BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17707_g1_i1 len=2395 path=[87:0-1934 86:1935-2394]

Length=2395
                                                                      Score     E

ref|XP_010323643.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    569   0.0      
ref|XP_009603849.1|  PREDICTED: ATP-dependent DNA helicase PIF1 {...    568   0.0      
ref|XP_009766209.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    566   0.0      
ref|XP_008229389.1|  PREDICTED: ATP-dependent DNA helicase PIF1         511   2e-169   
emb|CDP18728.1|  unnamed protein product                                508   3e-168   
ref|XP_007216310.1|  hypothetical protein PRUPE_ppa019701mg             509   5e-168   
ref|XP_011082948.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    501   2e-165   
ref|XP_008342384.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    501   2e-165   
ref|XP_007048817.1|  DNA repair and recombination protein pif1, p...    492   2e-162   
ref|XP_004306279.1|  PREDICTED: DNA repair and recombination prot...    491   3e-161   
ref|XP_010275115.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    488   8e-160   
ref|XP_010035891.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    486   9e-160   
ref|XP_010275116.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    486   1e-159   
ref|XP_002520397.1|  conserved hypothetical protein                     483   2e-158   Ricinus communis
ref|XP_011011003.1|  PREDICTED: ATP-dependent DNA helicase PIF1-l...    476   5e-156   
ref|XP_006380622.1|  hypothetical protein POPTR_0007s09900g             477   9e-156   
gb|KHM99615.1|  ATP-dependent DNA helicase PIF1                         473   2e-154   
ref|XP_006586570.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    472   4e-154   
ref|XP_010695976.1|  PREDICTED: ATP-dependent DNA helicase pfh1-like    471   4e-154   
ref|XP_011011004.1|  PREDICTED: ATP-dependent DNA helicase PIF1-l...    462   3e-151   
ref|XP_009378368.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    443   5e-142   
gb|KCW47396.1|  hypothetical protein EUGRSUZ_K01193                     382   9e-122   
ref|XP_002975258.1|  hypothetical protein SELMODRAFT_451567             374   1e-115   
ref|XP_002987435.1|  hypothetical protein SELMODRAFT_451566             374   1e-115   
ref|XP_002795884.1|  DNA repair and recombination protein pif1          322   9e-94    Paracoccidioides lutzii Pb01
gb|EKC25648.1|  ATP-dependent DNA helicase PIF1                         317   2e-93    
gb|EEQ89934.1|  DNA repair and recombination protein pif1               321   2e-93    Blastomyces dermatitidis ER-3
gb|EEH15751.1|  hypothetical protein PABG_05838                         321   3e-93    Paracoccidioides brasiliensis Pb03
ref|XP_010762136.1|  hypothetical protein PADG_06911                    321   3e-93    
emb|CDS10156.1|  hypothetical protein LRAMOSA02833                      318   1e-92    
ref|XP_002621288.1|  mitochondrial DNA helicase                         320   2e-92    Blastomyces gilchristii SLH14081
ref|XP_001215348.1|  DNA repair and recombination protein pif1, m...    315   5e-92    Aspergillus terreus NIH2624
ref|XP_009351018.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    313   5e-92    
ref|XP_001542316.1|  predicted protein                                  316   2e-91    Histoplasma capsulatum NAm1
gb|EEH09926.1|  DNA repair and recombination protein pif1               315   3e-91    Histoplasma capsulatum G186AR
gb|EER38765.1|  DNA repair and recombination protein pif1               315   5e-91    Histoplasma capsulatum H143
gb|EKG20445.1|  ATPase AAA+ type core                                   316   9e-91    
ref|XP_007585738.1|  putative mitochondrial dna helicase protein        312   9e-91    
emb|CCE34435.1|  related to PIF1 protein precursor                      313   3e-90    
dbj|GAM19367.1|  hypothetical protein SAMD00019534_025420               308   4e-90    
gb|KFH41258.1|  ATP-dependent DNA helicase-like protein                 312   6e-90    
emb|CDI53590.1|  related to PIF1-DNA helicase involved in mitocho...    310   6e-90    
ref|XP_003170448.1|  DNA repair and recombination protein PIF1          311   1e-89    
gb|EAS28483.2|  mitochondrial DNA helicase                              310   1e-89    
gb|EFW19538.1|  mitochondrial DNA helicase                              310   1e-89    
ref|XP_007879576.1|  hypothetical protein PFL1_03862                    308   2e-89    
ref|XP_753317.1|  mitochondrial DNA helicase (Pif1)                     311   2e-89    Aspergillus fumigatus Af293
gb|KEY77892.1|  mitochondrial DNA helicase Pif1                         311   2e-89    
gb|EDP52074.1|  mitochondrial DNA helicase (Pif1), putative             311   2e-89    Aspergillus fumigatus A1163
emb|CDO73329.1|  hypothetical protein BN946_scf185008.g92               306   2e-89    
ref|XP_002381272.1|  pif1p DNA helicase, putative                       308   3e-89    Aspergillus flavus NRRL3357
gb|EST05467.1|  hypothetical protein PSEUBRA_SCAF5g02311                308   5e-89    
ref|XP_003231028.1|  mitochondrial DNA helicase                         308   6e-89    
gb|EIE76854.1|  hypothetical protein RO3G_01558                         305   6e-89    
ref|XP_007885247.1|  PREDICTED: ATP-dependent DNA helicase PIF1         305   7e-89    
ref|XP_001824182.2|  DNA helicase PIF1                                  308   9e-89    Aspergillus oryzae RIB40
ref|XP_004343985.1|  zinc knuckle domain containing protein             305   1e-88    
ref|XP_003067291.1|  DNA repair and recombination protein pif1, m...    308   1e-88    
ref|XP_004185858.1|  hypothetical protein EIN_034430                    303   2e-88    
ref|XP_005099261.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    305   2e-88    
ref|XP_001274616.1|  mitochondrial DNA helicase (Pif1), putative        306   3e-88    Aspergillus clavatus NRRL 1
gb|KGO67613.1|  DNA helicase PIF1, ATP-dependent                        305   3e-88    
emb|CCF52961.1|  related to PIF1-DNA helicase involved in mitocho...    305   3e-88    
ref|XP_002340265.1|  mitochondrial DNA helicase (Pif1), putative        307   5e-88    Talaromyces stipitatus ATCC 10500
gb|KGO41533.1|  DNA helicase PIF1, ATP-dependent                        305   5e-88    
ref|XP_001800727.1|  hypothetical protein SNOG_10457                    305   7e-88    Parastagonospora nodorum SN15
dbj|GAD93197.1|  mitochondrial DNA helicase                             307   8e-88    
gb|KDB17913.1|  putative mitochondrial DNA helicase (Pif1)              308   9e-88    
ref|XP_758865.1|  hypothetical protein UM02718.1                        304   9e-88    Ustilago maydis 521
dbj|GAC93473.1|  hypothetical protein PHSY_001038                       304   9e-88    
ref|XP_001259348.1|  mitochondrial DNA helicase (Pif1), putative        305   1e-87    Aspergillus fischeri NRRL 181
ref|XP_956692.2|  hypothetical protein NCU00428                         308   1e-87    Neurospora crassa OR74A
dbj|GAM34605.1|  Pif1 helicase homolog                                  304   1e-87    
gb|EGE04343.1|  helicase                                                305   2e-87    
gb|KHO00718.1|  DNA helicase PIF1, ATP-dependent                        305   2e-87    
emb|CCL98608.1|  predicted protein                                      300   2e-87    
gb|KFG82116.1|  putative mitochondrial DNA helicase (Pif1)              305   2e-87    
ref|XP_002567410.1|  Pc21g03460                                         304   2e-87    Penicillium rubens Wisconsin 54-1255
gb|EKV05656.1|  Mitochondrial DNA helicase (Pif1), putative             303   3e-87    
ref|XP_010581033.1|  PREDICTED: ATP-dependent DNA helicase PIF1         296   3e-87    
ref|XP_001401106.1|  DNA helicase PIF1                                  305   4e-87    Aspergillus niger CBS 513.88
emb|CEJ94933.1|  Putative Dna helicase involved in rdna replicati...    305   5e-87    
gb|KID69626.1|  DNA helicase PIF1, ATP-dependent                        305   5e-87    
dbj|GAA90741.1|  mitochondrial DNA helicase                             303   5e-87    
gb|KID73235.1|  DNA helicase PIF1, ATP-dependent                        305   5e-87    
ref|XP_009153217.1|  hypothetical protein HMPREF1120_00965              304   5e-87    
ref|XP_007479627.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    300   8e-87    
ref|XP_007819664.1|  mitochondrial DNA helicase (Pif1), putative        304   9e-87    
emb|CBQ73114.1|  related to PIF1-DNA helicase involved in mitocho...    301   1e-86    
ref|XP_006634847.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    299   1e-86    
ref|XP_006693124.1|  DNA helicase-like protein                          303   2e-86    
ref|XP_785439.2|  PREDICTED: ATP-dependent DNA helicase PIF1-like       297   2e-86    Strongylocentrotus purpuratus [purple urchin]
gb|EXV03405.1|  PIF1-like helicase                                      304   2e-86    
ref|XP_642006.1|  DNA helicase                                          299   3e-86    Dictyostelium discoideum AX4
dbj|GAC71727.1|  DNA helicase PIF1/RRM3                                 299   4e-86    
ref|XP_655065.2|  hypothetical protein                                  303   4e-86    Entamoeba histolytica HM-1:IMSS
gb|KEY67206.1|  hypothetical protein S7711_03065                        301   5e-86    
ref|XP_005050364.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    291   5e-86    
gb|AAI70996.1|  PIF1 5'-to-3' DNA helicase homolog                      297   5e-86    Xenopus tropicalis [western clawed frog]
ref|XP_007310558.1|  hypothetical protein STEHIDRAFT_172690             297   5e-86    
ref|XP_008855707.1|  DNA repair and recombination protein, putative     302   5e-86    
ref|NP_001016603.1|  PIF1 5'-to-3' DNA helicase                         297   6e-86    Xenopus tropicalis [western clawed frog]
gb|KFA46747.1|  hypothetical protein S40293_08114                       301   6e-86    
ref|XP_006015915.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    291   6e-86    
ref|XP_003021736.1|  hypothetical protein TRV_04153                     301   7e-86    
ref|NP_001089530.1|  ATP-dependent DNA helicase PIF1                    297   7e-86    Xenopus laevis [clawed frog]
sp|Q0R4F1.1|PIF1_XENLA  RecName: Full=ATP-dependent DNA helicase ...    297   7e-86    Xenopus laevis [clawed frog]
gb|ELQ39072.1|  DNA repair and recombination protein pif1               301   7e-86    
ref|XP_001239749.1|  hypothetical protein CIMG_09370                    309   8e-86    Coccidioides immitis RS
ref|XP_003975778.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    296   9e-86    
ref|XP_009557237.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    291   9e-86    
ref|XP_002145112.1|  mitochondrial DNA helicase (Pif1), putative        301   1e-85    Talaromyces marneffei ATCC 18224
gb|KFA67465.1|  hypothetical protein S40285_00167                       301   1e-85    
ref|XP_003304276.1|  hypothetical protein PTT_16808                     300   1e-85    
gb|KGQ08685.1|  DNA repair and recombination protein pif1               300   1e-85    
ref|XP_007802685.1|  hypothetical protein EPUS_00465                    299   1e-85    
ref|XP_003712758.1|  hypothetical protein MGG_05212                     301   1e-85    
gb|ETS64711.1|  hypothetical protein PaG_00662                          298   1e-85    
ref|XP_003010636.1|  hypothetical protein ARB_03337                     300   2e-85    
gb|KFX51282.1|  ATP-dependent DNA helicase PIF1                         301   2e-85    
ref|XP_008595207.1|  DNA repair and recombination protein pif1          300   2e-85    
ref|XP_009086872.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    295   2e-85    
ref|XP_004914012.1|  PREDICTED: ATP-dependent DNA helicase PIF1-l...    298   2e-85    
gb|EZF27942.1|  hypothetical protein H100_00186                         299   2e-85    
gb|EZF78843.1|  hypothetical protein H105_00178                         299   2e-85    
ref|XP_010714634.1|  PREDICTED: ATP-dependent DNA helicase PIF1         291   2e-85    
dbj|GAK64353.1|  mitochondrial DNA helicase                             300   2e-85    
ref|XP_005521110.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    295   3e-85    
ref|XP_001940398.1|  DNA repair and recombination protein pif1, m...    299   3e-85    Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_001738818.1|  hypothetical protein                               301   3e-85    Entamoeba dispar SAW760
ref|XP_004914011.1|  PREDICTED: ATP-dependent DNA helicase PIF1-l...    297   3e-85    
ref|XP_007808889.1|  mitochondrial DNA helicase (Pif1), putative        301   3e-85    
ref|XP_001732078.1|  hypothetical protein MGL_0671                      293   4e-85    Malassezia globosa CBS 7966
ref|XP_007913123.1|  putative dna repair and recombination protei...    300   4e-85    
ref|XP_003348845.1|  hypothetical protein SMAC_01868                    301   4e-85    
ref|XP_006261800.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    290   4e-85    
ref|XP_426648.3|  PREDICTED: ATP-dependent DNA helicase PIF1            294   5e-85    Gallus gallus [bantam]
ref|XP_005802399.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    295   5e-85    
ref|XP_010407772.1|  PREDICTED: ATP-dependent DNA helicase PIF1         288   6e-85    
ref|XP_003755701.1|  PREDICTED: ATP-dependent DNA helicase PIF1         295   6e-85    
ref|XP_008730403.1|  hypothetical protein G647_07869                    298   6e-85    
ref|XP_004359275.1|  hypothetical protein DFA_01309                     306   8e-85    
ref|XP_009217019.1|  hypothetical protein GGTG_00999                    298   1e-84    
ref|XP_007061589.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    291   1e-84    
emb|CDM31007.1|  Probable transposable element                          297   1e-84    
gb|ENH78649.1|  mitochondrial dna helicase                              298   1e-84    
gb|EXX73392.1|  Rrm3p                                                   293   2e-84    
ref|XP_005307201.1|  PREDICTED: ATP-dependent DNA helicase PIF1         293   2e-84    
dbj|GAM21820.1|  hypothetical protein SAMD00019534_049950               290   3e-84    
sp|Q5AXT5.2|PIF1_EMENI  RecName: Full=ATP-dependent DNA helicase ...    295   3e-84    Aspergillus nidulans
ref|XP_007235511.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    293   3e-84    
ref|XP_005482376.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    291   4e-84    
ref|XP_007842811.1|  mitochondrial dna helicase                         292   4e-84    
emb|CEG05554.1|  unnamed protein product                                296   5e-84    
ref|XP_010892114.1|  PREDICTED: ATP-dependent DNA helicase PIF1         293   5e-84    
ref|XP_004078945.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    292   5e-84    
ref|XP_003438064.1|  PREDICTED: ATP-dependent DNA helicase PIF1-l...    291   7e-84    
ref|XP_008275686.1|  PREDICTED: ATP-dependent DNA helicase PIF1         291   8e-84    
ref|NP_942102.1|  ATP-dependent DNA helicase PIF1                       291   1e-83    Danio rerio [leopard danio]
emb|CAQ52798.1|  pif1 protein                                           291   1e-83    Dicentrarchus labrax [European sea bass]
emb|CCA69121.1|  related to PIF1-DNA helicase involved in mitocho...    291   1e-83    
ref|XP_005476110.1|  PREDICTED: ATP-dependent DNA helicase PIF1-l...    291   1e-83    
ref|XP_001908006.1|  hypothetical protein                               295   1e-83    Podospora anserina S mat+
ref|XP_008431609.1|  PREDICTED: ATP-dependent DNA helicase PIF1         291   1e-83    
emb|CDP32149.1|  Putative DNA repair and recombination protein PI...    295   2e-83    
gb|EPS32376.1|  hypothetical protein PDE_07336                          293   2e-83    
gb|KDN66508.1|  putative DNA repair and recombination protein pif1      295   2e-83    
ref|XP_001595251.1|  hypothetical protein SS1G_03340                    296   2e-83    Sclerotinia sclerotiorum 1980 UF-70
ref|XP_005151302.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    289   3e-83    
ref|XP_009828150.1|  hypothetical protein H257_05105                    289   3e-83    
ref|XP_002188590.2|  PREDICTED: ATP-dependent DNA helicase PIF1-like    292   4e-83    Taeniopygia guttata
ref|XP_004466702.1|  PREDICTED: ATP-dependent DNA helicase PIF1         290   4e-83    
ref|XP_004570630.1|  PREDICTED: ATP-dependent DNA helicase PIF1-l...    290   4e-83    
emb|CCT71284.1|  related to PIF1 protein precursor                      294   5e-83    
ref|XP_006786840.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    289   5e-83    
ref|XP_004570632.1|  PREDICTED: ATP-dependent DNA helicase PIF1-l...    289   5e-83    
gb|EUC55635.1|  DNA helicase (PIF1), putative                           289   5e-83    
ref|XP_007568820.1|  PREDICTED: ATP-dependent DNA helicase PIF1         289   7e-83    
gb|AAC26139.1|  RRM3/PIF1 helicase homolog                              293   8e-83    Schizosaccharomyces pombe
ref|NP_596488.1|  DNA repair and recombination protein                  293   9e-83    Schizosaccharomyces pombe
ref|XP_009861135.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    288   9e-83    
ref|XP_005939396.1|  PREDICTED: ATP-dependent DNA helicase PIF1-l...    288   9e-83    
emb|CEG02480.1|  unnamed protein product                                293   1e-82    
gb|KFX99163.1|  hypothetical protein V490_01914                         295   1e-82    
ref|XP_005721083.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    288   1e-82    
ref|XP_003220289.1|  PREDICTED: ATP-dependent DNA helicase PIF1         288   2e-82    
ref|XP_002848451.1|  DNA repair and recombination protein pif1          291   2e-82    Arthroderma otae CBS 113480
emb|CEG64773.1|  Putative YALI0B12892p                                  289   3e-82    
ref|XP_011117468.1|  hypothetical protein AOL_s00004g517                294   3e-82    
gb|ENH73204.1|  DNA repair and recombination protein pif1, mitoch...    291   3e-82    
gb|KFY28485.1|  hypothetical protein V491_00441                         293   3e-82    
ref|XP_009256580.1|  hypothetical protein FPSE_05187                    291   3e-82    
emb|CEI95435.1|  Putative YALI0B12892p                                  288   3e-82    
gb|KFY56242.1|  hypothetical protein V497_06412                         294   4e-82    
gb|EQB51081.1|  DNA repair and recombination protein pif1               292   4e-82    
gb|KFY02695.1|  hypothetical protein O988_01968                         294   4e-82    
ref|XP_385698.1|  hypothetical protein FG05522.1                        291   4e-82    Fusarium graminearum PH-1
ref|XP_002174910.2|  pif1 helicase Pfh1                                 291   5e-82    Schizosaccharomyces japonicus yFS275
gb|KFY37446.1|  hypothetical protein V494_04749                         293   5e-82    
ref|XP_005685899.1|  PREDICTED: ATP-dependent DNA helicase PIF1         283   5e-82    
gb|EMT70193.1|  DNA repair and recombination protein pif1, mitoch...    291   6e-82    
emb|CCF44443.1|  DNA repair and recombination protein pif1              291   6e-82    
gb|ESZ96563.1|  hypothetical protein SBOR_3065                          292   6e-82    
emb|CAO86064.1|  putative DNA-helicase                                  291   7e-82    
emb|CDQ77528.1|  unnamed protein product                                289   7e-82    
gb|EYB26197.1|  hypothetical protein FG05_05522                         291   7e-82    
emb|CAO85914.1|  putative DNA-helicase                                  291   8e-82    
ref|XP_006734921.1|  PREDICTED: ATP-dependent DNA helicase PIF1         286   8e-82    
emb|CCA68862.1|  related to PIF1 protein precursor                      284   8e-82    
gb|EPY50497.1|  pif1 helicase Pfh1                                      290   9e-82    
gb|EPQ04506.1|  ATP-dependent DNA helicase PIF1                         281   9e-82    
emb|CEF87539.1|  unnamed protein product                                291   1e-81    
ref|XP_007278884.1|  mitochondrial dna helicase                         291   1e-81    
ref|XP_006093517.1|  PREDICTED: ATP-dependent DNA helicase PIF1         280   2e-81    
ref|XP_005963349.1|  PREDICTED: ATP-dependent DNA helicase PIF1         285   2e-81    
ref|XP_005437461.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    282   2e-81    
gb|KFY66495.1|  hypothetical protein V496_02037                         291   2e-81    
ref|XP_004758756.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    285   2e-81    
ref|XP_006054521.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    285   2e-81    
gb|KFY94580.1|  hypothetical protein V498_03847                         291   3e-81    
ref|XP_007590472.1|  DNA repair and recombination protein pif1          291   3e-81    
emb|CCG81646.1|  putative Mitochondrial DNA helicase                    289   3e-81    
gb|EFX02820.1|  mitochondrial DNA helicase                              289   3e-81    
ref|XP_006209655.1|  PREDICTED: ATP-dependent DNA helicase PIF1         279   3e-81    
ref|XP_011112799.1|  hypothetical protein H072_7026                     289   3e-81    
ref|XP_009248182.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    285   3e-81    
emb|CCX05452.1|  Similar to DNA repair and recombination protein ...    290   3e-81    
ref|XP_007084712.1|  PREDICTED: ATP-dependent DNA helicase PIF1         282   4e-81    
ref|XP_007841313.1|  hypothetical protein PFICI_14541                   290   4e-81    
ref|XP_006979388.1|  PREDICTED: ATP-dependent DNA helicase PIF1         284   4e-81    
emb|CCU75089.1|  DNA-helicase                                           288   4e-81    
ref|XP_010991867.1|  PREDICTED: ATP-dependent DNA helicase PIF1         281   5e-81    
gb|KDN35967.1|  hypothetical protein RSAG8_11178                        281   5e-81    
gb|EQL02356.1|  DNA helicase PIF1, ATP-dependent                        287   5e-81    
ref|XP_004409469.1|  PREDICTED: ATP-dependent DNA helicase PIF1         284   5e-81    
ref|XP_005861195.1|  PREDICTED: ATP-dependent DNA helicase PIF1         281   5e-81    
ref|XP_003640106.1|  PREDICTED: ATP-dependent DNA helicase PIF1         284   5e-81    
gb|KDQ61420.1|  hypothetical protein JAAARDRAFT_54792                   284   5e-81    
ref|XP_004712039.1|  PREDICTED: ATP-dependent DNA helicase PIF1         284   6e-81    
gb|EWC48606.1|  hypothetical protein DRE_01828                          285   6e-81    
gb|KFZ03217.1|  hypothetical protein V502_11138                         290   7e-81    
ref|XP_003480064.2|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    282   7e-81    
ref|XP_008566201.1|  PREDICTED: ATP-dependent DNA helicase PIF1         280   7e-81    
ref|XP_008079638.1|  P-loop containing nucleoside triphosphate hy...    290   8e-81    
ref|XP_007294906.1|  DNA repair and recombination protein pif1          288   9e-81    
ref|XP_647539.1|  hypothetical protein DDB_G0268430                     289   1e-80    Dictyostelium discoideum AX4
ref|XP_006184109.1|  PREDICTED: ATP-dependent DNA helicase PIF1         280   1e-80    
ref|XP_004758755.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    285   1e-80    
ref|XP_010953999.1|  PREDICTED: ATP-dependent DNA helicase PIF1         281   1e-80    
ref|XP_002914318.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    282   1e-80    
ref|XP_010353788.1|  PREDICTED: ATP-dependent DNA helicase PIF1         283   1e-80    
gb|ELR05216.1|  hypothetical protein GMDG_01654                         289   2e-80    
ref|XP_005894618.1|  PREDICTED: ATP-dependent DNA helicase PIF1         281   2e-80    
ref|XP_009248185.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    285   2e-80    
ref|XP_004421747.1|  PREDICTED: ATP-dependent DNA helicase PIF1         283   2e-80    
ref|XP_005393944.1|  PREDICTED: ATP-dependent DNA helicase PIF1         278   2e-80    
gb|ELR57226.1|  ATP-dependent DNA helicase PIF1                         281   2e-80    
ref|XP_008137349.1|  PREDICTED: ATP-dependent DNA helicase PIF1         282   2e-80    
gb|AAH46611.1|  Pif1 protein                                            283   2e-80    Mus musculus [mouse]
emb|CCD53919.1|  hypothetical protein BofuT4_P130990.1                  287   2e-80    
ref|XP_006831600.1|  PREDICTED: ATP-dependent DNA helicase PIF1         282   2e-80    
ref|XP_007432731.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    282   2e-80    
ref|NP_001192981.1|  ATP-dependent DNA helicase PIF1                    282   2e-80    
ref|XP_003430227.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    282   3e-80    
gb|EPQ64078.1|  DNA helicase                                            286   3e-80    
gb|KFZ07260.1|  hypothetical protein V501_06621                         288   3e-80    
ref|XP_007874021.1|  hypothetical protein PNEG_02041                    286   3e-80    
ref|XP_006899697.1|  PREDICTED: ATP-dependent DNA helicase PIF1         282   3e-80    
ref|XP_003901104.1|  PREDICTED: ATP-dependent DNA helicase PIF1         282   3e-80    
gb|KFY86815.1|  hypothetical protein V500_07384                         288   3e-80    
gb|KFY76212.1|  hypothetical protein V499_04036                         288   4e-80    
ref|XP_007450771.1|  PREDICTED: ATP-dependent DNA helicase PIF1         281   4e-80    
ref|XP_776511.1|  hypothetical protein CNBC4370                         282   4e-80    Cryptococcus neoformans var. neoformans B-3501A
ref|XP_569577.1|  DNA repair and recombination protein pif1, mito...    282   4e-80    Cryptococcus neoformans var. neoformans JEC21
ref|XP_003507209.2|  PREDICTED: ATP-dependent DNA helicase PIF1         281   5e-80    
ref|XP_008331882.1|  PREDICTED: ATP-dependent DNA helicase PIF1         281   5e-80    
ref|XP_007532425.1|  PREDICTED: ATP-dependent DNA helicase PIF1         281   5e-80    
ref|XP_009903676.1|  PREDICTED: probable rRNA-processing protein ...    280   5e-80    
ref|XP_010807596.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    282   5e-80    
ref|XP_007112808.1|  PREDICTED: ATP-dependent DNA helicase PIF1         279   5e-80    
gb|EFQ24939.1|  DNA repair and recombination protein pif1               286   6e-80    
ref|XP_007608119.1|  PREDICTED: ATP-dependent DNA helicase PIF1         281   6e-80    
gb|EMR86306.1|  putative mitochondrial dna helicase protein             287   6e-80    
ref|XP_002807215.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    281   7e-80    
ref|XP_004351690.1|  DNA helicase, putative                             288   7e-80    
gb|EHH27397.1|  hypothetical protein EGK_17586                          280   7e-80    
gb|EPX71578.1|  pif1 helicase Pfh1                                      284   7e-80    
ref|XP_005559843.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    281   8e-80    
ref|XP_001108233.1|  PREDICTED: ATP-dependent DNA helicase PIF1-l...    281   8e-80    
gb|AAM50051.1|  DNA helicase-like protein                               281   9e-80    
ref|XP_005348238.1|  PREDICTED: ATP-dependent DNA helicase PIF1         281   9e-80    
ref|XP_003987088.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    281   9e-80    
ref|NP_766041.1|  ATP-dependent DNA helicase PIF1                       281   9e-80    
ref|XP_005614959.1|  PREDICTED: LOW QUALITY PROTEIN: PIF1 5'-to-3...    278   1e-79    
ref|XP_004056374.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    280   1e-79    
gb|EDL26099.1|  expressed sequence AI449441, isoform CRA_a              281   1e-79    
ref|XP_002718238.1|  PREDICTED: ATP-dependent DNA helicase PIF1         280   1e-79    
ref|XP_005211755.2|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    281   1e-79    
ref|XP_008014475.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    280   1e-79    
ref|XP_008014474.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    280   1e-79    
ref|XP_005075587.1|  PREDICTED: ATP-dependent DNA helicase PIF1         280   1e-79    
ref|XP_006770898.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    280   2e-79    
ref|XP_010349962.1|  PREDICTED: ATP-dependent DNA helicase PIF1         280   2e-79    
ref|XP_007166179.1|  PREDICTED: ATP-dependent DNA helicase PIF1         278   2e-79    
ref|XP_009658037.1|  DNA repair and recombination protein pif1          284   2e-79    
ref|XP_008071314.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    283   2e-79    
ref|XP_003192796.1|  DNA repair and recombination protein pif1, m...    280   2e-79    
gb|KGB77482.1|  DNA repair and recombination protein pif1               280   2e-79    
ref|XP_003739954.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    278   3e-79    
ref|XP_004311970.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    278   3e-79    
ref|XP_004629002.1|  PREDICTED: ATP-dependent DNA helicase PIF1         279   3e-79    
ref|NP_001273428.1|  ATP-dependent DNA helicase PIF1 isoform c          278   3e-79    
emb|CCU98991.1|  unnamed protein product                                276   3e-79    
gb|KEZ45366.1|  hypothetical protein SAPIO_CDS2187                      291   3e-79    
gb|KFH64514.1|  hypothetical protein MVEG_09247                         285   4e-79    
ref|XP_008867280.1|  hypothetical protein, variant 2                    277   4e-79    
ref|XP_004056376.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    280   4e-79    
ref|XP_008534183.1|  PREDICTED: ATP-dependent DNA helicase PIF1         278   4e-79    
ref|XP_007956003.1|  PREDICTED: ATP-dependent DNA helicase PIF1         279   5e-79    
gb|EGD97453.1|  DNA repair and recombination protein pif1               281   5e-79    
ref|XP_004374848.1|  PREDICTED: ATP-dependent DNA helicase PIF1         278   5e-79    
ref|XP_001174285.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    278   6e-79    
ref|NP_079325.2|  ATP-dependent DNA helicase PIF1 isoform a             278   6e-79    
ref|XP_009427602.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    278   6e-79    
ref|XP_001831315.2|  DNA repair and recombination protein pif1          278   6e-79    
ref|XP_004274792.1|  PREDICTED: ATP-dependent DNA helicase PIF1         278   7e-79    
gb|AAS77398.1|  PIF1/RRM3 DNA helicase-like protein                     278   7e-79    
ref|XP_004011048.1|  PREDICTED: ATP-dependent DNA helicase PIF1         275   7e-79    
ref|XP_003388034.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    277   9e-79    
ref|NP_001037718.1|  ATP-dependent DNA helicase PIF1                    278   1e-78    
ref|XP_005316747.1|  PREDICTED: ATP-dependent DNA helicase PIF1         278   1e-78    
ref|XP_004662503.1|  PREDICTED: ATP-dependent DNA helicase PIF1         273   2e-78    
ref|XP_005010388.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    270   2e-78    
ref|XP_004258641.1|  hypothetical protein EIN_397800                    285   2e-78    
ref|XP_006243333.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    278   2e-78    
ref|XP_003485090.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    276   2e-78    
ref|XP_010731657.1|  PREDICTED: ATP-dependent DNA helicase PIF1         277   2e-78    
ref|XP_004619712.1|  PREDICTED: ATP-dependent DNA helicase PIF1         275   2e-78    
gb|EHA98492.1|  ATP-dependent DNA helicase PIF1                         271   2e-78    
ref|XP_008834524.1|  PREDICTED: ATP-dependent DNA helicase PIF1         277   2e-78    
ref|NP_001273426.1|  ATP-dependent DNA helicase PIF1 isoform b          278   2e-78    
ref|XP_002548760.1|  predicted protein                                  280   3e-78    
gb|EGU76173.1|  hypothetical protein FOXB_13297                         287   3e-78    
ref|XP_010639595.1|  PREDICTED: ATP-dependent DNA helicase PIF1         272   3e-78    
ref|XP_003398615.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    275   4e-78    
gb|EHJ68457.1|  hypothetical protein KGM_08273                          273   5e-78    
ref|XP_002051875.1|  GJ24695                                            276   5e-78    
ref|XP_003418406.2|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    276   5e-78    
ref|XP_006616456.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    275   6e-78    
gb|KGL85436.1|  ATP-dependent DNA helicase PIF1                         268   6e-78    
ref|XP_006141862.1|  PREDICTED: ATP-dependent DNA helicase PIF1         276   8e-78    
gb|ELW71297.1|  ATP-dependent DNA helicase PIF1                         277   9e-78    
ref|XP_393890.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like       275   1e-77    
ref|XP_004877658.1|  PREDICTED: ATP-dependent DNA helicase PIF1         272   1e-77    
ref|XP_006920328.1|  PREDICTED: ATP-dependent DNA helicase PIF1         275   1e-77    
ref|XP_004578400.1|  PREDICTED: ATP-dependent DNA helicase PIF1         275   1e-77    
ref|XP_005238564.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    269   2e-77    
ref|XP_008951619.1|  PREDICTED: ATP-dependent DNA helicase PIF1         273   2e-77    
ref|XP_004687737.1|  PREDICTED: ATP-dependent DNA helicase PIF1         275   2e-77    
emb|CBH76627.1|  DNA helicase PIF1                                      271   3e-77    
ref|XP_009285712.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    267   5e-77    
gb|KFV79168.1|  ATP-dependent DNA helicase PIF1                         266   7e-77    
emb|CBJ33858.1|  conserved unknown protein                              266   8e-77    
gb|KHJ35730.1|  putative dna repair and recombination protein pif1      277   8e-77    
ref|XP_008867278.1|  hypothetical protein H310_04626                    271   8e-77    
ref|XP_004855705.1|  PREDICTED: ATP-dependent DNA helicase PIF1         272   1e-76    
gb|EJY57402.1|  AAEL017186-PA                                           272   1e-76    
ref|XP_001989128.1|  GH11550                                            272   1e-76    
ref|XP_004931751.1|  PREDICTED: ATP-dependent DNA helicase PIF1-l...    271   2e-76    
ref|XP_009669087.1|  PREDICTED: ATP-dependent DNA helicase PIF1         265   2e-76    
ref|XP_002001798.1|  GI17040                                            272   2e-76    
ref|XP_011060194.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    268   2e-76    
ref|XP_008555729.1|  PREDICTED: ATP-dependent DNA helicase PIF1         271   3e-76    
ref|XP_010142738.1|  PREDICTED: ATP-dependent DNA helicase PIF1         265   3e-76    
gb|KFB46189.1|  AGAP007775-PA-like protein                              272   3e-76    
ref|XP_002064634.1|  GK23961                                            271   4e-76    
gb|KFV71022.1|  ATP-dependent DNA helicase PIF1                         264   4e-76    
ref|XP_970873.1|  PREDICTED: ATP-dependent DNA helicase PIF1            270   6e-76    
gb|EFA81412.1|  DNA helicase                                            274   6e-76    
ref|XP_001968567.1|  GG24437                                            271   6e-76    
ref|XP_002087831.1|  GE14865                                            270   7e-76    
gb|ETN61278.1|  DNA repair and recombination protein pif1, mitoch...    271   8e-76    
gb|KFO85277.1|  ATP-dependent DNA helicase PIF1                         263   9e-76    
ref|XP_002163633.2|  PREDICTED: DNA repair and recombination prot...    271   1e-75    
ref|XP_001734645.1|  hypothetical protein                               269   1e-75    
emb|CBK25186.2|  unnamed protein product                                268   2e-75    
ref|XP_001356708.1|  GA16856                                            270   2e-75    
ref|XP_003704309.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    268   2e-75    
ref|XP_011060191.1|  PREDICTED: ATP-dependent DNA helicase PIF1 i...    268   3e-75    
gb|EZA54089.1|  ATP-dependent DNA helicase PIF1                         268   3e-75    
ref|XP_008856770.1|  DNA repair and recombination protein, putative     268   4e-75    
ref|XP_005176328.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    268   5e-75    
ref|NP_608782.1|  CG3238, isoform A                                     268   6e-75    
ref|XP_001961969.1|  GF14672                                            268   6e-75    
ref|XP_004367121.1|  DNA repair and recombination protein PIF1          278   6e-75    
gb|EMD44607.1|  DNA repair and recombination protein, putative          267   8e-75    
gb|AFR97989.1|  ATP-dependent DNA helicase PIF1                         268   9e-75    
ref|XP_649195.1|  DNA repair and recombination protein                  267   1e-74    
ref|XP_008867281.1|  hypothetical protein, variant 3                    265   1e-74    
ref|XP_002078034.1|  GD22755                                            267   2e-74    
ref|XP_317740.4|  AGAP007775-PA                                         266   2e-74    
ref|XP_002045317.1|  GM11131                                            266   3e-74    
gb|ENN77906.1|  hypothetical protein YQE_05583                          265   3e-74    
gb|ERL85435.1|  hypothetical protein D910_02854                         265   4e-74    
gb|EFN75369.1|  ATP-dependent DNA helicase PIF1                         261   5e-74    
ref|XP_004530338.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    265   6e-74    
gb|EPY81707.1|  PIF1/RRM3 DNA helicase-like protein                     258   9e-74    
gb|EFN61107.1|  ATP-dependent DNA helicase PIF1                         263   1e-73    
gb|EKG14532.1|  DNA helicase PIF1 ATP-dependent                         263   1e-73    
emb|CDK13362.1|  Protein PIF-1, isoform c                               261   2e-73    
ref|XP_005501207.1|  PREDICTED: ATP-dependent DNA helicase PIF1-like    257   3e-73    
gb|EXX57421.1|  Rrm3p                                                   259   3e-73    
ref|XP_002548501.1|  predicted protein                                  260   4e-73    
ref|XP_002769400.1|  conserved hypothetical protein                     263   6e-73    
ref|XP_001846421.1|  DNA repair and recombination protein pif1, m...    262   1e-72    
ref|NP_490774.2|  Protein PIF-1                                         262   1e-72    
gb|KEP51595.1|  putative DNA helicase (PIF1)                            257   2e-72    
ref|XP_006672433.1|  DNA repair and recombination protein pif1          264   3e-72    
ref|XP_008867279.1|  hypothetical protein, variant 1                    259   3e-72    
ref|XP_004341568.1|  RRM3/PIF1 helicase, putative                       262   4e-72    
gb|EJT52321.1|  hypothetical protein A1Q1_04532                         259   4e-72    
ref|XP_007842479.1|  dna repair and recombination protein pif1          260   4e-72    
gb|EGT38144.1|  hypothetical protein CAEBREN_13366                      260   5e-72    
gb|EKC99703.1|  DNA repair and recombination protein pif1               259   6e-72    
gb|EGT36565.1|  CBN-PIF-1 protein                                       260   7e-72    
gb|EUC55988.1|  DNA helicase (PIF1), putative                           254   2e-71    
gb|AET42504.1|  hypothetical protein EXVG_00319                         251   3e-71    
ref|XP_002638798.1|  C. briggsae CBR-PIF-1 protein                      258   3e-71    
ref|WP_024626688.1|  ATP-dependent endonuclease                         252   4e-71    
ref|WP_003808401.1|  MULTISPECIES: ATP-dependent endonuclease           252   5e-71    
ref|XP_009466611.1|  PREDICTED: ATP-dependent DNA helicase PIF1         249   6e-71    
gb|KFR00324.1|  ATP-dependent DNA helicase PIF1                         249   6e-71    
ref|WP_011742914.1|  ATP-dependent endonuclease                         251   7e-71    
ref|XP_008706907.1|  PREDICTED: ATP-dependent DNA helicase PIF1         253   9e-71    
ref|WP_039774872.1|  ATP-dependent endonuclease                         251   9e-71    
emb|CBY19601.1|  unnamed protein product                                255   9e-71    
ref|WP_015022237.1|  ATP-dependent endonuclease                         251   1e-70    
gb|AFR99034.1|  ATP-dependent DNA helicase PIF1                         256   1e-70    
ref|XP_002155933.2|  PREDICTED: uncharacterized protein LOC100203838    262   1e-70    
ref|XP_004931752.1|  PREDICTED: ATP-dependent DNA helicase PIF1-l...    249   2e-70    
ref|WP_033504806.1|  ATP-dependent endonuclease                         250   2e-70    
ref|WP_021913633.1|  uncharacterized protein                            250   3e-70    
ref|WP_029678703.1|  ATP-dependent endonuclease                         249   3e-70    
gb|KFW62233.1|  ATP-dependent DNA helicase PIF1                         247   4e-70    
ref|XP_003105097.1|  CRE-PIF-1 protein                                  255   4e-70    
ref|XP_010005024.1|  PREDICTED: ATP-dependent DNA helicase PIF1         248   4e-70    
ref|XP_002912149.1|  DNA repair and recombination protein pif1          253   4e-70    
ref|WP_018576136.1|  hypothetical protein                               252   5e-70    
dbj|GAA94772.1|  hypothetical protein E5Q_01427                         255   5e-70    
dbj|GAA94773.1|  hypothetical protein E5Q_01426                         255   5e-70    
ref|XP_010020581.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    248   9e-70    
gb|EKE11074.1|  hypothetical protein ACD_15C00140G0002                  247   1e-69    
ref|XP_008190248.1|  PREDICTED: ATP-dependent DNA helicase PIF1         251   1e-69    
ref|WP_033490515.1|  ATP-dependent endonuclease                         248   2e-69    
ref|XP_007842480.1|  mitochondrial dna helicase                         252   3e-69    
ref|XP_009267971.1|  hypothetical protein J056_004501                   251   3e-69    
ref|WP_033497731.1|  ATP-dependent endonuclease                         247   3e-69    
ref|WP_022859047.1|  ATP-dependent endonuclease                         247   4e-69    
gb|KFU96371.1|  ATP-dependent DNA helicase PIF1                         244   5e-69    
gb|KFO98596.1|  ATP-dependent DNA helicase PIF1                         243   6e-69    
ref|XP_008489154.1|  PREDICTED: ATP-dependent DNA helicase PIF1         244   8e-69    
gb|KGL93042.1|  ATP-dependent DNA helicase PIF1                         242   1e-68    
gb|EMS19224.1|  mitochondrial dna helicase                              251   1e-68    
ref|XP_572423.1|  mitochondrial DNA repair and recombination prot...    251   1e-68    
gb|KFJ07794.1|  helicase                                                245   2e-68    
emb|CCM00349.1|  predicted protein                                      249   2e-68    
emb|CDS27835.1|  ATP dependent DNA helicase PIF1                        248   2e-68    
ref|XP_004991536.1|  hypothetical protein PTSG_07735                    248   2e-68    
ref|WP_026502293.1|  ATP-dependent endonuclease                         244   2e-68    
gb|KFV14124.1|  ATP-dependent DNA helicase PIF1                         242   3e-68    
gb|KFY26613.1|  hypothetical protein V493_03980                         253   3e-68    
gb|KFO14373.1|  ATP-dependent DNA helicase PIF1                         241   3e-68    
gb|KFZ48327.1|  ATP-dependent DNA helicase PIF1                         241   4e-68    
gb|KFI81010.1|  helicase                                                244   5e-68    
ref|WP_024463431.1|  ATP-dependent endonuclease                         243   6e-68    
ref|WP_035009971.1|  ATP-dependent endonuclease                         243   9e-68    
ref|WP_026646281.1|  ATP-dependent endonuclease                         243   1e-67    
ref|WP_003842520.1|  ATP-dependent endonuclease                         243   1e-67    
ref|WP_003825571.1|  ATP-dependent endonuclease                         242   2e-67    
ref|WP_033488376.1|  ATP-dependent endonuclease                         242   3e-67    
gb|KFP79864.1|  ATP-dependent DNA helicase PIF1                         239   3e-67    
emb|CDS15528.1|  ATP dependent DNA helicase PIF1                        245   3e-67    
gb|KFO64573.1|  ATP-dependent DNA helicase PIF1                         239   3e-67    
ref|XP_010307841.1|  PREDICTED: ATP-dependent DNA helicase PIF1         239   3e-67    
ref|XP_010165851.1|  PREDICTED: ATP-dependent DNA helicase PIF1         238   4e-67    
ref|WP_039197344.1|  ATP-dependent endonuclease                         241   4e-67    
ref|WP_004219734.1|  ATP-dependent endonuclease                         241   4e-67    
ref|WP_022245061.1|  putative uncharacterized protein                   241   4e-67    
ref|WP_033500926.1|  ATP-dependent endonuclease                         241   5e-67    
ref|WP_032132420.1|  helicase                                           243   5e-67    
gb|EMG45970.1|  ATP-dependent helicase, putative (Dna repair and ...    243   6e-67    
ref|XP_003197100.1|  DNA helicase involved in rDNA replication an...    246   6e-67    
ref|XP_002786570.1|  conserved hypothetical protein                     244   6e-67    
ref|WP_003835699.1|  ATP-dependent endonuclease                         241   7e-67    
gb|EKD58476.1|  hypothetical protein ACD_56C00116G0009                  239   7e-67    
gb|KFZ57814.1|  ATP-dependent DNA helicase PIF1                         238   7e-67    
gb|KFI99443.1|  helicase                                                241   7e-67    
ref|WP_034880762.1|  ATP-dependent endonuclease                         240   8e-67    
ref|WP_003837039.1|  MULTISPECIES: ATP-dependent endonuclease           240   8e-67    
ref|WP_033506287.1|  ATP-dependent endonuclease                         240   9e-67    



>ref|XP_010323643.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Solanum lycopersicum]
Length=498

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/454 (61%), Positives = 357/454 (79%), Gaps = 13/454 (3%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             +T+VK T +Q+Q+L+AIS G SVF+TGSAGTGKT+L+QHII KL++IHG+SRV+VTASTG
Sbjct  44    KTKVKLTEQQNQILEAISNGNSVFITGSAGTGKTYLLQHIITKLKKIHGKSRVFVTASTG  103

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+AC+LNG TLHSFAGIGLG+A+  +LL +V  ++R   RW  V+AL+IDEIS++SGE++
Sbjct  104   VAACSLNGQTLHSFAGIGLGDASCVDLLSRVSLDKRAYRRWNKVRALVIDEISMVSGEVF  163

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQK--FAFEASSWKLS  1140
             D LEFIAR IRS   G  EE +WGGIQ+V SGDFFQLPP+ NK  Q+  FAFEA  W  S
Sbjct  164   DNLEFIARSIRSEELGC-EEKIWGGIQLVVSGDFFQLPPVINKKGQQKEFAFEADCWNAS  222

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDD  1320
             FD QI+L T+FRQSD QL+KLLQGIRKG+YD EDL LL+  CS +EPD  AV+LYPR +D
Sbjct  223   FDEQIELKTIFRQSDAQLIKLLQGIRKGKYDSEDLKLLDQCCSKVEPDSSAVQLYPRIED  282

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARH  1500
             V RVN + LD L + L  Y+A+D+G+D WK+QLK GIAP+ L+LCVG+RV+LTKN++   
Sbjct  283   VSRVNAERLDCLDEVLFNYQALDSGKDPWKKQLKNGIAPELLKLCVGSRVLLTKNIDVVG  342

Query  1501  KLVNGAAGTVIGFESVNGTYETF---------GTNWLPVVKFDFKPKKLIIRPETWSIMD  1653
              LVNGA GT++ F +V  T++ +           N LPVV+FD   ++L+I  E W +M+
Sbjct  343   GLVNGATGTILDFAAVQDTHKLYDHEISDICGNGNLLPVVRFD-SGQELMIGVERWYVME  401

Query  1654  GEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHL  1833
             G+E VA+RKQIPLILAWALSIHKCQGMTLN L+TDL R FG+GMVYVALSRVKSL+GL+L
Sbjct  402   GDEAVAMRKQIPLILAWALSIHKCQGMTLNNLHTDLYRVFGFGMVYVALSRVKSLDGLNL  461

Query  1834  SSFNPNIIKVHPKVLNFDKRLCSQPDQPKEDAVT  1935
              +FNP+ IK +PKVL F +RL ++ D+ KED+VT
Sbjct  462   VNFNPSKIKANPKVLQFYERLSAEKDEQKEDSVT  495



>ref|XP_009603849.1| PREDICTED: ATP-dependent DNA helicase PIF1 {ECO:0000255|HAMAP-Rule:MF_03176}-like 
[Nicotiana tomentosiformis]
Length=492

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/454 (63%), Positives = 352/454 (78%), Gaps = 13/454 (3%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             + RVK T +Q+Q+L+AIS G SVF+TGSAGTGKT+L+Q II KLR+IHG+SRV+VTASTG
Sbjct  38    KPRVKLTDQQNQILEAISNGNSVFITGSAGTGKTYLLQDIITKLRKIHGKSRVFVTASTG  97

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+AC+LNG TLHSFAGIGLG+A+A +LL +V  ++R   RW  V+AL+IDEIS+ISGE++
Sbjct  98    VAACSLNGQTLHSFAGIGLGDASAVDLLSRVTLDKRAYRRWNKVRALVIDEISMISGEVF  157

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLS  1140
             D LEFIAR IRS   G  E+  WGGIQ+V SGDFFQLPP+ NK  Q  +FAFEA  W  S
Sbjct  158   DNLEFIARSIRSDEVGC-EDKSWGGIQLVVSGDFFQLPPVINKKGQNKEFAFEAECWNAS  216

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDD  1320
             FD QI+L T+FRQSD QL+KLLQGIRKG+YD EDL LL+  CS +EPD  AV+LYPR +D
Sbjct  217   FDMQIELKTIFRQSDAQLIKLLQGIRKGKYDSEDLQLLDQCCSEVEPDASAVQLYPRIED  276

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARH  1500
             V RVN   LD L + L  Y+A+D+G+D WK+QLK GIAP+ L+LCVGARV+LTKN++   
Sbjct  277   VSRVNADRLDRLDEVLYHYQALDSGKDPWKKQLKNGIAPELLKLCVGARVLLTKNIDVIG  336

Query  1501  KLVNGAAGTVIGFESVNGTYETF---------GTNWLPVVKFDFKPKKLIIRPETWSIMD  1653
              LVNGA GT++ F  V  T++ +           N LPVVKFD   ++L+I  E W +MD
Sbjct  337   GLVNGATGTILDFAVVQDTHKLYDHEISDICINGNLLPVVKFD-SGQELMIGLEKWYVMD  395

Query  1654  GEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHL  1833
             G+E VA+RKQIPL+LAWALSIHKCQGMTLN L+TDL R FG+GMVYVALSRVKSL+GLHL
Sbjct  396   GDEAVAMRKQIPLMLAWALSIHKCQGMTLNNLHTDLYRVFGFGMVYVALSRVKSLDGLHL  455

Query  1834  SSFNPNIIKVHPKVLNFDKRLCSQPDQPKEDAVT  1935
              +FNP+ IK HPKVL F +RL  + D+ KEDAV+
Sbjct  456   VNFNPSKIKAHPKVLQFYQRLSGEKDELKEDAVS  489



>ref|XP_009766209.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Nicotiana sylvestris]
Length=492

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/506 (58%), Positives = 364/506 (72%), Gaps = 28/506 (6%)
 Frame = +1

Query  451   MNLIFSSAIATYRCFSSKAAAGKNRNLAQRAIsskkdssrnessssskppkkRTRVKWTV  630
             M L   +A   YR  SSKA          +                     K+ RVK T 
Sbjct  1     MKLSLYTAKTAYRFLSSKATCWSQATAKSKV---------------KLTSPKKPRVKLTD  45

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             +Q+Q+L+AIS G SVF+TGSAGTGKT+L+Q II KLR+IHG+SRV+VTASTGV+AC++NG
Sbjct  46    QQNQILEAISNGNSVFITGSAGTGKTYLLQDIITKLRKIHGKSRVFVTASTGVAACSING  105

