLCWHD
Sbjct  11   KKVSCRRLGGYLKEQKGRLYIIRRCVVMLLCWHD  44



>ref|XP_008341863.1| PREDICTED: uncharacterized protein LOC103404704 [Malus domestica]
Length=50

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  625  RISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            R+S R LGG LR+Q+ RLYIIRRCVVMLLCWHD
Sbjct  18   RVSCRRLGGYLRQQKGRLYIIRRCVVMLLCWHD  50



>ref|XP_009349278.1| PREDICTED: uncharacterized protein LOC103940822 [Pyrus x bretschneideri]
Length=50

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  625  RISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            R+S R LGG LR+Q+ RLYIIRRCVVMLLCWHD
Sbjct  18   RVSCRRLGGYLRQQKGRLYIIRRCVVMLLCWHD  50



>ref|XP_009620469.1| PREDICTED: uncharacterized protein LOC104112295 [Nicotiana tomentosiformis]
Length=47

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +R+SSR LG  L+EQR RLYI+RRCVVMLLCWHD
Sbjct  14   KRMSSRRLGKFLKEQRGRLYIMRRCVVMLLCWHD  47



>ref|XP_011004423.1| PREDICTED: uncharacterized protein LOC105110917 [Populus euphratica]
Length=47

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +++S R LGG LR+Q+ RLYIIRRCVVMLLCWHD
Sbjct  14   KKMSCRRLGGYLRQQKGRLYIIRRCVVMLLCWHD  47



>ref|XP_010317140.1| PREDICTED: uncharacterized protein LOC104645948 [Solanum lycopersicum]
Length=50

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +++SSR LG  L+EQR RLYI+RRCVVMLLCWHD
Sbjct  17   KKMSSRRLGKFLKEQRGRLYIMRRCVVMLLCWHD  50



>ref|XP_006344831.1| PREDICTED: uncharacterized protein LOC102601800 [Solanum tuberosum]
Length=50

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +++SSR LG  L+EQR RLYI+RRCVVMLLCWHD
Sbjct  17   KKMSSRRLGKFLKEQRGRLYIMRRCVVMLLCWHD  50



>gb|ABK93760.1| unknown [Populus trichocarpa]
Length=47

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            ++IS R LGG LR+Q+ RLYIIRRCVVML+CWHD
Sbjct  14   KKISCRRLGGYLRQQKGRLYIIRRCVVMLVCWHD  47



>ref|XP_006384216.1| hypothetical protein POPTR_0004s10280g [Populus trichocarpa]
 gb|ERP62013.1| hypothetical protein POPTR_0004s10280g [Populus trichocarpa]
Length=120

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +++S R LGG LR+Q+ RLYIIRRCVVMLLCWHD
Sbjct  87   KKMSCRRLGGYLRQQKGRLYIIRRCVVMLLCWHD  120



>gb|KFK41318.1| hypothetical protein AALP_AA2G114500 [Arabis alpina]
Length=46

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            R++ SR +GG +REQ+A+LYIIRRCVVMLLCWHD
Sbjct  13   RKMWSRAVGGVVREQKAKLYIIRRCVVMLLCWHD  46



>gb|KHN17965.1| hypothetical protein glysoja_035051 [Glycine soja]
Length=42

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLL  539
            RR+SSRGLGGALR+QRARLYIIRRCVVMLL
Sbjct  13   RRLSSRGLGGALRQQRARLYIIRRCVVMLL  42



>ref|XP_011099284.1| PREDICTED: uncharacterized protein LOC105177738 [Sesamum indicum]
Length=50

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +R+SSR LG  L+EQR RLYI+RRCVVMLLCWHD
Sbjct  17   KRLSSRRLGRFLKEQRGRLYIMRRCVVMLLCWHD  50



>ref|XP_011077282.1| PREDICTED: uncharacterized protein LOC105161330 [Sesamum indicum]
Length=46

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -1

Query  610  GLGGALREQRARLYIIRRCVVMLLCWHD  527
            GLGG LREQRARLYIIRRCVVMLLC+HD
Sbjct  19   GLGGVLREQRARLYIIRRCVVMLLCYHD  46



>ref|XP_008230382.1| PREDICTED: uncharacterized protein LOC103329662 [Prunus mume]
Length=119

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  625  RISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            R+S R LGG LR+Q+ RLYIIRRCVVMLLCWHD
Sbjct  87   RVSCRRLGGYLRQQKGRLYIIRRCVVMLLCWHD  119



>ref|XP_010032613.1| PREDICTED: uncharacterized protein LOC104422085 [Eucalyptus grandis]
Length=53

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  625  RISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            + S R LGG L+EQ++R+YIIRRCVVMLLCWHD
Sbjct  21   KASCRRLGGYLKEQKSRIYIIRRCVVMLLCWHD  53



>gb|KHN13813.1| hypothetical protein glysoja_016097, partial [Glycine soja]
Length=119

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +++  R LGG L+EQ+ RLYIIRRCVVMLLCWHD
Sbjct  86   KKVLCRRLGGCLKEQKGRLYIIRRCVVMLLCWHD  119



>ref|XP_010316187.1| PREDICTED: uncharacterized protein LOC104645697 [Solanum lycopersicum]
Length=48

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RRI S  LG  L+EQR RLYI+RRCVVMLLCWHD
Sbjct  15   RRICSGKLGRFLKEQRGRLYIVRRCVVMLLCWHD  48



>ref|XP_003520041.1| PREDICTED: uncharacterized protein LOC100806978 [Glycine max]
Length=69

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +++S R LGG L+EQ+ RLYIIRRCVVMLL WHD
Sbjct  6    KKVSCRRLGGNLKEQKGRLYIIRRCVVMLLYWHD  39



>ref|XP_009418440.1| PREDICTED: uncharacterized protein LOC103998642 [Musa acuminata 
subsp. malaccensis]
Length=42

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -1

Query  610  GLGGALREQRARLYIIRRCVVMLLCWHD  527
            GL  ALREQ+ARLYIIRRCVVMLLCWHD
Sbjct  15   GLSRALREQKARLYIIRRCVVMLLCWHD  42



>ref|XP_006602998.1| PREDICTED: uncharacterized protein LOC100804662 [Glycine max]
Length=122

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +++  R LGG L+EQ+ RLYIIRRCVVMLLCWHD
Sbjct  89   KKLLCRRLGGYLKEQKGRLYIIRRCVVMLLCWHD  122



>ref|XP_010470844.1| PREDICTED: uncharacterized protein LOC104750702 [Camelina sativa]
Length=46

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            R++ SRG+ G +REQ+A+LYIIRRCVVMLLCWHD
Sbjct  13   RKMWSRGVRGVVREQKAKLYIIRRCVVMLLCWHD  46



>ref|XP_010061863.1| PREDICTED: uncharacterized protein LOC104449413 [Eucalyptus grandis]
Length=51

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            RR+S   L G L+EQ+ RLYIIRRCVVMLLCWHD
Sbjct  18   RRLSCTRLKGHLKEQKGRLYIIRRCVVMLLCWHD  51



>ref|XP_007046310.1| Serine/threonine-protein kinase STN7 [Theobroma cacao]
 gb|EOY02142.1| Serine/threonine-protein kinase STN7 [Theobroma cacao]
Length=656

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = -3

Query  683  ITTKHEDDGQQW*HGSLQKKDFQQRARRSPKRTKG*ALHHQEMCGHAPMLA  531
            IT+K ED  +Q   GSL++K  +QRA RSP+  KG ALH++EMCG+AP+LA
Sbjct  608  ITSKDED--EQCHRGSLKEKAIKQRAWRSPQGAKGKALHNKEMCGYAPLLA  656



>ref|XP_006400132.1| hypothetical protein EUTSA_v10015386mg, partial [Eutrema salsugineum]
 gb|ESQ41585.1| hypothetical protein EUTSA_v10015386mg, partial [Eutrema salsugineum]
Length=66

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +R  SR LG  ++EQ+ R+YIIRRCVVMLLCWHD
Sbjct  33   KRSLSRRLGKYMKEQKGRIYIIRRCVVMLLCWHD  66



>ref|XP_009409906.1| PREDICTED: uncharacterized protein LOC103992053 [Musa acuminata 
subsp. malaccensis]
Length=44

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 1/34 (3%)
 Frame = -1

Query  625  RISSRG-LGGALREQRARLYIIRRCVVMLLCWHD  527
            R+S RG L   LREQ+A+LYIIRRC+VMLLCWHD
Sbjct  11   RVSQRGGLSRMLREQKAKLYIIRRCIVMLLCWHD  44



>ref|NP_001077782.1| ROTUNDIFOLIA like 21 protein [Arabidopsis thaliana]
 gb|AAP13818.1| DVL3 [Arabidopsis thaliana]
 gb|AEE34619.1| ROTUNDIFOLIA like 21 protein [Arabidopsis thaliana]
Length=40

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  616  SRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            ++ LGG L+EQ+ RLYIIRRCVVML+CWHD
Sbjct  11   NKKLGGYLKEQKGRLYIIRRCVVMLICWHD  40