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              TLHSFAGIGLG+A+  +LL +V  ++R   RW  V+AL+IDEIS+ISGE++D LEFIAR
Sbjct  106   QTLHSFAGIGLGDASDVDLLSRVTLDKRAYRRWNKVRALVIDEISMISGEVFDNLEFIAR  165

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQIDLT  1164
              IRS   G  E+ +WGGIQ+V SGDFFQLPP+ NK  Q  +FAFEA  W  SFD QI+L 
Sbjct  166   SIRSDELGC-EDKIWGGIQLVVSGDFFQLPPVINKKGQNKEFAFEAECWNASFDMQIELK  224

Query  1165  TVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRVNKKH  1344
             T+FRQSD QL+KLLQGIRKG+YD EDL LL+  CS +EPD  AV+LYPR +DV RVN   
Sbjct  225   TIFRQSDAQLIKLLQGIRKGKYDSEDLQLLDQCCSEVEPDASAVQLYPRIEDVSRVNADR  284

Query  1345  LDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAG  1524
             LD L + L  Y+A+D+G+D WK+QLK GIAP+ L+LCVGARV+LTKN++    LVNGA G
Sbjct  285   LDRLDEVLFHYQALDSGKDPWKKQLKNGIAPELLKLCVGARVLLTKNIDVIGGLVNGATG  344

Query  1525  TVIGFESVNGTYETF---------GTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
             T++ F  V  +++ +           N LPVVKFD   ++L+I  E W +MDG+E VA+R
Sbjct  345   TILDFAVVPDSHKLYDHEISDICINGNLLPVVKFD-SGQELMIGLEKWYVMDGDEAVAMR  403

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             KQIPLILAWALSIHKCQGMTLN L+TDL R FG+GMVYVALSRVKSL+GLHL +FNP+ I
Sbjct  404   KQIPLILAWALSIHKCQGMTLNNLHTDLYRVFGFGMVYVALSRVKSLDGLHLVNFNPSKI  463

Query  1858  KVHPKVLNFDKRLCSQPDQPKEDAVT  1935
             K HPKVL F +RL  + D+ KEDAV+
Sbjct  464   KAHPKVLQFYQRLSGEKDELKEDAVS  489



>ref|XP_008229389.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Prunus mume]
Length=515

 Score =   511 bits (1316),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 275/505 (54%), Positives = 348/505 (69%), Gaps = 18/505 (4%)
 Frame = +1

Query  460   IFSSAIATYRCFSSKAAAGKNRNLAQRAIsskkdssrnessssskppkkRTRVKWTVEQS  639
             +F  A++ +R FS+K   GKN   AQ     K  S        +K  K R RV+WT +Q 
Sbjct  6     LFGCALSAHRNFSTKIT-GKNAKWAQ----GKYKSGYKPREGEAKNTKTRERVQWTDQQK  60

Query  640   QVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNGYTL  819
             QV+ AIS GKSVF+TGSAGTGKT L++HII++L++ H  S+V+VTA TGV+ACA++G TL
Sbjct  61    QVMSAISEGKSVFITGSAGTGKTILVKHIIKQLKKCHAPSKVFVTAPTGVAACAISGQTL  120

Query  820   HSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIR  999
             HSFAGIG   A  + LLH++  N +   RW+  +AL++DE S++  EL++ LEFIAR I+
Sbjct  121   HSFAGIGCAMADRDTLLHRISKNDKAYKRWRKAEALVLDESSMVDAELFESLEFIARAIK  180

Query  1000  SSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT---QKFAFEASSWKLSFDTQIDLTTV  1170
                   DE  VWGGIQ+V SGDFFQLPP+  +     ++FAFEA  W  SFD Q++LT V
Sbjct  181   QV----DE--VWGGIQLVVSGDFFQLPPVKPQQKSGGKEFAFEAECWDSSFDLQVNLTKV  234

Query  1171  FRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRVNKKHLD  1350
             FRQSDPQL+KLLQGIR+GE D EDL LLE  CS  EPDP  V+LYPRN+DV RVN   L 
Sbjct  235   FRQSDPQLIKLLQGIRRGESDPEDLKLLEQSCSKAEPDPTVVQLYPRNEDVNRVNSSRLA  294

Query  1351  SLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAGTV  1530
             SL  +L+ Y AVD+GEDS K QL+ GIAP  + LC  ARVML KNLN    LVNGA GTV
Sbjct  295   SLGNELVVYTAVDSGEDSLKRQLEQGIAPKEIALCEDARVMLVKNLNTWRGLVNGATGTV  354

Query  1531  IGF-ESVN-GTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLILAW  1704
              GF ES + G         LPVV+FD    ++ I P TW+  +G+  VA R+Q+PLILAW
Sbjct  355   TGFYESEDVGVTRICDDGLLPVVRFD-SGLEMTIEPNTWTTKEGDS-VAKREQLPLILAW  412

Query  1705  ALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNF  1884
             A SIHKCQGMTL+ L+TDL+RAF  GMVYVALSRV+SLEGL+LS F+P+ IKVHPKV+ F
Sbjct  413   ASSIHKCQGMTLDRLHTDLSRAFENGMVYVALSRVRSLEGLYLSGFDPSKIKVHPKVVQF  472

Query  1885  DKRLCSQPDQPKEDAVTKKKQGGSS  1959
               +  S+ D+  ED    + + GS+
Sbjct  473   YNKFTSEQDKEGEDDNVSQNKNGSN  497



>emb|CDP18728.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   508 bits (1309),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 269/453 (59%), Positives = 327/453 (72%), Gaps = 26/453 (6%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             + R+KWT EQ+QVL+AI  GKSVFV+GSAGTGKT L++H+I+KL++IHGRS+V+VTASTG
Sbjct  70    KPRMKWTDEQTQVLNAILEGKSVFVSGSAGTGKTALLEHVIKKLKKIHGRSQVFVTASTG  129

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+ACALNG TLHSFAG GLG      LL +V S+RR   RW   + L++DE S+I  + +
Sbjct  130   VAACALNGMTLHSFAGTGLGGVDRASLLSRVLSDRRAYRRWIKAKVLVMDESSMIEADFF  189

Query  967   DKLEFIARKIRSSINGSDEEM---VWGGIQVVASGDFFQLPPIFNK----NTQKFAFEAS  1125
             + LEFIA +IR    G D  +   VWGGIQ+V SGDFFQLPP+  K      + FAFEA 
Sbjct  190   NDLEFIASEIR----GQDPLLKGKVWGGIQLVVSGDFFQLPPVLKKKKKKGAKVFAFEAD  245

Query  1126  SWKLSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLY  1305
              W  SFD QI+LT VFRQS+  LVKLLQGIR+G+ D EDL +L+  C + E DP AV+L+
Sbjct  246   CWNASFDLQIELTKVFRQSEADLVKLLQGIRRGDSDPEDLQILKQRCFSSEEDPSAVQLF  305

Query  1306  PRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKN  1485
             PRN+DV RVNKKHL SL + +  Y AVD+GE+  K+QL+ GIAPD LELC GARVML KN
Sbjct  306   PRNEDVNRVNKKHLQSLGEQIFVYSAVDSGEEPSKKQLRSGIAPDQLELCKGARVMLCKN  365

Query  1486  LNARHKLVNGAAGTVIGF-ESVNGTYETFGT-------------NWLPVVKFDFKPKKLI  1623
             +N   KLVNGA GT+I F + ++  YE+ G                LPVVKFD   + L 
Sbjct  366   INPWLKLVNGATGTIIDFHDKIDAFYESAGDCIDSDIHSICSDGYLLPVVKFD-SGQVLK  424

Query  1624  IRPETWSIMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALS  1803
             I  ETW +MDGE VVA RKQIPLILAWALSIHKCQGMTL+ L+TDL RAFG GMVYVALS
Sbjct  425   IGLETWVVMDGERVVAKRKQIPLILAWALSIHKCQGMTLDRLHTDLRRAFGCGMVYVALS  484

Query  1804  RVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             RVK+L+GLHLS FNP  I+  PKVL F + L S
Sbjct  485   RVKTLDGLHLSGFNPAKIEADPKVLQFYQNLSS  517



>ref|XP_007216310.1| hypothetical protein PRUPE_ppa019701mg [Prunus persica]
 gb|EMJ17509.1| hypothetical protein PRUPE_ppa019701mg [Prunus persica]
Length=549

 Score =   509 bits (1311),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 275/507 (54%), Positives = 347/507 (68%), Gaps = 18/507 (4%)
 Frame = +1

Query  460   IFSSAIATYRCFSSKAAAGKNRNLAQRAIsskkdssrnessssskppkkRTRVKWTVEQS  639
              F  A++ +R FS+K   GKN   AQ     K  S        +K  K R RV+WT +Q 
Sbjct  6     FFGCALSAHRNFSTKIT-GKNSKWAQ----GKYKSGYKAREGEAKNTKTRERVQWTDQQK  60

Query  640   QVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNGYTL  819
             QV+ AIS GKSVF+TGSAGTGKT L++HII++L++ HG S+V+VTA TGV+ACA++G TL
Sbjct  61    QVMSAISEGKSVFITGSAGTGKTILVKHIIKQLKKRHGPSKVFVTAPTGVAACAISGQTL  120

Query  820   HSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIR  999
             HSFAGIG   A  + LLH++  N +   RW+  +AL++DE S++  EL++ L+FIAR I+
Sbjct  121   HSFAGIGCAMADRDTLLHRISKNDKAYKRWRKAEALVLDESSMVDAELFESLDFIARAIK  180

Query  1000  SSINGSDEEMVWGGIQVVASGDFFQLPPIF---NKNTQKFAFEASSWKLSFDTQIDLTTV  1170
                   DE  VWGGIQ+V SGDFFQLPP+    N   ++FAFEA  W  SFD Q++LT V
Sbjct  181   QV----DE--VWGGIQLVVSGDFFQLPPVKPQQNSGGKEFAFEAECWDSSFDLQVNLTKV  234

Query  1171  FRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRVNKKHLD  1350
             FRQSDPQL+KLLQGIR+GE D EDL LLE  CS  EPDP  V+LYPRN+DV RVN   L 
Sbjct  235   FRQSDPQLIKLLQGIRRGESDPEDLKLLEQSCSKAEPDPTVVQLYPRNEDVNRVNSSRLA  294

Query  1351  SLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAGTV  1530
             SL  +L+ Y AVD+GEDS K QL+ GIAP  + LC  ARVML KNLN    LVNGA GTV
Sbjct  295   SLGNELVVYTAVDSGEDSLKRQLEQGIAPKEIALCEDARVMLVKNLNTWRGLVNGATGTV  354

Query  1531  IGF-ESVN-GTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLILAW  1704
              GF ES + G         LPVV+FD    ++ I P TW+  +G+  VA R+Q+PLILAW
Sbjct  355   TGFYESEDVGVTRICDDGLLPVVRFD-SGLEMTIEPNTWTANEGDS-VAKREQLPLILAW  412

Query  1705  ALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNF  1884
             A SIHKCQGMTL+ L+TDL+RAF  GMVYVALSRV+SLEGL+LS F+P+ IKVHPKV  F
Sbjct  413   ASSIHKCQGMTLDRLHTDLSRAFENGMVYVALSRVRSLEGLYLSGFDPSKIKVHPKVAQF  472

Query  1885  DKRLCSQPDQPKEDAVTKKKQGGSSTC  1965
               +  S+ D+ +E      +   +S+C
Sbjct  473   YNKFTSEQDKEEEINAPVGRNSTNSSC  499



>ref|XP_011082948.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Sesamum indicum]
Length=519

 Score =   501 bits (1291),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 263/486 (54%), Positives = 341/486 (70%), Gaps = 19/486 (4%)
 Frame = +1

Query  460   IFSSAIATYRCFSSKAAAGKNRNLAQRAIsskkdssrnessssskppkkRTRVKWTVEQS  639
             + S AIA  R FSS+AA  K +N  +      K       + + K      ++KWT EQ 
Sbjct  3     LLSFAIAAGRQFSSQAAFEK-KNWGKNYFFKNKKKYDGSGTKTPKM----PKIKWTDEQK  57

Query  640   QVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNGYTL  819
             Q LDA+ +GKSVF+TGSAGTGKTFL++H+I+KL+ IHG+S+V+VTA TGV+ACALNG TL
Sbjct  58    QALDAVCSGKSVFITGSAGTGKTFLLEHVIKKLKRIHGKSKVFVTAPTGVAACALNGQTL  117

Query  820   HSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIR  999
             HSFAGIG+ +     L+  V  +R  ++RW+ V+AL+IDEIS++   L++ L  +AR +R
Sbjct  118   HSFAGIGIADGDCGSLVDMVLEDRHAKYRWRKVKALVIDEISMVDTNLFEGLAHVARTLR  177

Query  1000  SSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQK----FAFEASSWKLSFDTQIDLTT  1167
                    E   WGGIQ++ SGDFFQLPP+  K  +K    +AFEA  W  +FD QI+LTT
Sbjct  178   DEEASGHENKTWGGIQMIVSGDFFQLPPVLKKRKKKGAKIYAFEAECWSATFDLQIELTT  237

Query  1168  VFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRVNKKHL  1347
             VFRQSD  LV+LLQGIRKG+ D +DL LLE  CS  EPDP AV+L+P   DV  VNK+ L
Sbjct  238   VFRQSDSLLVQLLQGIRKGKNDPDDLKLLEGCCSGYEPDPSAVRLFPMLTDVNMVNKEKL  297

Query  1348  DSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAGT  1527
             +SL++++  Y+A D GED W +QLK GIAPD LELC+GARVML KN+N   KLVNGA GT
Sbjct  298   ESLNEEIYVYKAQDLGEDKWMKQLKKGIAPDELELCIGARVMLIKNINPWRKLVNGATGT  357

Query  1528  VIGFESVNGTYETFGTN-------WLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQI  1686
             V+    V  + E +G +        LP+VKFD    +L++ PE W +M+G++VVA RKQI
Sbjct  358   VVELCKV--SKEQYGMDDMCNHGGVLPLVKFD-SGLELVVEPEIWVVMEGDKVVARRKQI  414

Query  1687  PLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVH  1866
             PL+LAWALSIHKCQGMTL+ L+TDL+R F +GMVYVALSRV+SL GL+LS  +P+ IK H
Sbjct  415   PLMLAWALSIHKCQGMTLDKLHTDLSRVFDFGMVYVALSRVRSLGGLYLSGLDPSKIKAH  474

Query  1867  PKVLNF  1884
             PKVL F
Sbjct  475   PKVLEF  480



>ref|XP_008342384.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Malus domestica]
Length=530

 Score =   501 bits (1291),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 252/449 (56%), Positives = 320/449 (71%), Gaps = 12/449 (3%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVS  792
             RVKWT +Q Q++ AIS GKSVF+TGSAGTGKT L++HII+ L+  H  S+V+VTA TGV+
Sbjct  43    RVKWTEQQKQIISAISEGKSVFITGSAGTGKTMLVKHIIKLLKRCHTPSKVFVTAPTGVA  102

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             ACA++G TLHSFAGIG G    + LL +V SN+    +W   +AL+IDEIS++ GEL D 
Sbjct  103   ACAISGQTLHSFAGIGCGNDDRDTLLSRVLSNKEACRKWSKAEALVIDEISMVDGELLDS  162

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI---FNKNTQKFAFEASSWKLSF  1143
             LE+IA+ IR      DE  +WGG+Q+V  GDFFQLPP+   +N  +++FAFEA  W+ SF
Sbjct  163   LEYIAKYIRQV----DE--IWGGMQLVVGGDFFQLPPVKTEWNSESKEFAFEADCWESSF  216

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDV  1323
             D Q++LT VFRQSDP+L+K+LQGIR GE D EDL  LEN C++  PDP AV+ YPR  DV
Sbjct  217   DLQVNLTKVFRQSDPRLIKILQGIRTGEIDPEDLKFLENSCADSVPDPSAVQFYPRIQDV  276

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHK  1503
              RVN   L+SL  +L+ Y +VD+G D WK QL+  IAP  + LC  ARVML KNLN R  
Sbjct  277   NRVNASRLESLGNELVVYTSVDSGHDPWKRQLEQVIAPKEIGLCKDARVMLLKNLNTRSG  336

Query  1504  LVNGAAGTVIGFESVN--GTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
             LVNGA GTV+ F      G         LP+VKFD    K +I+P+TW + +G+ VVA R
Sbjct  337   LVNGATGTVMAFRKTKDVGLTSICDGGLLPIVKFDSGIIK-VIKPKTWDVTEGDSVVAQR  395

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA SIHKCQGMTL+CLYT+L+++F YGMVYV LSRVKSLEGL++S F+P+ I
Sbjct  396   EQLPLRLAWASSIHKCQGMTLDCLYTNLSKSFEYGMVYVTLSRVKSLEGLYISGFHPSKI  455

Query  1858  KVHPKVLNFDKRLCSQPDQPKEDAVTKKK  1944
             KVHPKV  F KR      +  ED VT+KK
Sbjct  456   KVHPKVKQFYKRFSGDHKKEVEDNVTQKK  484



>ref|XP_007048817.1| DNA repair and recombination protein pif1, putative [Theobroma 
cacao]
 gb|EOX92974.1| DNA repair and recombination protein pif1, putative [Theobroma 
cacao]
Length=475

 Score =   492 bits (1266),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 241/433 (56%), Positives = 311/433 (72%), Gaps = 10/433 (2%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
              ++K T EQ+ VLD +  G SVF+TGSAGTGKT L++HII+ L++ +G S V+VTASTG+
Sbjct  50    AKIKLTDEQNNVLDHVRGGLSVFITGSAGTGKTVLLKHIIKILKKTYGESGVFVTASTGI  109

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +ACAL G TLHSFAGI +G+     LL  V ++R  R RW   Q L+IDEISL+  +L+D
Sbjct  110   AACALGGQTLHSFAGIRIGDGNRGMLLDLVLNDREARRRWNKAQVLVIDEISLVDADLFD  169

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIF---NKNTQKFAFEASSWKLS  1140
             KLE+IA+ +R S      + VWGGI++V SGDFFQLPPIF   + + ++FAFEA  W  S
Sbjct  170   KLEYIAKTVRES------DKVWGGIRLVVSGDFFQLPPIFKGHDPSRKEFAFEADCWDAS  223

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDD  1320
             FD Q++LT +FRQS+ + +KLLQG+R+G  D EDL  L+  CS  EP P AV+LYPR DD
Sbjct  224   FDIQVELTKIFRQSENRFIKLLQGVRRGNSDPEDLQFLKQSCSASEPHPSAVRLYPRIDD  283

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARH  1500
             V +VN++ + +L ++ + Y A+D G+  WK QL LG+APD L LC GARVML KNLN  H
Sbjct  284   VNKVNEEKMKALSEEQVIYEAIDRGKKPWKRQLALGLAPDKLVLCKGARVMLIKNLNVMH  343

Query  1501  KLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRK  1680
             +LVNGA G V GF    G       N LPVVKFD  P +++I P+ W +M G   VA R 
Sbjct  344   RLVNGATGIVTGFTETKGGTVLSPDNLLPVVKFDSGP-EMVIEPQKWYVMVGSRPVAWRL  402

Query  1681  QIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIK  1860
             Q+PL+LAWALSIHKCQGM+L+ ++TDL+RAFGYGMVYVALSRV+SL+GLHLS F+P+ IK
Sbjct  403   QLPLVLAWALSIHKCQGMSLDRIHTDLSRAFGYGMVYVALSRVRSLDGLHLSGFSPSKIK  462

Query  1861  VHPKVLNFDKRLC  1899
              HPKVL F   L 
Sbjct  463   AHPKVLEFYSHLA  475



>ref|XP_004306279.1| PREDICTED: DNA repair and recombination protein pif1, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=515

 Score =   491 bits (1263),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 251/443 (57%), Positives = 313/443 (71%), Gaps = 10/443 (2%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             +T+++WT EQ Q++ AIS GKSVF+TGSAGTGKT L+QH+I+ L+  H  S+V+VTA TG
Sbjct  49    KTKIQWTDEQKQIISAISEGKSVFITGSAGTGKTILVQHVIKLLKRQHRASKVFVTAPTG  108

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+ACA+ G TLH FAGIG   A  E LLH++  N +  +RW  V+AL+IDEIS++  E +
Sbjct  109   VAACAIGGQTLHCFAGIGYPMADRETLLHRIVLNNKAYNRWLKVKALVIDEISMVDTEFF  168

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIF---NKNTQKFAFEASSWKL  1137
             + LE+IAR IR  +N S     WGGIQ+V  GDFFQLPPI    N   ++FAFEA  W  
Sbjct  169   ESLEYIARNIRQ-VNKS-----WGGIQIVVGGDFFQLPPIKPQQNSGGREFAFEADCWNS  222

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRND  1317
             SFD Q+ LT VFRQSDP+L+KLL GIR+GE D EDL  LE  CS  EPDP  V+LYPR +
Sbjct  223   SFDLQVSLTKVFRQSDPRLIKLLNGIRRGESDPEDLMFLEQSCSEAEPDPSVVQLYPRIE  282

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV RVN   L SL  + + Y A+D+GE+S K QL+ GIAP  + LC  ARVML KNLN  
Sbjct  283   DVNRVNASRLVSLGNEFVIYTAIDSGEESRKSQLEQGIAPKEVTLCKDARVMLVKNLNTW  342

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA GTV GF            + LP+VKFD  P +++I PETW++ +G++VVA R
Sbjct  343   RGLVNGATGTVQGFYVPKNKDIAGVCHALPIVKFDSGP-EMLIEPETWAVTEGDKVVAER  401

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             KQ+PLILAWA SIHKCQGMTL+CL+TDL++AF  GMVYVALSRV+SLEGL+LS FN   I
Sbjct  402   KQVPLILAWASSIHKCQGMTLDCLHTDLSKAFENGMVYVALSRVRSLEGLYLSGFNRWKI  461

Query  1858  KVHPKVLNFDKRLCSQPDQPKED  1926
              VHPKVL F K    +  Q + D
Sbjct  462   MVHPKVLLFYKSFSGEVAQEEND  484



>ref|XP_010275115.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Nelumbo nucifera]
Length=532

 Score =   488 bits (1255),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 243/429 (57%), Positives = 316/429 (74%), Gaps = 11/429 (3%)
 Frame = +1

Query  622   WTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACA  801
             WT +Q QVL A++ GKSVF+TGSAGTGKT L++ ++  L+++H R  V+VTASTGV+ACA
Sbjct  102   WTNQQLQVLKAVAEGKSVFITGSAGTGKTILLKRVVEVLKQLHTRKSVFVTASTGVAACA  161

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             L+G TLHSFAGIG G+   E LL  + +  +  +RWK  +AL+IDEIS++  +L+D LE+
Sbjct  162   LSGQTLHSFAGIGFGDGDRESLL--LTAKSKSSYRWKRARALVIDEISMVDADLFDTLEY  219

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNK---NTQKFAFEASSWKLSFDTQ  1152
             IAR+IR   +G      W G+Q++ SGDFFQLPPI N+   + ++FAFEA  W  SFD Q
Sbjct  220   IAREIRRKESGRP----WSGLQLIVSGDFFQLPPIGNRLSLSGKEFAFEADCWDRSFDLQ  275

Query  1153  IDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRV  1332
             I+LT VFRQSD +LV+LLQGIR+G+ D E L LL++     EPD    +L+PR +DV RV
Sbjct  276   IELTQVFRQSDLKLVELLQGIRRGDNDPERLKLLQDRTVTSEPDFSVTRLFPRKNDVSRV  335

Query  1333  NKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVN  1512
             NK+ L SL ++ + Y A+D G++ WK QLKLGI PD +ELCVGARVML KN+     LVN
Sbjct  336   NKERLRSLGRETVTYTALDVGQEPWKSQLKLGITPDEVELCVGARVMLLKNIAQWDGLVN  395

Query  1513  GAAGTVIGFESVNG-TYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             GA GT+ GF+       +   +  LP V+FD  P +++I PE W++M+G+ V+A RKQIP
Sbjct  396   GATGTITGFKQRETVAIDICCSQLLPSVQFDSGP-EIVILPEKWNVMEGDTVLATRKQIP  454

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L+LAWALSIHKCQGMTLNCL TDL+RAFG GMVYVALSRV+SLEGL+LS FNP+ IK HP
Sbjct  455   LMLAWALSIHKCQGMTLNCLNTDLSRAFGCGMVYVALSRVRSLEGLYLSGFNPSKIKAHP  514

Query  1870  KVLNFDKRL  1896
             KVL F +RL
Sbjct  515   KVLEFYQRL  523



>ref|XP_010035891.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Eucalyptus grandis]
Length=511

 Score =   486 bits (1252),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 253/458 (55%), Positives = 321/458 (70%), Gaps = 16/458 (3%)
 Frame = +1

Query  607   RTR-VKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTAST  783
             RTR ++WT EQ++++ A+S G+SVFVTGSAGTGKT L++HII+ L++  GRSRV+VTAST
Sbjct  56    RTRHLQWTEEQTRIISAVSGGQSVFVTGSAGTGKTALLKHIIKLLKDSLGRSRVFVTAST  115

Query  784   GVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGEL  963
             GV+ACAL G TLHSFAGI      A  L   +  +++   RWK V+AL IDEIS++ GEL
Sbjct  116   GVAACALRGQTLHSFAGIRNPSHRASAL--DIYMDKKACKRWKKVRALFIDEISMVDGEL  173

Query  964   YDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI-FNKNT---QKFAFEASSW  1131
             +D LE IAR++R S         WGGIQ++ +GDF QLPPI  N N    ++FAFEA  W
Sbjct  174   FDDLECIAREVRESGE------TWGGIQLIVTGDFLQLPPIPRNGNCMSRKQFAFEADCW  227

Query  1132  KLSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPR  1311
             + SFD QI+LT VFRQSD +LVK+LQGIRKG+   +D   LE  C++ EPDP  V+LYPR
Sbjct  228   QSSFDLQIELTKVFRQSDERLVKVLQGIRKGQISPDDWEFLEESCASDEPDPSVVQLYPR  287

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLN  1491
             N+DV  VN   ++ L  +   + A D+G D WK Q++ G+APD + LC GARVML KN N
Sbjct  288   NEDVNEVNNSRIEELAAEGYFFTAADSGSDPWKRQVQRGMAPDEIFLCKGARVMLIKNKN  347

Query  1492  ARHKLVNGAAGTVIGF--ESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEV  1665
                 LVNGA GTV+ F         E      LPVVKFD   + ++I PETW ++DG+ V
Sbjct  348   TSRGLVNGAVGTVVEFVKPQDRDVSELCSEGVLPVVKFD-SGRTVVIEPETWYVVDGDSV  406

Query  1666  VAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFN  1845
             VA RKQIPLILAWALSIHKCQGM+L+ L+TDL R+FGYGMVYVALSRV+SL GLHLS F+
Sbjct  407   VAQRKQIPLILAWALSIHKCQGMSLDSLHTDLTRSFGYGMVYVALSRVRSLSGLHLSGFD  466

Query  1846  PNIIKVHPKVLNFDKRLCSQPDQPKEDAVTKKKQGGSS  1959
             P IIK HPK L F +RL  Q D+  ED  + +++ G S
Sbjct  467   PTIIKAHPKALEFYERLAHQHDKRSEDDGSSEEEHGCS  504



>ref|XP_010275116.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Nelumbo nucifera]
Length=523

 Score =   486 bits (1252),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 242/437 (55%), Positives = 317/437 (73%), Gaps = 12/437 (3%)
 Frame = +1

Query  622   WTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACA  801
             WT +Q +VL A++ G+SVF+TGSAGTGKT L++ ++  L++IH    V+VTASTGV+ACA
Sbjct  92    WTDQQLEVLKAVAEGQSVFITGSAGTGKTILLRRVVEVLKQIHNPKHVFVTASTGVAACA  151

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             LNG+TLHSFAGIG      E +L    SN+   +RWK  +AL+IDEIS++  +L+D L +
Sbjct  152   LNGHTLHSFAGIGRRTQDREAMLFNATSNKGAFYRWKRAKALVIDEISMVDADLFDTLGY  211

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNK-----NTQKFAFEASSWKLSFD  1146
             I+ +IR   +      +W GIQ++ SGDFFQLPP++N+     + ++FAFEA  W  SFD
Sbjct  212   ISGEIRYEKSSE----IWSGIQLIVSGDFFQLPPVWNRLSSSESGKEFAFEADWWNDSFD  267

Query  1147  TQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVY  1326
              QI+LT VFRQSD +L++LLQGIR+GE D E L LL +     EPD   ++L+PR DDV 
Sbjct  268   QQIELTQVFRQSDLKLIELLQGIRRGETDPEMLRLLYSRTVTSEPDSKVIRLFPRKDDVN  327

Query  1327  RVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKL  1506
             RVN++ L SL ++ I Y A+D G++ WK +LKLGIAPD +ELCVGARVMLTKN+     L
Sbjct  328   RVNQERLRSLGRETITYTALDVGQEPWKSELKLGIAPDEVELCVGARVMLTKNIALSDGL  387

Query  1507  VNGAAGTVIGFESVNGT--YETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRK  1680
             VNGA GT+ GF     T   +   +  LPVVKFD    +++I+PETW +M+G+ VVA RK
Sbjct  388   VNGATGTITGFIKPKRTVVMDICCSRLLPVVKFD-SGLEMVIKPETWDVMEGDAVVATRK  446

Query  1681  QIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIK  1860
             Q+PL+LAWALSIHKCQGMTLNCL+TDL+RAFG GMVYVALSRV+SLEGL+LS F P+ IK
Sbjct  447   QVPLMLAWALSIHKCQGMTLNCLHTDLSRAFGCGMVYVALSRVRSLEGLYLSGFKPSKIK  506

Query  1861  VHPKVLNFDKRLCSQPD  1911
              HPKVL F +R  +  D
Sbjct  507   AHPKVLEFYQRFSNSQD  523



>ref|XP_002520397.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42013.1| conserved hypothetical protein [Ricinus communis]
Length=512

 Score =   483 bits (1244),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 259/506 (51%), Positives = 335/506 (66%), Gaps = 30/506 (6%)
 Frame = +1

Query  460   IFSSAIATYRCFSSKAAAGKNRNLAQRAIsskkdssrnessssskppkkRTRVKWTVEQS  639
             + + AIA +R FS+K  + K    AQ                  K    + R+KWT E  
Sbjct  1     MMTRAIAVFRTFSAKTGS-KIPKTAQSG--------------YKKKTGNKPRIKWTEEHK  45

Query  640   QVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNGYTL  819
              +LD +  GKSVF+TGSAGTGKT L+ HII  L+  HG S V VTASTG +ACA+ G TL
Sbjct  46    GILDYVIRGKSVFITGSAGTGKTVLLGHIISILKRAHGSSGVVVTASTGSAACAIKGQTL  105

Query  820   HSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIR  999
             HSFAG G+G+   + LL +V  N R   RW  V+ L++DEIS+I G  +D LEFIAR+IR
Sbjct  106   HSFAGFGIGDGDPKALLERVVRNSRACKRWNQVKVLVVDEISMIGGNTFDTLEFIARQIR  165

Query  1000  SSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT---QKFAFEASSWKLSFDTQIDLTTV  1170
              S N      VWGGIQ++ SGDFFQLP +  K+    ++FAFEA  W  SF  Q+++T V
Sbjct  166   GSNN------VWGGIQLIVSGDFFQLPLVLKKSNPSGKEFAFEADCWNRSFHAQVEITKV  219

Query  1171  FRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRVNKKHLD  1350
             FRQ+DPQL+ LLQGIRKG  D EDL LLE  CSN EPDP AV+LYPR +DV +VN+K L 
Sbjct  220   FRQTDPQLINLLQGIRKGVIDTEDLKLLEQCCSNNEPDPSAVRLYPRIEDVNKVNEKRLK  279

Query  1351  SLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAGTV  1530
             SL + ++ Y+AVD G  + KE LK G+A D LE+C GARVML KNL+   KL NGA GTV
Sbjct  280   SLGEKIVAYKAVDGG--TRKELLKQGMAQDQLEICKGARVMLIKNLHVWSKLCNGATGTV  337

Query  1531  IGF-ESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLILAWA  1707
             IGF E  +   + F  N LPV+KFD   K  +I+P+ W   +G++ VA R Q+PL LA+A
Sbjct  338   IGFVEPYDDVIDLFPDNLLPVIKFD-SGKVTVIKPQKWECYEGDDFVAWRSQLPLRLAYA  396

Query  1708  LSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFD  1887
             LSIHKCQGMT++CLYTDL+R+F YGMVY  LSR ++++G+ LS F P++IK +PKVL+F 
Sbjct  397   LSIHKCQGMTIDCLYTDLSRSFIYGMVYAVLSRGRTMKGIQLSGFEPSMIKANPKVLHFY  456

Query  1888  KRLCSQ--PDQPKEDAVTKKKQGGSS  1959
              +L S+   +    D VT KK+  +S
Sbjct  457   DQLSSKQCTEAGDVDDVTYKKKVSNS  482



>ref|XP_011011003.1| PREDICTED: ATP-dependent DNA helicase PIF1-like isoform X1 [Populus 
euphratica]
Length=493

 Score =   476 bits (1225),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 243/431 (56%), Positives = 302/431 (70%), Gaps = 10/431 (2%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             +WT EQ  +   +  G SVF+TGSAGTGKT L++HII  L+++HG+S+V+VTASTG++AC
Sbjct  54    EWTQEQKNIFSHVQRGASVFITGSAGTGKTDLLKHIIDILKDVHGKSKVFVTASTGIAAC  113

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
             AL G TLHSFA IG+  A +  LL KV  N+    RWK  +AL+IDEIS+IS +L++ LE
Sbjct  114   ALQGQTLHSFASIGIQNADSGTLLDKVKMNKHACKRWKKAKALVIDEISMISADLFESLE  173

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT---QKFAFEASSWKLSFDT  1149
             +IAR IR S      E+VWGGIQ++  GDFFQLPP+  +     ++FAFEA  W  SFD 
Sbjct  174   YIARDIRGS------EVVWGGIQLLVCGDFFQLPPVIKQQKLSGKEFAFEADCWNASFDL  227

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYR  1329
             Q++LT VFRQSDP+L+K+LQGIRKGE D EDL LLE  CS  + D L V LYPR +DV +
Sbjct  228   QVELTQVFRQSDPRLIKMLQGIRKGETDAEDLQLLEESCSMNKQDSLVVWLYPRINDVEK  287

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
             VN++ + SL +  + Y A D+G +  K+QL  GI PD L LCVGARVML  NLN    L 
Sbjct  288   VNEERMKSLGESTVTYAAADSGLEHRKKQLNQGIVPDQLVLCVGARVMLIMNLNIERNLC  347

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA GTV GF  +            P VKFD  P +L+I P+ + I +G+ VVA R QIP
Sbjct  348   NGATGTVTGFVPLEDKNARNSDILFPQVKFDRGP-ELLIEPQKFEIFEGDIVVAWRYQIP  406

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             LILAWA+SIHKCQGMTL+   TDL+RAFGYGMVYVALSRV+SLEGLHLS F P+ IK HP
Sbjct  407   LILAWAISIHKCQGMTLDHAQTDLSRAFGYGMVYVALSRVRSLEGLHLSGFTPSKIKAHP  466

Query  1870  KVLNFDKRLCS  1902
             KVL F K   S
Sbjct  467   KVLLFYKSFTS  477



>ref|XP_006380622.1| hypothetical protein POPTR_0007s09900g [Populus trichocarpa]
 gb|ERP58419.1| hypothetical protein POPTR_0007s09900g [Populus trichocarpa]
Length=540

 Score =   477 bits (1228),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 256/490 (52%), Positives = 325/490 (66%), Gaps = 15/490 (3%)
 Frame = +1

Query  445   RTMNLIFSSAIATYR-CFSSKAAAGKNRNLAQRAIsskkdssrnessssskppkkRTRVK  621
             R+M    S+ IA YR  FS+K++  +    AQ    ++     N     +K    +   +
Sbjct  46    RSMKFFSSAIIAVYRRSFSTKSS--RTTKYAQSVCQNRIKKETNRIPKDTKTH--QPLFE  101

Query  622   WTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACA  801
             W  EQ  +   +  G SVF+TGSAGTGKT L++HII  L+++HG+S+V+VTASTG++ACA
Sbjct  102   WAQEQKNIFSHVHRGASVFITGSAGTGKTVLLKHIIDILKDVHGKSKVFVTASTGIAACA  161

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             L G TLHSFA IG+  A +  LL KV  N+    RWK  +AL+IDEIS+IS +L++ LE+
Sbjct  162   LQGQTLHSFASIGIQNADSGTLLDKVKMNKHACKRWKKAKALVIDEISMISADLFESLEY  221

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT---QKFAFEASSWKLSFDTQ  1152
             IAR IR S      E+VWGGIQ++  GDFFQLPP+  +     ++FAFEA  W  SFD Q
Sbjct  222   IARDIRGS------EVVWGGIQLIVCGDFFQLPPVIKQQKLSGKEFAFEADCWNASFDLQ  275

Query  1153  IDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRV  1332
             ++LT VFRQSDP+L+K+LQGIRKGE D EDL LLE  CS  + D L V LYPR +DV +V
Sbjct  276   VELTQVFRQSDPRLIKMLQGIRKGETDAEDLQLLEESCSMNKQDSLVVWLYPRINDVEKV  335

Query  1333  NKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVN  1512
             N++ + SL +  + Y A D+G +  K+QL  GI PD L LCVGARVML  NLN    L N
Sbjct  336   NEERMKSLGESTVTYAAADSGLEHRKKQLNQGIVPDQLVLCVGARVMLIMNLNIERNLCN  395

Query  1513  GAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPL  1692
             GA GTV GF  V            P VKFD  P +++I P+ + I +G+ VVA R QIPL
Sbjct  396   GATGTVTGFVPVEDKNARKSDILFPQVKFDRGP-EILIEPQKFEIFEGDIVVAWRYQIPL  454

Query  1693  ILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPK  1872
             ILAWA+SIHKCQGMTL+   TDL+RAFGYGMVYVALSRV+SLEGLHLS F P+ IK HPK
Sbjct  455   ILAWAISIHKCQGMTLDHAQTDLSRAFGYGMVYVALSRVRSLEGLHLSGFTPSKIKAHPK  514

Query  1873  VLNFDKRLCS  1902
             VL F K   S
Sbjct  515   VLLFYKSFTS  524



>gb|KHM99615.1| ATP-dependent DNA helicase PIF1 [Glycine soja]
Length=516

 Score =   473 bits (1217),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 261/508 (51%), Positives = 338/508 (67%), Gaps = 31/508 (6%)
 Frame = +1

Query  472   AIATYRCFSSKAAAGKNRNLAQRAIsskkdssrnessssskppkkRTRVKWTVEQSQVLD  651
             A A YR FSSK  A  +      A +     ++N +++  +     ++++W+ EQ QVL 
Sbjct  10    AAAAYRTFSSKRVAKPS------AWALTNPKTKNTNTTVEQCRTPMSKIEWSEEQKQVLS  63

Query  652   AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNGYTLHSFA  831
             ++S GKSVF+TGSAGTGKT L++ II+ L  +H    VYVTASTGV+ACAL G TLHSFA
Sbjct  64    SVSEGKSVFITGSAGTGKTLLLEEIIKFLNRLHTPYGVYVTASTGVAACALKGQTLHSFA  123

Query  832   GIGL--GEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIRSS  1005
             GIG+   +   + L+ +V SN+    RW+ V+AL+IDEIS++S +L++ LEF+AR++R  
Sbjct  124   GIGIIFSDDDPQLLVERVLSNQGACRRWRKVEALVIDEISMVSAKLFESLEFVAREMR--  181

Query  1006  INGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-------KFAFEASSWKLSFDTQIDLT  1164
               G DE   WGGIQ+V SGDFFQLPP+ +            +AFEA  W  SFD Q++LT
Sbjct  182   --GVDE--TWGGIQLVVSGDFFQLPPVVSNKDNCCSSQGVMYAFEAECWNRSFDLQVELT  237

Query  1165  TVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHC---SNLEPDPLAVKLYPRNDDVYRVN  1335
              VFRQSD  L +LL+GIR+GE D +DL  LEN C   S  + DP  V+L+P N DV RVN
Sbjct  238   RVFRQSDYGLTRLLEGIRRGESDPQDLEFLENLCLGSSECDHDPSIVQLFPLNKDVERVN  297

Query  1336  KKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNG  1515
              + L SL +D++ YRAVD+G+  WK  L+ GI PD + LC GARVML KNL+  H LVNG
Sbjct  298   DERLRSLQKDVVVYRAVDSGKGHWKGNLRYGIVPDEISLCEGARVMLVKNLDTEHGLVNG  357

Query  1516  AAGTVIGFESVNGTYETFG----TNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQ  1683
             A G V+GF    G  E          LPVVKFD   K L I+P  W +MDG EVVA RKQ
Sbjct  358   ATGVVVGFSWSLGEEEHLSGICNDKVLPVVKFD-GGKFLTIKPAKWHLMDGPEVVACRKQ  416

Query  1684  IPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKV  1863
             IPLILAWA+SIHKCQGMTL  ++TDL+RAFG GMVYVALSRV+SLEGLHLS+FN + IKV
Sbjct  417   IPLILAWAMSIHKCQGMTLERVHTDLSRAFGCGMVYVALSRVRSLEGLHLSAFNRSKIKV  476

Query  1864  HPKVLNFDKRLCSQPDQPKEDAVTKKKQ  1947
               +V  F + L S+  + KE  V  +++
Sbjct  477   DQRVSRFYRSLASE--KSKEVMVVDRRR  502



>ref|XP_006586570.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Glycine max]
Length=516

 Score =   472 bits (1215),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 261/508 (51%), Positives = 338/508 (67%), Gaps = 31/508 (6%)
 Frame = +1

Query  472   AIATYRCFSSKAAAGKNRNLAQRAIsskkdssrnessssskppkkRTRVKWTVEQSQVLD  651
             A A YR FSSK  A  +      A +     ++N +++  +     ++++W+ EQ QVL 
Sbjct  10    AAAAYRTFSSKRVAKPS------AWALTNPKTKNTNTTVEQCRTPMSKIEWSEEQKQVLS  63

Query  652   AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNGYTLHSFA  831
             ++S GKSVF+TGSAGTGKT L++ II+ L  +H    VYVTASTGV+ACAL G TLHSFA
Sbjct  64    SVSEGKSVFITGSAGTGKTLLLEEIIKFLNRLHTPYGVYVTASTGVAACALKGQTLHSFA  123

Query  832   GIGL--GEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIRSS  1005
             GIG+   +   + L+ +V SN+    RW+ V+AL+IDEIS++S +L++ LEF+AR++R  
Sbjct  124   GIGIIFSDDDPQLLVERVLSNQGACRRWRKVEALVIDEISMVSAKLFESLEFVAREMR--  181

Query  1006  INGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-------KFAFEASSWKLSFDTQIDLT  1164
               G DE   WGGIQ+V SGDFFQLPP+ +            +AFEA  W  SFD Q++LT
Sbjct  182   --GVDE--TWGGIQLVVSGDFFQLPPVVSNKDYCCSSQGVMYAFEAECWNRSFDLQVELT  237

Query  1165  TVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHC---SNLEPDPLAVKLYPRNDDVYRVN  1335
              VFRQSD  L +LL+GIR+GE D +DL  LEN C   S  + DP  V+L+P N DV RVN
Sbjct  238   RVFRQSDYGLTRLLEGIRRGESDPQDLEFLENLCLGSSECDHDPSIVQLFPLNKDVERVN  297

Query  1336  KKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNG  1515
              + L SL +D++ YRAVD+G+  WK  L+ GI PD + LC GARVML KNL+  H LVNG
Sbjct  298   DERLRSLQKDVVVYRAVDSGKGHWKGNLRYGIVPDEISLCEGARVMLVKNLDTEHGLVNG  357

Query  1516  AAGTVIGFESVNGTYETFG----TNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQ  1683
             A G V+GF    G  E          LPVVKFD   K L I+P  W +MDG EVVA RKQ
Sbjct  358   ATGVVVGFSWSLGEEEHLSGICNDKVLPVVKFD-GGKFLTIKPAKWHLMDGPEVVACRKQ  416

Query  1684  IPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKV  1863
             IPLILAWA+SIHKCQGMTL  ++TDL+RAFG GMVYVALSRV+SLEGLHLS+FN + IKV
Sbjct  417   IPLILAWAMSIHKCQGMTLERVHTDLSRAFGCGMVYVALSRVRSLEGLHLSAFNRSKIKV  476

Query  1864  HPKVLNFDKRLCSQPDQPKEDAVTKKKQ  1947
               +V  F + L S+  + KE  V  +++
Sbjct  477   DQRVSRFYRSLASE--KSKEVMVVDRRR  502



>ref|XP_010695976.1| PREDICTED: ATP-dependent DNA helicase pfh1-like [Beta vulgaris 
subsp. vulgaris]
Length=473

 Score =   471 bits (1211),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 241/434 (56%), Positives = 313/434 (72%), Gaps = 14/434 (3%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVS  792
             +V+WT +Q QV DAI   +SVF+TGSAGTGKT LI+ +I+ LR+I+G+  V VTASTGV 
Sbjct  44    KVQWTDQQLQVFDAIVRRESVFITGSAGTGKTKLIEEVIKSLRKIYGKKEVCVTASTGVV  103

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             ACAL G TLHSFAG+GL EA A+ LL +V  N+RV  RWKMV+AL++DEIS++ GEL+DK
Sbjct  104   ACALGGQTLHSFAGVGLAEADADILLSRVLDNKRVSKRWKMVKALVVDEISMVEGELFDK  163

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI-FNKNTQK---FAFEASSWKLS  1140
             LE+IAR IR      +++  WGGIQ+V SGDF QLPP+   KN+ +   FAFEA SW+ S
Sbjct  164   LEYIARMIR------EKDEPWGGIQLVVSGDFLQLPPVNVGKNSGRGKVFAFEADSWEHS  217

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDD  1320
             F  Q+ L TVFRQSDP+L++LLQGIR GE D E L LLE    + EP+   V+L+PR  D
Sbjct  218   FQLQVGLNTVFRQSDPELIRLLQGIRSGELDTEGLELLEKRRCSREPEETVVRLFPRITD  277

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARH  1500
             V +VN+  L  L + +I Y A D G+  W  QL  G+AP  L+LC GARVMLTKNLN + 
Sbjct  278   VNQVNEMRLKRLGEKIIVYEAFDTGDKPWIGQLDRGMAPKKLQLCKGARVMLTKNLNVKG  337

Query  1501  KLVNGAAGTVIGFESV--NGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAV  1674
             KLVNGA GT++GF+ V      +  G   LP+VKFD   +K+ I P TW++M G+   A 
Sbjct  338   KLVNGATGTIMGFKIVVEGNIAKICGGKLLPIVKFDSGGEKM-IEPATWNVMVGDRKCAT  396

Query  1675  RKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSS-FNPN  1851
             R Q+PLILAWA+SIHK QGMTL+ L+T+L+ AFG+GM+YVALSR++SL+GL  SS  +P+
Sbjct  397   RLQLPLILAWAMSIHKSQGMTLDRLHTNLSEAFGFGMIYVALSRLRSLDGLSFSSDLDPS  456

Query  1852  IIKVHPKVLNFDKR  1893
              I+ HPKVL + K+
Sbjct  457   KIRAHPKVLEYYKK  470



>ref|XP_011011004.1| PREDICTED: ATP-dependent DNA helicase PIF1-like isoform X2 [Populus 
euphratica]
Length=464

 Score =   462 bits (1190),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 235/418 (56%), Positives = 295/418 (71%), Gaps = 10/418 (2%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             +WT EQ  +   +  G SVF+TGSAGTGKT L++HII  L+++HG+S+V+VTASTG++AC
Sbjct  54    EWTQEQKNIFSHVQRGASVFITGSAGTGKTDLLKHIIDILKDVHGKSKVFVTASTGIAAC  113

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
             AL G TLHSFA IG+  A +  LL KV  N+    RWK  +AL+IDEIS+IS +L++ LE
Sbjct  114   ALQGQTLHSFASIGIQNADSGTLLDKVKMNKHACKRWKKAKALVIDEISMISADLFESLE  173

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT---QKFAFEASSWKLSFDT  1149
             +IAR IR S      E+VWGGIQ++  GDFFQLPP+  +     ++FAFEA  W  SFD 
Sbjct  174   YIARDIRGS------EVVWGGIQLLVCGDFFQLPPVIKQQKLSGKEFAFEADCWNASFDL  227

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYR  1329
             Q++LT VFRQSDP+L+K+LQGIRKGE D EDL LLE  CS  + D L V LYPR +DV +
Sbjct  228   QVELTQVFRQSDPRLIKMLQGIRKGETDAEDLQLLEESCSMNKQDSLVVWLYPRINDVEK  287

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
             VN++ + SL +  + Y A D+G +  K+QL  GI PD L LCVGARVML  NLN    L 
Sbjct  288   VNEERMKSLGESTVTYAAADSGLEHRKKQLNQGIVPDQLVLCVGARVMLIMNLNIERNLC  347

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA GTV GF  +            P VKFD  P +L+I P+ + I +G+ VVA R QIP
Sbjct  348   NGATGTVTGFVPLEDKNARNSDILFPQVKFDRGP-ELLIEPQKFEIFEGDIVVAWRYQIP  406

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKV  1863
             LILAWA+SIHKCQGMTL+   TDL+RAFGYGMVYVALSRV+SLEGLHLS F P+ IK+
Sbjct  407   LILAWAISIHKCQGMTLDHAQTDLSRAFGYGMVYVALSRVRSLEGLHLSGFTPSKIKL  464



>ref|XP_009378368.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Pyrus x bretschneideri]
Length=584

 Score =   443 bits (1140),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 230/448 (51%), Positives = 302/448 (67%), Gaps = 26/448 (6%)
 Frame = +1

Query  463   FSSAIATYRCFSSKAAAGKNRNLAQRAIsskkdssrnessssskppkkRTRVKWTVEQSQ  642
             F+ A +  R FS+K + GK+ N  Q                   P  K  RVKWT +Q +
Sbjct  7     FAYAFSAQRNFSTKTS-GKSINCVQ-------------DKYKFAPKPKNPRVKWTEQQKE  52

Query  643   VLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNGYTLH  822
             ++ AIS GKSVF+TGSAGTGKT L++HII+ L+  +  S+V+VTA TGV+ACA++G TLH
Sbjct  53    IISAISEGKSVFITGSAGTGKTMLVKHIIKLLKRCYTPSKVFVTAPTGVAACAISGQTLH  112

Query  823   SFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIRS  1002
             SFAGIG G    + LL +V SN+    +W   +AL+IDEIS++ GEL D LE+IA+ +R 
Sbjct  113   SFAGIGCGNDDRDTLLSRVLSNKEACRKWSKAEALVIDEISMVDGELLDSLEYIAKYVRQ  172

Query  1003  SINGSDEEMVWGGIQVVASGDFFQLPPI---FNKNTQKFAFEASSWKLSFDTQIDLTTVF  1173
                  DE  +WGG+Q+V  GDFFQLPP+   +N  +++FAFEA  W+ SFD Q++LT VF
Sbjct  173   I----DE--IWGGMQLVVGGDFFQLPPVKTEWNSESKEFAFEADCWESSFDLQVNLTKVF  226

Query  1174  RQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRVNKKHLDS  1353
             RQSDP+L+++LQGIR GE D EDL  LEN C++ EPDP AV+ YPR  DV RVN   L+S
Sbjct  227   RQSDPRLIRILQGIRTGEIDPEDLKFLENSCADSEPDPSAVQFYPRIQDVNRVNASRLES  286