>gb|ACG41949.1| hypothetical protein [Zea mays]
Length=41

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +R   RG G AL+EQRARLYII+RCVVMLL WHD
Sbjct  8    QRRRQRGFGKALKEQRARLYIIQRCVVMLLRWHD  41



>ref|XP_004968856.1| PREDICTED: uncharacterized protein LOC101776509 [Setaria italica]
Length=39

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  616  SRGLGGALREQRARLYIIRRCVVMLLCWHD  527
             RG G AL+EQRARLYII+RCVVMLL WHD
Sbjct  10   QRGFGKALKEQRARLYIIQRCVVMLLRWHD  39



>gb|ACG39256.1| hypothetical protein [Zea mays]
Length=40

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  616  SRGLGGALREQRARLYIIRRCVVMLLCWHD  527
             RG G AL+EQRARLYII+RCVVMLL WHD
Sbjct  11   QRGFGKALKEQRARLYIIQRCVVMLLRWHD  40



>ref|XP_009121526.1| PREDICTED: uncharacterized protein LOC103846365 [Brassica rapa]
Length=50

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +R  SR LG  ++EQ+ R+YIIRRCVVMLLCWHD
Sbjct  17   KRSISRRLGKYMKEQKGRVYIIRRCVVMLLCWHD  50



>ref|XP_008786558.1| PREDICTED: uncharacterized protein LOC103704860 [Phoenix dactylifera]
Length=45

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = -1

Query  598  ALREQRARLYIIRRCVVMLLCWHD  527
            ALREQ+ARLYIIRRCVVMLLCWHD
Sbjct  22   ALREQKARLYIIRRCVVMLLCWHD  45



>ref|XP_009105265.1| PREDICTED: uncharacterized protein LOC103831158 [Brassica rapa]
Length=40

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  616  SRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            S+ LGG LREQ+ RLYIIRRCVVML+CW D
Sbjct  11   SKKLGGYLREQKGRLYIIRRCVVMLICWSD  40



>ref|XP_008461574.1| PREDICTED: uncharacterized protein LOC103500144 [Cucumis melo]
Length=54

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -1

Query  619  SSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            S   LGG +REQ+ RLYIIR C+VMLLCWHD
Sbjct  24   SRSSLGGYIREQKGRLYIIRSCIVMLLCWHD  54



>ref|XP_010692497.1| PREDICTED: uncharacterized protein LOC104905605 [Beta vulgaris 
subsp. vulgaris]
Length=45

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +R+SSR LG  L EQR RLYIIRRC+VMLLC HD
Sbjct  12   KRMSSRRLGRFLSEQRGRLYIIRRCIVMLLCSHD  45



>ref|XP_008791239.1| PREDICTED: uncharacterized protein LOC103708195 [Phoenix dactylifera]
Length=45

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = -1

Query  598  ALREQRARLYIIRRCVVMLLCWHD  527
            A+REQ+ARLYIIRRCVVMLLCWHD
Sbjct  22   AMREQKARLYIIRRCVVMLLCWHD  45



>ref|XP_008367022.1| PREDICTED: uncharacterized protein LOC103430650 [Malus domestica]
Length=50

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = -1

Query  595  LREQRARLYIIRRCVVMLLCWHD  527
            LREQRARLYIIRRCVVMLLCWHD
Sbjct  28   LREQRARLYIIRRCVVMLLCWHD  50



>gb|ABD96875.1| DVL protein [Cleome spinosa]
Length=43

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -1

Query  616  SRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            SR LG  LREQ+ R+YII RCVVMLLCWHD
Sbjct  14   SRRLGKYLREQKGRIYIISRCVVMLLCWHD  43



>ref|XP_004968854.1| PREDICTED: uncharacterized protein LOC101775702 [Setaria italica]
Length=38

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -1

Query  619  SSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            S  GL   +RE +ARLYIIRRCVVMLLCWHD
Sbjct  8    SGGGLSKVVREHKARLYIIRRCVVMLLCWHD  38



>ref|XP_008361738.1| PREDICTED: uncharacterized protein LOC103425437 [Malus domestica]
 ref|XP_009356229.1| PREDICTED: uncharacterized protein LOC103947094 [Pyrus x bretschneideri]
Length=50

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = -1

Query  595  LREQRARLYIIRRCVVMLLCWHD  527
            LREQRARLYIIRRCVVMLLCWHD
Sbjct  28   LREQRARLYIIRRCVVMLLCWHD  50



>ref|XP_009357032.1| PREDICTED: uncharacterized protein LOC103947798 [Pyrus x bretschneideri]
Length=50