Query  1354  LHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAGTVI  1533
             L  +L+ Y +VD+G D WK QL+  IAP  + LC  ARVML KNLN +  LVNGA GTV+
Sbjct  287   LGNELVVYTSVDSGHDPWKRQLEQVIAPKEIGLCKDARVMLLKNLNTQRGLVNGATGTVM  346

Query  1534  GFESVN--GTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLILAWA  1707
              F      G         LP+VKFD    K +I+P+TW + +G+ VVA R+Q+PL LAWA
Sbjct  347   AFRKTKDVGLTSICDGGLLPIVKFDSGIIK-VIKPKTWDVTEGDSVVAQREQLPLTLAWA  405

Query  1708  LSIHKCQGMTLNCLYTDLNRAFGYGMVY  1791
              SIHKCQGMTL+ LYT+L+++FGYGMVY
Sbjct  406   SSIHKCQGMTLDRLYTNLSKSFGYGMVY  433



>gb|KCW47396.1| hypothetical protein EUGRSUZ_K01193, partial [Eucalyptus grandis]
Length=355

 Score =   382 bits (982),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 196/360 (54%), Positives = 248/360 (69%), Gaps = 13/360 (4%)
 Frame = +1

Query  886   NRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIRSSINGSDEEMVWGGIQVVASGD  1065
             +++   RWK V+AL IDEIS++ GEL+D LE IAR++R S         WGGIQ++ +GD
Sbjct  2     DKKACKRWKKVRALFIDEISMVDGELFDDLECIAREVRESGE------TWGGIQLIVTGD  55

Query  1066  FFQLPPI-FNKNT---QKFAFEASSWKLSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD  1233
             F QLPPI  N N    ++FAFEA  W+ SFD QI+LT VFRQSD +LVK+LQGIRKG+  
Sbjct  56    FLQLPPIPRNGNCMSRKQFAFEADCWQSSFDLQIELTKVFRQSDERLVKVLQGIRKGQIS  115

Query  1234  FEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKE  1413
              +D   LE  C++ EPDP  V+LYPRN+DV  VN   ++ L  +   + A D+G D WK 
Sbjct  116   PDDWEFLEESCASDEPDPSVVQLYPRNEDVNEVNNSRIEELAAEGYFFTAADSGSDPWKR  175

Query  1414  QLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAGTVIGF--ESVNGTYETFGTNWLP  1587
             Q++ G+APD + LC GARVML KN N    LVNGA GTV+ F         E      LP
Sbjct  176   QVQRGMAPDEIFLCKGARVMLIKNKNTSRGLVNGAVGTVVEFVKPQDRDVSELCSEGVLP  235

Query  1588  VVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNR  1767
             VVKFD   + ++I PETW ++DG+ VVA RKQIPLILAWALSIHKCQGM+L+ L+TDL R
Sbjct  236   VVKFD-SGRTVVIEPETWYVVDGDSVVAQRKQIPLILAWALSIHKCQGMSLDSLHTDLTR  294

Query  1768  AFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKEDAVTKKKQ  1947
             +FGYGMVYVALSRV+SL GLHLS F+P IIK HPK L F +RL  Q D+  ED  + +++
Sbjct  295   SFGYGMVYVALSRVRSLSGLHLSGFDPTIIKAHPKALEFYERLAHQHDKRSEDDGSSEEE  354



>ref|XP_002975258.1| hypothetical protein SELMODRAFT_451567 [Selaginella moellendorffii]
 gb|EFJ23459.1| hypothetical protein SELMODRAFT_451567 [Selaginella moellendorffii]
Length=580

 Score =   374 bits (961),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 200/429 (47%), Positives = 279/429 (65%), Gaps = 17/429 (4%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             EQ +VL+A+   +SVFVTGSAGTGK+++++  I+ LR ++  S VYVTASTG++ACA+ G
Sbjct  159   EQLRVLEAVCNRQSVFVTGSAGTGKSYILERAIQVLRTVYHPSAVYVTASTGIAACAIGG  218

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              T H+FAG+G+G +  E+L+  V  ++  + RW    AL+IDEIS+I  EL+DK++F+ R
Sbjct  219   TTFHAFAGVGIGLSKKEQLVDMVMRSKEKKQRWLNAAALVIDEISMIDAELFDKVDFVGR  278

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNK-NTQKFAFEASSWKLSFDTQIDLTT  1167
              +R S      +  +GG+Q++ +GDFFQLPP+     T+ F F A  WK  FD Q++LT 
Sbjct  279   AVRRS------KERFGGLQLIVTGDFFQLPPVQKPGETKSFVFSAKCWKECFDLQMELTQ  332

Query  1168  VFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDP--LAVKLYPRNDDVYRVNKK  1341
             VFRQSD + V +L  IR+GE  F     L++ C+++   P     +LYPR  DV R N++
Sbjct  333   VFRQSDREFVGMLNEIRRGECSFATETRLKS-CTSISTAPGIEPTRLYPRRADVDRENEQ  391

Query  1342  HLDSLH--QDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNG  1515
              L SL+     + + A D+G     + L    A   + L +GA+VML KNL     LVNG
Sbjct  392   KLRSLNPSSKSVTFSAKDSGR---TQMLNGSRAEAEITLAIGAQVMLIKNLGTEQGLVNG  448

Query  1516  AAGTVIGFESVNGTYETFGT-NWLPVVKFDFK-PKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             A G V+GF +   +         LPVV+F+     + IIRPE WS+M+GE  VA R Q+P
Sbjct  449   ARGIVVGFTAPEKSELRISPGGGLPVVRFNHSGSSEWIIRPEAWSVMEGEVEVAKRLQLP  508

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             LILAWALS+HKCQGMTL+C+ TDL+R F YGMVYVALSRV+SL GL L  F+P  I+VHP
Sbjct  509   LILAWALSVHKCQGMTLDCVETDLSRTFEYGMVYVALSRVRSLHGLRLLGFDPLKIRVHP  568

Query  1870  KVLNFDKRL  1896
             +V+ F  +L
Sbjct  569   EVVTFYDQL  577



>ref|XP_002987435.1| hypothetical protein SELMODRAFT_451566 [Selaginella moellendorffii]
 gb|EFJ11522.1| hypothetical protein SELMODRAFT_451566 [Selaginella moellendorffii]
Length=580

 Score =   374 bits (961),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 200/429 (47%), Positives = 279/429 (65%), Gaps = 17/429 (4%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             EQ +VL+A+   +SVFVTGSAGTGK+++++  I+ LR ++  S VYVTASTG++ACA+ G
Sbjct  159   EQLRVLEAVCNRQSVFVTGSAGTGKSYILERAIQVLRTVYHPSAVYVTASTGIAACAIGG  218

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              T H+FAG+G+G +  E+L+  V  ++  + RW    AL+IDEIS+I  EL+DK++F+ R
Sbjct  219   TTFHAFAGVGIGLSKKEQLVDMVMRSKEKKQRWLNAAALVIDEISMIDAELFDKVDFVGR  278

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNK-NTQKFAFEASSWKLSFDTQIDLTT  1167
              +R S      +  +GG+Q++ +GDFFQLPP+     T+ F F A  WK  FD Q++LT 
Sbjct  279   AVRRS------KERFGGLQLIVTGDFFQLPPVQKPGETKSFVFNAKCWKECFDLQMELTQ  332

Query  1168  VFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDP--LAVKLYPRNDDVYRVNKK  1341
             VFRQSD + V +L  IR+GE  F     L++ C+++   P     +LYPR  DV R N++
Sbjct  333   VFRQSDREFVGMLNEIRRGECSFATETRLKS-CTSISTAPGIEPTRLYPRRADVDRENEQ  391

Query  1342  HLDSLH--QDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNG  1515
              L SL+     + + A D+G     + L    A   + L +GA+VML KNL     LVNG
Sbjct  392   KLRSLNPSSKSVTFSAKDSGR---TQMLNGSRAEAEITLAIGAQVMLIKNLGTEQGLVNG  448

Query  1516  AAGTVIGFESVNGTYETFGT-NWLPVVKFDFK-PKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             A G V+GF +   +         LPVV+F+     + IIRPE WS+M+GE  VA R Q+P
Sbjct  449   ARGIVVGFTAPEKSELRISPGGGLPVVRFNHSGSSEWIIRPEAWSVMEGEVEVAKRLQLP  508

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             LILAWALS+HKCQGMTL+C+ TDL+R F YGMVYVALSRV+SL GL L  F+P  I+VHP
Sbjct  509   LILAWALSVHKCQGMTLDCVETDLSRTFEYGMVYVALSRVRSLHGLRLLGFDPLKIRVHP  568

Query  1870  KVLNFDKRL  1896
             +V+ F  +L
Sbjct  569   EVVTFYDQL  577



>ref|XP_002795884.1| DNA repair and recombination protein pif1 [Paracoccidioides sp. 
'lutzii' Pb01]
 gb|EEH40535.1| DNA repair and recombination protein pif1 [Paracoccidioides sp. 
'lutzii' Pb01]
Length=797

 Score =   322 bits (826),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 204/477 (43%), Positives = 268/477 (56%), Gaps = 67/477 (14%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ +V+DAI   GKS+F TGSAGTGK+ L++ IIRKLRE + +   R+ VTASTG++AC 
Sbjct  278   EQKRVVDAIVQDGKSIFFTGSAGTGKSVLMREIIRKLREKYKKEPDRIAVTASTGLAACN  337

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+ +  +L+ KV  N++ + RW   + LI+DEIS++ G+L+DKLE 
Sbjct  338   IEGVTLHSFAGIGLGKESVADLVKKVKRNQKNKTRWLRTKVLIVDEISMVDGDLFDKLEE  397

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT-QKFAFEASSWKLSFDTQID  1158
             IARKIR+  NG      +GGIQ+V +GDFFQLPP+ +     KFAF AS+W  +    I 
Sbjct  398   IARKIRN--NGRP----FGGIQLVITGDFFQLPPVPDSTKLAKFAFSASTWNTTIQHTIL  451

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRNDD  1320
             LT VFRQ DP+   +L  IR G+        F+ L+   N    LE    A +L+P   +
Sbjct  452   LTQVFRQKDPKFASMLNEIRLGKLSQETIDAFKQLSRPLNFHDALE----ATELFPTRSE  507

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLGIAPDFLELCVGARVMLTKNLN  1491
             V   N   ++ L  + + Y AVD G    ++ + QL        L+L  GA+VML KN++
Sbjct  508   VENANSARMNRLSGETMVYTAVDGGTMQNEAQRSQLLADCVTPILQLKKGAQVMLIKNMD  567

Query  1492  ARHKLVNGAAGTVIG------------------------------------FESVNGTYE  1563
                 LVNG+ G V+                                     FE+ NGT  
Sbjct  568   --ETLVNGSLGKVVAFMDEARFDYYSKSDGNFAGDQSYADCSTQAMSKLKSFENKNGTVS  625

Query  1564  TFGTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQG  1731
               G  W PVV F   D   + L+ +PETW I +   EV A R Q+PLILAWALSIHK QG
Sbjct  626   PKGL-W-PVVCFVQPDGTERHLLCQPETWKIELPNGEVRAQRTQVPLILAWALSIHKAQG  683

Query  1732  MTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              TL  +  DL R F  G  YVALSR  S  GL +S F+P  + VHPKVL F   L S
Sbjct  684   QTLQRVKVDLGRVFEKGQAYVALSRAVSQAGLQVSRFDPRRVMVHPKVLEFYSNLSS  740



>gb|EKC25648.1| ATP-dependent DNA helicase PIF1 [Crassostrea gigas]
Length=619

 Score =   317 bits (812),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 185/431 (43%), Positives = 258/431 (60%), Gaps = 25/431 (6%)
 Frame = +1

Query  616   VKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSA  795
             VK + EQS +LDA+  GK+VF TGSAGTGK+FL++ II  L   H     Y TASTGV+A
Sbjct  195   VKLSKEQSTILDAVLKGKNVFFTGSAGTGKSFLMRRIIGSLPPQH----TYATASTGVAA  250

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLH+FAGIG G A  E+ + ++ S  ++  +W+    L+IDEIS++SG  +DKL
Sbjct  251   CHIGGTTLHAFAGIGSGSAPLEQCV-QLASRPQIAQQWRKCHHLVIDEISMVSGAFFDKL  309

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQK-FAFEASSWKLSFDTQ  1152
             E +AR +R + N       +GGIQ++  GDF QLPP+     +K F F+A SW       
Sbjct  310   ETVARVVRKNDNP------FGGIQLIICGDFLQLPPVTKGTDKKTFCFQAKSWSRCVQVN  363

Query  1153  IDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLEN--HCSNLEPDPLAVKLYPRNDDVY  1326
             ++L  V RQ+D   + +LQ IR G+   E   +L    H    +   LA +L    +DV 
Sbjct  364   MELKEVRRQNDLSFISILQNIRLGKCSEETHQILRQTVHHEIQKNGILATRLCTHKEDVN  423

Query  1327  RVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLK-LGIAPDFLELCVGARVMLTKNLNARHK  1503
             ++N+ HL  L  +   + AVD GE+++K+QL+ L   P  + L VGA+VML KNL+ +  
Sbjct  424   KINQYHLGKLQGEEKTFVAVD-GEEAYKDQLEVLSPVPKKVVLKVGAQVMLAKNLDVQRG  482

Query  1504  LVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQ  1683
             LVNGA G V+GF+  N  Y        P+VKF    ++ +IRP  W+      V   RKQ
Sbjct  483   LVNGARGVVVGFDKKNQDY--------PLVKF-VSGEEEVIRPVRWTFKVSGAVFINRKQ  533

Query  1684  IPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKV  1863
             +PL LAWA+SIHK QGMTL+C+   L+R F  G  YVALSR KSLEGL +  F+ + +  
Sbjct  534   VPLKLAWAISIHKSQGMTLDCVEMSLSRVFEAGQTYVALSRAKSLEGLRILDFDRSCVLA  593

Query  1864  HPKVLNFDKRL  1896
             +P VL F  +L
Sbjct  594   NPDVLRFYHKL  604



>gb|EEQ89934.1| DNA repair and recombination protein pif1 [Blastomyces dermatitidis 
ER-3]
 gb|EGE80977.1| mitochondrial DNA helicase [Blastomyces dermatitidis ATCC 18188]
 gb|EQL37794.1| hypothetical protein BDFG_00843 [Blastomyces dermatitidis ATCC 
26199]
Length=798

 Score =   321 bits (823),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 201/472 (43%), Positives = 266/472 (56%), Gaps = 58/472 (12%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ +V++AI   GKS+F TGSAGTGK+ L++ IIR+LR  + R   RV VTASTG++AC 
Sbjct  261   EQKRVVEAIVKDGKSIFFTGSAGTGKSVLMREIIRQLRLRYKREPDRVAVTASTGLAACN  320

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    +L+ KV  N++ R RW   + LIIDEIS++ G+L+DKLE 
Sbjct  321   IEGVTLHSFAGIGLGKEPVADLVKKVKRNQKNRTRWLRTKVLIIDEISMVDGDLFDKLEE  380

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKN-TQKFAFEASSWKLSFDTQID  1158
             IARKIR+  NG      +GGIQ+V +GDFFQLPP+ +     KFAF AS+W  +    I 
Sbjct  381   IARKIRN--NGRP----FGGIQLVVTGDFFQLPPVPDSTKVAKFAFSASTWNTTIQHTIL  434

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVYRVN  1335
             LT VFRQ DP+   +L  +R G+   E +   +     L  D L A +L+P   +V   N
Sbjct  435   LTHVFRQKDPKFAAMLNEMRLGKLSTETIVAFKELARPLVDDTLEATELFPTRSEVENAN  494

Query  1336  KKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKL  1506
                +  L  + + + AVD G    ++ + QL        ++L  GA+VML KN++    L
Sbjct  495   SARMSRLSGETMVFTAVDGGTMQNEAQRSQLLADCVAPTIQLKKGAQVMLIKNMD--ESL  552

Query  1507  VNGAAGTVIGF------------------------------------ESVNGTYETFGTN  1578
             VNG+ G V+ F                                    E+  G+  T G  
Sbjct  553   VNGSLGKVVAFMDEAKFDYYCKHDANFDGGSANDDPNERTINKLKSYENATGSVSTRGI-  611

Query  1579  WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
             W PVV F   D   + L+ +PETW I +   EV A R QIPLILAWALSIHK QG TL  
Sbjct  612   W-PVVSFVQPDGTERHLLCQPETWKIELPNGEVRAQRTQIPLILAWALSIHKAQGQTLQR  670

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             +  DL R F  G  YVALSR  S +GL +S+F+P  + VHPKVL F   L S
Sbjct  671   VKVDLGRVFERGQAYVALSRATSKDGLQVSNFDPRRVMVHPKVLEFYSNLSS  722



>gb|EEH15751.1| hypothetical protein PABG_05838 [Paracoccidioides brasiliensis 
Pb03]
Length=798

 Score =   321 bits (822),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 204/477 (43%), Positives = 268/477 (56%), Gaps = 67/477 (14%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ +V+DAI   GKS+F TGSAGTGK+ L++ IIRKLRE + +   R+ VTASTG++AC 
Sbjct  279   EQKRVVDAIVQDGKSIFFTGSAGTGKSVLMREIIRKLREKYKKEPDRIAVTASTGLAACN  338

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+ +  +L+ KV  N++ + RW   + LI+DEIS++ G+L+DKLE 
Sbjct  339   IEGVTLHSFAGIGLGKESVADLVKKVKRNQKNKTRWLRTKVLIVDEISMVDGDLFDKLEE  398

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT-QKFAFEASSWKLSFDTQID  1158
             IARKIR+  NG      +GGIQ+V +GDFFQLPP+ +     KFAF AS+W  +    I 
Sbjct  399   IARKIRN--NGRP----FGGIQLVITGDFFQLPPVPDSTKLAKFAFSASTWNTTIQHTIL  452

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRNDD  1320
             LT VFRQ DP+   +L  IR G+        F+ L+   N    LE    A +L+P   +
Sbjct  453   LTQVFRQKDPKFASMLNEIRLGKLSQETIDAFKQLSRPLNFHDALE----ATELFPTRLE  508

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLGIAPDFLELCVGARVMLTKNLN  1491
             V   N   ++ L  + + Y AVD G    ++ + QL        L+L  GA+VML KN++
Sbjct  509   VENANSARMNRLSGETMVYTAVDGGTMQNEAQRSQLLADCVTPILQLKKGAQVMLIKNMD  568

Query  1492  ARHKLVNGAAGTVIG------------------------------------FESVNGTYE  1563
                 LVNG+ G V+                                     FE+ NGT  
Sbjct  569   --ESLVNGSLGKVVAFMDEARFDYYSKSDENFAGDQGYADRSAQTMSKLKSFENKNGTVN  626

Query  1564  TFGTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQG  1731
               G  W PVV F   D   + L+ +PETW I +   EV A R Q+PLILAWALSIHK QG
Sbjct  627   PKGL-W-PVVCFVQPDGTERHLLCQPETWKIELPNGEVRAQRTQVPLILAWALSIHKAQG  684

Query  1732  MTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              TL  +  DL R F  G  YVALSR  S  GL +S F+P  + VHPKVL F   L S
Sbjct  685   QTLQRVKVDLGRVFEKGQAYVALSRAVSQAGLQVSRFDPRRVMVHPKVLEFYSNLSS  741



>ref|XP_010762136.1| hypothetical protein PADG_06911 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH50832.2| hypothetical protein PADG_06911 [Paracoccidioides brasiliensis 
Pb18]
Length=797

 Score =   321 bits (822),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 204/477 (43%), Positives = 268/477 (56%), Gaps = 67/477 (14%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ +V+DAI   GKS+F TGSAGTGK+ L++ IIRKLRE + +   R+ VTASTG++AC 
Sbjct  278   EQKRVVDAIVQDGKSIFFTGSAGTGKSVLMREIIRKLREKYKKEPDRIAVTASTGLAACN  337

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+ +  +L+ KV  N++ + RW   + LI+DEIS++ G+L+DKLE 
Sbjct  338   IEGVTLHSFAGIGLGKESVADLVKKVKRNQKNKTRWLRTKVLIVDEISMVDGDLFDKLEE  397

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT-QKFAFEASSWKLSFDTQID  1158
             IARKIR+  NG      +GGIQ+V +GDFFQLPP+ +     KFAF AS+W  +    I 
Sbjct  398   IARKIRN--NGRP----FGGIQLVITGDFFQLPPVPDPTKLAKFAFSASTWNTTIQHTIL  451

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRNDD  1320
             LT VFRQ DP+   +L  IR G+        F+ L+   N    LE    A +L+P   +
Sbjct  452   LTQVFRQKDPKFASMLNEIRLGKLSQETIDAFKQLSRPLNFHDALE----ATELFPTRLE  507

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLGIAPDFLELCVGARVMLTKNLN  1491
             V   N   ++ L  + + Y AVD G    ++ + QL        L+L  GA+VML KN++
Sbjct  508   VENANSARMNRLSGETMVYTAVDGGTMQNEAQRSQLLADCVTPILQLKKGAQVMLIKNMD  567

Query  1492  ARHKLVNGAAGTVIG------------------------------------FESVNGTYE  1563
                 LVNG+ G V+                                     FE+ NGT  
Sbjct  568   --ESLVNGSLGKVVAFMDEARFDYYSKSDENFAGDQGYADRSAQTMSKLKSFENKNGTVN  625

Query  1564  TFGTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQG  1731
               G  W PVV F   D   + L+ +PETW I +   EV A R Q+PLILAWALSIHK QG
Sbjct  626   PKGL-W-PVVCFVQPDGTERHLLCQPETWKIELPNGEVRAQRTQVPLILAWALSIHKAQG  683

Query  1732  MTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              TL  +  DL R F  G  YVALSR  S  GL +S F+P  + VHPKVL F   L S
Sbjct  684   QTLQRVKVDLGRVFEKGQAYVALSRAVSQAGLQVSRFDPRRVMVHPKVLEFYSNLSS  740



>emb|CDS10156.1| hypothetical protein LRAMOSA02833 [Absidia idahoensis var. thermophila]
Length=733

 Score =   318 bits (814),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 191/458 (42%), Positives = 268/458 (59%), Gaps = 56/458 (12%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALN  807
             EQ +V +  ++  +SVF TGSAGTGK+ L++ II KL+ I+G + V VTASTG++AC ++
Sbjct  292   EQQRVYNIVVNDRQSVFFTGSAGTGKSVLLRAIIEKLKSIYG-AGVAVTASTGIAACNIS  350

Query  808   GYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIA  987
             G TLHSF+GIGLG+  A+ L  KV +N++ R  W   + LIIDEIS++ G+L+DK+E++A
Sbjct  351   GCTLHSFSGIGLGKDNADILAEKVMANKKKRDNWINTRVLIIDEISMVDGQLFDKIEYVA  410

Query  988   RKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT--QKFAFEASSWKLSFDTQIDL  1161
             R +R +         +GG+QVV +GDFFQLPP+  K     KFAFEA +W       I L
Sbjct  411   RAVRQN------SAPFGGLQVVITGDFFQLPPVSGKGAPASKFAFEAQTWNSVVKRTIML  464

Query  1162  TTVFRQSDPQLVKLLQGIRKGEYDFEDLN-------LLENHCSNLEPDPLAVKLYPRNDD  1320
               VFRQ D   VK+L  +R G+   E L        L E+H S L+P     +LYP  D 
Sbjct  465   KQVFRQKDETFVKILNEMRVGKLSTEALTTFRSLARLPESH-SKLKP----TELYPLRDS  519

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARH  1500
             V   N+  L+SL  + + +R+ D G    +      +APD L L + A+VML KN++A  
Sbjct  520   VNSANRTRLESLPGEPVIFRSRDYG----RVNADHFMAPDALHLKINAQVMLLKNMDA--  573

Query  1501  KLVNGAAGTVIGFESVNGTY-------------------------ETFGTNWLPVVKFDF  1605
              LVNG+ G V GF    G Y                         ++     LP+++F  
Sbjct  574   TLVNGSMGIVKGFAG-QGAYADPKKVRRYLLPNKYQGPQEEEPDVDSMCRRNLPIIEF-M  631

Query  1606  KPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYG  1782
               + +++  ETWSI M   E+VA R Q+PL+LAWA+SIHK QG TL+ +  DL +AF  G
Sbjct  632   NGRTIVVDNETWSIEMPNGEIVASRTQLPLMLAWAMSIHKSQGQTLDSVRVDLGKAFEKG  691

Query  1783  MVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
               YVALSR  SLE L + +FNP+++  HPKV  F KR+
Sbjct  692   QAYVALSRATSLESLQIVNFNPSVVMCHPKVTEFYKRI  729



>ref|XP_002621288.1| mitochondrial DNA helicase [Blastomyces dermatitidis SLH14081]
 gb|EEQ74105.1| mitochondrial DNA helicase [Blastomyces dermatitidis SLH14081]
Length=821

 Score =   320 bits (819),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 201/472 (43%), Positives = 265/472 (56%), Gaps = 58/472 (12%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ +V++AI   GKS+F TGSAGTGK+ L++ IIR+LR  + R   RV VTASTG++AC 
Sbjct  284   EQKRVVEAIVKDGKSIFFTGSAGTGKSVLMREIIRQLRLRYKREPDRVAVTASTGLAACN  343

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    +L+ KV  N++ R RW   + LIIDEIS++ G+L+DKLE 
Sbjct  344   IEGVTLHSFAGIGLGKEPVADLVKKVKRNQKNRTRWLRTKVLIIDEISMVDGDLFDKLEE  403

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKN-TQKFAFEASSWKLSFDTQID  1158
             IARKIR+  NG      +GGIQ+V +GDFFQLPP+ +     KFAF AS+W  +    I 
Sbjct  404   IARKIRN--NGRP----FGGIQLVVTGDFFQLPPVPDSTKVAKFAFSASTWNTTIQHTIL  457

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVYRVN  1335
             LT VFRQ DP+   +L  +R G+   E +   +     L  D L A +L+P   +V   N
Sbjct  458   LTHVFRQKDPKFAAMLNEMRLGKLSTETIVAFKELARPLVDDTLEATELFPTRSEVENAN  517

Query  1336  KKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKL  1506
                +  L    + + AVD G    ++ + QL        ++L  GA+VML KN++    L
Sbjct  518   SARMSRLSGKTMVFTAVDGGTMQNEAQRSQLLADCVAPTIQLKKGAQVMLIKNMD--ESL  575

Query  1507  VNGAAGTVIGF------------------------------------ESVNGTYETFGTN  1578
             VNG+ G V+ F                                    E+  G+  T G  
Sbjct  576   VNGSLGKVVAFMDEAKFDYYCKHDANFDGGSANDDPNERTINKLKSYENATGSVSTRGI-  634

Query  1579  WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
             W PVV F   D   + L+ +PETW I +   EV A R QIPLILAWALSIHK QG TL  
Sbjct  635   W-PVVSFVQPDGTERHLLCQPETWKIELPNGEVRAQRTQIPLILAWALSIHKAQGQTLQR  693

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             +  DL R F  G  YVALSR  S +GL +S+F+P  + VHPKVL F   L S
Sbjct  694   VKVDLGRVFERGQAYVALSRATSKDGLQVSNFDPRRVMVHPKVLEFYSNLSS  745



>ref|XP_001215348.1| DNA repair and recombination protein pif1, mitochondrial precursor 
[Aspergillus terreus NIH2624]
 gb|EAU33931.1| DNA repair and recombination protein pif1, mitochondrial precursor 
[Aspergillus terreus NIH2624]
Length=708

 Score =   315 bits (808),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 199/482 (41%), Positives = 275/482 (57%), Gaps = 71/482 (15%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLDA+   GKS+F TGSAGTGK+ L++ II+KLR+ + +   RV VTASTG++AC 
Sbjct  205   EQRHVLDAVVQHGKSIFFTGSAGTGKSVLMREIIKKLRDKYRKEPDRVAVTASTGLAACN  264

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ KV  N + R+RW   + LIIDE+S++ G+L+DKLE 
Sbjct  265   IGGVTLHSFAGIGLGKDKVPELVKKVKRNPKARNRWLRTKVLIIDEVSMVDGDLFDKLEE  324

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             +AR IR+  NG      +GGIQ+V +GDFFQLPP+    ++  KFAF A++W  S    I
Sbjct  325   VARLIRN--NGRP----FGGIQLVVTGDFFQLPPVPEGGSREAKFAFAAATWNTSIHHTI  378

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRND  1317
              LT VFRQ+DP+   +L  +R G+        F+ L+   N   +LE    A +L+P  +
Sbjct  379   LLTNVFRQADPEFAGMLNEMRLGKLSQRTIDVFKQLSRPLNFHDSLE----ATELFPTRN  434

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKN  1485
             +V   N   +  L  +L+ + AVD+G   ++ ++E+L    +AP  ++L  GA+VML KN
Sbjct  435   EVEHANGARMQRLSGELMTFNAVDSGTIQDEKFREKLLSNCMAPQVIQLKKGAQVMLIKN  494

Query  1486  LNARHKLVNGAAGTVIGFE---------------SVNGTYETFGTN--------------  1578
             +     LVNG+ G V+ F                S +G +  F  +              
Sbjct  495   ME--DTLVNGSIGRVVAFMDETTFEVYREHENDFSSSGDFNDFDEDSAVRARKKLKSAIN  552

Query  1579  ----------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSI  1716
                       W P+V F   D   + L+ +PETW I +   EV A R+QIPLILAWALSI
Sbjct  553   KDGGVVASRKW-PLVCFVQPDGSERHLLCQPETWKIELPNGEVQAQRQQIPLILAWALSI  611

Query  1717  HKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             HK QG TL  +  DL R F  G  YVALSR  S +GL ++ F+P  + VHPKV  F   L
Sbjct  612   HKAQGQTLQRVKVDLGRVFEKGQAYVALSRATSKDGLQVTRFDPRKVMVHPKVTEFYSNL  671

Query  1897  CS  1902
              S
Sbjct  672   VS  673



>ref|XP_009351018.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Pyrus x bretschneideri]
Length=607

 Score =   313 bits (801),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 187/467 (40%), Positives = 261/467 (56%), Gaps = 51/467 (11%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACAL  804
             EQ  +L  +  G S+F TGSAGTGK+ L++ II+ LR  + RS   + VTASTG++AC +
Sbjct  147   EQRHILQLVEEGHSIFYTGSAGTGKSVLLREIIKTLRRKYSRSLDAIAVTASTGIAACNI  206

Query  805   NGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFI  984
              G T+HSFAGIGLG  TAE+L  KV  N++   RW   Q LIIDE+S++ G+L+DKL  I
Sbjct  207   GGVTIHSFAGIGLGRETAEQLAIKVHKNKKATTRWLRTQVLIIDEVSMVEGDLFDKLARI  266

Query  985   ARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDLT  1164
                IR  +        +GGIQV+ +GDFFQLPP+      KFAFE   W  +     +LT
Sbjct  267   GSLIRKKVEP------FGGIQVIVTGDFFQLPPVARDTAVKFAFEGEMWSQTIKKTFNLT  320

Query  1165  TVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRNDDVYRVNK  1338
              VFRQ DP+ V +L  +R G    + ++  ++    +  E    A +L+PR +DV R N 
Sbjct  321   KVFRQKDPEFVDILNEMRFGRLTQKSIDKFKSLSREIIYEDGLGATELFPRREDVERSNT  380

Query  1339  KHLDSLHQDLIGYRAVDNGEDSWKEQ----LKLGIAPDFLELCVGARVMLTKNLNARHKL  1506
               +  +   +  ++AVD G  + KEQ    L   +AP+ L+L +GA+VML KNL+    L
Sbjct  381   VRMSGIEGTVHLFQAVDGGMITDKEQRNKLLSNFMAPETLKLKIGAQVMLIKNLD--ETL  438

Query  1507  VNGAAGTVIGFESVN----------------------------GTYETFGTNWLPVVKFD  1602
             VNG+ G V+ FE  +                            G   + GT  LPVV F 
Sbjct  439   VNGSIGMVVAFEDPSNPAALVDLDDPYAEKSQSKPASKVGKDAGKPTSKGT-LLPVVDF-  496

Query  1603  FKP----KKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNR  1767
               P    ++++++ E + +     EV A R Q+PLIL+WALSIHK QG TL  +  DL R
Sbjct  497   LIPGGLRRRVMVQSEVFKVEQPNGEVQASRTQLPLILSWALSIHKSQGQTLERVKVDLAR  556

Query  1768  AFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQP  1908
              F  G  YVALSR  SL GL + +FNP  + VHPKV+ + + L + P
Sbjct  557   VFEKGQAYVALSRATSLNGLQVLNFNPKKVTVHPKVVEWTRTLETVP  603



>ref|XP_001542316.1| predicted protein [Histoplasma capsulatum NAm1]
 gb|EDN05884.1| predicted protein [Histoplasma capsulatum NAm1]
Length=794

 Score =   316 bits (809),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 203/477 (43%), Positives = 273/477 (57%), Gaps = 67/477 (14%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ +V++AI   GKS+F TGSAGTGK+ L++ II+KLRE + +   R+ VTASTG++AC 
Sbjct  263   EQKRVVEAIVKDGKSIFFTGSAGTGKSVLMREIIKKLREKYKKEPDRIAVTASTGLAACN  322

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    +L+ KV  N++ R RW   + LIIDEIS++ G+L+DKLE 
Sbjct  323   IEGVTLHSFAGIGLGKGPVADLVKKVKQNQKNRTRWLRTKVLIIDEISMVDGDLFDKLEE  382

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IARKIR+  NG      +GGIQ+V +GDFFQLPP+ + +TQ  KFAF AS+W  +    I
Sbjct  383   IARKIRN--NGRP----FGGIQLVVTGDFFQLPPVPD-STQVAKFAFSASTWNTTIQHTI  435

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRND  1317
              LT VFRQ DP+   +L  +R G+        F+ L+   N    LE    A +L+P   
Sbjct  436   LLTHVFRQKDPKFAGMLNEMRLGKLSPETIAAFKQLSRPLNFHDALE----ATELFPTRS  491

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLGIAPDFLELCVGARVMLTKNL  1488
             +V   N   +  L  + + + AVD G    ++ + QL        ++L  GA+VML KN+
Sbjct  492   EVENANSARMARLSGETMVFTAVDGGTMQNEAQRSQLLADCVAPTIQLKKGAQVMLIKNM  551

Query  1489  NARHKLVNGAAGTVIGF---------------------------ESVNG--TYE----TF  1569
             +    LVNG+ G V+ F                           +++N   +YE    T 
Sbjct  552   D--ESLVNGSLGKVVAFMDEARFDYYTKNDEDFAGDPSHDDRKSQAINKVRSYENKIGTV  609

Query  1570  GTN--WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQG  1731
              TN  W PVV F   D   + L+ +PETW I +   EV A R Q+PLILAWALSIHK QG
Sbjct  610   STNGKW-PVVCFVQPDGTERHLLCQPETWKIELPNGEVRAQRTQVPLILAWALSIHKAQG  668

Query  1732  MTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              TL  +  DL R F  G  YVALSR  S  GL +S F+P  + VHPKVL F   L +
Sbjct  669   QTLQRVKVDLGRVFEKGQAYVALSRATSQAGLQVSRFDPRRVMVHPKVLEFYSNLST  725



>gb|EEH09926.1| DNA repair and recombination protein pif1 [Histoplasma capsulatum 
G186AR]
Length=794

 Score =   315 bits (808),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 200/476 (42%), Positives = 271/476 (57%), Gaps = 65/476 (14%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ +V++AI   GKS+F TGSAGTGK+ L++ II+KLRE + +   R+ VTASTG++AC 
Sbjct  263   EQKRVVEAIVKDGKSIFFTGSAGTGKSVLMREIIKKLREKYRKEPDRIAVTASTGLAACN  322

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    +L+ KV  N++ R RW   + L+IDEIS++ G+L+DKLE 
Sbjct  323   IEGVTLHSFAGIGLGKGPVADLVKKVKQNQKNRTRWLRTKVLVIDEISMVDGDLFDKLEE  382

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKN-TQKFAFEASSWKLSFDTQID  1158
             IARKIR+  NG      +GGIQ+V +GDFFQLPP+ +     KFAF AS+W  +    I 
Sbjct  383   IARKIRN--NGRP----FGGIQLVVTGDFFQLPPVPDSTKVAKFAFSASTWNTTIQHTIL  436

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRNDD  1320
             LT VFRQ DP+   +L  +R G+        F+ L+   N   +LE    A +L+P   +
Sbjct  437   LTHVFRQKDPKFAGMLNEMRLGKLSPETIAAFKQLSRPLNFHDSLE----ATELFPTRSE  492

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLGIAPDFLELCVGARVMLTKNLN  1491
             V   N   +  L  + + + AVD G    ++ + QL        ++L  GA+VML KN++
Sbjct  493   VENANSARMARLSGETMVFTAVDGGTMQNEAQRSQLLADCVAPTIQLKKGAQVMLIKNMD  552

Query  1492  ARHKLVNGAAGTVIGF---------------------------ESVNG--TYE----TFG  1572
                 LVNG+ G V+ F                           +++N   +YE    T  
Sbjct  553   --ESLVNGSLGKVVAFMDEARFDYYTKNDEDFAGDPSHDDRKSQAINKVRSYENKIGTVS  610

Query  1573  TN--WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGM  1734
             TN  W PVV F   D   + L+ +PETW I +   EV A R Q+PLILAWALSIHK QG 
Sbjct  611   TNGKW-PVVCFVQPDGTERHLLCQPETWKIELPNGEVRAQRTQVPLILAWALSIHKAQGQ  669

Query  1735  TLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             TL  +  DL R F  G  YVALSR  S  GL +S F+P  + VHPKVL F   L +
Sbjct  670   TLQRVKVDLGRVFEKGQAYVALSRATSQAGLQVSRFDPRRVMVHPKVLEFYSNLST  725



>gb|EER38765.1| DNA repair and recombination protein pif1 [Histoplasma capsulatum 
H143]
 gb|EGC44396.1| DNA repair and recombination protein pif1 [Histoplasma capsulatum 
H88]
Length=794

 Score =   315 bits (807),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 201/476 (42%), Positives = 270/476 (57%), Gaps = 65/476 (14%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ +V++AI   GKS+F TGSAGTGK+ L++ II+KLRE + +   R+ VTASTG++AC 
Sbjct  263   EQKRVVEAIVKDGKSIFFTGSAGTGKSVLMREIIKKLREKYKKEPDRIAVTASTGLAACN  322

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    +L+ KV  N++ R RW   + LIIDEIS++ G+L+DKLE 
Sbjct  323   IEGVTLHSFAGIGLGKEPVADLVKKVKQNQKNRTRWLRTKVLIIDEISMVDGDLFDKLEE  382

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKN-TQKFAFEASSWKLSFDTQID  1158
             IARKIR+  NG      +GGIQ+V +GDFFQLPP+ +     KFAF AS+W  +    I 
Sbjct  383   IARKIRN--NGRP----FGGIQLVVTGDFFQLPPVPDSTKVAKFAFSASTWNTTIQHTIL  436

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRNDD  1320
             LT VFRQ DP+   +L  +R G+        F+ L+   N    LE    A +L+P   +
Sbjct  437   LTHVFRQKDPKFAGMLNEMRLGKLSPETIAAFKQLSRPLNFHDALE----ATELFPTRSE  492

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLGIAPDFLELCVGARVMLTKNLN  1491
             V   N   +  L  + + + AVD G    ++ + QL        ++L  GA+VML KN++
Sbjct  493   VENANSARMARLSGETMVFTAVDGGTMQNEAQRSQLLADCVAPTIQLKKGAQVMLIKNMD  552

Query  1492  ARHKLVNGAAGTVIGF---------------------------ESVNG--TYE----TFG  1572
                 LVNG+ G V+ F                           +++N   +YE    T  
Sbjct  553   --ESLVNGSLGKVVAFMDEARFDYYTKNDEDFAGDPSHDDRKSQAINKVRSYENKIGTVS  610

Query  1573  TN--WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGM  1734
             TN  W PVV F   D   + L+ +PETW I +   EV A R Q+PLILAWALSIHK QG 
Sbjct  611   TNGKW-PVVCFVQPDGTERHLLCQPETWKIELPNGEVRAQRTQVPLILAWALSIHKAQGQ  669

Query  1735  TLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             TL  +  DL R F  G  YVALSR  S  GL +S F+P  + VHPKVL F   L +
Sbjct  670   TLQRVKVDLGRVFEKGQAYVALSRATSQAGLQVSRFDPRRVMVHPKVLEFYSNLST  725



>gb|EKG20445.1| ATPase AAA+ type core [Macrophomina phaseolina MS6]
Length=857

 Score =   316 bits (809),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 197/488 (40%), Positives = 274/488 (56%), Gaps = 67/488 (14%)
 Frame = +1

Query  610   TRVKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTAS  780
             +RV  + EQ  VL+  ++ GKSVF TGSAGTGK+ L++ II  L+  + R   RV VTAS
Sbjct  343   SRVFLSEEQQHVLNLVVNEGKSVFFTGSAGTGKSVLLREIIAALKRKYMRESERVAVTAS  402

Query  781   TGVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGE  960
             TG++AC + G TLHSF+GIGLG    EEL+ K+  N++ +HRW  V+ L+IDE+S+I G+
Sbjct  403   TGLAACNIGGVTLHSFSGIGLGNQPTEELIKKIKRNQKHKHRWMRVKVLVIDEVSMIDGD  462

Query  961   LYDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKN-TQKFAFEASSWKL  1137
             L+DKLE IAR +R+  NG      +GGIQ+V +GDFFQLPP+  KN   KFAF+A++W  
Sbjct  463   LFDKLESIARSLRN--NGRP----FGGIQLVITGDFFQLPPVPEKNKVAKFAFDANTWNT  516

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVK  1299
               +  I LT +FRQ DP    +L  +R+G         F  LN      S LE    A +
Sbjct  517   VIEHTIGLTHIFRQKDPVFAGMLNEMREGRLSQSSIDAFRKLNRPLESESGLE----ATE  572

Query  1300  LYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ----LKLGIAPDFLELCVGAR  1467
             L+P    V   N++ +  LH D+  Y A D G    K Q    L+  +AP+ ++L  GA+
Sbjct  573   LFPLRQQVEEANRRRMAILHGDVRTYEAKDGGTMVDKAQRDKFLQNCMAPEAIQLKKGAQ  632

Query  1468  VMLTKNLNARHKLVNGAAGTVIGF--ESVNGTYE--------------------------  1563
             VML KN++    LVNG+ G VIGF  E++  +Y+                          
Sbjct  633   VMLIKNMD--ETLVNGSLGRVIGFMNEAMFDSYQQNEEQYLGTAAADTDDPEERMLLEQK  690

Query  1564  ---------TFGTNWLPVVKF---DFKPKKLIIRPETW-SIMDGEEVVAVRKQIPLILAW  1704
                        G    PVV+F   D   + L+ + E+W + +   EV+A R Q+PLILAW
Sbjct  691   RRARITDLLNSGPQLYPVVRFTLPDGTMRDLLCQRESWKNELPNGEVIASRSQVPLILAW  750

Query  1705  ALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNF  1884
             ALSIHK QG TL  +  DL + F  G  YVALSR  S+ GL + +F+P  +  H KV +F
Sbjct  751   ALSIHKAQGQTLERVKVDLGKVFEKGQAYVALSRATSMAGLQVLNFDPRKVVAHDKVRSF  810

Query  1885  DKRLCSQP  1908
              ++L   P
Sbjct  811   YEKLSKAP  818



>ref|XP_007585738.1| putative mitochondrial dna helicase protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD46774.1| putative mitochondrial dna helicase protein [Neofusicoccum parvum 
UCRNP2]
Length=696

 Score =   312 bits (799),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 196/480 (41%), Positives = 271/480 (56%), Gaps = 67/480 (14%)
 Frame = +1

Query  610   TRVKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTAS  780
             +RV  + EQ  VL+  ++ GKSVF TGSAGTGK+ L++ II  L++ + R   RV VTAS
Sbjct  177   SRVFLSDEQQHVLNLVVNEGKSVFFTGSAGTGKSVLLREIIAALKKKYVRESERVAVTAS  236

Query  781   TGVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGE  960
             TG++AC + G TLHSF+GIGLG A  EEL+ K+  N++ +HRW  V+ L+IDE+S+I G+
Sbjct  237   TGLAACNIGGVTLHSFSGIGLGNAPTEELVKKIKRNQKHKHRWMRVKVLVIDEVSMIDGD  296

Query  961   LYDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT-QKFAFEASSWKL  1137
             L+DKLE IAR +R+  NG      +GGIQ++ +GDFFQLPP+  KN   KFAF+A++W  
Sbjct  297   LFDKLEQIARNLRN--NGRP----FGGIQLIITGDFFQLPPVPEKNKIAKFAFDANTWNT  350

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVK  1299
               +  I LT +FRQ DP    +L  +R+G         F  LN      S LE    A +
Sbjct  351   VIEHTIGLTHIFRQKDPVFAGMLNEMREGRLSQSSVDAFRKLNRPLAAESGLE----ATE  406

Query  1300  LYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ----LKLGIAPDFLELCVGAR  1467
             L+P    V   N++ +  LH D+  Y A D G    K Q    L   +AP+ ++L  GA+
Sbjct  407   LFPLRQQVEEANRRRMAVLHGDVRTYEAKDGGTMMDKTQRDRLLANCMAPEAIQLKKGAQ  466

Query  1468  VMLTKNLNARHKLVNGAAGTVIGF--ESVNGTYE--------------------------  1563
             VML KN++    LVNG+ G VIGF  E++  +Y+                          
Sbjct  467   VMLIKNMD--DTLVNGSLGRVIGFMNEAMFDSYQQNEAQYLGTAGPETDDPEERMELEQK  524

Query  1564  ---------TFGTNWLPVVKF---DFKPKKLIIRPETW-SIMDGEEVVAVRKQIPLILAW  1704
                        G+   PVV+F   D   + L+ + E+W + +   EV A R Q+PLILAW
Sbjct  525   RRARITDLLNAGSQLYPVVRFTLPDGTMRDLLCQRESWKNELPNGEVQASRSQVPLILAW  584

Query  1705  ALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNF  1884
             ALSIHK QG TL  +  DL R F  G  YVALSR  S+ GL + +F+P  +  H KV +F
Sbjct  585   ALSIHKAQGQTLERVKVDLGRVFEKGQAYVALSRATSMAGLQVMNFDPKKVVAHDKVRSF  644



>emb|CCE34435.1| related to PIF1 protein precursor [Claviceps purpurea 20.1]
Length=800

 Score =   313 bits (802),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 198/473 (42%), Positives = 268/473 (57%), Gaps = 54/473 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIH--GRSRVYVTASTG  786
             +  + EQ  VLD  ++ G+SVF TG AGTGK+ L++ II++L+  H     RV VTASTG
Sbjct  312   ITLSSEQEHVLDMVVNRGQSVFFTGPAGTGKSVLMRAIIQELKRKHRGEPDRVAVTASTG  371

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ KV  N + + RW   + LIIDEIS++ G+L+
Sbjct  372   LAACNIGGVTLHSFSGIGLGKDAASVLVKKVRRNVQAKTRWLRTKCLIIDEISMVDGDLF  431

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLS  1140
             DKL  I R IR+  NG      WGGIQ++ +GDFFQLPP+ +++T+  KFAF+A++W  S
Sbjct  432   DKLSTIGRTIRN--NGRP----WGGIQLIITGDFFQLPPVPDRDTRDAKFAFDAATWSTS  485

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDP--LAVKLYPRN  1314
              D  I LT VFRQ DP   K+L  +R G+     +N  +     L  D      +LYP  
Sbjct  486   IDHTIGLTQVFRQRDPNFAKMLNEMRIGQLSTATVNAFQALARPLNFDDGVDTAELYPTR  545

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNLN  1491
               V   N+K L  L      Y A+D G  + +++L    +AP  LEL VGA+VML KNL+
Sbjct  546   VQVEASNEKRLRDLPGKAYRYDAMDTGVPAIRDKLLANMMAPKALELKVGAQVMLIKNLD  605

Query  1492  ARHKLVNGAAGTVIGFESVNGTYE-----------------------TFGTNW-------  1581
                 LVNG+ G VI F S  GT++                        F  N        
Sbjct  606   --ESLVNGSLGKVIAF-SDEGTFDMDRPDMFNDSMDDSMAKAKRKLAAFSRNAQNDSPSR  662

Query  1582  -LPVVKF---DFKPKKLIIRPETWSI--MDGEEVVAVRKQIPLILAWALSIHKCQGMTLN  1743
               PVV+F      P+ L+ +PE W +   DG EV A R Q+PLILAWALSIHK QG TL 
Sbjct  663   KYPVVQFISSGGMPRVLLCQPEEWKVELPDG-EVQAKRTQLPLILAWALSIHKAQGQTLE  721

Query  1744  CLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              +  +L R F  G  YVALSR  + +GL +  F+ + +  HPKV++F  RL S
Sbjct  722   RVTVNLGRVFEKGQAYVALSRATTQQGLRVLGFDKSKVMAHPKVVDFYGRLYS  774



>dbj|GAM19367.1| hypothetical protein SAMD00019534_025420 [Acytostelium subglobosum 
LB1]
Length=616

 Score =   308 bits (789),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 178/427 (42%), Positives = 252/427 (59%), Gaps = 23/427 (5%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             EQ  V+D +  G S+F TGSAGTGKT++++ II+ LR +HG   V+VTASTG++AC + G
Sbjct  205   EQRHVVDLVLGGSSIFFTGSAGTGKTYVLREIIQALRFLHGDC-VHVTASTGIAACNVGG  263

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              TLHSFA IGLG+  A++ +  +  N +   RW+  + L+IDEIS+IS EL DKL+ I R
Sbjct  264   TTLHSFAAIGLGDKPAKDYIRSIAGNNKNLLRWRQTKVLVIDEISMISAELLDKLDQIGR  323

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDLTTV  1170
              +RSS         +GGIQ+V  GDF QLPP+  +    + F A  W++  D  I LT V
Sbjct  324   ALRSS------PRPFGGIQLVLVGDFCQLPPVSKQTAASYCFRAVCWEMMIDHSILLTKV  377

Query  1171  FRQSDPQLVKLLQGIRKGEYDFEDLNLLENHC--SNLEPDP--LAVKLYPRNDDVYRVNK  1338
             +RQ D + VK+L  +R G      L  L N C  +NL+     +   LYP        N+
Sbjct  378   YRQKDDKFVKVLNELRFGVISDVGLTTL-NQCVSNNLDATDGIIPTVLYPHRAKCDAENE  436

Query  1339  KHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGA  1518
             + L +L  + + + A D G D +++ LK   A   + L +GA+V+L KNL+   +LVNG+
Sbjct  437   RKLQALAGEAMVFEAEDEGPDPYRDMLKNMQAQSTVTLKIGAQVILLKNLDFEEELVNGS  496

Query  1519  AGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLIL  1698
              G V+ + + +          +P+VKF     + I++ E W+I  G   VA R Q+PL L
Sbjct  497   RGVVVAWAAEDS---------MPIVKFSTGTLRKIVK-EVWNIEQGNVKVASRTQVPLAL  546

Query  1699  AWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHL-SSFNPNIIKVHPKV  1875
             AWALSIHK QGM+++ L  DL   F YG  YVALSR  SL GL L S    N +KVHP+V
Sbjct  547   AWALSIHKSQGMSIDRLVIDLEGTFEYGQAYVALSRATSLTGLQLKSKLQSNQLKVHPEV  606