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  622  ISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +S + LG  LR+Q+ RLYIIRRCV+MLLCWHD
Sbjct  19   VSCKRLGRYLRQQKGRLYIIRRCVIMLLCWHD  50



>ref|XP_011085549.1| PREDICTED: uncharacterized protein LOC105167491 [Sesamum indicum]
Length=46

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -1

Query  625  RISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            R+SSR +G  L+EQ+ RLYI+RRCV+MLLCW D
Sbjct  14   RLSSRRVGRFLKEQKGRLYILRRCVLMLLCWQD  46



>ref|XP_003577968.1| PREDICTED: uncharacterized protein LOC100841681 [Brachypodium 
distachyon]
Length=39

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  613  RGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +GL  AL+EQ+ARLYIIRRCV MLL WHD
Sbjct  11   KGLKRALKEQKARLYIIRRCVAMLLSWHD  39



>ref|XP_009131515.1| PREDICTED: uncharacterized protein LOC103856177 [Brassica rapa]
Length=50

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  613  RGLGGALREQRARLYIIRRCVVMLLCWHD  527
            R LG  ++EQ+ R+YIIRRCVVMLLCWHD
Sbjct  22   RRLGKHIKEQKGRIYIIRRCVVMLLCWHD  50



>ref|XP_009623676.1| PREDICTED: uncharacterized protein LOC104114844 [Nicotiana tomentosiformis]
Length=49

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -1

Query  607  LGGALREQRARLYIIRRCVVMLLCWHD  527
            LG  L+EQR RLYI+RRCVVMLLCWHD
Sbjct  23   LGRFLKEQRGRLYIVRRCVVMLLCWHD  49



>ref|XP_009336624.1| PREDICTED: uncharacterized protein LOC103929192 [Pyrus x bretschneideri]
Length=50

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = -1

Query  595  LREQRARLYIIRRCVVMLLCWHD  527
            LR+QRARLYIIRRCVVMLLCWHD
Sbjct  28   LRQQRARLYIIRRCVVMLLCWHD  50



>gb|ABD96922.1| hypothetical protein [Cleome spinosa]
Length=44

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  616  SRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            SR LG  +REQ+ R+YIIR CV MLLCWHD
Sbjct  15   SRRLGKYMREQKGRIYIIRSCVAMLLCWHD  44



>ref|XP_006346874.1| PREDICTED: uncharacterized protein LOC102588676 [Solanum tuberosum]
Length=47

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            + ISS  LG  L+EQR RLYI+RRC+++L+CWHD
Sbjct  14   KSISSGKLGRFLKEQRGRLYIMRRCIIILICWHD  47



>dbj|BAD36506.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ08535.1| hypothetical protein OsI_30805 [Oryza sativa Indica Group]
 gb|EAZ44161.1| hypothetical protein OsJ_28783 [Oryza sativa Japonica Group]
Length=96

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -1

Query  607  LGGALREQRARLYIIRRCVVMLLCWHD  527
            L   LREQ+ARLYIIRRCVVMLLCW D
Sbjct  70   LQNVLREQKARLYIIRRCVVMLLCWSD  96



>gb|ACG26308.1| hypothetical protein [Zea mays]
Length=39

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -1

Query  607  LGGALREQRARLYIIRRCVVMLLCWHD  527
            +G AL+ QR RLYIIRRC+VMLLCWHD
Sbjct  13   VGRALKGQRGRLYIIRRCIVMLLCWHD  39



>ref|XP_002873751.1| hypothetical protein ARALYDRAFT_909580 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50010.1| hypothetical protein ARALYDRAFT_909580 [Arabidopsis lyrata subsp. 
lyrata]
Length=51

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +R  SR LG  ++EQ+ R+YIIRRCVVMLLC HD
Sbjct  18   KRSISRRLGKYMKEQKGRIYIIRRCVVMLLCSHD  51



>ref|XP_004956523.1| PREDICTED: uncharacterized protein LOC101762634 [Setaria italica]
Length=39

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -1

Query  598  ALREQRARLYIIRRCVVMLLCWHD  527
            AL+E RAR+YIIRRC+VMLLCWHD
Sbjct  16   ALKEHRARVYIIRRCIVMLLCWHD  39



>ref|NP_001078094.1| protein rotundifolia like 19 [Arabidopsis thaliana]
 gb|AAP13817.1| DVL2 [Arabidopsis thaliana]
 gb|AEE73818.1| protein rotundifolia like 19 [Arabidopsis thaliana]
Length=45

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            ++  SR LG  L+EQ+ R+YIIRRCV+MLLC HD
Sbjct  12   KKSQSRRLGKYLKEQKGRIYIIRRCVMMLLCSHD  45