Query  1876  LNFDKRL  1896
             + F K++
Sbjct  607   VEFYKQM  613



>gb|KFH41258.1| ATP-dependent DNA helicase-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=792

 Score =   312 bits (799),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 195/463 (42%), Positives = 271/463 (59%), Gaps = 50/463 (11%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSACA  801
             EQ  +L+  +   +SVF TG AGTGK+ L++ II +L++ + R   RV VTASTG++AC 
Sbjct  293   EQRHILNLVVEKKQSVFFTGPAGTGKSVLMRAIIDELKKKYERDPERVAVTASTGLAACN  352

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSF+GIGLG+ +A  L+ KV  N + ++RW  V+ LIIDE+S++ G+L+DKL  
Sbjct  353   IGGVTLHSFSGIGLGKESATALIKKVRRNPKAKNRWLRVKCLIIDEVSMVDGDLFDKLSQ  412

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR IR+  NG      WGGIQ+V +GDFFQLPP+ +++ +  KFAF+AS+WK S D  I
Sbjct  413   IARTIRN--NG----RPWGGIQLVITGDFFQLPPVPDRDQREVKFAFDASTWKTSIDHTI  466

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE-PDPLAV-KLYPRNDDVYR  1329
              LT VFRQ DPQ  ++L  +R GE   E     +     L+  D + + +LYP    V  
Sbjct  467   GLTAVFRQRDPQFARMLNEMRLGEISAETERAFKALSRPLKFQDGVDMAQLYPTRAQVES  526

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNLNARHKL  1506
              N   L +L  +   + A D+G+ + +++L    +AP  L+L VGA+VML KN +A   L
Sbjct  527   SNASRLRALPGEGRQFVAEDSGDPAIRDKLLANMMAPKCLDLKVGAQVMLIKNWDA--GL  584

Query  1507  VNGAAGTVIGFESVNGTYETFGTNW-----------------------------LPVVKF  1599
             VNG+ G VI F S   T+E  G +                               PVV+F
Sbjct  585   VNGSLGRVIAF-SDEKTFEMEGASGHDPDMSDAMTKARKKLQAFSAELEAPKQKFPVVQF  643

Query  1600  ---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNR  1767
                D  P+ +++ PE W + +   EV A R Q+PLILAWALSIHK QG TL  +  DL R
Sbjct  644   IAMDGTPRVVMVEPEEWKVELPNGEVQAKRLQLPLILAWALSIHKAQGQTLERVTVDLGR  703

Query  1768  AFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
              F  G  YVALSR  S  GL + +FN + +  HPKV +F K+L
Sbjct  704   VFEKGQAYVALSRATSQHGLQVLNFNKHKVMAHPKVCDFYKQL  746



>emb|CDI53590.1| related to PIF1-DNA helicase involved in mitochondrial DNA repair 
and telomere length control [Melanopsichium pennsylvanicum 
4]
Length=710

 Score =   310 bits (794),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 186/459 (41%), Positives = 256/459 (56%), Gaps = 44/459 (10%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSACA  801
             EQ +VL   +   KSVF TGSAGTGK+ L++ II++LR  H R    V VTASTG++AC 
Sbjct  256   EQRKVLQMVVEESKSVFFTGSAGTGKSVLLREIIKELRRKHARRPDSVAVTASTGIAACN  315

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G T+HSF+GIGLG+ +  EL  K+  NR+   RW   Q LIIDEIS++   L DKLE 
Sbjct  316   IGGVTVHSFSGIGLGKESTAELTSKIRKNRKAAARWARTQVLIIDEISMVDPALLDKLEE  375

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDL  1161
             IAR IR        +  +GGIQVV +GDFFQLPP+   +   FAF+A  W      +++L
Sbjct  376   IARLIRKK-----PDKPFGGIQVVITGDFFQLPPVIPGSNVTFAFDAQCWNKVMQHKVNL  430

Query  1162  TTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE--NHCSNLEPDPLAVKLYPRNDDVYRVN  1335
             T VFRQ D   V +L  +R G+   + ++  +        + D +  +L+PR +DV R N
Sbjct  431   TQVFRQKDESFVTMLNEMRFGKLSQKTIDAFKKLERVPTYDEDIVPTELFPRREDVDRAN  490

Query  1336  KKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKL  1506
                L++L  +   YRA D G    ++ +  L+  IA   L +  GA+VML KNL+    L
Sbjct  491   MDRLNALQTESQSYRAQDGGSLVGEARERVLQNSIALPVLHVKKGAQVMLIKNLD--ETL  548

Query  1507  VNGAAGTVIGF------ESVNGTYE----------------TFGTNWLPVVKFDF---KP  1611
             VNG+ G VI F      +   G  +                T    W P+V+F     + 
Sbjct  549   VNGSVGKVIDFMDDSEYDKQTGALDAMTELSKEDRDKINRPTSARKW-PLVRFHLANGQT  607

Query  1612  KKLIIRPETW--SIMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGM  1785
             +  + RPETW   + DG E+ A R Q+PLILAWA+SIHK QG TL C   +LNR F  G 
Sbjct  608   RDYLTRPETWKTELPDG-EIQASRMQVPLILAWAMSIHKSQGQTLPCCKINLNRVFERGQ  666

Query  1786  VYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              YVALSR  SLEGL +  F  + +  HP+V+ + + L +
Sbjct  667   AYVALSRATSLEGLQVIGFRADKVMAHPRVIAWSQSLIA  705



>ref|XP_003170448.1| DNA repair and recombination protein PIF1 [Microsporum gypseum 
CBS 118893]
 gb|EFR04685.1| DNA repair and recombination protein PIF1 [Microsporum gypseum 
CBS 118893]
Length=760

 Score =   311 bits (796),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 203/491 (41%), Positives = 271/491 (55%), Gaps = 72/491 (15%)
 Frame = +1

Query  610   TRVK---WTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSR--VYV  771
             TRV    ++ EQ+QV++ I   GKSVF TGSAGTGK+ L++ IIR+LR  + R    V V
Sbjct  250   TRVPSIFFSEEQNQVIETIVKKGKSVFYTGSAGTGKSVLMREIIRQLRLKYRRDSDAVAV  309

Query  772   TASTGVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLI  951
             TASTG++AC + G TLHSFAG+GLG+ + +EL+ KV  N++ ++RW   + LIIDEIS++
Sbjct  310   TASTGLAACNIEGVTLHSFAGVGLGKESTQELVKKVKRNQKAKNRWLKTKVLIIDEISMV  369

Query  952   SGELYDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASS  1128
              G+ +DKLE +ARKIR+  NG      +GGIQ+V +GDFFQLPP+     + KFAF A +
Sbjct  370   DGDFFDKLEELARKIRN--NGRP----FGGIQLVTTGDFFQLPPVPEGGKEAKFAFAAGT  423

Query  1129  WKLSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPL  1290
             W  S    I LT VFRQ DP    +L  +R G         F+DL+   N   N+E    
Sbjct  424   WNTSIQHTILLTQVFRQKDPDFANMLNEMRLGRLSPSAIQAFKDLSRPLNCGDNIE----  479

Query  1291  AVKLYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNG----EDSWKEQLKLGIAPDFLELCV  1458
             A +L+P   +V   N + ++ L   ++ + A D+G    E    + L   +AP  + L  
Sbjct  480   ATELFPTRAEVDLANSERMNRLSGSVMTFHAADSGAIKDEQFRAKLLSNCMAPPTIHLKK  539

Query  1459  GARVMLTKNLNARHKLVNGAAGTVIGF--------------ESVNGTYE-----------  1563
             GA+VML KN +    LVNG+ GTVI F                 NG ++           
Sbjct  540   GAQVMLIKNKD--ETLVNGSLGTVIAFMDEAGFDNHIKEGLRYENGNFDFDGEPDHARQK  597

Query  1564  -----------TFGTN---WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIP  1689
                        T G N     P+V F   D   ++L+  PE W I +   EV A R QIP
Sbjct  598   IKSMALDQKPKTGGINTAAQYPLVAFILPDGSERQLLCMPEAWKIELPNGEVQAQRLQIP  657

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             LILAWALSIHK QG TL  +  DL R F  G  YVALSR  S  GL +S F+P  + VHP
Sbjct  658   LILAWALSIHKAQGQTLQRVKVDLGRVFERGQAYVALSRATSKNGLQVSRFDPKKVMVHP  717

Query  1870  KVLNFDKRLCS  1902
             KV  F + L S
Sbjct  718   KVTEFYQNLSS  728



>gb|EAS28483.2| mitochondrial DNA helicase [Coccidioides immitis RS]
Length=725

 Score =   310 bits (793),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 195/487 (40%), Positives = 272/487 (56%), Gaps = 64/487 (13%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTAST  783
             R+  + EQ+ VLD I   G SVF TGSAGTGK+ L++  IR LR+ + +   RV VTAST
Sbjct  214   RMFLSEEQNHVLDMIVKKGHSVFFTGSAGTGKSVLMREAIRGLRQKYKKEPDRVAVTAST  273

Query  784   GVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGEL  963
             G++AC + G TLHSFAG+GLG+  A  LL KV  N++ R+RW   + LIIDEIS++ GE 
Sbjct  274   GLAACNIEGVTLHSFAGVGLGKEDATGLLKKVKRNQKARNRWLRTKVLIIDEISMVDGEF  333

Query  964   YDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLS  1140
             +DKLE +ARK+RS  NG      +GGIQ+V +GDFFQLPP+ + + + KFAF+A++W   
Sbjct  334   FDKLEELARKVRS--NGRP----FGGIQLVVTGDFFQLPPVADSSKEAKFAFDANTWNTC  387

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE--NHCSNLEPDPLAVKLYPRN  1314
                 I LT VFRQ DP+   +L  +R G    + ++  +  +   N E D  A +L+P  
Sbjct  388   VQHTILLTHVFRQKDPEFASMLNELRLGRVTQKTIDAFKQLSRPLNFEDDLEATELFPTR  447

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTK  1482
              +V   N   +  L  ++I + AVD+G   + S ++++    +AP  + L  GA+VML K
Sbjct  448   HEVEGANSTRMGRLSGEVIPFTAVDSGAIQDKSMRDKMLANCMAPPLIHLKKGAQVMLIK  507

Query  1483  NLNARHKLVNGAAGTVIGFESVNGTYETFGTN----------------------------  1578
             N++    LVNG+ G V+ F   + TY+ +  N                            
Sbjct  508   NMD--DSLVNGSLGKVVAFMD-DSTYDHYVRNEDSYHSGHEYNRDDESSRARKKIKSMAY  564

Query  1579  ------------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWAL  1710
                         W P+V F   D   ++L+ +PETW I +   EV A R+Q+PLILAWAL
Sbjct  565   DPKGLGVTTAKLW-PLVSFVLPDGTERQLLCKPETWKIELPNGEVQAQRQQVPLILAWAL  623

Query  1711  SIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDK  1890
             SIHK QG TL  +  DL R F  G  YVALSR  S  GL ++ F P  + VH KV  F  
Sbjct  624   SIHKAQGQTLQRVKVDLGRVFEKGQAYVALSRATSTSGLQVTRFEPRKVMVHHKVKEFYA  683

Query  1891  RLCSQPD  1911
              L +  D
Sbjct  684   NLSTTND  690



>gb|EFW19538.1| mitochondrial DNA helicase [Coccidioides posadasii str. Silveira]
Length=725

 Score =   310 bits (793),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 195/487 (40%), Positives = 272/487 (56%), Gaps = 64/487 (13%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTAST  783
             R+  + EQ+ VLD I   G SVF TGSAGTGK+ L++  IR LR+ + +   RV VTAST
Sbjct  214   RMFLSEEQNHVLDMIVKKGHSVFFTGSAGTGKSVLMREAIRGLRQKYKKEPDRVAVTAST  273

Query  784   GVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGEL  963
             G++AC + G TLHSFAG+GLG+  A  LL KV  N++ R+RW   + LIIDEIS++ GE 
Sbjct  274   GLAACNIEGVTLHSFAGVGLGKEDATGLLKKVKRNQKARNRWLRTKVLIIDEISMVDGEF  333

Query  964   YDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLS  1140
             +DKLE +ARK+RS  NG      +GGIQ+V +GDFFQLPP+ + + + KFAF+A++W   
Sbjct  334   FDKLEELARKVRS--NGRP----FGGIQLVVTGDFFQLPPVADSSKEAKFAFDANTWNTC  387

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE--NHCSNLEPDPLAVKLYPRN  1314
                 I LT VFRQ DP+   +L  +R G    + ++  +  +   N E D  A +L+P  
Sbjct  388   VQHTILLTHVFRQKDPEFASMLNELRLGRVTQKTIDAFKQLSRPLNFEDDLEATELFPTR  447

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTK  1482
              +V   N   +  L  ++I + AVD+G   + S ++++    +AP  + L  GA+VML K
Sbjct  448   HEVEGANSTRMGRLSGEVIPFTAVDSGAIQDKSMRDKMLANCMAPPLIHLKKGAQVMLIK  507

Query  1483  NLNARHKLVNGAAGTVIGFESVNGTYETFGTN----------------------------  1578
             N++    LVNG+ G V+ F   + TY+ +  N                            
Sbjct  508   NMD--DSLVNGSLGKVVAFMD-DSTYDHYVRNEDSYHSGHEYNRDDESSRARKKIKSMAY  564

Query  1579  ------------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWAL  1710
                         W P+V F   D   ++L+ +PETW I +   EV A R+Q+PLILAWAL
Sbjct  565   DPKGLGVTTAKLW-PLVSFVLPDGTERQLLCKPETWKIELPNGEVQAQRQQVPLILAWAL  623

Query  1711  SIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDK  1890
             SIHK QG TL  +  DL R F  G  YVALSR  S  GL ++ F P  + VH KV  F  
Sbjct  624   SIHKAQGQTLQRVKVDLGRVFEKGQAYVALSRATSTSGLQVTRFEPRKVMVHHKVKEFYA  683

Query  1891  RLCSQPD  1911
              L +  D
Sbjct  684   NLSTTND  690



>ref|XP_007879576.1| hypothetical protein PFL1_03862 [Pseudozyma flocculosa PF-1]
 gb|EPQ28558.1| hypothetical protein PFL1_03862 [Pseudozyma flocculosa PF-1]
Length=673

 Score =   308 bits (789),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 184/468 (39%), Positives = 262/468 (56%), Gaps = 50/468 (11%)
 Frame = +1

Query  610   TRVKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSR--VYVTAS  780
             ++V  + EQ  VLD  +   K+VF TGSAGTGK+ L++ IIR+L+++H + +  V VTAS
Sbjct  212   SKVFLSAEQRAVLDMVVRERKNVFFTGSAGTGKSVLLREIIRELKQVHSKKQDAVAVTAS  271

Query  781   TGVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGE  960
             TG++AC + G TLHSF+GIGLG+    +L+ K+  NR+   RW   Q LI+DE+S++  +
Sbjct  272   TGIAACNIGGVTLHSFSGIGLGKEPVAQLVTKIRRNRKANSRWLRTQVLIMDEVSMVDPD  331

Query  961   LYDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLS  1140
             L+DKLE +AR +R S         +GG+QVV +GDFFQLPP+       FAFEA SW   
Sbjct  332   LFDKLEEVARVVRKS------NKPFGGLQVVITGDFFQLPPVNPGGGMTFAFEAKSWDSV  385

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKL  1302
                Q++LT VFRQ D + V +L  +R G+        F+ L  +  +   + P     +L
Sbjct  386   VAHQVNLTKVFRQKDSRFVTMLNEMRFGQLSPATIKAFKSLERVPVYDEGIVP----TEL  441

Query  1303  YPRNDDVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLGIAPDFLELCVGARVM  1473
             +PR ++V R N + L +L      + A D G    D  +  L+  IA   L L VGA+VM
Sbjct  442   FPRREEVDRANLERLQALPSKAETFPATDGGSLERDGRERVLQNFIALKSLTLKVGAQVM  501

Query  1474  LTKNLNARHKLVNGAAGTVIGF--------------------ESVNGTYETFGTNWLPVV  1593
             L KN++    LVNG+ G V+ F                      +N         W P+V
Sbjct  502   LIKNVD--ETLVNGSVGLVLDFVDEREYVERGLGRIDEKDEGNKLNALNRASQRKW-PLV  558

Query  1594  KF----DFKPKKLIIRPETW-SIMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTD  1758
             +F    D   +  + +PE+W + +   E+ A R Q+PLILAWA+SIHK QG TL C   +
Sbjct  559   RFRLPNDSGFRDYLAKPESWKNELPTGEIQASRTQVPLILAWAMSIHKSQGQTLQCCRIN  618

Query  1759  LNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             LNR F  G  YVALSR  SLEGL +  FNP  +  HPKV+ + + L +
Sbjct  619   LNRVFEKGQAYVALSRATSLEGLQVMGFNPAKVMAHPKVIQWSRSLLA  666



>ref|XP_753317.1| mitochondrial DNA helicase (Pif1) [Aspergillus fumigatus Af293]
 gb|EAL91279.1| mitochondrial DNA helicase (Pif1), putative [Aspergillus fumigatus 
Af293]
Length=788

 Score =   311 bits (796),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 196/485 (40%), Positives = 272/485 (56%), Gaps = 72/485 (15%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLDA+ + GKS+F TGSAGTGK+ L++ II++LR  + +   RV VTASTG++AC 
Sbjct  286   EQRHVLDAVVNQGKSIFFTGSAGTGKSVLMREIIKQLRSKYRKEPDRVAVTASTGLAACN  345

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + LIIDE+S++ G+L+DKLE 
Sbjct  346   IEGVTLHSFAGIGLGKEPVPELVKKIKRNQKARNRWLRTKVLIIDEVSMVDGDLFDKLEE  405

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+   +++  KFAF A++W  S    I
Sbjct  406   IARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPEGSSREAKFAFAAATWNTSIQHTI  459

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEY------DFEDLNLLENHCSNLEPDPLAVKLYPRND  1317
              LT VFRQ DP+  ++L  +R G+        F+ L+   N    LE    A +L+P   
Sbjct  460   LLTHVFRQKDPEFAEMLNEMRLGKLTPRTIETFKSLSRPLNFHDALE----ATELFPTRQ  515

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKN  1485
             +V + N   +  L  + + + AVD+G   +  ++E+L    +AP  + L  GA+VML KN
Sbjct  516   EVEQANSARMSRLSGETMTFHAVDSGTIQDVQFREKLLANCMAPPVIHLKKGAQVMLIKN  575

Query  1486  LNARHKLVNGAAGTVIGFESVNGTYETFGTN-----------------------------  1578
             +     LVNG+ G V+ F     T+E +  N                             
Sbjct  576   ME--DSLVNGSIGRVVAFMD-EATFEYYRDNESEFADGRDAGSDDERLNHARKKLKGLGN  632

Query  1579  ----------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSI  1716
                       W P+V F   D   + L+ +PE W I +   EV A R+Q+PLILAWALSI
Sbjct  633   KDGGVVASRKW-PLVCFVQPDGTERHLLCQPEAWKIELPNGEVQAQRQQVPLILAWALSI  691

Query  1717  HKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             HK QG TL  +  DL R F  G  YVALSR  S  GL ++ F+P  + VHPKV  F   L
Sbjct  692   HKAQGQTLQRVKVDLGRVFEKGQAYVALSRATSKAGLQVTRFDPRKVMVHPKVTEFYSNL  751

Query  1897  CSQPD  1911
              S  D
Sbjct  752   VSITD  756



>gb|KEY77892.1| mitochondrial DNA helicase Pif1 [Aspergillus fumigatus var. RP-2014]
Length=788

 Score =   311 bits (796),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 196/485 (40%), Positives = 272/485 (56%), Gaps = 72/485 (15%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLDA+ + GKS+F TGSAGTGK+ L++ II++LR  + +   RV VTASTG++AC 
Sbjct  286   EQRHVLDAVVNQGKSIFFTGSAGTGKSVLMREIIKQLRSKYRKEPDRVAVTASTGLAACN  345

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + LIIDE+S++ G+L+DKLE 
Sbjct  346   IEGVTLHSFAGIGLGKEPVPELVKKIKRNQKARNRWLRTKVLIIDEVSMVDGDLFDKLEE  405

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+   +++  KFAF A++W  S    I
Sbjct  406   IARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPEGSSREAKFAFAAATWNTSIQHTI  459

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEY------DFEDLNLLENHCSNLEPDPLAVKLYPRND  1317
              LT VFRQ DP+  ++L  +R G+        F+ L+   N    LE    A +L+P   
Sbjct  460   LLTHVFRQKDPEFAEMLNEMRLGKLTPRTIETFKSLSRPLNFHDALE----ATELFPTRQ  515

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKN  1485
             +V + N   +  L  + + + AVD+G   +  ++E+L    +AP  + L  GA+VML KN
Sbjct  516   EVEQANSARMSRLSGETMTFHAVDSGTIQDVQFREKLLANCMAPPVIHLKKGAQVMLIKN  575

Query  1486  LNARHKLVNGAAGTVIGFESVNGTYETFGTN-----------------------------  1578
             +     LVNG+ G V+ F     T+E +  N                             
Sbjct  576   ME--DSLVNGSIGRVVAFMD-EATFEYYRDNESEFADGRDAGSDDERLNHARKKLKGLGN  632

Query  1579  ----------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSI  1716
                       W P+V F   D   + L+ +PE W I +   EV A R+Q+PLILAWALSI
Sbjct  633   KDGGVVASRKW-PLVCFVQPDGTERHLLCQPEAWKIELPNGEVQAQRQQVPLILAWALSI  691

Query  1717  HKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             HK QG TL  +  DL R F  G  YVALSR  S  GL ++ F+P  + VHPKV  F   L
Sbjct  692   HKAQGQTLQRVKVDLGRVFEKGQAYVALSRATSKAGLQVTRFDPRKVMVHPKVTEFYSNL  751

Query  1897  CSQPD  1911
              S  D
Sbjct  752   VSITD  756



>gb|EDP52074.1| mitochondrial DNA helicase (Pif1), putative [Aspergillus fumigatus 
A1163]
Length=788

 Score =   311 bits (796),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 196/485 (40%), Positives = 272/485 (56%), Gaps = 72/485 (15%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLDA+ + GKS+F TGSAGTGK+ L++ II++LR  + +   RV VTASTG++AC 
Sbjct  286   EQRNVLDAVVNQGKSIFFTGSAGTGKSVLMREIIKQLRSKYRKEPDRVAVTASTGLAACN  345

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + LIIDE+S++ G+L+DKLE 
Sbjct  346   IEGVTLHSFAGIGLGKEPVPELVKKIKRNQKARNRWLRTKVLIIDEVSMVDGDLFDKLEE  405

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+   +++  KFAF A++W  S    I
Sbjct  406   IARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPEGSSREAKFAFAAATWNTSIQHTI  459

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEY------DFEDLNLLENHCSNLEPDPLAVKLYPRND  1317
              LT VFRQ DP+  ++L  +R G+        F+ L+   N    LE    A +L+P   
Sbjct  460   LLTHVFRQKDPEFAEMLNEMRLGKLTPRTIETFKSLSRPLNFHDALE----ATELFPTRQ  515

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKN  1485
             +V + N   +  L  + + + AVD+G   +  ++E+L    +AP  + L  GA+VML KN
Sbjct  516   EVEQANSARMSKLSGETMTFHAVDSGTIQDVQFREKLLANCMAPPVIHLKKGAQVMLIKN  575

Query  1486  LNARHKLVNGAAGTVIGFESVNGTYETFGTN-----------------------------  1578
             +     LVNG+ G V+ F     T+E +  N                             
Sbjct  576   ME--DSLVNGSIGRVVAFMD-EATFEYYRDNESEFADGRDAGSDDERLNHARKKLKGLGN  632

Query  1579  ----------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSI  1716
                       W P+V F   D   + L+ +PE W I +   EV A R+Q+PLILAWALSI
Sbjct  633   KDGGVVASRKW-PLVCFVQPDGTERHLLCQPEAWKIELPNGEVQAQRQQVPLILAWALSI  691

Query  1717  HKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             HK QG TL  +  DL R F  G  YVALSR  S  GL ++ F+P  + VHPKV  F   L
Sbjct  692   HKAQGQTLQRVKVDLGRVFEKGQAYVALSRATSKAGLQVTRFDPRKVMVHPKVTEFYSNL  751

Query  1897  CSQPD  1911
              S  D
Sbjct  752   VSITD  756



>emb|CDO73329.1| hypothetical protein BN946_scf185008.g92 [Trametes cinnabarina]
Length=612

 Score =   306 bits (784),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 182/464 (39%), Positives = 264/464 (57%), Gaps = 45/464 (10%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSR--VYVTASTGVSACAL  804
             EQ+ +L  + AG+S+F TGSAG GK+ L++ II+ LR+ + +S   V VTASTG++AC +
Sbjct  158   EQTHILRLVGAGQSLFYTGSAGAGKSVLLREIIKSLRKRYQKSPDAVAVTASTGIAACNI  217

Query  805   NGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFI  984
              G T+HSFAGIGLG  +AE+L +K+  NR+   RW   + LIIDE+S++ G+L+DKL  I
Sbjct  218   GGVTIHSFAGIGLGIESAEQLANKIKKNRKATTRWLRTKVLIIDEVSMVDGDLFDKLARI  277

Query  985   ARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQIDL  1161
                IR           +GGIQVV +GDFFQLPP+    N+ KFAFEA  W  +     +L
Sbjct  278   GSIIRKRPEP------FGGIQVVVTGDFFQLPPVSKGMNSVKFAFEAEMWPQTIKKTFNL  331

Query  1162  TTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRNDDVYRVN  1335
             T VFRQ DP+ V +L  +R G    + +   ++    +  E    A +L+PR +DV R N
Sbjct  332   TKVFRQRDPEFVDMLNEMRFGRLSPKSIAKFKSLQREIVYEDGLGATELFPRREDVERSN  391

Query  1336  KKHLDSLHQDLIGYRAVDNG--EDSWKEQLKLG--IAPDFLELCVGARVMLTKNLNARHK  1503
                + S++     Y A D G  +D  + +  L   +AP  L L  G++VML KN++    
Sbjct  392   TVRMSSINGKEQVYTAYDGGSIQDMQQREKMLANFMAPKRLVLKEGSQVMLIKNMD--DT  449

Query  1504  LVNGAAGTVIGF----------------------ESVNGTYETFGTNWLPVVKFDFKP--  1611
             LVNG  G ++GF                      + V       G   LP+V+F  +P  
Sbjct  450   LVNGTMGKILGFVDPTAPPDDVGMLGDKPASKGTKDVKSAPAPVGRQLLPLVEF-LQPGG  508

Query  1612  --KKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYG  1782
               +++I+ PE W + +   EV   R Q+PLILAWA+SIHK QG TL  +  DL + F  G
Sbjct  509   SRRRIIVAPENWKVELPNGEVQVSRTQLPLILAWAMSIHKSQGQTLERVKVDLAKVFEKG  568

Query  1783  MVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQ  1914
               YVALSR  SL+GL + +F+P+ ++ HPKV+ + K L +  D+
Sbjct  569   QAYVALSRATSLDGLQVLNFDPSKVQAHPKVVEWSKTLETVADR  612



>ref|XP_002381272.1| pif1p DNA helicase, putative [Aspergillus flavus NRRL3357]
 gb|EED49371.1| pif1p DNA helicase, putative [Aspergillus flavus NRRL3357]
Length=693

 Score =   308 bits (788),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 197/485 (41%), Positives = 270/485 (56%), Gaps = 72/485 (15%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VL+A+   GKS+F TGSAGTGK+ L++ II+KLR+ + R   RV VTASTG++AC 
Sbjct  195   EQKHVLNAVVEQGKSIFFTGSAGTGKSVLMREIIKKLRDKYRREPDRVAVTASTGLAACN  254

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ KV  N + R+RW   + LIIDE+S++ G+L+DKLE 
Sbjct  255   IEGVTLHSFAGIGLGKEPVPELVKKVKRNPKGRNRWLRTKVLIIDEVSMVDGDLFDKLEE  314

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             +AR+IR+  NG      +GGIQ+V +GDFFQLPP+ + +T+  KFAF A++W  S    I
Sbjct  315   LARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPDGSTREAKFAFSAATWNTSIQHTI  368

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRND  1317
              LTTVFRQ+DP    +L  +R G+        F+ L    +   +LE    A +L+P   
Sbjct  369   LLTTVFRQADPDFANMLNEMRLGKLSQRTIDTFQQLQRPLDFHDSLE----ATELFPTRQ  424

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNG--EDSWKEQLKLG--IAPDFLELCVGARVMLTKN  1485
             +V   N   +  L  +++ + A D+G  +D    +  L   +AP  + L  GA+VML KN
Sbjct  425   EVEHANGARMQRLSGEVMTFNAADSGTIQDVQHREKLLANCMAPQVIHLKKGAQVMLIKN  484

Query  1486  LNARHKLVNGAAGTVIGFESVNGTYETFGTN-----------------------------  1578
             +     LVNG+ G V+ F     T++ +  N                             
Sbjct  485   ME--DTLVNGSIGRVVAFMD-EATFDFYRENESDFAGDQGAQTDEEMMDRARKKLKSLAH  541

Query  1579  ----------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSI  1716
                       W P+V F   D   + L+ +PETW I +   EV A R Q+PLILAWALSI
Sbjct  542   KEGGVVVSKKW-PLVCFVQPDGTERHLLCQPETWKIELPNGEVQAQRVQVPLILAWALSI  600

Query  1717  HKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             HK QG TL  +  DL R F  G  YVALSR  S EGL ++ F+   + VHPKV  F  +L
Sbjct  601   HKAQGQTLPRVKVDLGRVFEKGQAYVALSRATSKEGLQVTRFDARKVMVHPKVTEFYSKL  660

Query  1897  CSQPD  1911
              S  D
Sbjct  661   ISITD  665



>gb|EST05467.1| hypothetical protein PSEUBRA_SCAF5g02311 [Pseudozyma brasiliensis 
GHG001]
Length=734

 Score =   308 bits (789),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 184/461 (40%), Positives = 259/461 (56%), Gaps = 49/461 (11%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSACA  801
             EQ +VL   +  GK+VF TGSAGTGK+ L++ II++LR  H +    V VTASTG++AC 
Sbjct  283   EQRKVLHMVVEEGKNVFFTGSAGTGKSVLLREIIKELRRKHAKRPDSVAVTASTGIAACN  342

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G T+HSFAGIGLG+    +L+ K+  NR+   RW+  Q LIIDE+S++   L+DKLE 
Sbjct  343   IGGVTIHSFAGIGLGKEPVLQLMSKIRKNRKSSARWQRTQVLIIDEVSMVDPALFDKLEE  402

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDL  1161
             +AR IR        +  +GGIQVV +GDFFQLPP+    +  FAF+A SW      +++L
Sbjct  403   VARLIRKK-----PDKPFGGIQVVITGDFFQLPPVNPGGSVTFAFDAQSWDKVVQHKVNL  457

Query  1162  TTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRNDDV  1323
             T VFRQ D   V +L  +R G+        F+ L  +  +   + P     +L+PR +DV
Sbjct  458   TQVFRQKDESFVTMLNEMRFGQLSTKTIEAFKKLERIPRYEDGIVP----TELFPRREDV  513

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVMLTKNLNA  1494
              R N   L +L  +   YRA D G    ++ +  L+  IA   + L  GA+VML KNL+ 
Sbjct  514   DRANMDRLSALQSESQTYRAQDGGSLPAEARERVLQHSIALPVVHLKKGAQVMLIKNLD-  572

Query  1495  RHKLVNGAAGTVIGFESVNGTYETFG--------------------TNWLPVVKF---DF  1605
                LVNG+ G VI F       +  G                    T   P+V+F   + 
Sbjct  573   -ETLVNGSVGKVIDFMDETEHEKKLGMLDMPEGGEKEGTDKGPRISTRKWPLVRFVLPNG  631

Query  1606  KPKKLIIRPETW--SIMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGY  1779
             + +  + +PE+W   + DG EV A R+Q+PLILAWA+SIHK QG TL C   +LNR F  
Sbjct  632   QTRDYLAKPESWKTELPDG-EVQASRQQVPLILAWAMSIHKSQGQTLPCCKINLNRVFEK  690

Query  1780  GMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             G  YVALSR  SLEGL +  F  + +  HP+V+ + + L +
Sbjct  691   GQAYVALSRATSLEGLQVLGFKADKVMAHPRVIQWSRSLIT  731



>ref|XP_003231028.1| mitochondrial DNA helicase [Trichophyton rubrum CBS 118892]
Length=760

 Score =   308 bits (790),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 200/487 (41%), Positives = 269/487 (55%), Gaps = 69/487 (14%)
 Frame = +1

Query  622   WTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSR--VYVTASTGVS  792
             ++ EQ+QV++ I   GKSVF TGSAGTGK+ L++ IIR+LR  + R    V VTASTG++
Sbjct  257   FSEEQNQVIETIVKEGKSVFYTGSAGTGKSVLMREIIRQLRLKYSRDSDAVAVTASTGLA  316

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             AC + G TLHSFAG+GLG+ + +EL+ KV  N + ++RW   + LIIDEIS++ G+ +DK
Sbjct  317   ACNIEGVTLHSFAGVGLGKESTQELVKKVKRNLKAKNRWLKTKVLIIDEISMVDGDFFDK  376

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDT  1149
             LE +ARKIR+  NG      +GGIQ+V +GDFFQLPP+     + KFAF A +W  S   
Sbjct  377   LEELARKIRN--NG----RPFGGIQLVTTGDFFQLPPVPEGGKEAKFAFAAGTWNTSIQH  430

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPR  1311
              I LT VFRQ DP    +L  +R G         F+DL+       N+E    A +L+P 
Sbjct  431   TILLTQVFRQRDPDFANMLNEMRLGRLSPSAIQAFKDLSRPLICGDNIE----ATELFPT  486

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNG----EDSWKEQLKLGIAPDFLELCVGARVMLT  1479
               +V R N + ++ L   ++ + A D+G    E    + L   +AP  + L  GA+VML 
Sbjct  487   RAEVDRANSERMNRLSGSVMTFHAADSGAIKDEQFRAKLLSNCMAPATIHLKKGAQVMLI  546

Query  1480  KNLNARHKLVNGAAGTVIGF--------------ESVNGTYE------------------  1563
             KN +    LVNG+ GTVI F              +  NG Y+                  
Sbjct  547   KNKD--ETLVNGSLGTVIAFMDEAGFDNHIREGLKRENGYYDFNDEPSQAKEKIKSMAFD  604

Query  1564  ----TFGTN---WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWAL  1710
                 T   N     P+V F   D   ++L+  PE W I +   EV A R Q+PLILAWAL
Sbjct  605   QKANTGSVNTSRQYPLVAFILPDGSERQLLCMPEAWKIELPNGEVQAQRLQVPLILAWAL  664

Query  1711  SIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDK  1890
             SIHK QG TL  +  DL R F  G  YVALSR  S +GL +S F+P  + VHPKV  F +
Sbjct  665   SIHKAQGQTLQRVKVDLGRVFERGQAYVALSRATSKDGLQVSRFDPKKVMVHPKVTEFYQ  724

Query  1891  RLCSQPD  1911
              L S  D
Sbjct  725   NLSSISD  731



>gb|EIE76854.1| hypothetical protein RO3G_01558 [Rhizopus delemar RA 99-880]
Length=618

 Score =   305 bits (780),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 190/460 (41%), Positives = 262/460 (57%), Gaps = 49/460 (11%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             R   + EQ +VLD +    KS+F TGSAGTGK+ L++ II ++  I+G   + VTASTG+
Sbjct  172   RPTLSAEQQRVLDMVLKDKKSLFFTGSAGTGKSVLLRAIIDEMETIYG-PMLAVTASTGI  230

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKV-CSNRRVRHRWKMVQALIIDEISLISGELY  966
             +A  +NG TLHSF GIG+GE   E L+ K+   N++   RW   Q LIIDEIS++   L+
Sbjct  231   AATNINGCTLHSFGGIGIGEDKIETLVEKIKYENKKAHDRWTKTQVLIIDEISMVDAVLF  290

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFD  1146
             DKLE IAR +R+S      +  +GGIQV+ SGDFFQLPP+      KFAFEA+SWK    
Sbjct  291   DKLEAIARGLRNS------QEPFGGIQVIVSGDFFQLPPVNPNGPTKFAFEANSWKKVIT  344

Query  1147  TQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYP  1308
               + LT VFRQ D   V +L  +R G         F+ L       + +EP     +LYP
Sbjct  345   QTVMLTQVFRQKDGTFVNILNEMRLGRLSQSAIDIFKSLARKPAGSNEIEP----TELYP  400

Query  1309  RNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNL  1488
                +V   NK  LD+L  D+I ++AVD G+   + ++   +APD ++L + A+VML KN 
Sbjct  401   LRREVELSNKLRLDALGGDVIEFKAVDKGD---QRKVSQCMAPDVIQLKLHAQVMLLKNF  457

Query  1489  NARHKLVNGAAGTVIGF------------------ESVNGTYETFG-----TNWLPVVKF  1599
             +    LVNG+ G VIGF                  +    TY   G         PVV+F
Sbjct  458   DI--DLVNGSLGVVIGFVGRGNYRSEKSVQFLRTPQRQKETYLEAGGRIDMKTPYPVVRF  515

Query  1600  DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFG  1776
                 ++L++  ETWS  + G +V+A R QIPL+LAWA+SIHK QG TL+ +  DL + F 
Sbjct  516   A-SGRELVLEYETWSFELPGGKVLASRSQIPLMLAWAISIHKSQGQTLDRVKVDLGKVFE  574

Query  1777  YGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
              G  YVALSR  SL+ L + +F+P  +  HP+V  F K L
Sbjct  575   KGQAYVALSRATSLDRLQILNFDPAKVMAHPRVTEFYKTL  614



>ref|XP_007885247.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Callorhinchus milii]
Length=631

 Score =   305 bits (781),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 179/429 (42%), Positives = 248/429 (58%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K + EQS VL  +  GK+VF TGSAGTGK+FL++ I+  L         Y TASTGV+AC
Sbjct  206   KLSKEQSHVLRTVLCGKNVFFTGSAGTGKSFLLKRIVGALPP----KSTYTTASTGVAAC  261

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLHSFAGIG G+A  ++ + ++     V   W+  + LIIDEIS+++GE +DKLE
Sbjct  262   HIGGTTLHSFAGIGSGKAPMQQCV-ELAQRPGVLQHWQNCKHLIIDEISMVNGEFFDKLE  320

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQK-FAFEASSWKLSFDTQI  1155
              +AR +R SI        +GGIQ++  GDF QLPP+   N +K F F+A SW+      I
Sbjct  321   AVARIVRKSIEP------FGGIQLIVCGDFLQLPPVIRTNEKKTFCFQAKSWRKCIHLNI  374

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + +LQ IR G    E    L++     ++ D  LA +L    DDV  
Sbjct  375   ELTEVRRQTDKAFIAILQAIRIGRCTEEVAAQLIKTASHKIDQDGILATRLCTHKDDVEL  434

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N++ L  L   +  + A D+     +       A   LEL  GA+VMLTKNL+ +  +V
Sbjct  435   TNERRLQHLPGKVHTFNASDSDPMLVQTLNAQCPAGQTLELKKGAQVMLTKNLDVQRGMV  494

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V+GFES N          LP V+F     +  I+PE W+I     +   R+Q+P
Sbjct  495   NGARGVVLGFESEN--------KALPQVRFLCGVTE-TIKPERWTIKASSGIYLTRQQLP  545

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SLEGL +  F+P +++ +P
Sbjct  546   LRLAWAISIHKSQGMSLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPKVVRANP  605

Query  1870  KVLNFDKRL  1896
              VL F  R+
Sbjct  606   DVLQFYSRM  614



>ref|XP_001824182.2| DNA helicase PIF1 [Aspergillus oryzae RIB40]
Length=754

 Score =   308 bits (789),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 196/482 (41%), Positives = 269/482 (56%), Gaps = 72/482 (15%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VL+A+   GKS+F TGSAGTGK+ L++ II+KLR+ + R   RV VTASTG++AC 
Sbjct  256   EQKHVLNAVVEQGKSIFFTGSAGTGKSVLMREIIKKLRDKYRREPDRVAVTASTGLAACN  315

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ KV  N + R+RW   + LIIDE+S++ G+L+DKLE 
Sbjct  316   IEGVTLHSFAGIGLGKEPVPELVKKVKRNPKGRNRWLRTKVLIIDEVSMVDGDLFDKLEE  375

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             +AR+IR+  NG      +GGIQ+V +GDFFQLPP+ + +T+  KFAF A++W  S    I
Sbjct  376   LARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPDGSTREAKFAFSAATWNTSIQHTI  429

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRND  1317
              LTTVFRQ+DP    +L  +R G+        F+ L    +   +LE    A +L+P   
Sbjct  430   LLTTVFRQADPDFANMLNEMRLGKLSQRTIDTFQQLQRPLDFHDSLE----ATELFPTRQ  485

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNG--EDSWKEQLKLG--IAPDFLELCVGARVMLTKN  1485
             +V   N   +  L  +++ + A D+G  +D    +  L   +AP  + L  GA+VML KN
Sbjct  486   EVEHANGARMQRLSGEVMTFNAADSGTIQDVQHREKLLANCMAPQVIHLKKGAQVMLIKN  545

Query  1486  LNARHKLVNGAAGTVIGFESVNGTYETFGTN-----------------------------  1578
             +     LVNG+ G V+ F     T++ +  N                             
Sbjct  546   ME--DTLVNGSIGRVVAFMD-EATFDFYRENESDFAGDQGAQTDEEMMDRARKKLKSLAH  602

Query  1579  ----------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSI  1716
                       W P+V F   D   + L+ +PETW I +   EV A R Q+PLILAWALSI
Sbjct  603   KEGGVVVSKKW-PLVCFVQPDGTERHLLCQPETWKIELPNGEVQAQRVQVPLILAWALSI  661

Query  1717  HKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             HK QG TL  +  DL R F  G  YVALSR  S EGL ++ F+   + VHPKV  F  +L
Sbjct  662   HKAQGQTLPRVKVDLGRVFEKGQAYVALSRATSKEGLQVTRFDARKVMVHPKVTEFYSKL  721

Query  1897  CS  1902
              S
Sbjct  722   IS  723



>ref|XP_004343985.1| zinc knuckle domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20582.1| zinc knuckle domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=668

 Score =   305 bits (782),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 189/454 (42%), Positives = 262/454 (58%), Gaps = 32/454 (7%)
 Frame = +1

Query  616   VKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSA  795
              K + +Q++ L     G S+F TGSAGTGK+ L++ ++R LREIHG   V+VTASTG++A
Sbjct  228   AKLSPDQARGLALALRGNSLFFTGSAGTGKSLLLREMVRLLREIHGDDAVHVTASTGLAA  287

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLHS+AG+GLGE + E L+ KV S +R R RW   + LIIDE+S++ G L+DKL
Sbjct  288   CNIGGCTLHSYAGVGLGEQSQEVLVTKVLSTKRSRDRWVSTKVLIIDEVSMLEGTLFDKL  347

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQI  1155
             E++ARK+R      + +  +GGIQ++ SGDF Q        T+ F FE+++WK      I
Sbjct  348   EYVARKVR------NYDAPFGGIQLILSGDFLQ--------TKFFCFESAAWKKVVREVI  393

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-----------AVKL  1302
              LT VFRQSD   V LL  +R G+   E  ++L   C     D             A  L
Sbjct  394   VLTHVFRQSDNAFVALLNDLRVGKVTEEGRSMLA-RCMIPYHDRARSIHRGDDRIQATLL  452

Query  1303  YPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGI-APDFLELCVGARVMLT  1479
             YP   DV   N K L  L      YRAVD+G + ++  L     APD LEL + A+V+L 
Sbjct  453   YPHRRDVDGENTKRLAELAGTSRVYRAVDSGVEPYRSMLARNCSAPDVLELKLNAQVILL  512

Query  1480  KNLNARHKLVNGAAGTVIGFESV---NGTYETFG-TNWLPVVKFDFKPKKLIIRPETWSI  1647
             KNL++  +LVNGA G V+ F+     +   E++  +   P V F    ++LI  PE W+I
Sbjct  513   KNLDSALELVNGARGVVVDFKKPVKQDNKEESYDESKEYPEVLFTSGVRRLIT-PEEWNI  571

Query  1648  MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGL  1827
                 E  A R Q PL LAWALSIHK QGM+++ +  DL + + YG  YVALSR  SL+GL
Sbjct  572   GVAGEPQAWRVQCPLALAWALSIHKAQGMSISKVQMDLGKVWEYGQGYVALSRATSLDGL  631

Query  1828  HLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKEDA  1929
             ++   N   I  HPKVL F   + +Q  Q +++ 
Sbjct  632   YIMDLNEKGITAHPKVLQFYADMEAQQQQERDEG  665



>ref|XP_003067291.1| DNA repair and recombination protein pif1, mitochondrial precursor, 
putative [Coccidioides posadasii C735 delta SOWgp]
 gb|EER25146.1| DNA repair and recombination protein pif1, mitochondrial precursor, 
putative [Coccidioides posadasii C735 delta SOWgp]
Length=767

 Score =   308 bits (788),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 195/487 (40%), Positives = 271/487 (56%), Gaps = 64/487 (13%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTAST  783
             R+  + EQ+ VLD I   G SVF TGSAGTGK+ L++  IR LR+ + +   RV VTAST
Sbjct  256   RMFLSEEQNHVLDMIVKKGHSVFFTGSAGTGKSVLMREAIRGLRQKYKKEPDRVAVTAST  315

Query  784   GVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGEL  963
             G++AC + G TLHSFAG+GLG+  A  LL KV  N++ R+RW   + LIIDEIS++ GE 
Sbjct  316   GLAACNIEGVTLHSFAGVGLGKEDATGLLKKVKRNQKARNRWLRTKVLIIDEISMVDGEF  375

Query  964   YDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLS  1140
             +DKLE +ARK+RS  NG      +GGIQ+V +GDFFQLPP+ + + + KFAF+A++W   
Sbjct  376   FDKLEELARKVRS--NGRP----FGGIQLVVTGDFFQLPPVADSSKEAKFAFDANTWNTC  429

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE--NHCSNLEPDPLAVKLYPRN  1314
                 I LT VFRQ DP    +L  +R G    + ++  +  +   N E D  A +L+P  
Sbjct  430   VQHTILLTHVFRQKDPGFASMLNELRLGRVTQKTIDAFKQLSRPLNFEDDLEATELFPTR  489

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTK  1482
              +V   N   +  L  ++I + AVD+G   + S ++++    +AP  + L  GA+VML K
Sbjct  490   HEVEGANSTRMGRLSGEVIPFTAVDSGAIQDKSMRDKMLANCMAPPLIHLKKGAQVMLIK  549

Query  1483  NLNARHKLVNGAAGTVIGFESVNGTYETFGTN----------------------------  1578
             N++    LVNG+ G V+ F   + TY+ +  N                            
Sbjct  550   NMD--DSLVNGSLGKVVAFMD-DSTYDHYVRNEDSYHSGHEYNRDDESSRARKKIKSMAY  606

Query  1579  ------------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWAL  1710
                         W P+V F   D   ++L+ +PETW I +   EV A R+Q+PLILAWAL
Sbjct  607   DPKGLGVTTAKLW-PLVSFVLPDGTERQLLCKPETWKIELPNGEVQAQRQQVPLILAWAL  665

Query  1711  SIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDK  1890
             SIHK QG TL  +  DL R F  G  YVALSR  S  GL ++ F P  + VH KV  F  
Sbjct  666   SIHKAQGQTLQRVKVDLGRVFEKGQAYVALSRATSTSGLQVTRFEPRKVMVHHKVKEFYA  725

Query  1891  RLCSQPD  1911
              L +  D
Sbjct  726   NLSTTND  732



>ref|XP_004185858.1| hypothetical protein EIN_034430 [Entamoeba invadens IP1]
 gb|ELP86512.1| hypothetical protein EIN_034430 [Entamoeba invadens IP1]
Length=619

 Score =   303 bits (777),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 182/444 (41%), Positives = 263/444 (59%), Gaps = 34/444 (8%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             +Q QV+D  ++G S F +G+AGTGK+++++ +I  LR+ H    VYVTASTG++AC + G
Sbjct  133   DQKQVIDLANSGVSFFFSGAAGTGKSYVMKKMISILRQTHELG-VYVTASTGIAACNIGG  191

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              TLHSFAGIGLG+ + ++LL KV  N +   RWK  + ++IDEIS+ISGEL +KL+++A+
Sbjct  192   TTLHSFAGIGLGDLSGDQLLTKVIKNSQAFDRWKKAEVILIDEISMISGELLEKLDYVAK  251

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDLTTV  1170
              I+ +      +  +GGIQ++ SGDFFQLPP+      KF FE ++WK +    + L T 
Sbjct  252   NIKRN------QQPFGGIQMIFSGDFFQLPPVSKNQNIKFVFEVAAWKNAVKECVILHTQ  305

Query  1171  FRQSDPQLVKLLQGIRKGEYDFEDLNLLEN-HCSNLEPDPLAVKLYPRNDDVYRVNKKHL  1347
              RQ+D + + +L  IR G +  +   +L+     NL  +     LY    D   +N++ L
Sbjct  306   HRQNDLEFIDILNNIRYGYFTKKAQEVLQTCQKKNLGSEKRTC-LYSHRADADTMNRREL  364

Query  1348  DSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAGT  1527
             D L ++   +  +DNG ++ K+ LK   APD L L  GA VML KN+ A   LVNGA GT
Sbjct  365   DKLKEETTTFECLDNGIETSKKSLKDCQAPDKLVLKKGAVVMLLKNIAADLGLVNGAVGT  424

Query  1528  VIGFE-------------------SVNGTYETFGTN--WLPVVKFDFKPKKLIIRPETWS  1644
             VIGFE                    +  T  +F  +    P+V+F+ K K L+I P+ W 
Sbjct  425   VIGFEPMKEIKLKELKENEKSQFCDIRVTERSFYAHNKVFPLVQFE-KTKYLVI-PDVWE  482

Query  1645  IMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEG  1824
             I  G  V+A R Q+PL  AWALSIHK QG+TL     +L + F  G  YVALSR++SL+G
Sbjct  483   IEIGGIVMACRVQLPLAYAWALSIHKSQGLTLPRAEVNLEKVFESGQAYVALSRLQSLDG  542

Query  1825  LHLSSFNP--NIIKVHPKVLNFDK  1890
             L +    P  +  +V+PKVL F K
Sbjct  543   LKIVGNLPGQSAWRVNPKVLQFYK  566



>ref|XP_005099261.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Aplysia californica]
Length=663

 Score =   305 bits (780),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 179/430 (42%), Positives = 252/430 (59%), Gaps = 23/430 (5%)
 Frame = +1

Query  616   VKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSA  795
             V  T EQ+QVL+ +  G+S+F TGSAGTGK+FL++ II  L   H     + TASTGV+A
Sbjct  226   VMLTPEQNQVLEMVKKGRSIFFTGSAGTGKSFLLKRIIGALPPNH----TFATASTGVAA  281

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLHSFAGIG G+A  ++ + ++ S +RV  +W+  + LIIDE+S++ GEL+DKL
Sbjct  282   CHIGGTTLHSFAGIGSGKAPLQQCI-ELASRQRVAQQWRACKHLIIDEVSMVDGELFDKL  340

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNK-NTQKFAFEASSWKLSFDTQ  1152
             E +AR IR S      +  +GGIQ++  GDF QLPP+      ++F F++ +W+   +T 
Sbjct  341   ENVARVIRKS------DQPFGGIQLILCGDFLQLPPVTRPGEIRRFCFQSEAWQKCLETT  394

Query  1153  IDLTTVFRQSDPQLVKLLQGIRKGEY-DFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVY  1326
             + LT V RQ+D   + +LQ +RKG   DF    L       +E D + A +L     DV 
Sbjct  395   MQLTDVKRQADKSFINILQYVRKGMCPDFVSDTLQATKHHIIEKDGVVATRLCTHKVDVE  454

Query  1327  RVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKL  1506
              +N   L  L  +   + A D+ E        L   P  LEL +GA+VML KNL+ +  L
Sbjct  455   EINVSSLKELQGESRKFAATDSEEGYALHLNTLCPVPASLELKIGAQVMLCKNLDVQRGL  514

Query  1507  VNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQI  1686
             VNGA G V  +++ N  +        PVVKF     + II+P  W          VR+Q+
Sbjct  515   VNGARGVVTSYDTKNHGH--------PVVKFVCGVTE-IIKPSRWVFRLSGGNTVVRRQV  565

Query  1687  PLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVH  1866
             PL LAWA+SIHK QGMTL+C+   L+R F  G  YVALSR KSLEGL +  F+ + ++  
Sbjct  566   PLKLAWAISIHKSQGMTLDCVEMSLSRVFETGQAYVALSRAKSLEGLRVLDFSNSCVRAD  625

Query  1867  PKVLNFDKRL  1896
             P+VL+F  RL
Sbjct  626   PRVLSFYNRL  635



>ref|XP_001274616.1| mitochondrial DNA helicase (Pif1), putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW13190.1| mitochondrial DNA helicase (Pif1), putative [Aspergillus clavatus 
NRRL 1]
Length=747

 Score =   306 bits (784),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 194/482 (40%), Positives = 268/482 (56%), Gaps = 72/482 (15%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLD +   GKS+F TGSAGTGK+ L++ II++LR  + +   RV VTASTG++AC 
Sbjct  245   EQRHVLDTVVQQGKSIFFTGSAGTGKSVLMREIIKQLRSKYRKEPDRVAVTASTGLAACN  304

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + LIIDE+S++ G+L+DKLE 
Sbjct  305   IEGVTLHSFAGIGLGKEPVPELVKKIKRNQKARNRWLRTKVLIIDEVSMVDGDLFDKLEE  364

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+   + +  KFAF A +W  S    I
Sbjct  365   IARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPEGSNREAKFAFAAGTWNTSIQHTI  418

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEY------DFEDLNLLENHCSNLEPDPLAVKLYPRND  1317
              LT VFRQ DP    +L  +R G+        F+ L+   N   +LE    A +L+P   
Sbjct  419   LLTHVFRQKDPDFADMLNEMRLGKLTPRTIETFKSLSRPLNFHDSLE----ATELFPTRH  474

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKN  1485
             +V + N   +  L  +++ ++AVD+G   +  ++E+L    +AP  + L  GA+VML KN
Sbjct  475   EVEQANSARMVKLSGEMMTFQAVDSGSIQDAQYREKLLANCMAPPVIHLKKGAQVMLIKN  534

Query  1486  LNARHKLVNGAAGTVIGFESVNGTYETFGTN-----------------------------  1578
             +     LVNG+ G V  F     T+E +  N                             
Sbjct  535   ME--DTLVNGSIGRVAAFMD-EATFEYYRDNENEFSGRQENGSDEENLSHARKKLKGLGN  591

Query  1579  ----------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSI  1716
                       W P+V F   D   + L+ +PE W I +   EV A R+Q+PLILAWALSI
Sbjct  592   KDGGIVVSRKW-PLVCFVQPDGTERHLLCQPEAWKIELPNGEVQAQRQQVPLILAWALSI  650

Query  1717  HKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             HK QG TL  +  DL R F  G  YVALSR  S EGL ++ F+   + VHPKV  F  +L
Sbjct  651   HKAQGQTLQRVKVDLGRVFEKGQAYVALSRATSKEGLQVTRFDARKVMVHPKVTEFYAKL  710

Query  1897  CS  1902
              S
Sbjct  711   VS  712



>gb|KGO67613.1| DNA helicase PIF1, ATP-dependent [Penicillium italicum]
Length=720

 Score =   305 bits (782),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 187/469 (40%), Positives = 267/469 (57%), Gaps = 59/469 (13%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLDA+   GKS+F TGSAGTGK+ L++ II K+R  + +   R+ VTASTG++AC 
Sbjct  231   EQRAVLDAVVDRGKSMFFTGSAGTGKSVLMREIIAKMRNKYRKEPDRIAVTASTGLAACN  290

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + L++DE+S++ G+L+DKLE 
Sbjct  291   IGGVTLHSFAGIGLGKEPVPELVKKIKKNQKARNRWLRTKVLVVDEVSMVDGDLFDKLEE  350

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+ + + +  KFAF A+SW       I
Sbjct  351   IARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPDGSNREAKFAFAAASWTTCIQHTI  404

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE-PDPL-AVKLYPRNDDVYR  1329
              LT +FRQ DP+   +L  +R G+     +   +     L+  D + A +L+P   +V  
Sbjct  405   LLTNIFRQRDPEFADMLNEMRLGKITPRTIEAFKRLSRPLDVKDQIEATELFPTRAEVEG  464

Query  1330  VNKKHLDSLHQDLIGYRAVDNG--EDSWKEQLKLG--IAPDFLELCVGARVMLTKNLNAR  1497
              N   +  L  +++ + AVD+G  +D    +  L   +AP  ++L  GA+VML KN+   
Sbjct  465   ANSARMARLSGEVMRFNAVDSGTIQDPQHRERLLSNCMAPPMIQLKKGAQVMLIKNME--  522

Query  1498  HKLVNGAAGTVIGFESVN--GTYETFGTNWL-----------------------------  1584
               LVNG+ G V+ F S +   +Y+    N+                              
Sbjct  523   DSLVNGSIGKVVAFMSEDYFDSYKENDKNFADDTTASDDERAQRARKKLKPMGFKEGPAS  582

Query  1585  -----PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMT  1737
                  P+V F   D   + L+ +PETW I +   EV A R+Q+PLILAWALSIHK QG T
Sbjct  583   MARKWPLVSFLQPDGSERHLLCQPETWKIELPNGEVQAQRQQVPLILAWALSIHKAQGQT  642

Query  1738  LNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNF  1884
             L+ +  DL R F  G  YVALSR  S EGL ++ F P  + VHPKV+ F
Sbjct  643   LHRVKVDLGRVFEKGQAYVALSRAVSQEGLQVTRFEPRKVMVHPKVVEF  691



>emb|CCF52961.1| related to PIF1-DNA helicase involved in mitochondrial DNA repair 
and telomere length control [Ustilago hordei]
Length=717

 Score =   305 bits (782),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 185/460 (40%), Positives = 255/460 (55%), Gaps = 42/460 (9%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSACA  801
             EQ +VL   +  GK+VF TGSAGTGK+ L++ II++LR  H +    V VTASTG++AC 
Sbjct  267   EQRKVLHMVVEEGKNVFFTGSAGTGKSVLLREIIKELRRKHAKRPDSVAVTASTGIAACN  326

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G T+HSFAGIGLG+    +L+ K+  NR+   RW   Q LIIDE+S++   L+DKLE 
Sbjct  327   IGGLTIHSFAGIGLGKEPTAQLVSKIRKNRKAAARWARTQVLIIDEVSMVDPALFDKLEE  386

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDL  1161
             +AR IR        +  +GGIQVV +GDFFQLPP+    +  FAF+A SW      +++L
Sbjct  387   VARLIRKK-----PDKPFGGIQVVITGDFFQLPPVNPGGSVTFAFDAQSWHKVVQHKVNL  441

Query  1162  TTVFRQSDPQLVKLLQGIRKG---EYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRV  1332
             T VFRQ D   V +L  +R G   +   E    LE      + D +  +L+P  ++V R 
Sbjct  442   TQVFRQKDESFVSMLNEMRFGRLSQKTIEAFRKLE-RTPKYDDDIVPTELFPMRNEVDRA  500

Query  1333  NKKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHK  1503
             N   L +L  +   Y+A D G    ++ +  L+  IA   L L  GA+VML KN++    
Sbjct  501   NMGRLSALQSESQSYQAQDGGTLMGEARERVLQNSIALPVLHLKKGAQVMLIKNVD--ES  558

Query  1504  LVNGAAGTVIGF------ESVNGTYET-------------FGTNWLPVVKFDFK---PKK  1617
             LVNG+ G V+ F      +   G  E                T   P+V+F       + 
Sbjct  559   LVNGSVGKVVEFMDDTEYDKAIGNQEMAEMQKEERDKAVRVSTRKWPLVRFHLPNGGTRD  618

Query  1618  LIIRPETW--SIMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVY  1791
              + RPETW   + DG EV A R Q+PLILAWA+SIHK QG TL C   +LNR F  G  Y
Sbjct  619   YLARPETWKTELPDG-EVQASRTQVPLILAWAMSIHKSQGQTLPCCKINLNRVFEKGQAY  677

Query  1792  VALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD  1911
             VALSR  S+EGL +  F P  +  HP+V+ + + L +  D
Sbjct  678   VALSRATSIEGLQVLGFKPEKVMAHPRVIQWSQSLIALSD  717



>ref|XP_002340265.1| mitochondrial DNA helicase (Pif1), putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED22878.1| mitochondrial DNA helicase (Pif1), putative [Talaromyces stipitatus 
ATCC 10500]
Length=808

 Score =   307 bits (787),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 197/502 (39%), Positives = 274/502 (55%), Gaps = 65/502 (13%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLDA+    KS+F TGSAGTGK+ L++ II+KLR+ + R   RV VTASTG++AC 
Sbjct  301   EQKAVLDAVVDRQKSIFFTGSAGTGKSVLMREIIKKLRDKYRREPDRVAVTASTGLAACH  360

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+  A EL  KV  N++ R+RW   + LIIDE+S++ G+L+DKLE 
Sbjct  361   IEGVTLHSFAGIGLGKEPAAELFKKVRKNQKARNRWLRTKVLIIDEVSMVDGDLFDKLEE  420

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+ + + +  KFAF+A++W  S    I
Sbjct  421   IARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPDTSARDAKFAFDAATWNTSIQHTI  474

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE--PDPLAVKLYPRNDDVYR  1329
              LT VFRQ DP   ++L  +R G    +     +     L+   D  A +L+P   +V  
Sbjct  475   LLTHVFRQKDPVFAEMLNQMRLGRITPQTTEAFKKLSRPLDFHDDLDATELFPTRAEVEN  534

Query  1330  VNKKHLDSLHQDLIGYRAVDNG--EDSWKEQLKLG--IAPDFLELCVGARVMLTKNLNAR  1497
              N   +  L  +++ + A D+G  +D       L   +AP  + L  GA+VML KN+   
Sbjct  535   ANGLRMSRLSGEVMTFHAQDSGTIQDVQMRDRLLANCMAPPVIHLKKGAQVMLIKNM--E  592

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTN---------------------------------  1578
               LVNG+ G ++ F     T++ +  N                                 
Sbjct  593   DNLVNGSLGKIVAFMD-ETTFDYYRNNEDEFTGDGKEGSDDDDAAARNRKKIRALAHKDG  651

Query  1579  -------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKC  1725
                    W P+V F   D   + L+ +PETW I +   E+ A R Q+PLILAWALSIHK 
Sbjct  652   GISTSRKW-PLVCFTQQDGTERHLLCQPETWKIELPNGEIQAQRSQVPLILAWALSIHKA  710

Query  1726  QGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQ  1905
             QG TL  +  DL R F  G  YVALSR  S +GL ++ F+P  + VHPKV++F  +L   
Sbjct  711   QGQTLPRVKVDLGRVFEKGQAYVALSRATSQDGLQVTGFDPRKVMVHPKVIDFYSKLADI  770

Query  1906  PDQPKEDAVTKKKQGGSSTCNQ  1971
                      TKK+  G  T N+
Sbjct  771   NSVVNPSGNTKKEVNGGRTVNE  792



>gb|KGO41533.1| DNA helicase PIF1, ATP-dependent [Penicillium expansum]
 gb|KGO61839.1| DNA helicase PIF1, ATP-dependent [Penicillium expansum]
 gb|KGO69979.1| DNA helicase PIF1, ATP-dependent [Penicillium expansum]
Length=720

 Score =   305 bits (781),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 187/469 (40%), Positives = 265/469 (57%), Gaps = 59/469 (13%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLDA+   GKS+F TGSAGTGK+ L++ II KLR  + +   R+ VTASTG++AC 
Sbjct  231   EQRAVLDAVVDRGKSMFFTGSAGTGKSVLMREIIAKLRNKYRKEPDRIAVTASTGLAACN  290

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + L++DE+S++ G+L+DKLE 
Sbjct  291   IGGVTLHSFAGIGLGKEPVPELVKKIKKNQKARNRWLRTKVLVVDEVSMVDGDLFDKLEE  350

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+ + + +  KFAF A+SW       I
Sbjct  351   IARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPDGSNREAKFAFAAASWTTCIQHTI  404

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE-PDPL-AVKLYPRNDDVYR  1329
              LT +FRQ DP+   +L  +R G+     +         L+  D + A +L+P   +V  
Sbjct  405   LLTNIFRQRDPEFADMLNEMRLGKITPRTIEAFRRLSRPLDVKDQIEATELFPTRAEVEG  464

Query  1330  VNKKHLDSLHQDLIGYRAVDNG--EDSWKEQLKLG--IAPDFLELCVGARVMLTKNLNAR  1497
              N   +  L  +++ + AVD+G  +D    +  L   +AP  ++L  GA+VML KN+   
Sbjct  465   ANSARMARLSGEVMRFNAVDSGTIQDPQHRERLLSNCMAPPMIQLKKGAQVMLIKNME--  522

Query  1498  HKLVNGAAGTVIGFESVN--GTYETFGTNWL-----------------------------  1584
               LVNG+ G V+ F S +   +Y+    N+                              
Sbjct  523   DSLVNGSIGKVVAFMSEDYFDSYKENDKNFADDATVSDDERAHRARKKLKPMGYKESPAS  582

Query  1585  -----PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMT  1737
                  P+V F   D   + L+ +PETW I +   EV A R+Q+PLILAWALSIHK QG T
Sbjct  583   MARKWPLVSFLQPDGSERHLLCQPETWKIELPNGEVQAQRQQVPLILAWALSIHKAQGQT  642

Query  1738  LNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNF  1884
             L  +  DL R F  G  YVALSR  S EGL ++ F P  + VHP+V+ F
Sbjct  643   LQRVKVDLGRVFEKGQAYVALSRAVSQEGLQVTRFEPRKVMVHPRVVEF  691



>ref|XP_001800727.1| hypothetical protein SNOG_10457 [Phaeosphaeria nodorum SN15]
 gb|EAT81851.2| hypothetical protein SNOG_10457 [Phaeosphaeria nodorum SN15]
Length=741

 Score =   305 bits (782),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 195/472 (41%), Positives = 263/472 (56%), Gaps = 61/472 (13%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAISA-GKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTAST  783
             R+  + EQ  VL+ ++   KSVF TGSAGTGK+ L++ II  LR  + R   RV VTAST
Sbjct  246   RIFLSEEQQNVLNLVTEYKKSVFFTGSAGTGKSVLLREIIAALRRKYVREPDRVAVTAST  305

Query  784   GVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGEL  963
             G++AC + G TLHSF+GIGLG+  AE+L+ K+  N + + RW   + LI+DE+S++ G+L
Sbjct  306   GLAACNVGGVTLHSFSGIGLGKEPAEDLIKKIRRNAKAKQRWMRTKVLIMDEVSMVDGDL  365

Query  964   YDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI--FNKNTQKFAFEASSWKL  1137
             +DKLE IAR IR+  NG      +GGIQ+V +GDFFQLPP+  + K + KFAF+A +W  
Sbjct  366   FDKLEQIARTIRN--NGRP----FGGIQLVITGDFFQLPPVPEYGKAS-KFAFDAGTWTT  418

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLN-LLENHCSNLEPDPLAV  1296
             S +  I LT VFRQ DP    +L  +R+G         F  L+  L     N+E    A 
Sbjct  419   SIEHTIGLTHVFRQKDPVFANMLNEMREGRLTPDSIARFRKLDRALPASDENIE----AT  474

Query  1297  KLYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ----LKLGIAPDFLELCVGA  1464
             +L+P   +V R N   +  LH  +  + A D G  + KEQ    L+  + P+ + L  GA
Sbjct  475   ELFPTRQEVDRANNLRMQQLHGTVFSFEARDGGTITNKEQRDRLLQSCMVPEVVHLKKGA  534

Query  1465  RVMLTKNLNARHKLVNGAAGTVIGFESVN---------------GTYE----------TF  1569
             +VML KN++    LVNG+ G V GF +                 G  E          T 
Sbjct  535   QVMLVKNMD--DTLVNGSLGKVTGFMTEQMFVLYKEDEEAFLEGGASEQAMKNEMAKSTL  592

Query  1570  GTNW---LPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQ  1728
             G N     PVV+F   D   + L+ + E W I +   EV A R QIPLILAWALSIHK Q
Sbjct  593   GLNTAQVFPVVRFAIADGTTRDLLCKREDWKIELPNGEVQASRSQIPLILAWALSIHKAQ  652

Query  1729  GMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNF  1884
             G TL  +  DL R F  G  YVALSR  S+ GL +  F+P  +  H KV +F
Sbjct  653   GQTLERVRVDLGRVFEKGQAYVALSRATSMAGLQILRFDPRKVIAHEKVRSF  704



>dbj|GAD93197.1| mitochondrial DNA helicase [Byssochlamys spectabilis No. 5]
Length=843

 Score =   307 bits (787),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 193/480 (40%), Positives = 270/480 (56%), Gaps = 63/480 (13%)
 Frame = +1

Query  625   TVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSA  795
             + EQ  VL+A+   GKS+F TGSAGTGK+ L++ II+KLR+ + R   RV VTASTG++A
Sbjct  338   SAEQRGVLEAVVDKGKSIFFTGSAGTGKSVLMREIIKKLRDKYRREPDRVAVTASTGLAA  397

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + LIIDE+S++ G+L+DKL
Sbjct  398   CNIEGVTLHSFAGIGLGKEAVPELVKKIKKNQKARNRWMRTKILIIDEVSMVDGDLFDKL  457

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQ  1152
             E IAR+IR+  NG      +GGIQ++ +GDFFQLPP+ + + + KFAF A++W       
Sbjct  458   EEIARRIRN--NGRP----FGGIQLIVTGDFFQLPPVPDSSREAKFAFSAATWNTCIQHT  511

Query  1153  IDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE-PDPL-AVKLYPRNDDVY  1326
             I LT VFRQ DP+  ++L  +R G+     + + +     L+  D L A +L+P   +V 
Sbjct  512   ILLTHVFRQKDPEFAEMLNEMRLGKITPRTIEVFKKLSRPLDFHDALEATELFPTRAEVE  571

Query  1327  RVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKNLNA  1494
               N   +  L  +++ + A D+G   +  ++E+L    +AP  + L  GA+VML KN+  
Sbjct  572   NANSARMQRLSGEVMTFHATDSGSIKDVQFREKLLANCMAPPVIHLKKGAQVMLIKNME-  630

Query  1495  RHKLVNGAAGTVIGF--------------------------ESVN---------GTYETF  1569
                LVNG+ G V+ F                          E  N         G  E  
Sbjct  631   -DTLVNGSLGRVVAFMDEATFDYYRKNEDEFGDEDGALSDEEKANRARKKLKSFGYKENE  689

Query  1570  GT-----NWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHK  1722
             G       W P+V F   D   + L+ +PETW I +   E+ A R+Q+PLILAWALSIHK
Sbjct  690   GAVTTSRKW-PLVCFVQPDGTERHLLCQPETWKIELPNGEIQAQRQQVPLILAWALSIHK  748

Query  1723  CQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              QG TL  +  DL R F  G  YVALSR  S  GL +  F P  + VHPKV+ F   L S
Sbjct  749   AQGQTLQRVKVDLGRVFEKGQAYVALSRATSQAGLQVLRFEPRKVMVHPKVIQFYSNLVS  808



>gb|KDB17913.1| putative mitochondrial DNA helicase (Pif1) [Ustilaginoidea virens]
Length=858

 Score =   308 bits (788),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 195/485 (40%), Positives = 272/485 (56%), Gaps = 60/485 (12%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLRE--IHGRSRVYVTASTG  786
             +  + EQ  VLD  ++ G+SVF TG AGTGK+ L++ II +L++   H   RV VTASTG
Sbjct  345   ISLSSEQEHVLDMVVNRGQSVFFTGPAGTGKSVLMRAIINELKKKFSHNPERVAVTASTG  404

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ K+  N++ + RW   + LIIDEIS++ G+L+
Sbjct  405   LAACNIGGITLHSFSGIGLGKEDAPTLVRKIRRNQKAKTRWLQTKCLIIDEISMVDGDLF  464

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN---KNTQKFAFEASSWKL  1137
             DKL  I R IR+  NG      WGGIQ++ +GDFFQLPP+ +   K   KFAF+A++W  
Sbjct  465   DKLSQIGRTIRN--NGRP----WGGIQLIITGDFFQLPPVPDADKKRESKFAFDAATWST  518

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLA--VKLYPR  1311
             S D  I LT VFRQ DPQ  ++L  +R G+     ++  +     L  D      +L+P 
Sbjct  519   SIDHTIGLTQVFRQRDPQFARMLNEMRIGKISQSTVDAFKALSRPLSFDDGVDLAELFPT  578

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNL  1488
                V   N++ L  L   +  Y A+D+G+ + +++L +  +AP  LEL VGA+VML KNL
Sbjct  579   RAQVEGSNERKLRELPGKIYRYDAMDSGDQAVRDKLLVNMMAPKALELKVGAQVMLIKNL  638

Query  1489  NARHKLVNGAAGTVIGFESVNGTYETFGTNWL----------------------------  1584
             +    LVNG+ G VI F S   T+E  G N L                            
Sbjct  639   D--ETLVNGSLGKVIAF-SDEKTFEMGGLNPLDAAMEDSIAKAKRKLAAFSRDSGSGSGL  695

Query  1585  -----PVVKFDFK---PKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMT  1737
                  PVV+F      P+ ++ +PE W + +   EV A R Q+PLILAWALSIHK QG T
Sbjct  696   NARKFPVVQFISTGGLPRVILCQPEEWKVELPNGEVQAKRTQLPLILAWALSIHKAQGQT  755

Query  1738  LNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQP  1917
             L  +  +L R F  G  YVALSR  S +GL +  F+ + +  H KV+ F  +L S     
Sbjct  756   LERVTVNLGRVFEKGQAYVALSRATSQDGLRVLGFDRSKVMAHQKVIEFYGKLYS-----  810

Query  1918  KEDAV  1932
              EDAV
Sbjct  811   VEDAV  815



>ref|XP_758865.1| hypothetical protein UM02718.1 [Ustilago maydis 521]
 gb|EAK83616.1| hypothetical protein UM02718.1 [Ustilago maydis 521]
Length=706

 Score =   304 bits (778),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 184/458 (40%), Positives = 251/458 (55%), Gaps = 38/458 (8%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSACA  801
             EQ +VL   +  GK+VF TGSAGTGK+ L++ II++LR  H +    V VTASTG++AC 
Sbjct  256   EQRKVLHMVVEEGKNVFFTGSAGTGKSVLLREIIKELRRKHAKRPDSVAVTASTGIAACN  315

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G T+HSFAGIGLG+     LL+KV   R+   RW+  Q LIIDE+S++   L DKLE 
Sbjct  316   IGGVTIHSFAGIGLGKEAVTPLLNKVRKQRKALGRWQRTQVLIIDEVSMVDPALLDKLEE  375

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDL  1161
             IAR IR        +  +GGIQ+V +GDFFQLPP+    +  FAF+A  W      +++L
Sbjct  376   IARLIRKK-----PDKPFGGIQLVITGDFFQLPPVNPGGSVTFAFDAQCWDRVVQHKVNL  430

Query  1162  TTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE--NHCSNLEPDPLAVKLYPRNDDVYRVN  1335
             T VFRQ D   V +L  +R G+   + ++           + D +  +L+P  ++V R N
Sbjct  431   TQVFRQKDQSFVTMLNEMRFGKLSQKTIDAFRKLERVPKYDNDIMPTELFPMRNEVDRAN  490

Query  1336  KKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKL  1506
                L +L  +   YRA D G    ++    L   IA   L L  GA+VML KNL+    L
Sbjct  491   ASRLMALQAEGQTYRAQDGGTLTGEARDRILSHSIAVPVLSLKKGAQVMLIKNLD--ETL  548

Query  1507  VNGAAGTVIGF------ESVNGTYET-------------FGTNWLPVVKFDF---KPKKL  1620
             VNG+ G VI F      +   G  E                T   P+V+F     + +  
Sbjct  549   VNGSVGKVIDFMDDADYDKQTGALEAGEQQREDRDKAPRISTRKWPLVRFHLPNGQTRDY  608

Query  1621  IIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVA  1797
             + RPE+W   +   EV A R Q+PLILAWA+SIHK QG TL C   DLNR F  G  YVA
Sbjct  609   LARPESWKTELPNGEVQASRTQVPLILAWAMSIHKSQGQTLPCCKIDLNRVFEKGQAYVA  668

Query  1798  LSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD  1911
             LSR  SLEGL +  F P+ +  HP+V+ + + L +  D
Sbjct  669   LSRATSLEGLQVLGFRPDKVMAHPRVIQWSQSLIALSD  706



>dbj|GAC93473.1| hypothetical protein PHSY_001038 [Pseudozyma hubeiensis SY62]
Length=719

 Score =   304 bits (779),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 184/460 (40%), Positives = 253/460 (55%), Gaps = 42/460 (9%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSACA  801
             EQ +VL   +  GK+VF TGSAGTGK+ L++ II++LR  H +    V VTASTG++AC 
Sbjct  269   EQRKVLHMVVEEGKNVFFTGSAGTGKSVLLREIIKELRRKHAKRPESVAVTASTGIAACN  328

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G T+HSFAGIGLG+    +LL K+   R+   RW+  Q LIIDE+S++   L DKLE 
Sbjct  329   IGGVTIHSFAGIGLGKEPVAQLLSKIRKQRKSSARWQRTQVLIIDEVSMVDPALLDKLEE  388

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDL  1161
             +AR IR        +  +GGIQVV +GDFFQLPP+    +  FAF+A  W      +++L
Sbjct  389   VARLIRK-----KPDKPFGGIQVVITGDFFQLPPVNPGGSVTFAFDAQCWDRVVQHKVNL  443

Query  1162  TTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE--NHCSNLEPDPLAVKLYPRNDDVYRVN  1335
             T VFRQ D   V +L  +R G+   + ++           + D +  +L+P   +V + N
Sbjct  444   TQVFRQKDESFVTMLNEMRFGKLSQKTIDAFRKLERVPRYDDDIVPTELFPMRQEVDKAN  503

Query  1336  KKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKL  1506
                L +L  +   YRAVD G    ++    L   IA   L L  GA+VML KNL+    L
Sbjct  504   AGRLLALQAEAQSYRAVDGGTLMGEARDRILSHSIAVSVLNLKKGAQVMLIKNLD--ETL  561

Query  1507  VNGAAGTVIGFESVNGTYETFGT--------------------NWLPVVKFDF---KPKK  1617
             VNG+ G VI F   N   +  G                      W P+V+F     + + 
Sbjct  562   VNGSVGKVIDFMDDNEYDKQTGALDAAEFQKEDRDKAQRSAVRKW-PLVRFHLANGQTRD  620

Query  1618  LIIRPETW--SIMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVY  1791
              + RPE+W   + DGE V A R Q+PLILAWA+SIHK QG TL C   +LNR F  G  Y
Sbjct  621   YLARPESWKTELPDGE-VQASRTQVPLILAWAMSIHKSQGQTLPCCKINLNRVFEKGQAY  679

Query  1792  VALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD  1911
             VALSR  SLEGL +  F P+ +  HP+V+ + + L +  D
Sbjct  680   VALSRATSLEGLQVLGFRPDKVMAHPRVIQWSQSLIALSD  719



>ref|XP_001259348.1| mitochondrial DNA helicase (Pif1), putative [Neosartorya fischeri 
NRRL 181]
 gb|EAW17451.1| mitochondrial DNA helicase (Pif1), putative [Neosartorya fischeri 
NRRL 181]
Length=744

 Score =   305 bits (780),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 194/485 (40%), Positives = 269/485 (55%), Gaps = 72/485 (15%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLD + + GKS+F TGSAGTGK+ L++ II++LR  + +   RV VTASTG++AC 
Sbjct  242   EQRHVLDTVVNQGKSIFFTGSAGTGKSVLMREIIKQLRSKYRKEPDRVAVTASTGLAACN  301

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + LIIDE+S++ G+L+DKLE 
Sbjct  302   IEGVTLHSFAGIGLGKEPVPELVKKIKRNQKARNRWLRTKVLIIDEVSMVDGDLFDKLEE  361

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+   + +  KFAF A++W  S    I
Sbjct  362   IARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPEGSNREAKFAFAAATWNTSIQHTI  415

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEY------DFEDLNLLENHCSNLEPDPLAVKLYPRND  1317
              LT VFRQ DP+  ++L  +R G+        F+ L+   N    LE    A +L+P   
Sbjct  416   LLTHVFRQKDPEFAEMLNEMRLGKLTPRTIETFKSLSRPLNFHDALE----ATELFPTRQ  471

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKN  1485
             +V + N   +  L  + + + AVD+G   +  ++E+L    +AP  + L  GA+VML KN
Sbjct  472   EVEQANSARMSRLSGETMTFHAVDSGTIQDVQFREKLLANCMAPPVIHLKKGAQVMLIKN  531

Query  1486  LNARHKLVNGAAGTVIGFESVNGTYETFGTN-----------------------------  1578
             +     LVNG+ G V+ F     T+E +  N                             
Sbjct  532   ME--DSLVNGSIGRVVAFMD-EATFEYYRDNESEFADGQDAGSDDERLNHARKKLKGLGN  588

Query  1579  ----------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSI  1716
                       W P+V F   D   + L+ +PE W I +   EV A R+Q+PLILAWALSI
Sbjct  589   KDGGVVVSRKW-PLVCFVQPDGTERHLLCQPEAWKIELPNGEVQAQRQQVPLILAWALSI  647

Query  1717  HKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             HK QG TL  +  DL R F  G  YVALSR  S  GL ++ F+   + VHPKV  F   L
Sbjct  648   HKAQGQTLQRVKVDLGRVFEKGQAYVALSRATSKAGLQVTRFDARKVMVHPKVTEFYSNL  707

Query  1897  CSQPD  1911
              S  D
Sbjct  708   VSISD  712



>ref|XP_956692.2| hypothetical protein NCU00428 [Neurospora crassa OR74A]
 emb|CAF05978.1| related to PIF1 protein precursor [Neurospora crassa]
 gb|EAA27456.2| DNA repair and recombination protein pif1 [Neurospora crassa 
OR74A]
 gb|KHE87908.1| hypothetical protein GE21DRAFT_4757 [Neurospora crassa]
Length=931

 Score =   308 bits (790),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 190/478 (40%), Positives = 267/478 (56%), Gaps = 66/478 (14%)
 Frame = +1

Query  655   ISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACALNGYTLHSF  828
             +  G+SVF TG AGTGK+ L++ II +L++   R   RV VTASTG++AC + G TLHSF
Sbjct  426   VEKGQSVFFTGPAGTGKSVLMRAIISELKKKFAREPERVAVTASTGLAACNIGGMTLHSF  485

Query  829   AGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIRSSI  1008
             AGIGLG+   + L+ K+  N++ + RW   + LIIDEIS++ GEL+DKL  I R IR+  
Sbjct  486   AGIGLGKEDIQTLVKKIRRNQKAKTRWLKTKVLIIDEISMVDGELFDKLSQIGRIIRN--  543

Query  1009  NGSDEEMVWGGIQVVASGDFFQLPPIFNK--NTQ---KFAFEASSWKLSFDTQIDLTTVF  1173
             NG      WGGIQ+V +GDFFQLPP+ +K  N Q   KFAF+A++W +S D  I LT VF
Sbjct  544   NGRP----WGGIQLVITGDFFQLPPVLDKDLNKQRDVKFAFDAATWNMSIDHTIGLTEVF  599

Query  1174  RQSDPQLVKLLQGIRKGEY------DFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRVN  1335
             RQ DP+  ++L  +R G        +F+ L+        LE      +L+P  ++V   N
Sbjct  600   RQRDPEFAEMLNEMRLGRISDRTVKNFQQLSRPLAFDDGLE----VTELFPTRNEVENSN  655

Query  1336  KKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNLNARHKLVN  1512
             ++ L +L   +  Y A D GE + +E+L    +AP  +EL   A+VML KN++    LVN
Sbjct  656   RQRLAALKGKIYRYEAYDTGEPAVREKLLANMMAPPVIELKKDAQVMLIKNMD--ETLVN  713

Query  1513  GAAGTVIGFES-------------------------------VNGTYETFGTNWLPVVKF  1599
             G+ GTV+GF +                                N   E       P+V+F
Sbjct  714   GSLGTVVGFMNEATFELKAGSDFDDDEDLDKKRRIKAFTSALSNAAIEKGDNTEYPLVRF  773

Query  1600  ---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNR  1767
                D   + ++ +PE W + +   EV A RKQ+PLILAWALSIHK QG TL  +  DL R
Sbjct  774   HAVDGTRRDILCQPEDWKVELPTGEVQASRKQLPLILAWALSIHKAQGQTLERVKVDLGR  833

Query  1768  AFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKEDAVTKK  1941
              F  G  YVALSR  + +GL +  F  + +  HP+V++F  +L S      E AV K+
Sbjct  834   VFEKGQAYVALSRATTQQGLQVLRFQKDKVMAHPRVVSFYNKLYS-----AESAVMKR  886



>dbj|GAM34605.1| Pif1 helicase homolog [Talaromyces cellulolyticus]
Length=743

 Score =   304 bits (779),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 186/461 (40%), Positives = 261/461 (57%), Gaps = 47/461 (10%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLDA+    KS+F TGSAGTGK+ L++ II+KLR+ + +   RV VTASTG++AC 
Sbjct  255   EQKAVLDAVVDRQKSIFFTGSAGTGKSVLMREIIKKLRDKYRKEPDRVAVTASTGLAACH  314

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+  A+EL+ KV  N++ R+RW   + LI+DE+S++ G+L+DKLE 
Sbjct  315   IEGVTLHSFAGIGLGKEPAKELVKKVRKNQKARNRWLRTKVLIVDEVSMVDGDLFDKLEE  374

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR IR+  NG      +GGIQ+V +GDFFQLPP+   + +  KFAF+A++W  S    I
Sbjct  375   IARSIRN--NGRP----FGGIQLVVTGDFFQLPPVPETSARDAKFAFDAATWNTSIQHTI  428

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE--PDPLAVKLYPRNDDVYR  1329
              LT VFRQ DP   ++L  +R G+   +     +     L+   D  A +L+P   +V  
Sbjct  429   LLTHVFRQKDPVFAEMLNQMRLGKITPQTTEAFKKLSRPLDFHDDLDATELFPTRAEVEN  488

Query  1330  VNKKHLDSLHQDLIGYRAVDNG--EDSWKEQLKLG--IAPDFLELCVGARVMLTKNLNAR  1497
              N   +  L  +++ + A D+G  +D       L   +AP  + L  GA+VML KN+   
Sbjct  489   ANSARMSRLSGEVMVFHAQDSGSIQDVQMRDRLLANCMAPPVIHLKKGAQVMLIKNME--  546

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTN--------------------------WLPVVKF  1599
               LVNG+ G ++ F     T++ +  N                           L   + 
Sbjct  547   DNLVNGSLGKIVAFMD-EATFDYYRNNEDEFTGDNKDGEDGDDAAAKNRKKLRALAHKEG  605

Query  1600  DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFG  1776
             D   + L+ +PETW I +   E+ A R Q+PLILAWALSIHK QG TL  +  DL R F 
Sbjct  606   DGTERHLLCQPETWKIELPNGEIQAQRSQVPLILAWALSIHKAQGQTLPRVKVDLGRVFE  665

Query  1777  YGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLC  1899
              G  YVALSR  S  GL ++ F P  + VHPKV+ F  +L 
Sbjct  666   KGQAYVALSRATSQAGLQVTGFEPRKVMVHPKVIEFYSKLA  706



>gb|EGE04343.1| helicase [Trichophyton equinum CBS 127.97]
Length=794

 Score =   305 bits (782),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 199/483 (41%), Positives = 268/483 (55%), Gaps = 71/483 (15%)
 Frame = +1

Query  622   WTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSR--VYVTASTGVS  792
             ++ EQ+QV++ I   GKSVF TGSAGTGK+ L++ IIR+LR  + R    V VTASTG++
Sbjct  295   FSEEQNQVIETIVRKGKSVFYTGSAGTGKSVLMREIIRQLRLKYSRDTDAVAVTASTGLA  354

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             AC + G TLHSFAG+GLG+ + +EL+ +   N + ++RW   + LIIDEIS++ G+ +DK
Sbjct  355   ACNIEGVTLHSFAGVGLGKESTQELVKR---NLKAKNRWLKTKVLIIDEISMVDGDFFDK  411

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDT  1149
             LE +ARKIR+  NG      +GGIQ+V +GDFFQLPP+     + KFAF A +W  S   
Sbjct  412   LEELARKIRN--NGRP----FGGIQLVTTGDFFQLPPVPEGGKEAKFAFAAGTWNTSIQH  465

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPR  1311
              I LT VFRQ DP    +L  +R G         F+DL+   N   N+E    A +L+P 
Sbjct  466   TILLTQVFRQRDPDFANMLNEMRLGRLSPSAIQAFKDLSRPLNCGDNIE----ATELFPT  521

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNG----EDSWKEQLKLGIAPDFLELCVGARVMLT  1479
               +V R N + ++ L   ++ + A D+G    E    + L   +AP  + L  GA+VML 
Sbjct  522   RAEVDRANSERMNRLSGSVMTFHAADSGAIKDEQFRAKLLSNCMAPATIHLKKGAQVMLI  581

Query  1480  KNLNARHKLVNGAAGTVIGF--------------ESVNGTYE------------------  1563
             KN +    LVNG+ GTVI F              +  NG Y+                  
Sbjct  582   KNKD--ETLVNGSLGTVIAFMDEAGFDNHVKEGLKRENGYYDFDEPSQAKQKIKSMAFDQ  639

Query  1564  ---TFGTN---WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALS  1713
                T   N     P+V F   D   ++L+  PE W I +   EV A R QIPLILAWALS
Sbjct  640   KTNTGSINTSRQYPLVAFILPDGSERQLLCMPEAWKIELPNGEVQAQRLQIPLILAWALS  699

Query  1714  IHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKR  1893
             IHK QG TL  +  DL R F  G  YVALSR  S +GL +S F+P  + VHPKV  F + 
Sbjct  700   IHKAQGQTLQRVKVDLGRVFERGQAYVALSRATSKDGLQVSRFDPKKVMVHPKVTEFYQN  759

Query  1894  LCS  1902
             L S
Sbjct  760   LSS  762



>gb|KHO00718.1| DNA helicase PIF1, ATP-dependent [Metarhizium album ARSEF 1941]
Length=803

 Score =   305 bits (782),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 186/473 (39%), Positives = 269/473 (57%), Gaps = 53/473 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             +  T EQ+ V+D  ++  +SVF TG AG GK+ L++ II +L++ + R   RV VTASTG
Sbjct  289   ISLTGEQAHVVDMVVNQNQSVFFTGPAGAGKSVLMRAIINELKKKYARDPERVAVTASTG  348

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSFAGIGLG+     L+ K+  N + ++RW   + LIIDEIS++ G+L+
Sbjct  349   LAACNIGGITLHSFAGIGLGKEEPSVLVRKIRKNPKAKNRWLRTKCLIIDEISMVDGDLF  408

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN---KNTQKFAFEASSWKL  1137
             DKL  + R IR+  NG      WGGIQ+V +GDFFQLPP+ +   K   KFAF+A++W  
Sbjct  409   DKLSQVGRTIRN--NGRP----WGGIQLVITGDFFQLPPVPDADKKRESKFAFDAATWST  462

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE--NHCSNLEPDPLAVKLYPR  1311
             S D  I LT VFRQ DP+  ++L  +R G    + +   +  +   N E      +LYP 
Sbjct  463   SIDHTIGLTQVFRQRDPKFAQMLNEMRVGRISDQTVQAFKALSRPLNFEDGVDLAELYPT  522

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNL  1488
                V   N+K L  L  ++  Y A+D+G+ + +++L +  +AP  +EL +GA+VML KNL
Sbjct  523   RAQVEGSNEKRLRDLPGEIHRYEAMDSGDPAVRDKLLMNMMAPKAIELKIGAQVMLIKNL  582

Query  1489  NARHKLVNGAAGTVIGFESVNGTYETFGTN------------------------------  1578
             +    LVNG+ G VI F S   T+E  G++                              
Sbjct  583   D--ETLVNGSLGKVIAF-SDEKTFEMSGSHSYDDMMEDSMAKAKRKLQAFSRDSDSAASS  639

Query  1579  -WLPVVKFDFK---PKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLN  1743
                PVV+F      P+ L+ +PE W++ +   E+ A R Q+PLILAWALSIHK QG TL 
Sbjct  640   QLYPVVQFISTGGVPRVLLCQPEEWTVELPNGEIQAKRNQLPLILAWALSIHKAQGQTLE  699

Query  1744  CLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              +  +L R F  G  YVALSR  S  GL +  F  + +  HP+V++F  +L S
Sbjct  700   RVTVNLGRVFEKGQAYVALSRATSQHGLRVLGFERSKVMAHPRVIDFYSKLSS  752



>emb|CCL98608.1| predicted protein [Fibroporia radiculosa]
Length=600

 Score =   300 bits (768),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 176/458 (38%), Positives = 255/458 (56%), Gaps = 44/458 (10%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACAL  804
             EQ  +L  +  G+++F TGSAGTGK+ L++ II  +R  H RS   V VTASTG++AC +
Sbjct  151   EQQHILQLVREGQNIFYTGSAGTGKSVLLREIIAIMRAKHSRSPDAVAVTASTGIAACNI  210

Query  805   NGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFI  984
              G T+HSF+GIGLG  +AE L +KV  N++   RW   Q LIIDEIS++ GEL+DK+  I
Sbjct  211   GGMTIHSFSGIGLGLESAEVLANKVRKNKKASARWARTQVLIIDEISMVEGELFDKIAHI  270

Query  985   ARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDLT  1164
                +R           +GGIQVV +GDFFQLPP+       FAFEA  W+ +     +LT
Sbjct  271   GSILR------KRPEPFGGIQVVVTGDFFQLPPVTKGQKATFAFEAEMWRKTIKKTFNLT  324

Query  1165  TVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRNDDVYRVNK  1338
              VFRQ DP+ V +L  +R G+     +    +   ++  E    A +L+P  +DV R N 
Sbjct  325   QVFRQRDPEFVDMLNEMRFGKLTPGSIARFRSLARDIVYEDGLGATELFPLREDVERSNT  384

Query  1339  KHLDSLHQDLIGYRAVDNG----EDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKL  1506
               +  +  +   + A+D G    E   ++ L   +AP  L L +GA+VML KN++    L
Sbjct  385   ARMRVIQGETRSFTALDGGTLTDETQREKMLNNFMAPKTLTLKIGAQVMLIKNID--DTL  442

Query  1507  VNGAAGTVIGF------------------ESVNGTY---ETFGTNWLPVVKFDFKP----  1611
             VNG+ G ++ F                   S NG     ++ G  W PVV F  +P    
Sbjct  443   VNGSMGKIVKFIDPSASLEEDDIAYGGKPSSKNGKAGKKQSSGVMW-PVVDF-LQPGGGL  500

Query  1612  KKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMV  1788
             +++ ++PE+W + +   EV   R Q+PLILAWA+SIHK QG TL  +  DL + F  G  
Sbjct  501   RRVTVQPESWKVELPNGEVQVSRTQLPLILAWAMSIHKSQGQTLERVKVDLAKVFEKGQA  560

Query  1789  YVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             YVALSR   L+GL +  F+P  +  HPKV+++ + L +
Sbjct  561   YVALSRATCLDGLQVLHFDPARVNAHPKVVDWTRTLAT  598



>gb|KFG82116.1| putative mitochondrial DNA helicase (Pif1) [Metarhizium anisopliae]
Length=814

 Score =   305 bits (782),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 186/472 (39%), Positives = 265/472 (56%), Gaps = 52/472 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             +  + EQ+ V+D  ++  +SVF TG AGTGK+ L++ II +L++ + R   RV VTASTG
Sbjct  299   ISLSSEQAHVVDMVVNQNQSVFFTGPAGTGKSVLMRAIISELKKKYARDSERVAVTASTG  358

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSFAGIGLG+     L+ K+  N + ++RW   + LIIDEIS++ G+L+
Sbjct  359   LAACNIGGITLHSFAGIGLGKEAPPALVKKIRRNPKAKNRWLRTKCLIIDEISMVDGDLF  418

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI--FNKNTQKFAFEASSWKLS  1140
             DKL  + R IR+  NG      WGGIQ+V +GDFFQLPP+   +K   KFAF+A++W  S
Sbjct  419   DKLSQVGRTIRN--NGRP----WGGIQLVITGDFFQLPPVPDADKRDSKFAFDAATWSTS  472

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRN  1314
              D  I LT VFRQ DP+  ++L  IR G+     +   +     L  E      +LYP  
Sbjct  473   IDHTIGLTQVFRQRDPEFARMLNEIRIGKISDHTVQAFKALSRPLKFEDGVDLAELYPTR  532

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNLN  1491
               V   N+K L  L   +  Y A+D G+ + +++L +  +AP  +EL +GA+VML KNL+
Sbjct  533   AQVEGSNEKRLRELPGKIHRYEALDTGDPAVRDKLLMSMMAPKAIELKIGAQVMLIKNLD  592

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTN-------------------------------  1578
                 LVNG+ G VI F S   T+E  G N                               
Sbjct  593   --ESLVNGSLGKVIAF-SDEKTFEMGGNNAYDEMPGDSMAKARRKVQAFSRDSGSDSSSQ  649

Query  1579  WLPVVKFDFK---PKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
               PVV+F      P+ ++ +PE W++ +   E+ A R Q+PLILAWALSIHK QG TL  
Sbjct  650   QYPVVQFISTGGVPRVILCQPEDWTVELPNGEIQAKRNQLPLILAWALSIHKAQGQTLER  709

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             +  +L + F  G  YVALSR  S  GL +  F  + +  HP+V+ F  +L S
Sbjct  710   VTVNLGKVFEKGQAYVALSRATSQHGLRVVGFERSKVMAHPRVVEFYSKLSS  761



>ref|XP_002567410.1| Pc21g03460 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP95243.1| Pc21g03460 [Penicillium rubens Wisconsin 54-1255]
Length=763

 Score =   304 bits (779),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 190/477 (40%), Positives = 267/477 (56%), Gaps = 59/477 (12%)
 Frame = +1

Query  625   TVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSA  795
             T EQ  V DA+   GKS+F TGSAGTGK+ L++ II KLR  + +   RV VTASTG++A
Sbjct  272   TDEQKAVSDAVVERGKSMFFTGSAGTGKSVLMREIIAKLRNKYRKESDRVAVTASTGLAA  331

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + LI+DE+S++ G+L+DKL
Sbjct  332   CNIGGVTLHSFAGIGLGKEPVLELVKKIKKNQKARNRWLRTKVLIVDEVSMVDGDLFDKL  391

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDT  1149
             E I+R+IR+  NG      +GGIQ+V +GDFFQLPP+ + + +  KFAF A+SW      
Sbjct  392   EEISRRIRN--NGRP----FGGIQLVVTGDFFQLPPVPDGSNREAKFAFAAASWTTCIQH  445

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE-PDPL-AVKLYPRNDDV  1323
              I LT +FRQ DP+   +L  +R G+     +         L+  D + A +L+P   +V
Sbjct  446   TILLTNIFRQRDPEFADMLNEMRLGKITPRTIEAFRRLSRPLDVKDQIEATELFPTRAEV  505

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNG--EDSWKEQLKLG--IAPDFLELCVGARVMLTKNLN  1491
                N   +  L  +++ + AVD+G  +D    +  L   +AP  ++L  GA+VML KN+ 
Sbjct  506   EGANSARMARLSGEIMRFNAVDSGTIQDPQHRERLLANCMAPPMIQLKKGAQVMLIKNME  565

Query  1492  ARHKLVNGAAGTVIGFESVN--GTYETFGTNWL---------------------------  1584
                 LVNG+ G V+ F S +   +Y+    N+                            
Sbjct  566   --DSLVNGSIGKVVAFMSEDYFDSYKENDKNFADDATASDDERANRARKKLKPMGYKEGP  623

Query  1585  -------PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQG  1731
                    P+V F   D   + L+ +PETW I +   EV A R+Q+PLILAWALSIHK QG
Sbjct  624   ASTARKWPLVSFLQPDGSERHLLCQPETWKIELPNGEVQAQRQQVPLILAWALSIHKAQG  683

Query  1732  MTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              TL  +  DL R F  G  YVALSR  S EGL ++ F P  + VHPKV+ F   L +
Sbjct  684   QTLQRVKVDLGRVFEKGQAYVALSRAVSQEGLQVTRFEPRKVMVHPKVVEFYSNLVT  740



>gb|EKV05656.1| Mitochondrial DNA helicase (Pif1), putative [Penicillium digitatum 
Pd1]
 gb|EKV18274.1| Mitochondrial DNA helicase (Pif1), putative [Penicillium digitatum 
PHI26]
Length=720

 Score =   303 bits (776),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 187/469 (40%), Positives = 265/469 (57%), Gaps = 59/469 (13%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VL+A+   GKS+F TGSAGTGK+ L++ II KLR  + +   R+ VTASTG++AC 
Sbjct  231   EQRAVLEAVVDRGKSMFFTGSAGTGKSVLMREIIAKLRNKYRKEPDRIAVTASTGLAACN  290

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + L++DE+S++ G+L+DKLE 
Sbjct  291   IGGVTLHSFAGIGLGKEPVPELVKKIKKNQKARNRWLRTKVLVVDEVSMVDGDLFDKLEE  350

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+ + + +  KFAF A+SW       I
Sbjct  351   IARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPDGSNREAKFAFAAASWTTCIQHTI  404

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE-PDPL-AVKLYPRNDDVYR  1329
              LT +FRQ DP+   +L  +R G+     +         L+  D + A +L+P   +V  
Sbjct  405   LLTNIFRQRDPEFADMLNEMRLGKITPRTIEAFRRLSRPLDVKDQIEATELFPTRAEVDG  464

Query  1330  VNKKHLDSLHQDLIGYRAVDNG--EDSWKEQLKLG--IAPDFLELCVGARVMLTKNLNAR  1497
              N   +  L  +++ + AVD+G  +D    +  L   +AP  ++L  GA+VML KN+   
Sbjct  465   ANSARMARLSGEVMRFNAVDSGTIQDPQHRERLLANCMAPPMIQLKKGAQVMLIKNME--  522