>ref|XP_008380323.1| PREDICTED: uncharacterized protein LOC103443281 [Malus domestica]
Length=47

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -1

Query  601  GALREQRARLYIIRRCVVMLLCWHD  527
            G LR+Q+ RLYIIRRCV+MLLCWHD
Sbjct  23   GYLRQQKGRLYIIRRCVIMLLCWHD  47



>ref|XP_010238041.1| PREDICTED: uncharacterized protein LOC100842284 [Brachypodium 
distachyon]
Length=39

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -1

Query  598  ALREQRARLYIIRRCVVMLLCWHD  527
            AL+E R+RLYIIRRC+VMLLCWHD
Sbjct  16   ALKEHRSRLYIIRRCIVMLLCWHD  39



>ref|XP_004956522.1| PREDICTED: uncharacterized protein LOC101762237 [Setaria italica]
Length=39

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -1

Query  598  ALREQRARLYIIRRCVVMLLCWHD  527
             LREQ+ARLYIIRRCVVMLLCW D
Sbjct  16   VLREQKARLYIIRRCVVMLLCWSD  39



>ref|NP_001175756.1| Os09g0306500 [Oryza sativa Japonica Group]
 dbj|BAH94484.1| Os09g0306500 [Oryza sativa Japonica Group]
Length=39

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  613  RGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +GL  AL+EQ+ARLYIIRRCV ML+ WHD
Sbjct  11   KGLKRALKEQKARLYIIRRCVAMLIRWHD  39



>ref|XP_002462161.1| hypothetical protein SORBIDRAFT_02g020768 [Sorghum bicolor]
 gb|EER98682.1| hypothetical protein SORBIDRAFT_02g020768 [Sorghum bicolor]
Length=69

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = -1

Query  595  LREQRARLYIIRRCVVMLLCWHD  527
            LREQ+ARLYIIRRCVVMLLCW D
Sbjct  47   LREQKARLYIIRRCVVMLLCWSD  69



>ref|XP_009799695.1| PREDICTED: uncharacterized protein LOC104245734 [Nicotiana sylvestris]
Length=46

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            ++ S + +   ++EQ+ RL+IIRRC+VMLLCWHD
Sbjct  13   KKFSCKSVREYIKEQKGRLFIIRRCIVMLLCWHD  46



>ref|XP_004503578.1| PREDICTED: uncharacterized protein LOC101512326 [Cicer arietinum]
Length=43

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/26 (69%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = -1

Query  604  GGALREQRARLYIIRRCVVMLLCWHD  527
            G  L+E+RA+ YIIRRC+VMLLCW D
Sbjct  14   GRVLKEKRAKFYIIRRCIVMLLCWKD  39



>gb|ACY95284.1| unknown [Zea mays]
Length=41

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -1

Query  607  LGGALREQRARLYIIRRCVVMLLCWHD  527
            L   LREQ+ARLYIIRRCVVMLLCW D
Sbjct  15   LQRVLREQKARLYIIRRCVVMLLCWSD  41



>gb|ACG49134.1| hypothetical protein [Zea mays]
Length=44

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -1

Query  607  LGGALREQRARLYIIRRCVVMLLCWHD  527
            L   LREQ+ARLYIIRRCVVMLLCW D
Sbjct  18   LQRVLREQKARLYIIRRCVVMLLCWSD  44



>ref|XP_009357749.1| PREDICTED: uncharacterized protein LOC103948440 [Pyrus x bretschneideri]
Length=99

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -1

Query  616  SRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            SR     ++EQRAR YI+RRCV ML+CWHD
Sbjct  66   SRKCARLVKEQRARFYIMRRCVTMLICWHD  95



>ref|NP_001078592.1| protein rotundifolia like 18 [Arabidopsis thaliana]
 gb|AAP13816.1| DVL1 [Arabidopsis thaliana]
 gb|AED92236.1| protein rotundifolia like 18 [Arabidopsis thaliana]
Length=51

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLLCWHD  527
            +R  SR LG  ++EQ+ R+YIIRRC+VMLLC HD
Sbjct  18   KRSISRRLGKYMKEQKGRIYIIRRCMVMLLCSHD  51



>gb|KGN52048.1| hypothetical protein Csa_5G608360 [Cucumis sativus]
Length=49

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  628  RRISSRGLGGALREQRARLYIIRRCVVMLL  539
            RR SSRGLGG +R+QRARLYIIRRCV++ +
Sbjct  15   RRGSSRGLGGVVRQQRARLYIIRRCVIIFV  44



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1321621760038