Query  1498  HKLVNGAAGTVIGFESVN--GTYETFGTNWL-----------------------------  1584
               LVNG+ G V+ F S +   +Y+    N+                              
Sbjct  523   DSLVNGSIGKVVAFMSEDYFDSYKENDKNFADDATASDNERAHRARKKLKPMGYKEGPAS  582

Query  1585  -----PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMT  1737
                  P+V F   D   + L+ +PETW I +   EV A R+Q+PLILAWALSIHK QG T
Sbjct  583   MARKWPLVSFLQPDGSERHLLCQPETWKIELPNGEVQAQRQQVPLILAWALSIHKAQGQT  642

Query  1738  LNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNF  1884
             L  +  DL R F  G  YVALSR  S EGL ++ F P  + VHPKV+ F
Sbjct  643   LQRVKVDLGRVFEKGQAYVALSRAVSQEGLQVTRFEPRKVMVHPKVVEF  691



>ref|XP_010581033.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Haliaeetus leucocephalus]
Length=494

 Score =   296 bits (759),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 181/435 (42%), Positives = 248/435 (57%), Gaps = 27/435 (6%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             R   + + EQ  VL A+ +GKSVF TG AGTGK+FL++ I+  L         Y TASTG
Sbjct  58    RPLARLSAEQEAVLGAVRSGKSVFFTGCAGTGKSFLLKKIVGSLPP----KSTYATASTG  113

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+AC + G TLH+FAGIG G+A  E+ + ++     VR  W   Q LIIDEIS++ G+L+
Sbjct  114   VAACHIGGTTLHAFAGIGSGKAPLEQCI-QLAERPGVRQHWLACQHLIIDEISMVDGKLF  172

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSF  1143
             DKLE +AR +R      DE   +GGIQ++  GDF QLPP+   N + KF F+A SW+   
Sbjct  173   DKLEAVARVVRKR----DEP--FGGIQLIICGDFLQLPPVCKANEETKFCFQAKSWRKCI  226

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL-EPDP-LAVKLYPRND  1317
                ++LT V RQ+D   V LL  +R G    E   LL    +N  E D  LA +L    D
Sbjct  227   HINMELTEVRRQTDKTFVSLLSAVRLGRCTEEVTRLLMQTAANRSERDGILATRLCTHKD  286

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLN  1491
             DV   N++ L  L  ++  + A+D+  D    +L     P    +EL +GA+VML KNL+
Sbjct  287   DVEITNERCLQQLSGEVHTFEALDS--DPMLAKLIDAQCPVGGRVELKLGAQVMLAKNLD  344

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVA  1671
                 LVNGA G V+GFES            LP V+F     + +I+ E W       V  
Sbjct  345   VSQGLVNGARGVVVGFESQQ--------KGLPKVRFLCGATQ-VIKMEKWVFKGPSGVHL  395

Query  1672  VRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPN  1851
              R+Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SL GL +  F+P 
Sbjct  396   SRQQLPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARSLAGLRVLDFDPK  455

Query  1852  IIKVHPKVLNFDKRL  1896
             +++  P VL F ++L
Sbjct  456   VVRADPSVLQFYRQL  470



>ref|XP_001401106.1| DNA helicase PIF1 [Aspergillus niger CBS 513.88]
 emb|CAK42044.1| unnamed protein product [Aspergillus niger]
Length=800

 Score =   305 bits (780),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 193/489 (39%), Positives = 270/489 (55%), Gaps = 78/489 (16%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLDA+   GKS+F TGSAGTGK+ L++ II+KLR+ + +   RV VTASTG++AC 
Sbjct  290   EQRHVLDAVVQQGKSIFFTGSAGTGKSVLMREIIKKLRDKYKKEPDRVAVTASTGLAACN  349

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + LI+DE+S++ G+L+DKLE 
Sbjct  350   IEGVTLHSFAGIGLGKEPVPELVKKIKKNQKARNRWMRTKVLIVDEVSMVDGDLFDKLEE  409

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+   + +  KFAF A++W  S    I
Sbjct  410   IARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPEGSNREAKFAFAAATWNTSIQHTI  463

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRND  1317
              LT +FRQ DP+   +L  +R G+        F+ L+   +   +LE    A +L+P   
Sbjct  464   LLTHIFRQRDPEFADMLNELRLGKISPRTIETFKQLSRPLDFHDSLE----ATELFPTRQ  519

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKN  1485
             +V   N   +  L  + + + AVD+G   +  ++E+L    +AP  + L  GA+VML KN
Sbjct  520   EVESANGARMSRLSGETMTFNAVDSGTIQDPQFRERLLANCMAPPVIHLKKGAQVMLIKN  579

Query  1486  LNARHKLVNGAAGTVIGF---------------------ESVNGTYE-------------  1563
             +     LVNG+ G V+ F                     E+ N + +             
Sbjct  580   ME--DTLVNGSIGRVVAFMDEATFDYYIDNENEFSGGAGEAGNNSDDEIMARARKKLKPM  637

Query  1564  ------------TFGTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLI  1695
                         T    W P+V F   D   + L+ +PETW I +   EV A R+Q+PLI
Sbjct  638   AANKDGSGPGGITLTRKW-PLVCFVQPDGTERHLLCQPETWKIELPNGEVQAQRQQVPLI  696

Query  1696  LAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKV  1875
             LAWALSIHK QG TL  +  DL R F  G  YVALSR  S  GL +  F    + VHPKV
Sbjct  697   LAWALSIHKAQGQTLQRVKVDLGRVFEKGQAYVALSRATSKAGLQVMRFEARKVMVHPKV  756

Query  1876  LNFDKRLCS  1902
              +F  +L S
Sbjct  757   TDFYSKLVS  765



>emb|CEJ94933.1| Putative Dna helicase involved in rdna replication and ty1 transposition 
[Torrubiella hemipterigena]
Length=844

 Score =   305 bits (782),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 189/471 (40%), Positives = 268/471 (57%), Gaps = 47/471 (10%)
 Frame = +1

Query  625   TVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSA  795
             + EQ  VLD  +  GKSVF TG AGTGK+ L++ II +L+  + R   RV VTASTG++A
Sbjct  363   SAEQRHVLDMVVEQGKSVFFTGPAGTGKSVLMRAIIAELKRKYARDSDRVAVTASTGLAA  422

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLHSF+GIGLG+  A +L+ K+  N + + RW   + L+IDEIS++ G+L+DKL
Sbjct  423   CNIGGITLHSFSGIGLGKEPANQLVKKIRRNPKAKQRWMRTKCLVIDEISMVDGQLFDKL  482

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQK--FAFEASSWKLSFDT  1149
               I R IR+  NG      WGGIQ++ +GDF QLPP+ +   ++  FAF+AS+W+ S D 
Sbjct  483   SQIGRTIRN--NGRP----WGGIQLIITGDFLQLPPVPDGEQRESVFAFDASTWETSIDH  536

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDP--LAVKLYPRNDDV  1323
              I LT VFRQ DP+   +L  +R G    + +N  +     L  +      +LYP    V
Sbjct  537   TIGLTQVFRQKDPEFANMLNEMRIGTITDKTVNAFKALSRPLSFNDGIEGAQLYPTRMQV  596

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGI-APDFLELCVGARVMLTKNLNARH  1500
                N++ L  L  +   + +VD G+   +++L + + AP  + L VGA+VML KNL+   
Sbjct  597   EASNERRLRELPGEPRRFDSVDTGDPMVRDKLLVNMMAPKGIVLKVGAQVMLIKNLD--E  654

Query  1501  KLVNGAAGTVIGF-------------ESVNGTY------------ETFGTN--WLPVVKF  1599
              LVNG+ GTV+ F             E V+G              E  G      PVV+F
Sbjct  655   TLVNGSLGTVVDFSDQKTMEARYGMDEDVSGNVAKAQKKLNQFMNEANGAKAPQYPVVRF  714

Query  1600  ---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNR  1767
                +   + +I  PE W + +   EV A R+Q+PLILAWALSIHK QG TL+ +  DL R
Sbjct  715   MAANGTTRTIICIPEEWKVELPNGEVQAKRQQVPLILAWALSIHKAQGQTLDRVTVDLGR  774

Query  1768  AFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPK  1920
              F  G  YVALSR  + +GL + +F  + +  HPKV++F K+L S  D  K
Sbjct  775   VFEKGQAYVALSRATTQQGLRVLNFEKSKVMAHPKVVDFYKKLYSAADASK  825



>gb|KID69626.1| DNA helicase PIF1, ATP-dependent, partial [Metarhizium anisopliae 
ARSEF 549]
Length=856

 Score =   305 bits (782),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 186/472 (39%), Positives = 265/472 (56%), Gaps = 52/472 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             +  + EQ+ V+D  ++  +SVF TG AGTGK+ L++ II +L++ + R   RV VTASTG
Sbjct  341   ISLSSEQAHVVDMVVNQNQSVFFTGPAGTGKSVLMRAIISELKKKYARDSERVAVTASTG  400

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSFAGIGLG+     L+ K+  N + ++RW   + LIIDEIS++ G+L+
Sbjct  401   LAACNIGGITLHSFAGIGLGKEAPPALVKKIRRNPKAKNRWLRTKCLIIDEISMVDGDLF  460

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI--FNKNTQKFAFEASSWKLS  1140
             DKL  + R IR+  NG      WGGIQ+V +GDFFQLPP+   +K   KFAF+A++W  S
Sbjct  461   DKLSQVGRTIRN--NGRP----WGGIQLVITGDFFQLPPVPDADKRDSKFAFDAATWSTS  514

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRN  1314
              D  I LT VFRQ DP+  ++L  IR G+     +   +     L  E      +LYP  
Sbjct  515   IDHTIGLTQVFRQRDPEFARMLNEIRIGKISDHTVQAFKALSRPLKFEDGVDLAELYPTR  574

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNLN  1491
               V   N+K L  L   +  Y A+D G+ + +++L +  +AP  +EL +GA+VML KNL+
Sbjct  575   AQVEGSNEKRLRELPGKIHRYEALDTGDPAVRDKLLMSMMAPKAIELKIGAQVMLIKNLD  634

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTN-------------------------------  1578
                 LVNG+ G VI F S   T+E  G N                               
Sbjct  635   --ESLVNGSLGKVIAF-SDEKTFEMGGNNAYDEMPGDSMAKARRKVQAFSRDSGSDSSSQ  691

Query  1579  WLPVVKFDFK---PKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
               PVV+F      P+ ++ +PE W++ +   E+ A R Q+PLILAWALSIHK QG TL  
Sbjct  692   QYPVVQFISTGGVPRVILCQPEDWTVELPNGEIQAKRNQLPLILAWALSIHKAQGQTLER  751

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             +  +L + F  G  YVALSR  S  GL +  F  + +  HP+V+ F  +L S
Sbjct  752   VTVNLGKVFEKGQAYVALSRATSQHGLRVVGFERSKVMAHPRVVEFYSKLSS  803



>dbj|GAA90741.1| mitochondrial DNA helicase [Aspergillus kawachii IFO 4308]
Length=761

 Score =   303 bits (777),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 193/489 (39%), Positives = 270/489 (55%), Gaps = 79/489 (16%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLDA+   GKS+F TGSAGTGK+ L++ II+KLR+ + +   RV VTASTG++AC 
Sbjct  244   EQRHVLDAVVQQGKSIFFTGSAGTGKSVLMREIIKKLRDKYKKEPDRVAVTASTGLAACN  303

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + LI+DE+S++ G+L+DKLE 
Sbjct  304   IEGVTLHSFAGIGLGKEPVPELVKKIKKNQKARNRWMRTKVLIVDEVSMVDGDLFDKLEE  363

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+   + +  KFAF A++W  S    I
Sbjct  364   IARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPEGSNREAKFAFAAATWNTSIQHTI  417

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRND  1317
              LT +FRQ DP+   +L  +R G+        F+ L+   +   +LE    A +L+P   
Sbjct  418   LLTHIFRQRDPEFADMLNELRLGKISPRTIDTFKQLSRPLDFHDSLE----ATELFPTRQ  473

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKN  1485
             +V   N   +  L  + + + AVD+G   +  ++E+L    +AP  + L  GA+VML KN
Sbjct  474   EVESANGARMSRLSGETMTFNAVDSGTIQDPQFRERLLANCMAPPVIHLKKGAQVMLIKN  533

Query  1486  LNARHKLVNGAAGTVIGFESVNGTYETF-------------GTN----------------  1578
             +     LVNG+ G V+ F     T++ +             G N                
Sbjct  534   ME--DTLVNGSIGRVVAFMD-EATFDYYIDNENEFSGAGGSGNNSDDEIMARARKKLKPM  590

Query  1579  -----------------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLI  1695
                              W P+V F   D   + L+ +PETW I +   EV A R+Q+PLI
Sbjct  591   AANKDASGPGGITLTRKW-PLVCFVQPDGTERHLLCQPETWKIELPNGEVQAQRQQVPLI  649

Query  1696  LAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKV  1875
             LAWALSIHK QG TL  +  DL R F  G  YVALSR  S  GL +  F    + VHPKV
Sbjct  650   LAWALSIHKAQGQTLQRVKVDLGRVFEKGQAYVALSRATSKAGLQVMRFEARKVMVHPKV  709

Query  1876  LNFDKRLCS  1902
              +F  +L S
Sbjct  710   TDFYSKLVS  718



>gb|KID73235.1| DNA helicase PIF1, ATP-dependent, partial [Metarhizium brunneum 
ARSEF 3297]
Length=813

 Score =   305 bits (780),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 186/475 (39%), Positives = 266/475 (56%), Gaps = 52/475 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             +  + EQ+ V+D  ++  +SVF TG AGTGK+ L++ II +L++ + R   R+ VTASTG
Sbjct  297   ISLSSEQAHVVDMVVNQNQSVFFTGPAGTGKSVLMRAIISELKKKYARDSERIAVTASTG  356

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSFAGIGLG+     L+ K+  N + ++RW   + LIIDEIS++ G+L+
Sbjct  357   LAACNIGGITLHSFAGIGLGKEAPPALVKKIRRNPKAKNRWLRTKCLIIDEISMVDGDLF  416

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI--FNKNTQKFAFEASSWKLS  1140
             DKL  + R IR+  NG      WGGIQ+V +GDFFQLPP+   +K   KFAF+A++W  S
Sbjct  417   DKLSQVGRTIRN--NGRP----WGGIQLVITGDFFQLPPVPDADKRDSKFAFDAATWSTS  470

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRN  1314
              D  I LT VFRQ DP+  ++L  IR G+     +   +     L  E      +LYP  
Sbjct  471   IDHTIGLTQVFRQRDPEFARMLNEIRIGKISDHTVQAFKALSRPLKFEDGVDLAELYPTR  530

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNLN  1491
               V   N+K L  L   +  Y A+D G+ + +++L +  +AP  +EL +GA+VML KNL+
Sbjct  531   AQVEGSNEKRLRELPGKIHRYEALDTGDPAVRDKLLMNMMAPKAIELKIGAQVMLIKNLD  590

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTNWL-----------------------------  1584
                 LVNG+ G VI F S   T+E  G N                               
Sbjct  591   --ESLVNGSLGKVIAF-SDEKTFEMGGNNAFDEMTGDSMAKARRKLQPFSRDSGTDSSSQ  647

Query  1585  --PVVKFDFK---PKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
               PVV+F      P+ ++ +PE W++ +   E+ A R Q+PLILAWALSIHK QG TL  
Sbjct  648   QYPVVQFISTGGVPRVILCQPEEWTVELPNGEIQAKRNQLPLILAWALSIHKAQGQTLER  707

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD  1911
             +  +L + F  G  YVALSR  S  GL +  F  + +  HP+V+ F  +L S  D
Sbjct  708   VTVNLGKVFEKGQAYVALSRATSQHGLRVLGFERSKVMAHPRVVEFYSKLSSVDD  762



>ref|XP_009153217.1| hypothetical protein HMPREF1120_00965 [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY52756.1| hypothetical protein HMPREF1120_00965 [Exophiala dermatitidis 
NIH/UT8656]
Length=798

 Score =   304 bits (779),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 193/487 (40%), Positives = 270/487 (55%), Gaps = 72/487 (15%)
 Frame = +1

Query  616   VKWTVEQSQVLDA-ISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             V ++ EQ  VL A I  GKSVF TGSAGTGK+ L++ II +++  + +   R+ VTASTG
Sbjct  262   VFFSDEQQTVLKAVIEEGKSVFFTGSAGTGKSVLMRAIISQMKHKYRKEPDRIAVTASTG  321

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             +++C L G TLHS+AGIGLG+  A EL+ K+  N++ R +W   + LIIDEIS++ G+L+
Sbjct  322   LASCILEGQTLHSWAGIGLGKEPAPELVKKIKRNQKSRQKWLRTKVLIIDEISMVDGQLF  381

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT-QKFAFEASSWKLSF  1143
             DKLE +AR IR+  NG      +GGIQ+V +GDFFQLPP+  KN+  KF F+A++W    
Sbjct  382   DKLEQVARTIRN--NGRP----FGGIQLVVTGDFFQLPPVPEKNSVAKFVFDATTWNTCI  435

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEY------DFEDLNLLENHCSNLEPDPLAVKLY  1305
                I LT VFRQ D +  ++L  +R G+       +F+ L+   N    LE    A +LY
Sbjct  436   GHTILLTHVFRQKDERFAQMLNEMRLGKMSAATVREFKSLSRPLNFHDELE----ATELY  491

Query  1306  PRNDDVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLGIAPDFLELCVGARVML  1476
             PR ++V   N+  +  L   ++ Y AVD G    +  K  L   IAP+ LEL  GA+VML
Sbjct  492   PRREEVEFANQNRMRKLSGQVMTYHAVDTGVQDPNVRKALLANFIAPEVLELKKGAQVML  551

Query  1477  TKNLNARHKLVNGAAGTVIGFESVNGTYETF-----------------------------  1569
              KN+++  +LVNG+ G V  F    GT+  +                             
Sbjct  552   IKNIDS--QLVNGSLGIVQSFMD-EGTFFAYKEDEPSFLLAQEPDNGDLSDEKMAAREKL  608

Query  1570  -------------GTNWLPVVKF---DFKPKKLIIRPETWSIMDGE-EVVAVRKQIPLIL  1698
                           T   P+V+F   D   + ++  P+ W     + EV+A R Q+PLIL
Sbjct  609   QAARMKSAAAGAGATRLWPMVRFNLPDGTSRTMLCSPDEWKTESQQGEVLAKRVQVPLIL  668

Query  1699  AWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVL  1878
             AWALSIHK QG TL  +  DL + F  G  YVALSR +S EGL +  F+   + VHPKVL
Sbjct  669   AWALSIHKAQGQTLTRVKVDLGKVFEKGQAYVALSRARSKEGLQVLRFDERKVMVHPKVL  728

Query  1879  NFDKRLC  1899
              F  +L 
Sbjct  729   EFYSKLS  735



>ref|XP_007479627.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X1 [Monodelphis 
domestica]
 ref|XP_007479628.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X2 [Monodelphis 
domestica]
 ref|XP_007479629.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X3 [Monodelphis 
domestica]
 ref|XP_007479630.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X4 [Monodelphis 
domestica]
Length=633

 Score =   300 bits (767),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 174/426 (41%), Positives = 248/426 (58%), Gaps = 25/426 (6%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             + + EQ++VL A+ +GKS+F TGSAGTGK++L++ I+  L          VTASTGV+AC
Sbjct  203   QLSPEQARVLSAVLSGKSIFFTGSAGTGKSYLLKRILGSLPP----KGTVVTASTGVAAC  258

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLH+FAGIG G+A   + +  +     +R  W   Q L+IDE+S++   L+DKLE
Sbjct  259   HIGGTTLHAFAGIGSGKAPLAQCV-ALAQRPSIRQSWASCQRLVIDEVSMVEASLFDKLE  317

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQ  1152
              +AR IR       ++  +GGIQ++  GDF QLPP+  KN Q  +F F+A SW+      
Sbjct  318   AVARAIR------QQDKPFGGIQLIICGDFLQLPPV-TKNNQPPQFCFQAKSWRKCIQLT  370

Query  1153  IDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSN-LEPDP-LAVKLYPRNDDVY  1326
             ++LT V+RQ+DP  + LLQ +R G    E    L+    + +E D  LA +L    DDV 
Sbjct  371   MELTEVWRQTDPTFISLLQAVRLGRCSDEVTQKLKATARHKVERDGILATRLCTHQDDVA  430

Query  1327  RVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKL  1506
               N++ L  L   +  Y AVD+     +           L+L +GA+VML KNL     L
Sbjct  431   LTNERRLQQLPGQVHSYEAVDSDPTMVRTLDSQCPVSHLLQLKLGAQVMLVKNLAVSQGL  490

Query  1507  VNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQI  1686
             VNGA G V+GFE+ +G         LP VKF     + ++R E W++      +  R+Q+
Sbjct  491   VNGARGVVVGFEA-DG-------RGLPTVKFLCGVTE-VVRTERWTVHGPGGQLLSRQQL  541

Query  1687  PLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVH  1866
             PL LAWALSIHK QGMTL+C+   L R F  G  YVALSR +SL+GL +  F+PN+++  
Sbjct  542   PLRLAWALSIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLQGLRVLDFDPNVVRCD  601

Query  1867  PKVLNF  1884
             P+VL F
Sbjct  602   PRVLKF  607



>ref|XP_007819664.1| mitochondrial DNA helicase (Pif1), putative [Metarhizium robertsii 
ARSEF 23]
 gb|EFZ00879.1| DNA repair and recombination protein pif1 [Metarhizium robertsii 
ARSEF 23]
Length=813

 Score =   304 bits (778),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 185/472 (39%), Positives = 265/472 (56%), Gaps = 52/472 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             +  + EQ+ V+D  ++  +SVF TG AGTGK+ L++ II +L++ + R   RV VTASTG
Sbjct  298   ISLSSEQAHVVDMVVNQNQSVFFTGPAGTGKSVLMRAIISELKKKYARDSERVAVTASTG  357

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSFAGIGLG+     L+ K+  N + ++RW   + LIIDEIS++ G+L+
Sbjct  358   LAACNIGGITLHSFAGIGLGKEAPPALVKKIRRNPKAKNRWLRTKCLIIDEISMVDGDLF  417

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI--FNKNTQKFAFEASSWKLS  1140
             DKL  + R IR+  NG      WGGIQ+V +GDFFQLPP+   +K   KFAF+A++W  S
Sbjct  418   DKLSQVGRTIRN--NGRP----WGGIQLVITGDFFQLPPVPDADKRDSKFAFDAATWSTS  471

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRN  1314
              D  I LT VFRQ DP+  ++L  +R G+     +   +     L  E      +LYP  
Sbjct  472   IDHTIGLTQVFRQRDPEFARMLNEMRIGKISDHTVQAFKALSRPLKFEDGVDLAELYPTR  531

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNLN  1491
               V   N+K L  L   +  Y A+D G+ + +++L +  +AP  +EL +GA+VML KNL+
Sbjct  532   AQVEGSNEKRLRELPGKIHRYEALDTGDPAVRDKLLMSMMAPKAIELKIGAQVMLIKNLD  591

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTN-------------------------------  1578
                 LVNG+ G VI F S   T+E  G N                               
Sbjct  592   --ESLVNGSLGKVIAF-SDEKTFEMGGNNAYDEMPGDSMAKARRKLQAFSRDSGSDSSSQ  648

Query  1579  WLPVVKFDFK---PKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
               PVV+F      P+ ++ +PE W++ +   E+ A R Q+PLILAWALSIHK QG TL  
Sbjct  649   QYPVVQFISTGGVPRVILCQPEEWTVELPNGEIQAKRNQLPLILAWALSIHKAQGQTLER  708

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             +  +L + F  G  YVALSR  S  GL +  F  + +  HP+V+ F  +L S
Sbjct  709   VTVNLGKVFEKGQAYVALSRATSQHGLRVVGFERSKVMAHPRVVEFYSKLSS  760



>emb|CBQ73114.1| related to PIF1-DNA helicase involved in mitochondrial DNA repair 
and telomere length control [Sporisorium reilianum SRZ2]
Length=726

 Score =   301 bits (771),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 181/460 (39%), Positives = 256/460 (56%), Gaps = 42/460 (9%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSACA  801
             EQ +VL   +  GK+VF TGSAGTGK+ L++ IIR+LR  + +    V VTASTG++AC 
Sbjct  276   EQRKVLHMVVEEGKNVFFTGSAGTGKSVLLREIIRELRHKYNKRPESVAVTASTGIAACN  335

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G T+HS+AGIGLG+    +L+ K+   R+   RW+  Q LIIDE+S++   L+DKLE 
Sbjct  336   IGGVTIHSYAGIGLGKEPVLQLMSKIRKQRKATARWQRTQVLIIDEVSMVDPALFDKLEE  395

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDL  1161
             IAR IR        +  +GGIQVV +GDFFQLPP+    +  FAF+A  W      +++L
Sbjct  396   IARLIRKR-----PDRPFGGIQVVITGDFFQLPPVNPGGSMTFAFDAQCWDKVVQHKVNL  450

Query  1162  TTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE--NHCSNLEPDPLAVKLYPRNDDVYRVN  1335
             T VFRQ D   V +L  +R G+   + ++           + D +  +L+P   +V R N
Sbjct  451   TQVFRQKDESFVTMLNEMRFGKLSQKTIDAFRKLERVPRYDDDIVPTELFPMRQEVDRAN  510

Query  1336  KKHLDSLHQDLIGYRAVDNGEDSWKEQLKL---GIAPDFLELCVGARVMLTKNLNARHKL  1506
              + L++L  +   YRA D G    +++ ++    IA   L L  GA+VML KNL+    L
Sbjct  511   MERLNALQSESQSYRAQDGGTLMGEQRERILANSIALPVLHLKKGAQVMLIKNLD--ETL  568

Query  1507  VNGAAGTVIGF--------------------ESVNGTYETFGTNWLPVVKFDF---KPKK  1617
             VNG+ G VI F                    E  +    T    W P+V+F     + + 
Sbjct  569   VNGSVGKVIDFMDDAEYDKQTGALDMSDMQKEERDKAPRTSTRKW-PLVRFHLPNGQTRD  627

Query  1618  LIIRPETW--SIMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVY  1791
              + RPE+W   + DGE V A R Q+PLILAWA+SIHK QG TL C   +L R F  G  Y
Sbjct  628   YLARPESWKTELPDGE-VQASRTQVPLILAWAMSIHKSQGQTLPCCKINLGRVFEKGQAY  686

Query  1792  VALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD  1911
             VALSR  SLEGL +  F P+ +  HP+V+ + + L +  D
Sbjct  687   VALSRATSLEGLQVLGFKPDKVMAHPRVIQWSQSLIALSD  726



>ref|XP_006634847.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Lepisosteus 
oculatus]
Length=637

 Score =   299 bits (765),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 185/431 (43%), Positives = 246/431 (57%), Gaps = 27/431 (6%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K + EQS VL A+ +GK+VF TGSAGTGK+FL++ I+  L         Y TASTGV+AC
Sbjct  206   KLSKEQSLVLSAVLSGKNVFFTGSAGTGKSFLLKRILGSLPP----KSTYATASTGVAAC  261

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLH+FAGIG G A  E+ L ++     V   W   + LIIDE+S++ GEL+DKLE
Sbjct  262   HIGGTTLHAFAGIGSGSAPLEQCL-ELAQRPGVLQHWTSCRHLIIDEVSMVEGELFDKLE  320

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              IAR IR S         +GGIQ++A GDF QLPP+   K   KF F+A SW+  F   +
Sbjct  321   AIARSIRRSPE------PFGGIQLIACGDFLQLPPVTKGKVKPKFCFQARSWRKCFHLNM  374

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G+   E    L+      +E D  LA +L    DDV  
Sbjct  375   ELTEVRRQTDKTFISLLQAVRVGKVTEEVTAQLMNTAYHRIERDGILATRLCTHKDDVEL  434

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLNARHK  1503
              N+  L  L   +  + + D+  D     L    +P    L+L VGA+VMLTKNL+ +  
Sbjct  435   TNETKLQQLPGAVRTFESADS--DPQLATLIDAQSPVGRVLQLKVGAQVMLTKNLDVQRG  492

Query  1504  LVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQ  1683
             LVNGA G V+GFE         G+  LP V+F     + +++ E W    G  V   R Q
Sbjct  493   LVNGARGVVLGFEP--------GSKGLPRVRFLCGVTE-VMKQERWMFKAGGGVYLSRHQ  543

Query  1684  IPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKV  1863
             +PL LAWA+SIHK QGMTL+C+   L+R F  G  YVALSR +SLEGL +  F+P ++  
Sbjct  544   LPLKLAWAISIHKSQGMTLDCVEISLSRVFESGQAYVALSRARSLEGLRVMDFDPRVVWA  603

Query  1864  HPKVLNFDKRL  1896
                VL F  RL
Sbjct  604   DAHVLQFYSRL  614



>ref|XP_006693124.1| DNA helicase-like protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
 gb|EGS20828.1| DNA helicase-like protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
Length=809

 Score =   303 bits (776),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 192/481 (40%), Positives = 265/481 (55%), Gaps = 63/481 (13%)
 Frame = +1

Query  655   ISAGKSVFVTGSAGTGKTFLIQHIIRKLRE--IHGRSRVYVTASTGVSACALNGYTLHSF  828
             +  G+SVF TG AGTGK+ L++ II+ L++  I    RV +TASTG++AC + G TLHSF
Sbjct  313   VEQGQSVFFTGPAGTGKSVLMRAIIQDLKKKYIRDPERVAITASTGLAACNIGGMTLHSF  372

Query  829   AGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIRSSI  1008
             AGIGLG+     L+ K+  N + ++RW   + LIIDEIS++  EL+DKL  I R IR+  
Sbjct  373   AGIGLGKEDVNTLVKKIRRNPKAKNRWLKTKVLIIDEISMVDAELFDKLSQIGRIIRN--  430

Query  1009  NGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ---KFAFEASSWKLSFDTQIDLTTVFRQ  1179
             NG      WGGIQ+V +GDFFQLPP+         KFAFEA++W +S D  I LT VFRQ
Sbjct  431   NGRP----WGGIQLVITGDFFQLPPVPESGKTREAKFAFEAATWNMSIDHTIALTEVFRQ  486

Query  1180  SDPQLVKLLQGIRKGEY------DFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRVNKK  1341
              DP+  ++L  +R G+       +F+ L+   +    LE      +L+P   +V   N+K
Sbjct  487   KDPEFAEMLNEMRLGKISDKTVRNFQALSRPLHFDDGLE----VTELFPTRQEVDSSNQK  542

Query  1342  HLDSLHQDLIGYRAVDNGEDSWKEQLKLG--IAPDFLELCVGARVMLTKNLNARHKLVNG  1515
              L +L      Y +VD G D       L   +AP  +EL  GA+VML KN++    LVNG
Sbjct  543   RLQALAGKTYRYDSVDTGSDPVLRDKLLANMMAPPTIELKKGAQVMLIKNMD--DTLVNG  600

Query  1516  AAGTVIGFESVNGTYETFG------------------TNWL---------PVVKF---DF  1605
             + GTVI F +   T+E  G                   N L         P+V+F   D 
Sbjct  601   SLGTVIDFMT-ESTFEIRGGADDSDVESDAKRRIRSFANALSNKEANKEYPLVRFHAVDG  659

Query  1606  KPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYG  1782
               + ++  PE W + +   EV A RKQ+PLILAWALSIHK QG TL  +  DL + F  G
Sbjct  660   TQRNILCVPEDWKVELPTGEVQAARKQLPLILAWALSIHKAQGQTLERVKVDLGKVFEKG  719

Query  1783  MVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKEDAVTKKKQGGSST  1962
               YVALSR  S +GL + +F  + +  HP+V+ F  +L +       ++V KKK  GS T
Sbjct  720   QAYVALSRATSQKGLQVLNFQKSKVMAHPRVIQFYNKLST------AESVMKKKAAGSIT  773

Query  1963  C  1965
              
Sbjct  774   S  774



>ref|XP_785439.2| PREDICTED: ATP-dependent DNA helicase PIF1-like [Strongylocentrotus 
purpuratus]
Length=592

 Score =   297 bits (760),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 170/422 (40%), Positives = 244/422 (58%), Gaps = 25/422 (6%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             EQ +VL+A+ + +S+F TGSAGTGK+FL++HII  L         + TASTGV+AC + G
Sbjct  164   EQKRVLNAVLSRQSIFFTGSAGTGKSFLLRHIISALPP----DSTFATASTGVAACHIGG  219

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              TLH FAGIG G     +L+ ++ S    R +W+  + LI+DEIS+I G+ + KLE +AR
Sbjct  220   TTLHQFAGIGSGTGQLPQLI-ELASRPTRRQQWRKCKHLIVDEISMIDGDFFTKLEAVAR  278

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNK-NTQKFAFEASSWKLSFDTQIDLTT  1167
              I+      DE   +GGIQ++  GDF QLPP+  +   QKF F++ +W        +L  
Sbjct  279   VIKRC----DEP--FGGIQLILCGDFLQLPPVVKRGEKQKFCFQSPAWHRCIQVNFELME  332

Query  1168  VFRQSDPQLVKLLQGIRKGEYDFEDLNLLE---NHCSNLEPDPLAVKLYPRNDDVYRVNK  1338
             V RQ DP  + +LQ IR G    E  + L     HC + E    A +L    +DV ++N 
Sbjct  333   VKRQKDPAFINILQKIRVGRCSAEVTDCLTGTAKHCVDTE-GIHATRLCTHKEDVDQLNN  391

Query  1339  KHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGA  1518
              HL+ L  D+  + A+D+     K+          ++L +GA+VML KNL+    LVNGA
Sbjct  392   VHLNKLIGDVRVFEAMDSDPSLVKQTNSQCPVRQRIDLKIGAQVMLAKNLDVHKGLVNGA  451

Query  1519  AGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLIL  1698
              G V GFES        G    P V+F     + +IRPE WS+  G+ ++  R+Q+PL L
Sbjct  452   RGVVTGFES--------GMKGNPKVRF-MSGLEEVIRPERWSMCIGQSLILTRRQLPLKL  502

Query  1699  AWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVL  1878
             AWA+SIHK QGM+L+C+   L+R F  G  YVALSR  SL+GL +  F+ + ++ HP V+
Sbjct  503   AWAISIHKSQGMSLDCVEISLSRVFECGQAYVALSRATSLQGLRVLDFDGSCVRAHPDVI  562

Query  1879  NF  1884
              F
Sbjct  563   RF  564



>gb|EXV03405.1| PIF1-like helicase [Metarhizium robertsii]
Length=870

 Score =   304 bits (778),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 185/472 (39%), Positives = 265/472 (56%), Gaps = 52/472 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             +  + EQ+ V+D  ++  +SVF TG AGTGK+ L++ II +L++ + R   RV VTASTG
Sbjct  355   ISLSSEQAHVVDMVVNQNQSVFFTGPAGTGKSVLMRAIISELKKKYARDSERVAVTASTG  414

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSFAGIGLG+     L+ K+  N + ++RW   + LIIDEIS++ G+L+
Sbjct  415   LAACNIGGITLHSFAGIGLGKEAPPALVKKIRRNPKAKNRWLRTKCLIIDEISMVDGDLF  474

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI--FNKNTQKFAFEASSWKLS  1140
             DKL  + R IR+  NG      WGGIQ+V +GDFFQLPP+   +K   KFAF+A++W  S
Sbjct  475   DKLSQVGRTIRN--NGRP----WGGIQLVITGDFFQLPPVPDADKRDSKFAFDAATWSTS  528

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRN  1314
              D  I LT VFRQ DP+  ++L  +R G+     +   +     L  E      +LYP  
Sbjct  529   IDHTIGLTQVFRQRDPEFARMLNEMRIGKISDHTVQAFKALSRPLKFEDGVDLAELYPTR  588

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNLN  1491
               V   N+K L  L   +  Y A+D G+ + +++L +  +AP  +EL +GA+VML KNL+
Sbjct  589   AQVEGSNEKRLRELPGKIHRYEALDTGDPAVRDKLLMSMMAPKAIELKIGAQVMLIKNLD  648

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTN-------------------------------  1578
                 LVNG+ G VI F S   T+E  G N                               
Sbjct  649   --ESLVNGSLGKVIAF-SDEKTFEMGGNNAYDEMPGDSMAKARRKLQAFSRDSGSDSSSQ  705

Query  1579  WLPVVKFDFK---PKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
               PVV+F      P+ ++ +PE W++ +   E+ A R Q+PLILAWALSIHK QG TL  
Sbjct  706   QYPVVQFISTGGVPRVILCQPEEWTVELPNGEIQAKRNQLPLILAWALSIHKAQGQTLER  765

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             +  +L + F  G  YVALSR  S  GL +  F  + +  HP+V+ F  +L S
Sbjct  766   VTVNLGKVFEKGQAYVALSRATSQHGLRVVGFERSKVMAHPRVVEFYSKLSS  817



>ref|XP_642006.1| DNA helicase [Dictyostelium discoideum AX4]
 gb|EAL68135.1| DNA helicase [Dictyostelium discoideum AX4]
Length=669

 Score =   299 bits (765),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 178/434 (41%), Positives = 262/434 (60%), Gaps = 25/434 (6%)
 Frame = +1

Query  625   TVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACA  801
             T EQ ++++ I   GK+VF TGSAGTGK+F+++H++ KLR+ + +S VYVTA+TG++A  
Sbjct  242   TSEQQKIVNLIVDGGKNVFFTGSAGTGKSFVLKHLVSKLRKKYPKS-VYVTAATGIAAVN  300

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGI LG A A+ L  ++  ++++  +W     LIIDEIS+I  EL++KL+ 
Sbjct  301   IGGTTLHSFAGIKLGVAPAQRLAVEILQSKKLLQKWLDCSVLIIDEISMIDAELFEKLDT  360

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDL  1161
             I + +R    G+++   +GGIQ+V  GDFFQLPP+       +AFE  +WK S D  ++L
Sbjct  361   IGQMVR----GNNQP--FGGIQLVLVGDFFQLPPVHGN----YAFECKAWKKSIDISVEL  410

Query  1162  TTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCS---NLEPDPLAVKLYPRNDDVYRV  1332
             TTV RQ + + + +L  IR G+   + +N L + C+   ++    L  +LY  N  V + 
Sbjct  411   TTVMRQKETEFIDILNKIRVGDIKEDMINRLVSTCNKPLDISNGILPTRLYSTNASVDQE  470

Query  1333  NKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGI-APDFLELCVGARVMLTKNLNARHKLV  1509
             N+  LD L  +   ++AVD+G     E L     A   L L VGA+V+L + +     LV
Sbjct  471   NQSSLDKLLGEPFSFQAVDSGNKELIELLDRDCPAMKNLTLKVGAQVVLLRKIEKGDGLV  530

Query  1510  NGAAGTVIGFESV-----NGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAV  1674
             NG+ G V+ F        N  +      +LPVV F+   +K+ I P  W +   E+  A 
Sbjct  531   NGSRGVVVDFVKARVSRKNNKFHKVN-QYLPVVLFN-DGQKVTIPPSEWCVWSEEK--AY  586

Query  1675  RKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNI  1854
             R QIPL LAWAL+IH+ QGMTL+ +  +L+R F  G  YVALSRVKSL GLHL S N   
Sbjct  587   RNQIPLKLAWALTIHRAQGMTLDKVECELSRTFASGQGYVALSRVKSLAGLHLKSLNTPA  646

Query  1855  IKVHPKVLNFDKRL  1896
             +K  PKV+ F+K++
Sbjct  647   LKTSPKVVTFNKKI  660



>dbj|GAC71727.1| DNA helicase PIF1/RRM3 [Pseudozyma antarctica T-34]
Length=693

 Score =   299 bits (766),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 185/459 (40%), Positives = 254/459 (55%), Gaps = 47/459 (10%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ +VL   +  GK+VF TGSAGTGK+ L++ IIR+LR  H +S   V VTASTG++AC 
Sbjct  244   EQRKVLSMVVDEGKNVFFTGSAGTGKSVLLREIIRELRRKHSKSPDAVAVTASTGIAACN  303

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G T+HSFAGIGLG+    +L+ K+  NR+   RW   Q LIIDEIS++   L DKLE 
Sbjct  304   IGGVTIHSFAGIGLGKEPVAQLVSKIRKNRKATGRWSRTQVLIIDEISMVDPALLDKLEE  363

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDL  1161
             IAR +R       +   +GGIQ+V +GDFFQLPP+    +  FAF+A  W+     +++L
Sbjct  364   IARVLR------KKPKPFGGIQIVITGDFFQLPPVNPGGSVTFAFDAQCWEHVVQHKVNL  417

Query  1162  TTVFRQSDPQLVKLLQGIRKG---EYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRV  1332
             T VFRQ D   V +L  +R G   +   E    LE      + D +  +L+P  ++V   
Sbjct  418   TQVFRQKDSSFVTMLNEMRFGTLSQKTIEAFKRLE-RVPQYDGDIVPTELFPMRNEVDAA  476

Query  1333  NKKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHK  1503
             N + L++L  D   YRA D G    ++    L+  IA   L +  GA+VML KN++    
Sbjct  477   NAQRLNALQADSQTYRAQDGGSLQAEARDRVLQSSIALPVLSVKKGAQVMLIKNID--ET  534

Query  1504  LVNGAAGTVIGF---------------------ESVNGTYETFGTNWLPVVKFDFK---P  1611
             LVNG+ G V+ F                     E   GT    G  W P+V+F       
Sbjct  535   LVNGSIGKVVDFVDEMEHARLVGDLESHEQMTSEREKGT-RMPGRKW-PLVRFHVPGGGT  592

Query  1612  KKLIIRPETW--SIMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGM  1785
             +  +  PETW   + DG E+ A R Q+PLILAWA+SIHK QG TL C   +LNR F  G 
Sbjct  593   RDYLAMPETWKTELPDG-EIQASRTQVPLILAWAMSIHKSQGQTLPCCKINLNRVFEKGQ  651

Query  1786  VYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              YVALSR  S+EGL +  F  + +  HP+V+ + K L +
Sbjct  652   AYVALSRATSIEGLQVLGFQASKVMAHPRVIEWSKSLIA  690



>ref|XP_655065.2| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gb|EAL49677.2| hypothetical protein, conserved [Entamoeba histolytica HM-1:IMSS]
 gb|EMD45361.1| DNA repair and recombination protein, putative [Entamoeba histolytica 
KU27]
 gb|EMH74636.1| DNA repair and recombination protein, putative [Entamoeba histolytica 
HM-1:IMSS-B]
 gb|EMS16719.1| DNA repair and recombination protein [Entamoeba histolytica HM-3:IMSS]
 gb|ENY65709.1| DNA repair and recombination protein, putative [Entamoeba histolytica 
HM-1:IMSS-A]
Length=841

 Score =   303 bits (775),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 180/420 (43%), Positives = 247/420 (59%), Gaps = 20/420 (5%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             +Q  VL A   GKS F TG+AG GK++++  I+ KL+  H +  VYVTASTG++AC +NG
Sbjct  83    DQELVLKAALEGKSFFFTGAAGCGKSYVLSAIVEKLK--HDK-EVYVTASTGIAACNVNG  139

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              T+HSF+GIG GE ++ EL  KV  +++   +W  V+ LIIDEIS+I G+L+DKLEFIAR
Sbjct  140   MTIHSFSGIGKGEGSSSELWDKVKRDKKALKKWNKVEVLIIDEISMIDGDLFDKLEFIAR  199

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDLTTV  1170
             K R++       + +GGIQ++  GDF QLPPI    T KFAFE++ W         LTTV
Sbjct  200   KARNN------NLAFGGIQMIICGDFCQLPPISRNGTTKFAFESNCWNKVIPYCYYLTTV  253

Query  1171  FRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRVNKKHLD  1350
              RQ+D + + LL GIR GE + E +N L+  C + E       L     +V  VN K L 
Sbjct  254   HRQNDQKFITLLNGIRIGEINDEMINCLKG-CCDKECKQQCTHLLSYIKEVDDVNTKELQ  312

Query  1351  SLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAGTV  1530
              L  + + Y +VD G   +   +K+    D L L  GA VM+ KN++    LVNG+ G V
Sbjct  313   KLQGNEVVYHSVDTGNSIYLTSMKI---TDELHLKAGAFVMINKNIDVERGLVNGSVGVV  369

Query  1531  IGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLILAWAL  1710
             IGF+  +     F    +P+V+     + L I   +W I  G ++VA R QIPL LAWA+
Sbjct  370   IGFDETS----LFSGQPVPIVQ--LSNRTLPISECSWDIELGNQLVAKRSQIPLQLAWAI  423

Query  1711  SIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLS-SFNPNIIKVHPKVLNFD  1887
             SIHK QGMTL      ++  F  G  YVALSR+KSL+GL++  S     IK + K   FD
Sbjct  424   SIHKSQGMTLERAVIRIDNVFETGQAYVALSRLKSLDGLYIEGSVIKERIKCNEKAKKFD  483



>gb|KEY67206.1| hypothetical protein S7711_03065 [Stachybotrys chartarum IBT 
7711]
 gb|KFA75157.1| hypothetical protein S40288_02846 [Stachybotrys chartarum IBT 
40288]
Length=805

 Score =   301 bits (772),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 193/487 (40%), Positives = 263/487 (54%), Gaps = 56/487 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             +  + EQ  VLD  ++ G+SVF TG AGTGK+ L++ II+ L++ + +   RV VTASTG
Sbjct  290   ISLSSEQKHVLDLVVNKGRSVFFTGPAGTGKSVLMRAIIKDLKKKYSKDPERVAVTASTG  349

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ K+  N   R RW   + LIIDEIS++ GEL+
Sbjct  350   LAACNIGGITLHSFSGIGLGKEDAPSLVKKIRRNPNARQRWLKTKCLIIDEISMVDGELW  409

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ---KFAFEASSWKL  1137
             DKL+ I R IR+  NG      WGGIQ+V +GDFFQLPP+ +       KFAF+A++W  
Sbjct  410   DKLDHIGRTIRN--NG----RPWGGIQIVVTGDFFQLPPVPDHGQNREAKFAFDAATWDT  463

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLA--VKLYPR  1311
             S D  I LT VFRQ DPQ   +L  +R G+   E     +     L  D      +L+P 
Sbjct  464   SLDHTIGLTQVFRQRDPQFAAMLNEMRLGKISPETEKAFKALARPLTFDDGVDLAELFPT  523

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNL  1488
                V   N+K L  L      Y A D G +  K++L +  +AP  LEL V A+VML KNL
Sbjct  524   RAQVDSSNEKRLRELKGKSYRYDAADVGPEGVKDRLLVNMMAPKALELKVNAQVMLIKNL  583

Query  1489  NARHKLVNGAAGTVIGFES----------------------VNGTYETFGTNW-------  1581
             +    LVNG+ G VI F                             +TF  +        
Sbjct  584   D--DTLVNGSLGKVIAFSDDKLFDLTNPDDFDDALNDRMARAKKKLKTFSRDPDEASDGV  641

Query  1582  -LPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
               PVV+F   D  P+ ++ +P  W + +   ++ A R Q+PLILAWALSIHK QG TL  
Sbjct  642   KYPVVQFSATDGTPRVVLCQPMEWKVELPNGDLQAKRTQVPLILAWALSIHKAQGQTLER  701

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKED  1926
             +  +L R F  G  YVALSR  S  GL +  F+ N +  HP+V+ F  +L S      E+
Sbjct  702   VTVNLGRVFEKGQAYVALSRATSQHGLRVLGFDKNKVMAHPRVVAFYNKLYSA-----EE  756

Query  1927  AVTKKKQ  1947
             A  +K Q
Sbjct  757   AAGRKPQ  763



>ref|XP_005050364.1| PREDICTED: ATP-dependent DNA helicase PIF1-like, partial [Ficedula 
albicollis]
Length=426

 Score =   291 bits (745),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 180/424 (42%), Positives = 245/424 (58%), Gaps = 27/424 (6%)
 Frame = +1

Query  640   QVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNGYTL  819
             +VL A+ +GKSVF TGSAGTGK+FL++ I+  L      +  Y TASTGV+AC + G TL
Sbjct  3     EVLGAVRSGKSVFFTGSAGTGKSFLLKRIVGSLPP----NITYATASTGVAACHIGGTTL  58

Query  820   HSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIR  999
             H+FAGIG G+A  E+ + ++     VR  W   Q LIIDEIS++ G+ +DKLE +AR +R
Sbjct  59    HAFAGIGSGKAPLEQCI-QLAERPGVRQHWLACQHLIIDEISMVDGKFFDKLEAVARAVR  117

Query  1000  SSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQIDLTTVFR  1176
                   DE   +GGIQ++  GDF QLPP+   N + KF F+A SW+      ++LT V R
Sbjct  118   KR----DEP--FGGIQLIICGDFLQLPPVCKANEETKFCFQAKSWRKCIHINMELTEVRR  171

Query  1177  QSDPQLVKLLQGIRKGEYDFEDLNLL-ENHCSNLEPDP-LAVKLYPRNDDVYRVNKKHLD  1350
             Q+D   V LL  IR G    E   LL +      E D  LA +L    DDV   N++ L 
Sbjct  172   QTDKTFVSLLSAIRLGRCTEEVTRLLMQTAAHRSERDGILATRLCTHKDDVEITNERRLQ  231

Query  1351  SLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLNARHKLVNGAAG  1524
              L  ++  + A+D+  D    +L     P    +EL +GA+VML KNL+    LVNGA G
Sbjct  232   QLPGEVHVFEALDS--DPMLVKLIDAQCPVGGRVELKLGAQVMLAKNLDVSQGLVNGARG  289

Query  1525  TVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLILAW  1704
              V+GFES            LP V+F     +LI + E W I     V   R+Q+PL LAW
Sbjct  290   VVVGFESEQ--------KGLPKVRFLCGVTQLI-KMEKWVIKGPSGVHLSRQQLPLKLAW  340

Query  1705  ALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNF  1884
             A+SIHK QGM+L+C+   L+R F  G  YVALSR +SL GL +  F+P +++  P VL F
Sbjct  341   AISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARSLAGLRVLDFDPKVVRADPAVLQF  400

Query  1885  DKRL  1896
              ++L
Sbjct  401   YRQL  404



>gb|AAI70996.1| PIF1 5'-to-3' DNA helicase homolog [Xenopus (Silurana) tropicalis]
Length=636

 Score =   297 bits (761),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 175/427 (41%), Positives = 248/427 (58%), Gaps = 23/427 (5%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVS  792
             +V+ + EQS VL+ + +G++VF TGSAGTGK++L++ I+  L         Y TASTGV+
Sbjct  205   QVRLSTEQSLVLNTVLSGRNVFFTGSAGTGKSYLLKRIVGALPP----KSTYATASTGVA  260

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             AC + G TLH+FAGIG G+A+ E+ + ++     VR  W   + LIIDEIS++ GE +DK
Sbjct  261   ACHIGGTTLHAFAGIGTGKASIEQCI-ELAKRPGVRQHWTGCKHLIIDEISMVEGEFFDK  319

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDT  1149
             LE +AR +R    G DE   +GGIQ++  GDF QLPP+   ++Q KF F+A SW+     
Sbjct  320   LEAVARAVR----GKDEP--FGGIQLIVCGDFLQLPPVTQASSQTKFCFQARSWRKCIHL  373

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGE-YDFEDLNLLENHCSNLEPDP-LAVKLYPRNDDV  1323
              ++LT V RQ+D   + LLQ IR G   D     LL+     +E D  LA +L    DDV
Sbjct  374   TMELTEVRRQTDKNFISLLQAIRLGRCTDDVSRKLLQTSSHKVERDGILATRLCTHKDDV  433

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHK  1503
                N++ L  L  +   Y A+D+     K           ++L  GA+VML KNL+    
Sbjct  434   EITNERRLQQLPGESHLYEALDSDPMLVKTINAQCPVNQQIQLKKGAQVMLAKNLDVSRG  493

Query  1504  LVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQ  1683
             LVNGA G V  FE         G   LPVV+F     + +I+P+ W       +   R+Q
Sbjct  494   LVNGARGVVTKFEE--------GNKNLPVVRFLCGVTE-VIKPDRWVFKGHGGIYLSRQQ  544

Query  1684  IPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKV  1863
             +PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR ++LEGL +  F+P +++ 
Sbjct  545   LPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARNLEGLRVMDFDPKVVRA  604

Query  1864  HPKVLNF  1884
             +P VL F
Sbjct  605   NPYVLQF  611



>ref|XP_007310558.1| hypothetical protein STEHIDRAFT_172690 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM80434.1| hypothetical protein STEHIDRAFT_172690 [Stereum hirsutum FP-91666 
SS1]
Length=623

 Score =   297 bits (760),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 187/472 (40%), Positives = 261/472 (55%), Gaps = 49/472 (10%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACAL  804
             EQ Q+L  +  GKS+F TGSAGTGK+ L++ II+ + + + +S   V VTASTG++AC +
Sbjct  162   EQKQILQLVKDGKSIFYTGSAGTGKSVLLREIIKAMHKKYAKSLEAVAVTASTGIAACNI  221

Query  805   NGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFI  984
              G T+HSFAGIGLG  +AEEL  K+  N++   RW   + LIIDE+S++ GEL+DKL  I
Sbjct  222   GGITIHSFAGIGLGIESAEELATKIRKNKKSSSRWLRTKVLIIDEVSMVDGELFDKLARI  281

Query  985   ARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQIDL  1161
                +R           +GGIQ+V +GDFFQLPP+   N Q KFAFEA  W    + ++ L
Sbjct  282   GSIMRKRTE------PFGGIQLVITGDFFQLPPVSKGNRQMKFAFEAQLWNQVVERKLML  335

Query  1162  TTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRNDDVYRVN  1335
             T VFRQ D   V +L  +R G    + +   +    ++  E      +L+PR +DV   N
Sbjct  336   TKVFRQKDQDFVDMLNEMRFGTLSQKSIQKFKALSRDIIYEDGLGPTELFPRREDVDSSN  395

Query  1336  KKHLDSLHQDLIGYRAVDN---GEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKL  1506
                +  L  +   + A D    GED  K  L   +APD L L V A+VML KN++    L
Sbjct  396   GVRMSRLRGNNRTFYAKDGGNAGEDQRKRLLDNFMAPDVLYLAVDAQVMLIKNVD--ETL  453

Query  1507  VNGAAGTVIGF-----------ESVNGTYETFG-----------------TNWLPVVKFD  1602
             VNG+ G ++ F           E    T +  G                     PVV+F 
Sbjct  454   VNGSMGRIVRFVDPQKYKDEVLEDATFTNDKEGKPASKGGPTKPSSSKVDVQMWPVVEFT  513

Query  1603  FK--PKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAF  1773
                  +++++ PETW + +   EV A R+Q+PLILAWA+SIHK QG TL+ +  DL R F
Sbjct  514   VPGGKREVMVMPETWKVELPNGEVQASRQQLPLILAWAMSIHKSQGQTLDRVKVDLARVF  573

Query  1774  GYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKEDA  1929
               G  YVALSR  SL+GL + +FNP+ + VH KV  + + L +  D  KEDA
Sbjct  574   EKGQAYVALSRATSLDGLQVLNFNPDKVLVHEKVRAWARTLETLVD--KEDA  623



>ref|XP_008855707.1| DNA repair and recombination protein, putative [Entamoeba nuttalli 
P19]
 gb|EKE41958.1| DNA repair and recombination protein, putative [Entamoeba nuttalli 
P19]
Length=841

 Score =   302 bits (774),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 179/420 (43%), Positives = 247/420 (59%), Gaps = 20/420 (5%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             +Q  VL A   GKS F TG+AG GK++++  I+ KL+  H +  VYVTASTG++AC +NG
Sbjct  83    DQELVLKAALEGKSFFFTGAAGCGKSYVLSAIVEKLK--HDK-EVYVTASTGIAACNVNG  139

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              T+HSF+GIG GE ++ EL  KV  +++   +W  V+ LIIDEIS+I G+L+DKLEFIAR
Sbjct  140   MTIHSFSGIGKGEGSSSELWDKVKRDKKALKKWNKVEVLIIDEISMIDGDLFDKLEFIAR  199

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDLTTV  1170
             K R++       + +GGIQ++  GDF QLPPI    T KFAFE++ W         LTTV
Sbjct  200   KARNN------NLAFGGIQMIICGDFCQLPPISRNGTTKFAFESNCWNKVIPYCYYLTTV  253

Query  1171  FRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRVNKKHLD  1350
              RQ+D + + LL GIR GE + E +N L+  C + E       L     +V  VN K L 
Sbjct  254   HRQNDQKFITLLNGIRIGEINDEMINCLKG-CCDKECKQQCTHLLSYIKEVDDVNTKELQ  312

Query  1351  SLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAGTV  1530
              L  + + Y ++D G   +   +K+    D L L  GA VM+ KN++    LVNG+ G V
Sbjct  313   KLQGNEVVYHSIDTGNSIYLTSMKIT---DELHLKAGAFVMINKNIDVERGLVNGSVGVV  369

Query  1531  IGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLILAWAL  1710
             IGF+  +     F    +P+V+     + L I   +W I  G ++VA R QIPL LAWA+
Sbjct  370   IGFDETS----LFSGQPVPIVQ--LSNRTLPISECSWDIELGNQLVAKRSQIPLQLAWAI  423

Query  1711  SIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLS-SFNPNIIKVHPKVLNFD  1887
             SIHK QGMTL      ++  F  G  YVALSR+KSL+GL++  S     IK + K   FD
Sbjct  424   SIHKSQGMTLERAVIRIDNVFETGQAYVALSRLKSLDGLYIEGSVIKERIKCNEKAKKFD  483



>ref|NP_001016603.1| PIF1 5'-to-3' DNA helicase [Xenopus (Silurana) tropicalis]
Length=636

 Score =   297 bits (761),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 175/427 (41%), Positives = 248/427 (58%), Gaps = 23/427 (5%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVS  792
             +V+ + EQS VL+ + +G++VF TGSAGTGK++L++ I+  L         Y TASTGV+
Sbjct  205   QVRLSTEQSLVLNTVLSGRNVFFTGSAGTGKSYLLKRIVGALPP----KSTYATASTGVA  260

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             AC + G TLH+FAGIG G+A+ E+ + ++     VR  W   + LIIDEIS++ GE +DK
Sbjct  261   ACHIGGTTLHAFAGIGTGKASIEQCI-ELAKRPGVRQHWTGCKHLIIDEISMVEGEFFDK  319

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDT  1149
             LE +AR +R    G DE   +GGIQ++  GDF QLPP+   ++Q KF F+A SW+     
Sbjct  320   LEAVARAVR----GKDEP--FGGIQLIVCGDFLQLPPVTQASSQTKFCFQARSWRKCIHL  373

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGE-YDFEDLNLLENHCSNLEPDP-LAVKLYPRNDDV  1323
              ++LT V RQ+D   + LLQ IR G   D     LL+     +E D  LA +L    DDV
Sbjct  374   TMELTEVRRQTDKNFISLLQAIRLGRCTDDVSRKLLQTSSHKVERDGILATRLCTHKDDV  433

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHK  1503
                N++ L  L  +   Y A+D+     K           ++L  GA+VML KNL+    
Sbjct  434   EITNERRLQQLPGESHLYEALDSDPMLVKTINAQCPVNQQIQLKKGAQVMLAKNLDVSRG  493

Query  1504  LVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQ  1683
             LVNGA G V  FE         G   LPVV+F     + +I+P+ W       +   R+Q
Sbjct  494   LVNGARGVVTKFEE--------GNKNLPVVRFLCGVTE-VIKPDRWVFKGHGGIYLSRQQ  544

Query  1684  IPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKV  1863
             +PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR ++LEGL +  F+P +++ 
Sbjct  545   LPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARNLEGLRVMDFDPKVVRA  604

Query  1864  HPKVLNF  1884
             +P VL F
Sbjct  605   NPYVLQF  611



>gb|KFA46747.1| hypothetical protein S40293_08114 [Stachybotrys chartarum IBT 
40293]
Length=805

 Score =   301 bits (772),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 193/487 (40%), Positives = 263/487 (54%), Gaps = 56/487 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             +  + EQ  VLD  ++ G+SVF TG AGTGK+ L++ II+ L++ + +   RV VTASTG
Sbjct  290   ISLSSEQKHVLDLVVNKGRSVFFTGPAGTGKSVLMRAIIKDLKKKYSKDPERVAVTASTG  349

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ K+  N   R RW   + LIIDEIS++ GEL+
Sbjct  350   LAACNIGGITLHSFSGIGLGKEDAPSLVKKIRRNPNARQRWLKTKCLIIDEISMVDGELW  409

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ---KFAFEASSWKL  1137
             DKL+ I R IR+  NG      WGGIQ+V +GDFFQLPP+ +       KFAF+A++W  
Sbjct  410   DKLDHIGRTIRN--NG----RPWGGIQIVVTGDFFQLPPVPDHGQNREAKFAFDAATWDT  463

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLA--VKLYPR  1311
             S D  I LT VFRQ DPQ   +L  +R G+   E     +     L  D      +L+P 
Sbjct  464   SLDHTIGLTQVFRQRDPQFAAMLNEMRLGKISPETEKAFKALARPLTFDDGVDLAELFPT  523

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNL  1488
                V   N+K L  L      Y A D G +  K++L +  +AP  LEL V A+VML KNL
Sbjct  524   RAQVDSSNEKRLRELKGKSYRYDAADVGPEGVKDRLLVNMMAPKALELKVNAQVMLIKNL  583

Query  1489  NARHKLVNGAAGTVIGFES----------------------VNGTYETFGTNW-------  1581
             +    LVNG+ G VI F                             +TF  +        
Sbjct  584   D--DTLVNGSLGKVIAFSDDKLFDLTNPDDFDDALNDRMARAKKKLKTFSRDPDEASDGV  641

Query  1582  -LPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
               PVV+F   D  P+ ++ +P  W + +   ++ A R Q+PLILAWALSIHK QG TL  
Sbjct  642   KYPVVQFSATDGTPRVVLCQPMEWKVELPNGDLQAKRTQVPLILAWALSIHKAQGQTLER  701

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKED  1926
             +  +L R F  G  YVALSR  S  GL +  F+ N +  HP+V+ F  +L S      E+
Sbjct  702   VTVNLGRVFEKGQAYVALSRATSQHGLRVLGFDKNKVMAHPRVVAFYNKLYSA-----EE  756

Query  1927  AVTKKKQ  1947
             A  +K Q
Sbjct  757   AAGRKPQ  763



>ref|XP_006015915.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Alligator sinensis]
Length=440

 Score =   291 bits (745),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 179/435 (41%), Positives = 249/435 (57%), Gaps = 27/435 (6%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             R+    + EQ+ VL A  +G+SVF TGSAGTGK+FL++ I+  L         Y TASTG
Sbjct  2     RSAAGLSQEQALVLSAALSGRSVFFTGSAGTGKSFLLKKILGSLPP----KSTYATASTG  57

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+AC + G TLH+FAGIG G+A  E+ + ++     VR  W   Q LIIDEIS++ GE +
Sbjct  58    VAACHIGGTTLHAFAGIGSGKAPLEQCI-QLAQRLGVRQHWLGCQHLIIDEISMVDGEFF  116

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSF  1143
             DKLE +AR +R        +  +GGIQ++  GDF QLPP+   N Q KF F+A SW+   
Sbjct  117   DKLEAVARAVRK------RDDPFGGIQLIICGDFLQLPPVCKGNDQIKFCFQAKSWRKCI  170

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRND  1317
                ++LT V RQ+D   + LL+ +R G    E    L +   + +E D  LA +L    D
Sbjct  171   HVNMELTEVRRQTDKAFISLLRAVRLGRCPDEVTWQLTQTAANRVERDGILATRLCTHKD  230

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLN  1491
             DV   N++ L  L  +   + AVD+  D    +L     P    +EL  GA+VMLTKNL+
Sbjct  231   DVELTNERRLQQLPGERRCFEAVDS--DPMLAKLIDAQCPVGHHIELKPGAQVMLTKNLD  288

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVA  1671
                 LVNGA G V+ FE+        G   LP V+F     + +I+ E W       V  
Sbjct  289   VSRGLVNGARGVVVEFEA--------GGKGLPRVRFLCGVTE-VIKLERWIFKGPSGVHL  339

Query  1672  VRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPN  1851
              R+Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SL+GL +  F+P 
Sbjct  340   SRQQLPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARSLKGLRVLDFDPK  399

Query  1852  IIKVHPKVLNFDKRL  1896
             ++K +P+VL F  +L
Sbjct  400   VVKANPQVLQFYSQL  414



>ref|XP_003021736.1| hypothetical protein TRV_04153 [Trichophyton verrucosum HKI 0517]
 gb|EFE41118.1| hypothetical protein TRV_04153 [Trichophyton verrucosum HKI 0517]
Length=780

 Score =   301 bits (770),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 203/503 (40%), Positives = 269/503 (53%), Gaps = 81/503 (16%)
 Frame = +1

Query  622   WTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSR--VYVTASTGVS  792
             ++ EQ+QV++ I   GKSVF TGSAGTGK+ L++ IIR+LR  + R    V VTASTG++
Sbjct  257   FSEEQNQVIETIVKKGKSVFYTGSAGTGKSVLMREIIRQLRLKYSRDSDAVAVTASTGLA  316

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             AC + G TLHSFAG+GLG+ + +EL+ KV  N + + RW   + LIIDEIS++ G+ +DK
Sbjct  317   ACNIEGVTLHSFAGVGLGKESTQELVKKVKRNLKAKTRWLKTKVLIIDEISMVDGDFFDK  376

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDT  1149
             LE +ARKIR+  NG      +GGIQ+V +GDFFQLPP+     + KFAF A +W  S   
Sbjct  377   LEELARKIRN--NGRP----FGGIQLVTTGDFFQLPPVPEGGKEAKFAFAAGTWNTSIQH  430

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAV-----  1296
              I LT VFRQ DP    +L  +R G         F+DL+       N+E   L V     
Sbjct  431   TILLTQVFRQRDPDFANMLNEMRLGRLSPSAIQAFKDLSRPLTCSDNIEATELYVIERAV  490

Query  1297  -----KL------YPRNDDVYRVNKKHLDSLHQDLIGYRAVDNG----EDSWKEQLKLGI  1431
                  KL      +P   +V R N + ++ L   ++ + A D+G    E    + L   +
Sbjct  491   FYICWKLMVTICRFPTRAEVDRANSERMNRLSGSVMTFHAADSGAIKDEQFRAKLLSNCM  550

Query  1432  APDFLELCVGARVMLTKNLNARHKLVNGAAGTVIGF--------------ESVNGTYE--  1563
             AP  + L  GA+VML KN +    LVNG+ GTVI F              +  NG Y+  
Sbjct  551   APATIHLKKGAQVMLIKNKD--ETLVNGSLGTVIAFMDEAGFDNHIREGLKRENGYYDFD  608

Query  1564  --------------------TFGTN---WLPVVKF---DFKPKKLIIRPETWSI-MDGEE  1662
                                 T   N     P+V F   D   ++L+  PE W I +   E
Sbjct  609   DEPSQAKQKIKSMAFDQKANTGSVNTSRQYPLVAFILPDGSERQLLCMPEAWKIELPNGE  668

Query  1663  VVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSF  1842
             V A R QIPLILAWALSIHK QG TL  +  DL R F  G  YVALSR  S +GL +S F
Sbjct  669   VQAQRLQIPLILAWALSIHKAQGQTLQRVKVDLGRVFERGQAYVALSRATSKDGLQVSRF  728

Query  1843  NPNIIKVHPKVLNFDKRLCSQPD  1911
             +P  + VHPKV  F + L S  D
Sbjct  729   DPRKVMVHPKVTEFYQNLSSISD  751



>ref|NP_001089530.1| ATP-dependent DNA helicase PIF1 [Xenopus laevis]
 gb|AAH97805.2| MGC115521 protein [Xenopus laevis]
Length=634

 Score =   297 bits (760),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 174/427 (41%), Positives = 248/427 (58%), Gaps = 23/427 (5%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVS  792
             +++ + EQS VL+ + +G++VF TGSAGTGK++L++ I+  L         Y TASTGV+
Sbjct  204   QIRLSTEQSLVLNTVLSGRNVFFTGSAGTGKSYLLKRIVGALPP----KSTYATASTGVA  259

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             AC + G TLH+FAGIG G+A+ E+ + ++     VR  W   + LIIDEIS++ GE +DK
Sbjct  260   ACHIGGTTLHAFAGIGSGKASLEQCI-ELAKRPGVRQHWTSCKHLIIDEISMVEGEFFDK  318

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDT  1149
             LE +AR +R    G DE   +GGIQ++  GDF QLPP+   ++Q KF F+  SW+     
Sbjct  319   LEAVARAVR----GKDEP--FGGIQLIVCGDFLQLPPVTQASSQTKFCFQGKSWRKCIHL  372

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGE-YDFEDLNLLENHCSNLEPDP-LAVKLYPRNDDV  1323
              ++LT V RQ+D   + LLQ IR G   D     LL+     +E D  LA +L    DDV
Sbjct  373   TMELTEVRRQTDKNFISLLQAIRLGRCTDDVARQLLQTTNHKVERDGILATRLCTHKDDV  432

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHK  1503
                N++ L  L  +   Y A+D+     K           ++L  GA+VML KNL+    
Sbjct  433   EITNERRLQQLPGESHSYEALDSDPMLVKTINAQCPVNQQIQLKKGAQVMLAKNLDVSRG  492

Query  1504  LVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQ  1683
             LVNGA G VI FE         G   LPVV+F     + +I+P+ W       +   R+Q
Sbjct  493   LVNGARGVVIKFEE--------GNKNLPVVRFLCGVTE-VIKPDRWVFKGHGGIYLSRQQ  543

Query  1684  IPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKV  1863
             +PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR ++LEGL +  F+P +++ 
Sbjct  544   LPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARNLEGLRVMDFDPKVVRA  603

Query  1864  HPKVLNF  1884
             +P VL F
Sbjct  604   NPYVLQF  610



>sp|Q0R4F1.1|PIF1_XENLA RecName: Full=ATP-dependent DNA helicase PIF1; AltName: Full=DNA 
repair and recombination helicase PIF1 [Xenopus laevis]
 gb|AAZ41379.1| PIF1 [Xenopus laevis]
Length=635

 Score =   297 bits (760),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 174/427 (41%), Positives = 248/427 (58%), Gaps = 23/427 (5%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVS  792
             +++ + EQS VL+ + +G++VF TGSAGTGK++L++ I+  L         Y TASTGV+
Sbjct  205   QIRLSTEQSLVLNTVLSGRNVFFTGSAGTGKSYLLKRIVGALPP----KSTYATASTGVA  260

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             AC + G TLH+FAGIG G+A+ E+ + ++     VR  W   + LIIDEIS++ GE +DK
Sbjct  261   ACHIGGTTLHAFAGIGSGKASLEQCI-ELAKRPGVRQHWTSCKHLIIDEISMVEGEFFDK  319

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDT  1149
             LE +AR +R    G DE   +GGIQ++  GDF QLPP+   ++Q KF F+  SW+     
Sbjct  320   LEAVARAVR----GKDEP--FGGIQLIVCGDFLQLPPVTQASSQTKFCFQGKSWRKCIHL  373

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGE-YDFEDLNLLENHCSNLEPDP-LAVKLYPRNDDV  1323
              ++LT V RQ+D   + LLQ IR G   D     LL+     +E D  LA +L    DDV
Sbjct  374   TMELTEVRRQTDKNFISLLQAIRLGRCTDDVARQLLQTTNHKVERDGILATRLCTHKDDV  433

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHK  1503
                N++ L  L  +   Y A+D+     K           ++L  GA+VML KNL+    
Sbjct  434   EITNERRLQQLPGESHSYEALDSDPMLVKTINAQCPVNQQIQLKKGAQVMLAKNLDVSRG  493

Query  1504  LVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQ  1683
             LVNGA G VI FE         G   LPVV+F     + +I+P+ W       +   R+Q
Sbjct  494   LVNGARGVVIKFEE--------GNKNLPVVRFLCGVTE-VIKPDRWVFKGHGGIYLSRQQ  544

Query  1684  IPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKV  1863
             +PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR ++LEGL +  F+P +++ 
Sbjct  545   LPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARNLEGLRVMDFDPKVVRA  604

Query  1864  HPKVLNF  1884
             +P VL F
Sbjct  605   NPYVLQF  611



>gb|ELQ39072.1| DNA repair and recombination protein pif1 [Magnaporthe oryzae 
Y34]
 gb|ELQ59484.1| DNA repair and recombination protein pif1 [Magnaporthe oryzae 
P131]
Length=820

 Score =   301 bits (772),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 194/480 (40%), Positives = 264/480 (55%), Gaps = 63/480 (13%)
 Frame = +1

Query  616   VKWTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             V  + EQ  V + + S  +SVF TG AGTGK+ L++ II +L++   +   R+ VTASTG
Sbjct  308   VTLSNEQRHVKNLVCSRSQSVFFTGPAGTGKSVLMRAIIDELKKKWKKDPDRLAVTASTG  367

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+     L+ K+  N + ++RW   + LIIDEIS++ G+L+
Sbjct  368   LAACNIGGMTLHSFSGIGLGKEDVTTLVKKIRRNPKAKNRWLRTKTLIIDEISMVDGDLF  427

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI---FNKNTQKFAFEASSWKL  1137
             DKL  I R IR+  NG      WGGIQ+V +GDFFQLPP+    +K   KFAFEA++W  
Sbjct  428   DKLSQIGRIIRN--NGKP----WGGIQLVITGDFFQLPPVPDGADKREIKFAFEAATWNT  481

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKG---EYDFEDLNLLENHC---SNLEPDPLAVK  1299
             S D  I LT VFRQ DP    +L  +R G   E    +   LE        LE      +
Sbjct  482   SIDHTIGLTEVFRQKDPAFANMLNEMRLGRISEQTVANFKSLERELRFDDGLE----VTE  537

Query  1300  LYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ-LKLGIAPDFLELCVGARVML  1476
             L+P   +V R N + L +L      Y A D+G+ +++++ L+  +AP  LEL  GA+VML
Sbjct  538   LFPTRTEVERSNTRRLQALKSKPYHYDAQDSGDPNFRDKLLQNMMAPQKLELRKGAQVML  597

Query  1477  TKNLNARHKLVNGAAGTVIGF-------------------------ESVNGTYETFG---  1572
              KN++    LVNG+ GTV+GF                         E V    + FG   
Sbjct  598   IKNMD--ETLVNGSLGTVVGFMSETAASLGGISSHGGLDGEEDSISEDVRKRIKAFGREL  655

Query  1573  ------TNWLPVVKF---DFKPKKLIIRPETW-SIMDGEEVVAVRKQIPLILAWALSIHK  1722
                       PVV F   D  P+ L++ PE W S +   EV A RKQ+PLILAWALSIHK
Sbjct  656   ESNSTDNKEYPVVTFHGADGTPRSLLMVPEEWKSELPTGEVQASRKQVPLILAWALSIHK  715

Query  1723  CQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              QG TL  +  DL + F  G  YVALSR  S EGL +  F+   +  HP+V+ F  +L S
Sbjct  716   AQGQTLERVKVDLGKIFEKGQAYVALSRATSQEGLQVLKFDKAKVMAHPRVVQFYNKLYS  775



>ref|XP_001239749.1| hypothetical protein CIMG_09370 [Coccidioides immitis RS]
Length=1535

 Score =   309 bits (791),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 195/487 (40%), Positives = 272/487 (56%), Gaps = 64/487 (13%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTAST  783
             R+  + EQ+ VLD I   G SVF TGSAGTGK+ L++  IR LR+ + +   RV VTAST
Sbjct  214   RMFLSEEQNHVLDMIVKKGHSVFFTGSAGTGKSVLMREAIRGLRQKYKKEPDRVAVTAST  273

Query  784   GVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGEL  963
             G++AC + G TLHSFAG+GLG+  A  LL KV  N++ R+RW   + LIIDEIS++ GE 
Sbjct  274   GLAACNIEGVTLHSFAGVGLGKEDATGLLKKVKRNQKARNRWLRTKVLIIDEISMVDGEF  333

Query  964   YDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLS  1140
             +DKLE +ARK+RS  NG      +GGIQ+V +GDFFQLPP+ + + + KFAF+A++W   
Sbjct  334   FDKLEELARKVRS--NGRP----FGGIQLVVTGDFFQLPPVADSSKEAKFAFDANTWNTC  387

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE--NHCSNLEPDPLAVKLYPRN  1314
                 I LT VFRQ DP+   +L  +R G    + ++  +  +   N E D  A +L+P  
Sbjct  388   VQHTILLTHVFRQKDPEFASMLNELRLGRVTQKTIDAFKQLSRPLNFEDDLEATELFPTR  447

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTK  1482
              +V   N   +  L  ++I + AVD+G   + S ++++    +AP  + L  GA+VML K
Sbjct  448   HEVEGANSTRMGRLSGEVIPFTAVDSGAIQDKSMRDKMLANCMAPPLIHLKKGAQVMLIK  507

Query  1483  NLNARHKLVNGAAGTVIGFESVNGTYETFGTN----------------------------  1578
             N++    LVNG+ G V+ F   + TY+ +  N                            
Sbjct  508   NMD--DSLVNGSLGKVVAFMD-DSTYDHYVRNEDSYHSGHEYNRDDESSRARKKIKSMAY  564

Query  1579  ------------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWAL  1710
                         W P+V F   D   ++L+ +PETW I +   EV A R+Q+PLILAWAL
Sbjct  565   DPKGLGVTTAKLW-PLVSFVLPDGTERQLLCKPETWKIELPNGEVQAQRQQVPLILAWAL  623

Query  1711  SIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDK  1890
             SIHK QG TL  +  DL R F  G  YVALSR  S  GL ++ F P  + VH KV  F  
Sbjct  624   SIHKAQGQTLQRVKVDLGRVFEKGQAYVALSRATSTSGLQVTRFEPRKVMVHHKVKEFYA  683

Query  1891  RLCSQPD  1911
              L +  D
Sbjct  684   NLSTTND  690



>ref|XP_003975778.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Takifugu rubripes]
Length=631

 Score =   296 bits (759),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 176/429 (41%), Positives = 242/429 (56%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K + EQ+ VL A+  G++VF TGSAGTGK+FL++ I+  L         + TASTGV+AC
Sbjct  201   KLSQEQTAVLSAVLTGRNVFFTGSAGTGKSFLLKRIMGSLPP----KSTFATASTGVAAC  256

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLHSFAGIG G A  E+ + ++     V   W   + LIIDEIS++  + +DKLE
Sbjct  257   HIGGTTLHSFAGIGSGSAPVEQCI-ELAQRPGVLQHWTSCRHLIIDEISMVEAQFFDKLE  315

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              +AR +R S         +GGIQ++  GDF QLPP+   K    F F+A SW+      +
Sbjct  316   AVARSVRRSPEP------FGGIQLIVCGDFLQLPPVSKGKEKASFCFQARSWRKVIQVNM  369

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    LL++    +E D  LA +L    DDV  
Sbjct  370   ELTEVRRQTDRSFISLLQAVRVGRVTEEVTTKLLKSAYHQIERDGILATRLCTHKDDVEL  429

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N+  L  L   +  + A+D+     K           ++L VGA+VMLTKNL+    LV
Sbjct  430   TNENKLKQLPGSVRVFEALDSDPVLVKTIDAHSPVGRIIQLKVGAQVMLTKNLDITRGLV  489

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V+ FES        G N LP V+F     + +++PE W    G  +   R+Q+P
Sbjct  490   NGARGVVVAFES--------GKNGLPRVRFLCGVTE-VLKPERWVFKSGGGIHLSRQQLP  540

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  F+P +++  P
Sbjct  541   LKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPQVVRADP  600

Query  1870  KVLNFDKRL  1896
              VL F K+L
Sbjct  601   DVLAFCKKL  609



>ref|XP_009557237.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent DNA helicase PIF1 
[Cuculus canorus]
Length=462

 Score =   291 bits (746),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 182/435 (42%), Positives = 249/435 (57%), Gaps = 27/435 (6%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             R  V  + EQ  VL A+ +GKS+F TG AGTGK+FL + I+  L         YVTASTG
Sbjct  26    RPLVMLSAEQEAVLSAVRSGKSIFFTGCAGTGKSFLXKRIVGSLPP----KSTYVTASTG  81

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+AC + G TLH+FAGIG G+A  E+ + ++     V   W   Q LIIDEIS++ G+ +
Sbjct  82    VAACHIGGTTLHAFAGIGSGKAPLEQCV-QLAERPGVWQHWLACQHLIIDEISMVDGKFF  140

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSF  1143
             D+LE +AR +R      DE   +GGIQ++  GDF QLPP+   N + KF F+A SW+   
Sbjct  141   DRLEAVARAVRKR----DEP--FGGIQLIICGDFLQLPPVCKANEETKFCFQAKSWRKCI  194

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL-EPDP-LAVKLYPRND  1317
                ++LT V RQ+D   V LL  +R G    E   LL    +N  E D  LA +L    D
Sbjct  195   HINMELTEVRRQTDKTFVSLLSAVRLGRCTEEVTRLLMQTAANRSERDGILATRLCTHKD  254

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLN  1491
             DV   N++ L  L  ++  + A+D+  D    +L     P    +EL +GA+VML KNL+
Sbjct  255   DVEVTNERRLQQLSGEVHTFEALDS--DPMLVKLIDAQCPVGGRVELKLGAQVMLAKNLD  312

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVA  1671
                 LVNGA G V+GFES     E  G   LP V+F     + II+ E W       +  
Sbjct  313   VPQGLVNGARGVVVGFES-----EEKG---LPKVRFLCGVTQ-IIKMEKWVFKGPSGIHL  363

Query  1672  VRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPN  1851
              R+Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SLEGL +  F+P 
Sbjct  364   SRQQLPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARSLEGLRVLDFDPK  423

Query  1852  IIKVHPKVLNFDKRL  1896
             +++  P VL F ++L
Sbjct  424   VVRADPAVLQFYRQL  438



>ref|XP_002145112.1| mitochondrial DNA helicase (Pif1), putative [Talaromyces marneffei 
ATCC 18224]
 gb|EEA28597.1| mitochondrial DNA helicase (Pif1), putative [Talaromyces marneffei 
ATCC 18224]
Length=802

 Score =   301 bits (770),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 188/478 (39%), Positives = 265/478 (55%), Gaps = 65/478 (14%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLDA+    KS+F TGSAGTGK+ L++ II+KLR+ + +   RV VTASTG++AC 
Sbjct  295   EQKAVLDAVVDRQKSIFFTGSAGTGKSVLMREIIKKLRDKYRKEPDRVAVTASTGLAACH  354

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+  A EL+ KV  N++ R+RW   + LI+DE+S++ G+L+DKLE 
Sbjct  355   IEGVTLHSFAGIGLGKEPATELVKKVRKNQKARNRWMRTKVLIVDEVSMVDGDLFDKLEE  414

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+   + +  KFAF+A++W  S    I
Sbjct  415   IARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPETSAREAKFAFDAATWNTSIQHTI  468

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE--PDPLAVKLYPRNDDVYR  1329
              LT VFRQ DP   ++L  +R G+   +     +     L+   D  A +L+P   +V  
Sbjct  469   LLTHVFRQKDPVFAEMLNQMRLGKITPQTTEAFKKLSRPLDFHDDLDATELFPTRAEVEN  528

Query  1330  VNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKNLNAR  1497
              N   +  L  +++ + A D+G   +   +E+L    +AP  + L  GA+VML KN+   
Sbjct  529   ANGLRMSRLSGEVMTFHAQDSGSIQDVQMRERLLANCMAPPVIHLKKGAQVMLIKNME--  586

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTN---------------------------------  1578
               LVNG+ G ++ F     T++ +  N                                 
Sbjct  587   DNLVNGSLGKIVAFMD-EATFDYYRNNEDEFTGDNKDGDDDDDAAARNRKKLRALAHKDG  645

Query  1579  -------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKC  1725
                    W P+V F   D   + L+ +PE W I +   E+ A R Q+PLILAWALSIHK 
Sbjct  646   GVTTSRRW-PLVCFTQQDGTERHLLCQPEIWKIELPNGEIQAQRSQVPLILAWALSIHKA  704

Query  1726  QGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLC  1899
             QG TL  +  DL R F  G  YVALSR  S  GL ++ F P  + VHPKV+ F  +L 
Sbjct  705   QGQTLPRVKVDLGRVFEKGQAYVALSRATSQAGLQVTGFEPRKVMVHPKVIEFYSKLT  762



>gb|KFA67465.1| hypothetical protein S40285_00167 [Stachybotrys chlorohalonata 
IBT 40285]
Length=806

 Score =   301 bits (770),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 192/487 (39%), Positives = 267/487 (55%), Gaps = 56/487 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             +  + EQ  VLD  ++ G+SVF TG AGTGK+ L++ II++L++ + +   RV VTASTG
Sbjct  291   ISLSSEQKHVLDLVVNKGQSVFFTGPAGTGKSVLMRAIIKELKKKYSKDPERVAVTASTG  350

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ K+  N   R RW   + LIIDE+S++ GEL+
Sbjct  351   LAACNIGGITLHSFSGIGLGKEDAPSLVKKIRRNPNARQRWLKTKCLIIDEVSMVDGELF  410

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ---KFAFEASSWKL  1137
             DKL+ I R IR+  NG      WGGIQ+V +GDFFQLPP+ +       KFAF+A++W  
Sbjct  411   DKLDHIGRTIRN--NG----RPWGGIQIVVTGDFFQLPPVPDHGQNREAKFAFDAATWDT  464

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLA--VKLYPR  1311
             S D  I LT VFRQ DPQ   +L  +R G+   E     +     L  D      +L+P 
Sbjct  465   SLDHTIGLTQVFRQRDPQFAAMLNEMRLGKISPETEKAFKALARPLTFDDGVDLAELFPT  524

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNL  1488
                V   N+K L  L      Y A D G +  K++L +  +AP  LEL V A+VML KNL
Sbjct  525   RAQVDSSNEKRLRELKGKSYRYDAADVGPEGVKDRLLVNMMAPKALELKVNAQVMLIKNL  584

Query  1489  NARHKLVNGAAGTVIGF-----------ESVNGT-----------YETFGTNW-------  1581
             +    LVNG+ G VI F           +  +G             +TF  +        
Sbjct  585   D--DTLVNGSLGKVIAFSDDKLFDLTNTDDFDGALNDKMARAKKKLKTFSRDPNEASDGV  642

Query  1582  -LPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
               PVV+F   D  P+ ++ +P  W + +   ++ A R Q+PLILAWALSIHK QG TL  
Sbjct  643   KYPVVQFSATDGTPRVVLCQPMEWKVELPNGDLQAKRTQVPLILAWALSIHKAQGQTLER  702

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKED  1926
             +  +L + F  G  YVALSR  S  GL +  F+ N +  HP+V+ F  +L S      E+
Sbjct  703   VTVNLRQVFEKGQAYVALSRATSQHGLRVLGFDKNKVMAHPRVVAFYNKLYSA-----EE  757

Query  1927  AVTKKKQ  1947
             A  +K Q
Sbjct  758   AAGRKPQ  764



>ref|XP_003304276.1| hypothetical protein PTT_16808 [Pyrenophora teres f. teres 0-1]
 gb|EFQ87631.1| hypothetical protein PTT_16808 [Pyrenophora teres f. teres 0-1]
Length=782

 Score =   300 bits (768),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 190/467 (41%), Positives = 253/467 (54%), Gaps = 51/467 (11%)
 Frame = +1

Query  631   EQSQVLDAISA-GKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VL+ ++   KSVF TGSAGTGK+ L++ II  LR  + R   RV VTASTG++AC 
Sbjct  296   EQQNVLNLVTEYKKSVFFTGSAGTGKSVLLREIIAALRRKYVREPDRVAVTASTGLAACN  355

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSF+GIGLG+  AE+L+ K+  N++ + RW   + LI+DE+S++ G+L+DKLE 
Sbjct  356   IGGVTLHSFSGIGLGKEPAEDLVKKIRRNQKAKQRWMRTKVLIMDEVSMVDGDLFDKLEQ  415

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQID  1158
             IAR IR+  NG      +GGIQ+V +GDFFQLPP+ +   Q KFAF+A +W  S +  I 
Sbjct  416   IARTIRN--NGRP----FGGIQLVITGDFFQLPPVPDHGRQAKFAFDAGTWTTSIEHTIG  469

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDL---NLLENHCSNLEPDPLAVKLYPRNDDVYR  1329
             L  VFRQ DP    +L  +R+G    E +     LE      +    A +L+P   +V R
Sbjct  470   LHHVFRQKDPVFAGMLNEMREGRLTPESIARFRKLERPLPTTDESVEATELFPTRQEVDR  529

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQ----LKLGIAPDFLELCVGARVMLTKNLNAR  1497
              N   +  LH     + A D G    KE     L+  + P+ + L  GA+VML KN++  
Sbjct  530   ANSTRMLQLHGSTFTFEARDGGTIQNKEMRDKLLQSCMVPELIHLKKGAQVMLVKNMD--  587

Query  1498  HKLVNGAAGTVIGF----------ESVNGTYET------------------FGTNWLPVV  1593
               LVNG+ G V GF          E   G  ET                        PVV
Sbjct  588   DTLVNGSLGKVTGFMTEQMFSIYKEDEEGFLETGPSEAALKTEMAKTSLGVTNNQVYPVV  647

Query  1594  KF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDL  1761
             +F   D   + L+ + E W I +   EV A R QIPLILAWALSIHK QG TL  +  DL
Sbjct  648   RFAIADGTTRDLLCKREDWKIELPNGEVQASRSQIPLILAWALSIHKAQGQTLERVRVDL  707

Query  1762  NRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              R F  G  YVALSR  S+ GL +  F+P  +  H KV  F   L +
Sbjct  708   GRVFEKGQAYVALSRATSMAGLQILRFDPRKVLAHEKVRLFYSSLST  754



>gb|KGQ08685.1| DNA repair and recombination protein pif1 [Beauveria bassiana 
D1-5]
Length=798

 Score =   300 bits (769),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 189/473 (40%), Positives = 264/473 (56%), Gaps = 53/473 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             +  + EQ  VLD  +  G+SVF TG AGTGK+ L++ II +L+  + R   RV VTASTG
Sbjct  313   IALSSEQRHVLDLVVEQGQSVFFTGPAGTGKSVLMRAIISELKSKYARESERVAVTASTG  372

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ KV  N + ++RW   + LIIDEIS++ G+L+
Sbjct  373   LAACNIGGITLHSFSGIGLGKEDASVLIKKVRRNPKAKNRWLKTKVLIIDEISMVDGDLF  432

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN--KNTQKFAFEASSWKLS  1140
             DKL  I R IR+  NG      WGGIQ+V +GDFFQLPP+ +  K   KFAF+A++W  S
Sbjct  433   DKLSQIGRTIRN--NG----RPWGGIQLVITGDFFQLPPVPDDSKRESKFAFDAATWTTS  486

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLA--VKLYPRN  1314
              D  I L  VFRQ DP+  ++L  +R G+   + +   +     L+ D      +L+P  
Sbjct  487   IDHTIGLNQVFRQRDPEFARMLNEMRLGKITDDTVRAFKALERPLKFDDGVDLAELFPLR  546

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNLN  1491
               V   N+K L  L   +  + A D GE + KE+L    +AP  ++L + A+VML KNL+
Sbjct  547   AQVEGSNEKRLRDLPGQIHRFEAADTGEPALKERLLANMMAPKSIDLKLNAQVMLIKNLD  606

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFG--------------------------------T  1575
             A   LVNG+ G VIGF S   T+E  G                                 
Sbjct  607   A--SLVNGSLGRVIGF-SDERTFEMGGGIPDDPTMDEAMNKARKKLSSFSRDSELISNSK  663

Query  1576  NWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLN  1743
                PVV+F      P+ ++ +PE W + +   +V A R Q+PLILAWALSIHK QG TL 
Sbjct  664   KQYPVVQFISASGVPRVILCQPEEWKVELPNGDVQAKRTQLPLILAWALSIHKAQGQTLE  723

Query  1744  CLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              +  +L + F  G  YVALSR  S +GL +  F+ + +  HPKV+ F  +L S
Sbjct  724   RVTVNLGKVFEKGQAYVALSRATSQDGLRVIGFDKHKVMAHPKVVEFYNKLYS  776



>ref|XP_007802685.1| hypothetical protein EPUS_00465 [Endocarpon pusillum Z07020]
 gb|ERF71476.1| hypothetical protein EPUS_00465 [Endocarpon pusillum Z07020]
Length=732

 Score =   299 bits (765),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 193/480 (40%), Positives = 268/480 (56%), Gaps = 68/480 (14%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  +L A+   GKS+F TGSAGTGK+ L++ II KLR  + +   R+ VTASTG++A  
Sbjct  219   EQKAILTAVVDEGKSIFFTGSAGTGKSVLMRSIINKLRNKYNKEPDRLAVTASTGLAAVN  278

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             ++G TLHSFAGIGLG+  A ELL K+    + R RW   + LIIDE+S+I G+L+DKLE 
Sbjct  279   IDGTTLHSFAGIGLGKEPATELLKKIRRTPKTRQRWIRTKVLIIDEVSMIDGDLFDKLEQ  338

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKN-TQKFAFEASSWKLSFDTQID  1158
             +AR IR+  NGS     +GGIQ+V +GDFFQLPP+  K+   KF+F+A++W    +  I 
Sbjct  339   VARIIRN--NGSP----FGGIQLVVTGDFFQLPPVPEKDRAAKFSFDAATWNTCIEHTIL  392

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRNDD  1320
             LT VFRQ D    ++L  +R G         F+ L+   N   NLE    A +L+P   +
Sbjct  393   LTHVFRQKDATFAEMLNQMRLGRLTPASIRAFQSLSRPLNFTDNLE----ATELFPTRAE  448

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNG--EDSWKEQ-LKLGIAPDFLELCVGARVMLTKNLN  1491
             V   N   +  L  + + Y A D+G  + + +E+ LK  +AP  L+L  GA+VML KN +
Sbjct  449   VDYANNNKMKMLSGETMTYTAEDSGVMDLAVRERILKYFMAPKELQLKKGAQVMLIKNFD  508

Query  1492  ARHKLVNGAAGTVIGF-----------------------------------ESVNGTYET  1566
                 LVNG+ G V+ F                                   E ++     
Sbjct  509   --QNLVNGSLGKVVRFSDLEMFAYSKEHAEEFDAAYRDGRSPDDAQFRKMREKIHAAVYK  566

Query  1567  FGTN----WLPVVKF---DFKPKKLIIRPETW-SIMDGEEVVAVRKQIPLILAWALSIHK  1722
              GT+      PVV F   D   +++I++PE W S +   E+ A R+QIPLILAWALSIHK
Sbjct  567   NGTSGRGKLFPVVCFQLSDGSFREIIVQPEEWKSELPNGEIQAKRQQIPLILAWALSIHK  626

Query  1723  CQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              QG TL  +  DL R F  G  YVALSR  + +GL ++ F+   + VHPKV+ F  +L S
Sbjct  627   AQGQTLERVKVDLGRVFEKGQAYVALSRATTQQGLQVTRFDAKKVMVHPKVVTFYDQLVS  686



>ref|XP_003712758.1| hypothetical protein MGG_05212 [Magnaporthe oryzae 70-15]
 gb|EHA52951.1| hypothetical protein MGG_05212 [Magnaporthe oryzae 70-15]
Length=864

 Score =   301 bits (772),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 194/480 (40%), Positives = 264/480 (55%), Gaps = 63/480 (13%)
 Frame = +1

Query  616   VKWTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             V  + EQ  V + + S  +SVF TG AGTGK+ L++ II +L++   +   R+ VTASTG
Sbjct  352   VTLSNEQRHVKNLVCSRSQSVFFTGPAGTGKSVLMRAIIDELKKKWKKDPDRLAVTASTG  411

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+     L+ K+  N + ++RW   + LIIDEIS++ G+L+
Sbjct  412   LAACNIGGMTLHSFSGIGLGKEDVTTLVKKIRRNPKAKNRWLRTKTLIIDEISMVDGDLF  471

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI---FNKNTQKFAFEASSWKL  1137
             DKL  I R IR+  NG      WGGIQ+V +GDFFQLPP+    +K   KFAFEA++W  
Sbjct  472   DKLSQIGRIIRN--NGKP----WGGIQLVITGDFFQLPPVPDGADKREIKFAFEAATWNT  525

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKG---EYDFEDLNLLENHC---SNLEPDPLAVK  1299
             S D  I LT VFRQ DP    +L  +R G   E    +   LE        LE      +
Sbjct  526   SIDHTIGLTEVFRQKDPAFANMLNEMRLGRISEQTVANFKSLERELRFDDGLE----VTE  581

Query  1300  LYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ-LKLGIAPDFLELCVGARVML  1476
             L+P   +V R N + L +L      Y A D+G+ +++++ L+  +AP  LEL  GA+VML
Sbjct  582   LFPTRTEVERSNTRRLQALKSKPYHYDAQDSGDPNFRDKLLQNMMAPQKLELRKGAQVML  641

Query  1477  TKNLNARHKLVNGAAGTVIGF-------------------------ESVNGTYETFG---  1572
              KN++    LVNG+ GTV+GF                         E V    + FG   
Sbjct  642   IKNMD--ETLVNGSLGTVVGFMSETAASLGGISSHGGLDGEEDSISEDVRKRIKAFGREL  699

Query  1573  ------TNWLPVVKF---DFKPKKLIIRPETW-SIMDGEEVVAVRKQIPLILAWALSIHK  1722
                       PVV F   D  P+ L++ PE W S +   EV A RKQ+PLILAWALSIHK
Sbjct  700   ESNSTDNKEYPVVTFHGADGTPRSLLMVPEEWKSELPTGEVQASRKQVPLILAWALSIHK  759

Query  1723  CQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              QG TL  +  DL + F  G  YVALSR  S EGL +  F+   +  HP+V+ F  +L S
Sbjct  760   AQGQTLERVKVDLGKIFEKGQAYVALSRATSQEGLQVLKFDKAKVMAHPRVVQFYNKLYS  819



>gb|ETS64711.1| hypothetical protein PaG_00662 [Pseudozyma aphidis DSM 70725]
Length=693

 Score =   298 bits (762),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 184/459 (40%), Positives = 254/459 (55%), Gaps = 47/459 (10%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ +VL   +  GK+VF TGSAGTGK+ L++ IIR+LR  H +S   V VTASTG++AC 
Sbjct  244   EQRKVLSMVVDEGKNVFFTGSAGTGKSVLLREIIRELRRKHSKSPDAVAVTASTGIAACN  303

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G T+HSFAGIGLG+    +L+ K+  NR+   RW   Q LIIDEIS++   L DKLE 
Sbjct  304   IGGVTIHSFAGIGLGKEPVAQLVSKIRKNRKATGRWSRTQVLIIDEISMVDPALLDKLEE  363

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDL  1161
             IAR +R       +   +GGIQ+V +GDFFQLPP+    +  FAF+A  W+     +++L
Sbjct  364   IARVLR------KKPKPFGGIQIVITGDFFQLPPVNPGGSVTFAFDAQCWEHVVQHKVNL  417

Query  1162  TTVFRQSDPQLVKLLQGIRKG---EYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRV  1332
             T VFRQ D   V +L  +R G   +   E    LE      + D +  +L+P  ++V   
Sbjct  418   TQVFRQKDSSFVTMLNEMRFGTLSQKTIEAFKRLE-RVPQYDGDIVPTELFPMRNEVDAA  476

Query  1333  NKKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHK  1503
             N + L++L  +   YRA D G    ++    L+  IA   L +  GA+VML KN++    
Sbjct  477   NAQRLNALQAESQTYRAQDGGSLQAEARDRVLQSSIALPVLSVKKGAQVMLIKNID--ET  534

Query  1504  LVNGAAGTVIGF---------------------ESVNGTYETFGTNWLPVVKFDFK---P  1611
             LVNG+ G V+ F                     E   GT    G  W P+V+F       
Sbjct  535   LVNGSIGKVVDFVDEMEHARLVGDLESHEQMTSEREKGT-RMPGRKW-PLVRFHVPGGGT  592

Query  1612  KKLIIRPETW--SIMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGM  1785
             +  +  PETW   + DG E+ A R Q+PLILAWA+SIHK QG TL C   +LNR F  G 
Sbjct  593   RDYLAMPETWKTELPDG-EIQASRTQVPLILAWAMSIHKSQGQTLPCCKINLNRVFEKGQ  651

Query  1786  VYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              YVALSR  S+EGL +  F  + +  HP+V+ + K L +
Sbjct  652   AYVALSRATSIEGLQVLGFQASKVMAHPRVIEWSKSLIA  690



>ref|XP_003010636.1| hypothetical protein ARB_03337 [Arthroderma benhamiae CBS 112371]
 gb|EFE29996.1| hypothetical protein ARB_03337 [Arthroderma benhamiae CBS 112371]
Length=780

 Score =   300 bits (767),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 202/503 (40%), Positives = 268/503 (53%), Gaps = 81/503 (16%)
 Frame = +1

Query  622   WTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSR--VYVTASTGVS  792
             ++ EQ+QV++ I   GKSVF TGSAGTGK+ L++ IIR+LR  + R    V VTASTG++
Sbjct  257   FSEEQNQVIETIVKKGKSVFYTGSAGTGKSVLMREIIRQLRLKYSRDSDAVAVTASTGLA  316

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             AC + G TLHSFAG+GLG+ + +EL+ KV  N + + RW   + LIIDEIS++ G+ +DK
Sbjct  317   ACNIEGVTLHSFAGVGLGKESTQELVKKVKRNLKAKTRWLKTKVLIIDEISMVDGDFFDK  376

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDT  1149
             LE +ARKIR+  NG      +GGIQ+V +GDFFQLPP+     + KFAF A +W  S   
Sbjct  377   LEELARKIRN--NGRP----FGGIQLVTTGDFFQLPPVPEGGKEAKFAFAAGTWNTSIQH  430

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAV-----  1296
              I LT VFRQ DP    +L  +R G         F+DL+       N+E   L V     
Sbjct  431   TILLTQVFRQRDPDFANMLNEMRLGRLSPSAIQAFKDLSRPLTCSDNIEATELYVIERTL  490

Query  1297  -----KL------YPRNDDVYRVNKKHLDSLHQDLIGYRAVDNG----EDSWKEQLKLGI  1431
                  KL      +P   +V R N + ++ L   ++ + A D+G    E    + L   +
Sbjct  491   FYICWKLIVTIYRFPTRAEVDRANSERMNRLSGSVMTFHAADSGAIKDEQFRAKLLSNCM  550

Query  1432  APDFLELCVGARVMLTKNLNARHKLVNGAAGTVIGF--------------ESVNGTY---  1560
             AP  + L  GA+VML KN +    LVNG+ GTVI F              +  NG Y   
Sbjct  551   APATIHLKKGAQVMLIKNKD--ETLVNGSLGTVIAFMDEAGFDNHIREGLKRENGYYAFD  608

Query  1561  -------------------ETFGTN---WLPVVKF---DFKPKKLIIRPETWSI-MDGEE  1662
                                 T   N     P+V F   D   ++L+  PE W I +   E
Sbjct  609   DEPSQAKQKIKSMAFDQKTNTGSVNTSRQYPLVAFILPDGSERQLLCMPEAWKIELPNGE  668

Query  1663  VVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSF  1842
             V A R Q+PLILAWALSIHK QG TL  +  DL R F  G  YVALSR  S +GL +S F
Sbjct  669   VQAQRLQVPLILAWALSIHKAQGQTLQRVKVDLGRVFERGQAYVALSRATSKDGLQVSRF  728

Query  1843  NPNIIKVHPKVLNFDKRLCSQPD  1911
             +P  + VHPKV  F + L S  D
Sbjct  729   DPKKVMVHPKVTEFYQNLSSISD  751



>gb|KFX51282.1| ATP-dependent DNA helicase PIF1 [Talaromyces marneffei PM1]
Length=836

 Score =   301 bits (770),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 188/478 (39%), Positives = 265/478 (55%), Gaps = 65/478 (14%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VLDA+    KS+F TGSAGTGK+ L++ II+KLR+ + +   RV VTASTG++AC 
Sbjct  329   EQKAVLDAVVDRQKSIFFTGSAGTGKSVLMREIIKKLRDKYRKEPDRVAVTASTGLAACH  388

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+  A EL+ KV  N++ R+RW   + LI+DE+S++ G+L+DKLE 
Sbjct  389   IEGVTLHSFAGIGLGKEPATELVKKVRKNQKARNRWMRTKVLIVDEVSMVDGDLFDKLEE  448

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+   + +  KFAF+A++W  S    I
Sbjct  449   IARRIRN--NGRP----FGGIQLVVTGDFFQLPPVPETSAREAKFAFDAATWNTSIQHTI  502

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE--PDPLAVKLYPRNDDVYR  1329
              LT VFRQ DP   ++L  +R G+   +     +     L+   D  A +L+P   +V  
Sbjct  503   LLTHVFRQKDPVFAEMLNQMRLGKITPQTTEAFKKLSRPLDFHDDLDATELFPTRAEVEN  562

Query  1330  VNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKNLNAR  1497
              N   +  L  +++ + A D+G   +   +E+L    +AP  + L  GA+VML KN+   
Sbjct  563   ANGLRMSRLSGEVMTFHAQDSGSIQDVQMRERLLANCMAPPVIHLKKGAQVMLIKNME--  620

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTN---------------------------------  1578
               LVNG+ G ++ F     T++ +  N                                 
Sbjct  621   DNLVNGSLGKIVAFMD-EATFDYYRNNEDEFTGDNKDGDDDDDAAARNRKKLRALAHKDG  679

Query  1579  -------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKC  1725
                    W P+V F   D   + L+ +PE W I +   E+ A R Q+PLILAWALSIHK 
Sbjct  680   GVTTSRRW-PLVCFTQQDGTERHLLCQPEIWKIELPNGEIQAQRSQVPLILAWALSIHKA  738

Query  1726  QGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLC  1899
             QG TL  +  DL R F  G  YVALSR  S  GL ++ F P  + VHPKV+ F  +L 
Sbjct  739   QGQTLPRVKVDLGRVFEKGQAYVALSRATSQAGLQVTGFEPRKVMVHPKVIEFYSKLT  796



>ref|XP_008595207.1| DNA repair and recombination protein pif1 [Beauveria bassiana 
ARSEF 2860]
 gb|EJP68853.1| DNA repair and recombination protein pif1 [Beauveria bassiana 
ARSEF 2860]
Length=798

 Score =   300 bits (768),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 187/472 (40%), Positives = 265/472 (56%), Gaps = 51/472 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             +  + EQ  VLD  +  G+SVF TG AGTGK+ L++ II +L+  + R   RV VTASTG
Sbjct  313   IALSSEQRHVLDLVVEQGQSVFFTGPAGTGKSVLMRAIISELKSKYARESERVAVTASTG  372

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ KV  N + ++RW   + LIIDEIS++ G+L+
Sbjct  373   LAACNIGGITLHSFSGIGLGKEDASVLIKKVRRNPKAKNRWLKTKVLIIDEISMVDGDLF  432

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN--KNTQKFAFEASSWKLS  1140
             DKL  I R IR+  NG      WGGIQ+V +GDFFQLPP+ +  K   KFAF+A++W  S
Sbjct  433   DKLSQIGRTIRN--NG----RPWGGIQLVITGDFFQLPPVPDDSKRESKFAFDAATWTTS  486

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLA--VKLYPRN  1314
              D  I L  VFRQ DP+  ++L  +R G+   + +   +     L+ D      +L+P  
Sbjct  487   IDHTIGLNQVFRQRDPEFARMLNEMRLGKITDDTVRAFKALERPLKFDDGVDLAELFPLR  546

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNLN  1491
               V   N+K L  L   +  + A D GE + KE+L    +AP  ++L + A+VML KNL+
Sbjct  547   AQVEGSNEKRLRDLPGQIHRFEAADTGEPALKERLLANMMAPKSIDLKLNAQVMLIKNLD  606

Query  1492  ARHKLVNGAAGTVIGF-------------------ESVNGTYETFGT------------N  1578
             A   LVNG+ G VIGF                   E++N   +   +             
Sbjct  607   A--SLVNGSLGRVIGFSDERTFEMGGGIPDDPTMDEAMNKARKKLSSFSRDSELISNSKK  664

Query  1579  WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
               PVV+F      P+ ++ +PE W + +   +V A R Q+PLILAWALSIHK QG TL  
Sbjct  665   QYPVVQFISASGVPRVILCQPEEWKVELPNGDVQAKRTQLPLILAWALSIHKAQGQTLER  724

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             +  +L + F  G  YVALSR  S +GL +  F+ + +  HPKV+ F  +L S
Sbjct  725   VTVNLGKVFEKGQAYVALSRATSQDGLRVIGFDKHKVMAHPKVVEFYNKLYS  776



>ref|XP_009086872.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent DNA helicase PIF1, 
partial [Serinus canaria]
Length=592

 Score =   295 bits (754),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 182/435 (42%), Positives = 248/435 (57%), Gaps = 27/435 (6%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             R   + + EQ  VL A+ +GKS+F TGSAGTGK+FL++ I+  L      +  Y TASTG
Sbjct  154   RPPARLSAEQEAVLGAVRSGKSIFFTGSAGTGKSFLLKRILGSLPP----NITYATASTG  209

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+AC + G TLH+FAGIG G+A  E+ + ++     VR  W   Q LIIDEIS++ G+ +
Sbjct  210   VAACHIGGTTLHAFAGIGSGKAPLEQCV-QLAERPGVRQHWLACQHLIIDEISMVDGKFF  268

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSF  1143
             DKLE +AR +R      DE   +GGIQ++  GDF QLPP+   N + KF F+A SW+   
Sbjct  269   DKLEAVARAVRKR----DEP--FGGIQLIICGDFLQLPPVCKANEETKFCFQAKSWRKCI  322

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRND  1317
                ++LT V RQ+D   V LL  IR G    E    L++      E D  LA +L    D
Sbjct  323   HINMELTEVRRQTDKTFVSLLSAIRLGRCTEEVTRQLMQTAAHKSERDGILATRLCTHKD  382

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLN  1491
             DV   N++ L  L  ++  + A+D+  D    +L     P    +EL +GA+VML KNL+
Sbjct  383   DVEITNERRLQQLPGEVHVFEALDS--DPMLVKLIDAQCPVGGRVELKLGAQVMLAKNLD  440

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVA  1671
                 LVNGA G V+GFES            LP V+F     +LI + E W I     V  
Sbjct  441   VSQGLVNGARGVVVGFESEQ--------KGLPKVRFLCGVTQLI-KMEKWVIKGPSGVHL  491

Query  1672  VRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPN  1851
              R+Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SL GL +  F+P 
Sbjct  492   SRQQLPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARSLAGLRVLDFDPK  551

Query  1852  IIKVHPKVLNFDKRL  1896
              +K  P VL F ++L
Sbjct  552   AVKADPAVLQFYRQL  566



>ref|XP_004914012.1| PREDICTED: ATP-dependent DNA helicase PIF1-like isoform X2 [Xenopus 
(Silurana) tropicalis]
Length=704

 Score =   298 bits (762),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 175/427 (41%), Positives = 248/427 (58%), Gaps = 23/427 (5%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVS  792
             +V+ + EQS VL+ + +G++VF TGSAGTGK++L++ I+  L         Y TASTGV+
Sbjct  273   QVQLSTEQSLVLNTVLSGRNVFFTGSAGTGKSYLLKRIVGALPP----KSTYATASTGVA  328

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             AC + G TLH+FAGIG G+A+ E+ + ++     VR  W   + LIIDEIS++ GE +DK
Sbjct  329   ACHIGGTTLHAFAGIGTGKASIEQCI-ELAKRPGVRQHWTGCKHLIIDEISMVEGEFFDK  387

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDT  1149
             LE +AR +R    G DE   +GGIQ++  GDF QLPP+   ++Q KF F+A SW+     
Sbjct  388   LEAVARAVR----GKDEP--FGGIQLIVCGDFLQLPPVTQASSQTKFCFQARSWRKCIHL  441

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGE-YDFEDLNLLENHCSNLEPDP-LAVKLYPRNDDV  1323
              ++LT V RQ+D   + LLQ IR G   D     LL+     +E D  LA +L    DDV
Sbjct  442   TMELTEVRRQTDKNFISLLQAIRLGRCTDDVSRKLLQTSSHKVERDGILATRLCTHKDDV  501

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHK  1503
                N++ L  L  +   Y A+D+     K           ++L  GA+VML KNL+    
Sbjct  502   EITNERRLQQLPGESHLYEALDSDPMLVKTINAQCPVNQQIQLKKGAQVMLAKNLDVSRG  561

Query  1504  LVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQ  1683
             LVNGA G V  FE         G   LPVV+F     + +I+P+ W       +   R+Q
Sbjct  562   LVNGARGVVTKFEE--------GNKNLPVVRFLCGVTE-VIKPDRWVFKGHGGIYLSRQQ  612

Query  1684  IPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKV  1863
             +PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR ++LEGL +  F+P +++ 
Sbjct  613   LPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARNLEGLRVMDFDPKVVRA  672

Query  1864  HPKVLNF  1884
             +P VL F
Sbjct  673   NPYVLQF  679



>gb|EZF27942.1| hypothetical protein H100_00186 [Trichophyton rubrum MR850]
 gb|EZF46948.1| hypothetical protein H102_00185 [Trichophyton rubrum CBS 100081]
 gb|EZF57573.1| hypothetical protein H103_00187 [Trichophyton rubrum CBS 288.86]
 gb|EZF68226.1| hypothetical protein H104_00186 [Trichophyton rubrum CBS 289.86]
 gb|EZF89511.1| hypothetical protein H110_00186 [Trichophyton rubrum MR1448]
 gb|EZG00326.1| hypothetical protein H113_00187 [Trichophyton rubrum MR1459]
 gb|EZG21947.1| hypothetical protein H107_00189 [Trichophyton rubrum CBS 202.88]
 gb|KDB38672.1| hypothetical protein H112_00186 [Trichophyton rubrum D6]
 gb|EGD92287.2| hypothetical protein TERG_08504 [Trichophyton rubrum CBS 118892]
Length=780

 Score =   299 bits (766),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 202/503 (40%), Positives = 270/503 (54%), Gaps = 81/503 (16%)
 Frame = +1

Query  622   WTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSR--VYVTASTGVS  792
             ++ EQ+QV++ I   GKSVF TGSAGTGK+ L++ IIR+LR  + R    V VTASTG++
Sbjct  257   FSEEQNQVIETIVKEGKSVFYTGSAGTGKSVLMREIIRQLRLKYSRDSDAVAVTASTGLA  316

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             AC + G TLHSFAG+GLG+ + +EL+ KV  N + ++RW   + LIIDEIS++ G+ +DK
Sbjct  317   ACNIEGVTLHSFAGVGLGKESTQELVKKVKRNLKAKNRWLKTKVLIIDEISMVDGDFFDK  376

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDT  1149
             LE +ARKIR+  NG      +GGIQ+V +GDFFQLPP+     + KFAF A +W  S   
Sbjct  377   LEELARKIRN--NGRP----FGGIQLVTTGDFFQLPPVPEGGKEAKFAFAAGTWNTSIQH  430

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAV-----  1296
              I LT VFRQ DP    +L  +R G         F+DL+       N+E   L V     
Sbjct  431   TILLTQVFRQRDPDFANMLNEMRLGRLSPSAIQAFKDLSRPLICGDNIEATELYVIERAL  490

Query  1297  -----KL------YPRNDDVYRVNKKHLDSLHQDLIGYRAVDNG----EDSWKEQLKLGI  1431
                  KL      +P   +V R N + ++ L   ++ + A D+G    E    + L   +
Sbjct  491   VYICWKLIVTLCRFPTRAEVDRANSERMNRLSGSVMTFHAADSGAIKDEQFRAKLLSNCM  550

Query  1432  APDFLELCVGARVMLTKNLNARHKLVNGAAGTVIGF--------------ESVNGTYE--  1563
             AP  + L  GA+VML KN +    LVNG+ GTVI F              +  NG Y+  
Sbjct  551   APATIHLKKGAQVMLIKNKD--ETLVNGSLGTVIAFMDEAGFDNHIREGLKRENGYYDFN  608

Query  1564  --------------------TFGTN---WLPVVKF---DFKPKKLIIRPETWSI-MDGEE  1662
                                 T   N     P+V F   D   ++L+  PE W I +   E
Sbjct  609   DEPSQAKEKIKSMAFDQKANTGSVNTSRQYPLVAFILPDGSERQLLCMPEAWKIELPNGE  668

Query  1663  VVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSF  1842
             V A R Q+PLILAWALSIHK QG TL  +  DL R F  G  YVALSR  S +GL +S F
Sbjct  669   VQAQRLQVPLILAWALSIHKAQGQTLQRVKVDLGRVFERGQAYVALSRATSKDGLQVSRF  728

Query  1843  NPNIIKVHPKVLNFDKRLCSQPD  1911
             +P  + VHPKV  F + L S  D
Sbjct  729   DPKKVMVHPKVTEFYQNLSSISD  751



>gb|EZF78843.1| hypothetical protein H105_00178 [Trichophyton soudanense CBS 
452.61]
 gb|EZG11226.1| hypothetical protein H106_00079 [Trichophyton rubrum CBS 735.88]
Length=780

 Score =   299 bits (766),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 202/503 (40%), Positives = 270/503 (54%), Gaps = 81/503 (16%)
 Frame = +1

Query  622   WTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSR--VYVTASTGVS  792
             ++ EQ+QV++ I   GKSVF TGSAGTGK+ L++ IIR+LR  + R    V VTASTG++
Sbjct  257   FSEEQNQVIETIVKKGKSVFYTGSAGTGKSVLMREIIRQLRLKYSRDSDAVAVTASTGLA  316

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             AC + G TLHSFAG+GLG+ + +EL+ KV  N + ++RW   + LIIDEIS++ G+ +DK
Sbjct  317   ACNIEGVTLHSFAGVGLGKESTQELVKKVKRNLKAKNRWLKTKVLIIDEISMVDGDFFDK  376

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDT  1149
             LE +ARKIR+  NG      +GGIQ+V +GDFFQLPP+     + KFAF A +W  S   
Sbjct  377   LEELARKIRN--NGRP----FGGIQLVTTGDFFQLPPVPEGGKEAKFAFAAGTWNTSIQH  430

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAV-----  1296
              I LT VFRQ DP    +L  +R G         F+DL+       N+E   L V     
Sbjct  431   TILLTQVFRQRDPDFANMLNEMRLGRLSPSAIQAFKDLSRPLICGDNIEATELYVIERAL  490

Query  1297  -----KL------YPRNDDVYRVNKKHLDSLHQDLIGYRAVDNG----EDSWKEQLKLGI  1431
                  KL      +P   +V R N + ++ L   ++ + A D+G    E    + L   +
Sbjct  491   VYICWKLIVTLCRFPTRAEVDRANSERMNRLSGSVMTFHAADSGAIKDEQFRAKLLSNCM  550

Query  1432  APDFLELCVGARVMLTKNLNARHKLVNGAAGTVIGF--------------ESVNGTYE--  1563
             AP  + L  GA+VML KN +    LVNG+ GTVI F              +  NG Y+  
Sbjct  551   APATIHLKKGAQVMLIKNKD--ETLVNGSLGTVIAFMDEAGFDNHIREGLKRENGYYDFN  608

Query  1564  --------------------TFGTN---WLPVVKF---DFKPKKLIIRPETWSI-MDGEE  1662
                                 T   N     P+V F   D   ++L+  PE W I +   E
Sbjct  609   DEPSQAKEKIKSMAFDQKANTGSVNTSRQYPLVAFILPDGSERQLLCMPEAWKIELPNGE  668

Query  1663  VVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSF  1842
             V A R Q+PLILAWALSIHK QG TL  +  DL R F  G  YVALSR  S +GL +S F
Sbjct  669   VQAQRLQVPLILAWALSIHKAQGQTLQRVKVDLGRVFERGQAYVALSRATSKDGLQVSRF  728

Query  1843  NPNIIKVHPKVLNFDKRLCSQPD  1911
             +P  + VHPKV  F + L S  D
Sbjct  729   DPKKVMVHPKVTEFYQNLSSISD  751



>ref|XP_010714634.1| PREDICTED: ATP-dependent DNA helicase PIF1, partial [Meleagris 
gallopavo]
Length=488

 Score =   291 bits (745),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 177/435 (41%), Positives = 248/435 (57%), Gaps = 27/435 (6%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             R   + +VEQ  VL A+ +GKS+F TG AGTGK+FL++ I+  L      +  Y TASTG
Sbjct  50    RPPARLSVEQEAVLGAVRSGKSIFFTGCAGTGKSFLLKKIVGSLPP----NSTYATASTG  105

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+AC + G TLH+FAGIG G+A  E+ + ++     VR  W   Q LIIDEIS++ G+ +
Sbjct  106   VAACHIGGTTLHAFAGIGSGKAPLEQCI-QLAERPGVRQHWLACQRLIIDEISMVDGKFF  164

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQK-FAFEASSWKLSF  1143
             DKLE +AR +R      DE   +GGIQ++  GDF QLPP+   N +  F F+A SW+   
Sbjct  165   DKLEAVARAVRKR----DEP--FGGIQLIICGDFLQLPPVCKANEETTFCFQAKSWRKCI  218

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL-EPDP-LAVKLYPRND  1317
                ++LT V RQ+D   + LL  +R G    E ++LL    +N  E D  LA +L    D
Sbjct  219   HVNMELTEVRRQTDKTFISLLSAVRLGRCTEEVISLLMQTATNRSERDGILATRLCTHKD  278

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLN  1491
             DV   N++ L  L  D   + A+D+  D    +L     P    +EL VGA+VML KNL+
Sbjct  279   DVELTNERRLRQLSGDSHTFEALDS--DPMLVKLIDAQCPVGGRVELKVGAQVMLAKNLD  336

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVA  1671
                 LVNGA G V+GFE+            LP V+F     + +I+ E W       +  
Sbjct  337   VSQGLVNGARGVVVGFETEQ--------KGLPKVRFLCGVTR-VIKLERWLFKGPSGIHL  387

Query  1672  VRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPN  1851
              R+Q+PL LAWA+SIHK QGM+L+ +   L+R F  G  YVALSR +SL GL +  F+P 
Sbjct  388   SRQQLPLTLAWAISIHKSQGMSLDSVEISLSRVFESGQAYVALSRARSLTGLRVLDFDPK  447

Query  1852  IIKVHPKVLNFDKRL  1896
             +++  P VL F ++L
Sbjct  448   VVRADPTVLQFYRQL  462



>dbj|GAK64353.1| mitochondrial DNA helicase [Pseudozyma antarctica]
Length=793

 Score =   300 bits (767),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 180/457 (39%), Positives = 256/457 (56%), Gaps = 43/457 (9%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ +VL   +  GK+VF TGSAGTGK+ L++ IIR+LR  H +S   V VTASTG++AC 
Sbjct  344   EQRKVLSMVVDEGKNVFFTGSAGTGKSVLLREIIRELRRKHSKSPDAVAVTASTGIAACN  403

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G T+HSFAGIGLG+    +L+ K+  NR+   RW   Q LIIDEIS++   L DKLE 
Sbjct  404   IGGVTIHSFAGIGLGKEPVAQLVSKIRKNRKATGRWSRTQVLIIDEISMVDPALLDKLEE  463

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDL  1161
             IAR +R       +   +GGIQ+V +GDFFQLPP+    +  FAF+A  W+     +++L
Sbjct  464   IARVLR------KKPKPFGGIQIVITGDFFQLPPVNPGGSVTFAFDAQCWEHVVQHKVNL  517

Query  1162  TTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE--NHCSNLEPDPLAVKLYPRNDDVYRVN  1335
             T VFRQ D   V +L  +R G+   + +   +        + D +  +L+P  ++V   N
Sbjct  518   TQVFRQKDSSFVTMLNEMRFGKLSQKTIEAFKKLERVPQYDGDIVPTELFPMRNEVDAAN  577

Query  1336  KKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKL  1506
              + L++L  +   YRA D G    ++ +  L+  IA   L +  GA+VML KN++    L
Sbjct  578   AQRLNALQAESQTYRAQDGGSLQAEARERVLQNSIALPVLHVKKGAQVMLIKNID--ETL  635

Query  1507  VNGAAGTVIGF----------------ESVNGTYETF----GTNWLPVVKFDFK---PKK  1617
             VNG+ G V+ F                + +N   E      G  W P+V+F       + 
Sbjct  636   VNGSIGKVVDFVDEMEHARLAGDLESHDQMNAEREKMTRMPGRKW-PLVRFHVPGGGTRD  694

Query  1618  LIIRPETW--SIMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVY  1791
              +  PETW   + DG E+ A R Q+PLILAWA+SIHK QG TL C   +LNR F  G  Y
Sbjct  695   YLAMPETWKTELPDG-EIQASRSQVPLILAWAMSIHKSQGQTLPCCKINLNRVFEKGQAY  753

Query  1792  VALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             VALSR  S+EGL +  F  + +  HP+V+ + K L +
Sbjct  754   VALSRATSIEGLQVLGFQASKVMAHPRVIEWSKSLIA  790



>ref|XP_005521110.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Pseudopodoces 
humilis]
Length=606

 Score =   295 bits (754),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 181/435 (42%), Positives = 249/435 (57%), Gaps = 27/435 (6%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             R   + + EQ  VL A+ +GKSVF TGSAGTGK+FL++ I+  L      +  Y TASTG
Sbjct  168   RPPARLSAEQEAVLRAVRSGKSVFFTGSAGTGKSFLLKRIVGSLPP----NITYATASTG  223

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+AC + G TLH+FAGIG G+A  E+ + ++     VR  W   Q LIIDEIS++ G+ +
Sbjct  224   VAACHIGGTTLHAFAGIGSGKAPLEQCI-QLAERPGVRQHWLACQHLIIDEISMVDGKFF  282

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSF  1143
             D+LE +AR +R      DE   +GGIQ++  GDF QLPP+   N + KF F+A SW+   
Sbjct  283   DRLEAVARAVRKR----DEP--FGGIQLIICGDFLQLPPVCKANEETKFCFQAKSWRKCI  336

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRND  1317
                ++LT V RQ+D   V LL  IR G    E    L++      E D  LA +L    D
Sbjct  337   HINMELTEVRRQTDKTFVSLLSAIRLGRCTEEVTRQLMQTAAHRSERDGILATRLCTHKD  396

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLN  1491
             DV   N++ L  L  ++  + A+D+  D    +L     P    +EL +GA+VML KNL+
Sbjct  397   DVEITNERRLQELPGEVHVFEALDS--DPMLVKLIDAQCPVGGRVELKLGAQVMLAKNLD  454

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVA  1671
                 LVNGA G V+GFES            LP V+F     +LI + E W I     V  
Sbjct  455   VSQGLVNGARGVVVGFESEQ--------KRLPKVRFLCGVTQLI-KMEKWIIKGPSGVHL  505

Query  1672  VRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPN  1851
              R+Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SL GL +  F+P 
Sbjct  506   SRQQLPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARSLAGLRVLDFDPK  565

Query  1852  IIKVHPKVLNFDKRL  1896
             +++  P VL F ++L
Sbjct  566   VVRADPAVLQFYRQL  580



>ref|XP_001940398.1| DNA repair and recombination protein pif1, mitochondrial precursor 
[Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU43117.1| DNA repair and recombination protein pif1, mitochondrial precursor 
[Pyrenophora tritici-repentis Pt-1C-BFP]
Length=788

 Score =   299 bits (766),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 191/467 (41%), Positives = 257/467 (55%), Gaps = 51/467 (11%)
 Frame = +1

Query  631   EQSQVLDAISA-GKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VL+ ++   KSVF TGSAGTGK+ L++ II  LR  + R   RV VTASTG++AC 
Sbjct  302   EQQNVLNLVTEYKKSVFFTGSAGTGKSVLLREIIAALRRKYVREPDRVAVTASTGLAACN  361

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSF+GIGLG+  AE+L+ K+  N++ + RW   + LI+DE+S++ G+L+DKLE 
Sbjct  362   IGGVTLHSFSGIGLGKEPAEDLVKKIRRNQKAKQRWMRTKVLIMDEVSMVDGDLFDKLEQ  421

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQID  1158
             IAR IR+  NG      +GGIQ+V +GDFFQLPP+ +   Q KFAF+A +W  S +  I 
Sbjct  422   IARTIRN--NGRP----FGGIQLVITGDFFQLPPVPDHGRQAKFAFDAGTWTTSIEHTIG  475

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDL---NLLENHCSNLEPDPLAVKLYPRNDDVYR  1329
             L  VFRQ DP    +L  +R+G    E +     LE      +    A +L+P   +V R
Sbjct  476   LHHVFRQKDPVFAGMLNEMREGRLTPESIARFKKLERPLPTTDESVEATELFPTRQEVDR  535

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQ----LKLGIAPDFLELCVGARVMLTKNLNAR  1497
              N   +  LH +   + A D G    KE     L+  + P+ + L  GA+VML KN++  
Sbjct  536   ANSSRMLQLHGNTFTFDARDGGTIQNKEMRDKLLQNCMVPEQIHLKKGAQVMLVKNMD--  593

Query  1498  HKLVNGAAGTVIGF--ESVNGTYE-----------------------TFGTNW---LPVV  1593
               LVNG+ G V GF  E +   Y+                       T G N     PVV
Sbjct  594   DTLVNGSLGKVTGFMTEQMFNIYKDDEEAFLEAGPSEAALKVEMGKATLGINTNQVYPVV  653

Query  1594  KF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDL  1761
             +F   D   + L+ + E W I +   EV A R QIPLILAWALSIHK QG TL  +  DL
Sbjct  654   RFAIADGTTRDLLCKREDWKIELPNGEVQASRSQIPLILAWALSIHKAQGQTLERVRVDL  713

Query  1762  NRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              R F  G  YVALSR  S+ GL +  F+P  +  H KV  F   L +
Sbjct  714   GRVFEKGQAYVALSRATSMAGLQILRFDPRKVLAHEKVRLFYSSLST  760



>ref|XP_001738818.1| hypothetical protein [Entamoeba dispar SAW760]
 gb|EDR24881.1| hypothetical protein, conserved [Entamoeba dispar SAW760]
Length=862

 Score =   301 bits (770),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 178/420 (42%), Positives = 246/420 (59%), Gaps = 20/420 (5%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             +Q  VL A   GKS F TG+AG GK++++  I+ KL+  H +  VYVTASTG++AC +NG
Sbjct  83    DQELVLKAALEGKSFFFTGAAGCGKSYVLSAIVEKLK--HDK-EVYVTASTGIAACNVNG  139

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              T+HSF+GIG GE ++ EL  KV  +++   +W  V+ LIIDEIS+I G+L+DKLEF+AR
Sbjct  140   MTIHSFSGIGKGEGSSSELWDKVKQDKKALKKWNKVEVLIIDEISMIDGDLFDKLEFVAR  199

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDLTTV  1170
             K R++       + +GGIQ++  GDF QLPPI    T KFAFE++ W         LTTV
Sbjct  200   KARNN------NLAFGGIQMIICGDFCQLPPISRNGTTKFAFESNCWNRVIPYCYYLTTV  253

Query  1171  FRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRVNKKHLD  1350
              RQ+D + + LL GIR GE   E +N L+  C + E       L     +V  VN K L 
Sbjct  254   HRQNDQKFITLLNGIRIGEISDEMVNCLKG-CCDKECKQQCTHLLSYIKEVDDVNTKELQ  312

Query  1351  SLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAGTV  1530
              L  + + Y +VD G   +   +K+    D L L  GA VM+ KN++    LVNG+ G V
Sbjct  313   KLQGNEVVYHSVDTGNSIYLTSMKI---TDELHLKAGAFVMINKNIDVERGLVNGSVGIV  369

Query  1531  IGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLILAWAL  1710
             IGF+  +     F    +P+V+     + L I   +W I  G ++VA R QIPL LAWA+
Sbjct  370   IGFDKTS----LFSGQPVPIVQ--LSNRTLPISECSWDIELGNQLVAKRSQIPLQLAWAI  423

Query  1711  SIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLS-SFNPNIIKVHPKVLNFD  1887
             SIHK QGMTL      ++  F  G  YVALSR+KSL+GL++  +     IK + K   FD
Sbjct  424   SIHKSQGMTLERAVIRIDNVFETGQAYVALSRLKSLDGLYIEGTVIKERIKCNEKAKEFD  483



>ref|XP_004914011.1| PREDICTED: ATP-dependent DNA helicase PIF1-like isoform X1 [Xenopus 
(Silurana) tropicalis]
Length=706

 Score =   297 bits (761),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 175/427 (41%), Positives = 248/427 (58%), Gaps = 23/427 (5%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVS  792
             +V+ + EQS VL+ + +G++VF TGSAGTGK++L++ I+  L         Y TASTGV+
Sbjct  273   QVQLSTEQSLVLNTVLSGRNVFFTGSAGTGKSYLLKRIVGALPP----KSTYATASTGVA  328

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             AC + G TLH+FAGIG G+A+ E+ + ++     VR  W   + LIIDEIS++ GE +DK
Sbjct  329   ACHIGGTTLHAFAGIGTGKASIEQCI-ELAKRPGVRQHWTGCKHLIIDEISMVEGEFFDK  387

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDT  1149
             LE +AR +R    G DE   +GGIQ++  GDF QLPP+   ++Q KF F+A SW+     
Sbjct  388   LEAVARAVR----GKDEP--FGGIQLIVCGDFLQLPPVTQASSQTKFCFQARSWRKCIHL  441

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGE-YDFEDLNLLENHCSNLEPDP-LAVKLYPRNDDV  1323
              ++LT V RQ+D   + LLQ IR G   D     LL+     +E D  LA +L    DDV
Sbjct  442   TMELTEVRRQTDKNFISLLQAIRLGRCTDDVSRKLLQTSSHKVERDGILATRLCTHKDDV  501

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHK  1503
                N++ L  L  +   Y A+D+     K           ++L  GA+VML KNL+    
Sbjct  502   EITNERRLQQLPGESHLYEALDSDPMLVKTINAQCPVNQQIQLKKGAQVMLAKNLDVSRG  561

Query  1504  LVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQ  1683
             LVNGA G V  FE         G   LPVV+F     + +I+P+ W       +   R+Q
Sbjct  562   LVNGARGVVTKFEE--------GNKNLPVVRFLCGVTE-VIKPDRWVFKGHGGIYLSRQQ  612

Query  1684  IPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKV  1863
             +PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR ++LEGL +  F+P +++ 
Sbjct  613   LPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARNLEGLRVMDFDPKVVRA  672

Query  1864  HPKVLNF  1884
             +P VL F
Sbjct  673   NPYVLQF  679



>ref|XP_007808889.1| mitochondrial DNA helicase (Pif1), putative [Metarhizium acridum 
CQMa 102]
 gb|EFY91386.1| mitochondrial DNA helicase (Pif1), putative [Metarhizium acridum 
CQMa 102]
Length=915

 Score =   301 bits (772),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 186/470 (40%), Positives = 264/470 (56%), Gaps = 52/470 (11%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSACA  801
             EQ+ V+D  ++  +SVF TG AG GK+ L++ II +L++ + R   RV VTASTG++AC 
Sbjct  407   EQAHVVDMVVNQNQSVFFTGPAGAGKSVLMRAIISELKKKYARDPERVAVTASTGLAACN  466

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+     L+ K+  N + ++RW   + LIIDEIS++ G+L+DKL  
Sbjct  467   IGGITLHSFAGIGLGKEEPSALVRKIRRNPKAKNRWLRTKCLIIDEISMVDGDLFDKLSQ  526

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI--FNKNTQKFAFEASSWKLSFDTQI  1155
             + R IR+  NG      WGGIQ+V +GDFFQLPP+   +K   KFAF+A++W  S D  I
Sbjct  527   VGRTIRN--NGRP----WGGIQLVITGDFFQLPPVPDADKRESKFAFDAATWSTSIDHTI  580

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRNDDVYR  1329
              LT VFRQ DP+  ++L  +R G+     +   +     L  E      +LYP    V  
Sbjct  581   GLTQVFRQRDPEFARMLNEMRIGKISDHTVQAFKALSRPLKFEDGVDLAELYPTRAQVEG  640

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNLNARHKL  1506
              N+K L  L   +  Y A+D+G+ + +++L +  +AP  +EL +GA+VML KNL+    L
Sbjct  641   SNEKRLRELPGKIHRYEALDSGDPTIRDKLLVNMMAPKAIELKIGAQVMLIKNLD--ESL  698

Query  1507  VNGAAGTVIGFESVNGTYETFGTN-------------------------------WLPVV  1593
             VNG+ G VI F S   T+E  G N                                 PVV
Sbjct  699   VNGSLGKVIAF-SDEKTFEMGGNNAYDEIVGDPMAKARRKLQAFSRDSGSDSSSQQYPVV  757

Query  1594  KFDFK---PKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDL  1761
             +F      P+ ++ +PE W++ +   E+ A R Q+PLILAWALSIHK QG TL  +  +L
Sbjct  758   QFISTGGVPRVILCQPEEWTVELPNGEIQAKRNQLPLILAWALSIHKAQGQTLERVTVNL  817

Query  1762  NRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD  1911
              + F  G  YVALSR  S  GL +  F  + +  HPKV+ F  +L S  D
Sbjct  818   GKVFEKGQAYVALSRATSQHGLRVLGFERSKVMAHPKVVEFYNKLSSVDD  867



>ref|XP_001732078.1| hypothetical protein MGL_0671 [Malassezia globosa CBS 7966]
 gb|EDP44864.1| hypothetical protein MGL_0671 [Malassezia globosa CBS 7966]
Length=546

 Score =   293 bits (749),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 180/475 (38%), Positives = 255/475 (54%), Gaps = 61/475 (13%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTAST  783
             RV  + EQ  VL+A+    KSVF TGSAG GK++L++ II+ L   + +S   V +TAST
Sbjct  81    RVFLSREQQSVLEAVVKQEKSVFFTGSAGAGKSYLLRQIIQDLHVKYSKSPGAVAITAST  140

Query  784   GVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGEL  963
             G++AC + G TLHSF+G+G+G  T ++L+  V  NR    RWK    L+IDE+S+I  +L
Sbjct  141   GIAACNIGGITLHSFSGVGVGTGTPDQLVRTVRRNRPTVTRWKKTAVLVIDEVSMIDPKL  200

Query  964   YDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSF  1143
             ++KL+ +AR IR S         +GGIQVV SGDFFQLPP+       F FE+  W    
Sbjct  201   FEKLDHVARVIRQS------NRPFGGIQVVMSGDFFQLPPVSPNGQTSFVFESPVWSSVI  254

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDP------LAVKLY  1305
               + +LT VFRQ D   V +L  +R G+   E + +     S LE  P         +LY
Sbjct  255   QQKFNLTEVFRQRDQTFVNMLNDMRYGKLAPETIRIF----SQLERTPSLPEGITPTELY  310

Query  1306  PRNDDVYRVNKKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVML  1476
                 DV + N+  LD+L  D+  Y ++D+G+   D  +  L   +AP  + L  GA+VML
Sbjct  311   ALRRDVEKANQMRLDALQTDMRTYTSMDSGQLPPDQLQRTLDNFMAPRHMALKKGAQVML  370

Query  1477  TKNLNARHKLVNGAAGTVIGF-----------------------ESVNGTYETF------  1569
              KN++   +L NG+ GTV+ F                       E   G   T       
Sbjct  371   IKNVD--RELSNGSVGTVLDFLDEDSFKDQYGEEDVSDELLARAERAPGASRTMQQERTE  428

Query  1570  ---GTNWLPVVKFDF---KPKKLIIRPETWSIMDGE-EVVAVRKQIPLILAWALSIHKCQ  1728
                   W P+++F       +  + RPE+W + D   +VVA R Q+P+ILAWA+SIHK Q
Sbjct  429   ARAAPRW-PLIRFHLVNGHVRDYLARPESWKMEDPNGKVVASRTQVPVILAWAMSIHKSQ  487

Query  1729  GMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKR  1893
             G TL     DL R F  G  YVALSR  SL+GL +  F+P+ +  HPKV+ ++ R
Sbjct  488   GQTLQHCRIDLRRVFEKGQAYVALSRATSLDGLQVIGFHPSKVMAHPKVIQWNCR  542



>ref|XP_007913123.1| putative dna repair and recombination protein pif1 protein [Togninia 
minima UCRPA7]
 gb|EOO02136.1| putative dna repair and recombination protein pif1 protein [Togninia 
minima UCRPA7]
Length=841

 Score =   300 bits (768),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 189/484 (39%), Positives = 267/484 (55%), Gaps = 63/484 (13%)
 Frame = +1

Query  667   KSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSACALNGYTLHSFAGIG  840
             KSVF TG AGTGK+ L++ II+ L++   R   R+ VTASTG++AC + G TLHSF+GIG
Sbjct  340   KSVFFTGPAGTGKSVLMRAIIQDLKKKWARDPERLAVTASTGLAACNIGGMTLHSFSGIG  399

Query  841   LGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIRSSINGSD  1020
             LG+   + L+ K+  N + ++RW   + LIIDEIS++ G+L+DKL  I R IR+  NG  
Sbjct  400   LGKEDVQTLVKKIRRNPKAKNRWLRAKTLIIDEISMVDGDLFDKLSQIGRIIRN--NGRP  457

Query  1021  EEMVWGGIQVVASGDFFQLPPIFN---KNTQKFAFEASSWKLSFDTQIDLTTVFRQSDPQ  1191
                 WGGIQ+V +GDFFQLPP+ +   K   KFAFEA++W  S D  I LT VFRQ DP 
Sbjct  458   ----WGGIQLVITGDFFQLPPVPDGDKKREVKFAFEAATWNTSIDHTIGLTEVFRQKDPV  513

Query  1192  LVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRNDDVYRVNKKHLDSLHQD  1365
               ++L  +R G+   + +   +     L  + D    +L+P  ++V   N+K L +L   
Sbjct  514   FAQMLNEMRLGQISQDTVKAFQGLSRPLRFDDDLEVTELFPTRNEVENSNEKRLKALPGK  573

Query  1366  LIGYRAVDNGEDSWKEQ-LKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAGTVIGFE  1542
                Y A D G+ + +E+ L+  +AP  LEL  GA+VML KN++    LVNG+ G VIGF 
Sbjct  574   SYRYDAHDTGDPAIREKLLQNMMAPKTLELKKGAQVMLIKNMD--ETLVNGSLGKVIGFM  631

Query  1543  S------VNGTYETFGTN--------------------------------WLPVVKF---  1599
             +        G ++ FG +                                  P+V+F   
Sbjct  632   TESHFNITGGGFDAFGADDEGMDTGMDPKVKKRLAMFSRELDSSAGPDRKEYPLVQFHAV  691

Query  1600  DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFG  1776
             D  P+ L+   E W + +   EV A R+Q+PLILAWALSIHK QG TL  +  DL + F 
Sbjct  692   DGTPRILLCVSEPWKVELPTGEVQASREQLPLILAWALSIHKAQGQTLERVKVDLGKVFE  751

Query  1777  YGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKEDAVTKKKQGGS  1956
              G  YVALSR  +  GL +  F  + +  HP+V+ F ++L S      E A+ KKK   +
Sbjct  752   KGQAYVALSRATTQAGLQVLRFEKHKVMAHPRVVQFYQKLYS-----AESAIGKKKPAQT  806

Query  1957  STCN  1968
             S  N
Sbjct  807   SIAN  810



>ref|XP_003348845.1| hypothetical protein SMAC_01868 [Sordaria macrospora k-hell]
 emb|CCC08320.1| unnamed protein product [Sordaria macrospora k-hell]
Length=932

 Score =   301 bits (772),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 190/476 (40%), Positives = 270/476 (57%), Gaps = 65/476 (14%)
 Frame = +1

Query  655   ISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACALNGYTLHSF  828
             +  G+SVF TG AGTGK+ L++ II +L++   R   RV VTASTG++AC + G TLHSF
Sbjct  431   VEKGQSVFFTGPAGTGKSVLMRAIISELKKKFAREPERVAVTASTGLAACNIGGMTLHSF  490

Query  829   AGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIRSSI  1008
             AGIGLG+   + L+ K+  N + ++RW   + LIIDEIS++ G+L+DKL  I R IR+  
Sbjct  491   AGIGLGKEDVQTLVKKIRRNPKAKNRWLKTKVLIIDEISMVDGDLFDKLSQIGRTIRN--  548

Query  1009  NGSDEEMVWGGIQVVASGDFFQLPPIFNK--NTQ---KFAFEASSWKLSFDTQIDLTTVF  1173
             NG      WGGIQ+V +GDFFQLPP+ +K  N Q   KFAF+A++W +S D  I LT VF
Sbjct  549   NGRP----WGGIQLVITGDFFQLPPVPDKDLNKQRDVKFAFDATTWNMSIDHTIGLTEVF  604

Query  1174  RQSDPQLVKLLQGIR---KGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDDVYRVNKKH  1344
             RQ DP+++  ++  R   K   +F+ L+   +    LE      +L+P   +V   N++ 
Sbjct  605   RQRDPEMLNEMRLGRISDKTVKNFQQLSRPLSFSDGLE----VTELFPTRTEVENSNRQR  660

Query  1345  LDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNLNARHKLVNGAA  1521
             L +L   +  Y A D GE + +E+L    +AP  +EL   A+VML KN++    LVNG+ 
Sbjct  661   LAALKGKVYRYEAYDTGEPAVREKLLANMMAPPVIELKKDAQVMLIKNMD--ETLVNGSL  718

Query  1522  GTVIGFESVNGTYE-------------------------------TFGTNW-LPVVKF--  1599
             GTV+GF +   T+E                                 G N   P+V+F  
Sbjct  719   GTVVGFMN-EATFELKANSDFDDDEDIDKKRRIRAFTSALSTAAIEKGDNTEYPLVRFHA  777

Query  1600  -DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAF  1773
              D   + ++ +PE W + +   EV A RKQ+PLILAWALSIHK QG TL  +  DL R F
Sbjct  778   VDGTRRDILCQPEDWKVELPTGEVQASRKQLPLILAWALSIHKAQGQTLERVKVDLGRVF  837

Query  1774  GYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKEDAVTKK  1941
               G  YVALSR  + +GL +  F  + +  HP+V++F  +L S      E AV K+
Sbjct  838   EKGQAYVALSRATTQQGLQVLRFQKDKVMAHPRVVSFYNKLYS-----AESAVKKR  888



>ref|XP_006261800.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Alligator mississippiensis]
Length=460

 Score =   290 bits (741),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 177/432 (41%), Positives = 248/432 (57%), Gaps = 27/432 (6%)
 Frame = +1

Query  616   VKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSA  795
              + + EQ+ VL A  +G+SVF TGSAGTGK++L++ I+  L         Y TASTGV+A
Sbjct  25    ARLSQEQALVLSAALSGRSVFFTGSAGTGKSYLLKKILGSLPP----KSTYATASTGVAA  80

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLH+FAGIG G+A  E+ + ++     VR  W   Q LIIDEIS++ GE +DKL
Sbjct  81    CHIGGTTLHAFAGIGSGKAPLEQCI-QLAQRLGVRQHWLGCQHLIIDEISMVDGEFFDKL  139

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQ  1152
             E +AR +R        +  +GGIQ++  GDF QLPP+   N Q KF F+A SW+      
Sbjct  140   EAVARAVRK------RDDPFGGIQLIICGDFLQLPPVCKGNDQIKFCFQAKSWRKCIHVN  193

Query  1153  IDLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVY  1326
             ++LT V RQ+D   + LL+ +R G    E    L +   + +E D  LA +L    DDV 
Sbjct  194   MELTEVRRQTDKAFISLLRAVRLGRCPDEVTWQLTQTAANRVERDGILATRLCTHKDDVE  253

Query  1327  RVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLNARH  1500
               N++ L  L  +   + AVD+  D    +L     P    +EL  GA+VMLTKNL+   
Sbjct  254   LTNERRLQQLPGERRCFEAVDS--DPMLAKLIDAQCPVGHHIELKPGAQVMLTKNLDVSR  311

Query  1501  KLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRK  1680
              LVNGA G V+ FE+        G   LP V+F     + +I+ E W       V   R+
Sbjct  312   GLVNGARGVVVEFEA--------GGKGLPRVRFLCGVTE-VIKLERWIFKGPSGVHLSRQ  362

Query  1681  QIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIK  1860
             Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SL+GL +  F+P ++K
Sbjct  363   QLPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARSLKGLRVLDFDPKVVK  422

Query  1861  VHPKVLNFDKRL  1896
              +P+VL F  +L
Sbjct  423   ANPQVLQFYSQL  434



>ref|XP_426648.3| PREDICTED: ATP-dependent DNA helicase PIF1 [Gallus gallus]
Length=602

 Score =   294 bits (752),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 180/436 (41%), Positives = 251/436 (58%), Gaps = 29/436 (7%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             R   + +VEQ  VL A+ +GKSVF TG AGTGK+FL++ I+  L      +  Y TASTG
Sbjct  164   RPPARLSVEQEAVLGAVRSGKSVFFTGCAGTGKSFLLKKIVGSLPP----NSTYATASTG  219

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+AC + G TLH+FAGIG G+A  E+ + ++     VR  W   Q LIIDEIS++ G+ +
Sbjct  220   VAACHIGGTTLHAFAGIGSGKAPLEQCI-QLAERPGVRQHWLACQRLIIDEISMVDGKFF  278

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQK-FAFEASSWKLSF  1143
             DKLE +AR +R      DE   +GGIQ++  GDF QLPP+   N +  F F+A SW+   
Sbjct  279   DKLEAVARAVRKR----DEP--FGGIQLIICGDFLQLPPVCKANEETTFCFQAKSWRKCI  332

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL-EPDP-LAVKLYPRND  1317
                ++LT V RQ+D   + LL  +R G    E ++LL +  +N  E D  LA +L    D
Sbjct  333   HINMELTEVRRQTDKTFISLLSAVRLGRCTEEVISLLLHTATNRSEHDGILATRLCTHKD  392

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWK---EQLKLGIAPDFLELCVGARVMLTKNL  1488
             DV   N++ L  L  DL  + A+D+     K   +Q  +G     +EL VGA+VML KNL
Sbjct  393   DVELTNERRLRQLSGDLHTFEALDSDPMLVKLIDDQCPVG---GRVELKVGAQVMLAKNL  449

Query  1489  NARHKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVV  1668
             +    LVNGA G V+GFE+            LP V+F     + +I+ E W       V 
Sbjct  450   DVSQGLVNGARGVVVGFETEQ--------KGLPKVRFLCGVTQ-VIKMERWLFKGPSGVH  500

Query  1669  AVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNP  1848
               R+Q+PL LAWA+SIHK QGM+L+ +   L+R F  G  YVALSR +SL GL +  F+P
Sbjct  501   LSRQQLPLKLAWAISIHKSQGMSLDSVEISLSRVFESGQAYVALSRARSLAGLRVLDFDP  560

Query  1849  NIIKVHPKVLNFDKRL  1896
              +++  P VL F ++L
Sbjct  561   KVVRADPTVLQFYRQL  576



>ref|XP_005802399.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Xiphophorus 
maculatus]
Length=629

 Score =   295 bits (754),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 172/429 (40%), Positives = 243/429 (57%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K + EQ+ VL+A+ +GK+VF TGSAGTGK+FL++ I+  L         + TASTGV+AC
Sbjct  201   KLSKEQAAVLNAVLSGKNVFFTGSAGTGKSFLLKRILGSLPP----KSTFATASTGVAAC  256

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLHSFAGIG G A  E+ + ++     V   W   + LIIDE+S++  + +DKLE
Sbjct  257   HIGGTTLHSFAGIGSGSAPLEQCV-ELAQRPAVLQHWTSCRHLIIDEVSMVEAQFFDKLE  315

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              IAR +R S         +GGIQ++  GDF QLPP+   K    F F+A SW+      +
Sbjct  316   SIARSVRRSTQP------FGGIQLIVCGDFLQLPPVPKGKEKASFCFQARSWRKVIQVNM  369

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    LL++    +E D  LA +L    DDV  
Sbjct  370   ELTEVRRQTDQNFISLLQAVRVGRVSEEVTATLLKSAYHQIERDGILATRLCTHKDDVEL  429

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N+  L  L      + A+D+  +  +           ++L VGA+VMLTKNL+    LV
Sbjct  430   TNQNKLQQLPGSSRAFEALDSDPEMVRTIDAHSPVSRLIQLKVGAQVMLTKNLDVARGLV  489

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V+ F+S        G    P V+F     + +++PE W       +   R+Q+P
Sbjct  490   NGARGVVVSFDS--------GKQGFPCVRFLCGITE-VLKPERWVFKSAGGIHLSRQQLP  540

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  F+P++++  P
Sbjct  541   LKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPHVVRADP  600

Query  1870  KVLNFDKRL  1896
             +VL F K+L
Sbjct  601   EVLLFYKKL  609



>ref|XP_010407772.1| PREDICTED: ATP-dependent DNA helicase PIF1, partial [Corvus cornix 
cornix]
Length=432

 Score =   288 bits (738),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 180/427 (42%), Positives = 246/427 (58%), Gaps = 27/427 (6%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             EQ  VL A+ +GKS+F TGSAGTGK+FL++ I+  L      +  Y TASTGV+AC + G
Sbjct  2     EQEAVLGAVRSGKSIFFTGSAGTGKSFLLKKIVGSLPP----NITYATASTGVAACHIGG  57

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              TLH+FAGIG G+A  E+ + ++     VR  W   Q LIIDEIS++ G+ +DKLE +AR
Sbjct  58    TTLHAFAGIGSGKAPLEQCI-QLAERPGVRQHWLACQHLIIDEISMVDGKFFDKLEAVAR  116

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQIDLTT  1167
              +R      DE   +GGIQ++  GDF QLPP+   N + KF F+A SW+      ++LT 
Sbjct  117   AVRKR----DEP--FGGIQLIICGDFLQLPPVCKANEETKFCFQAKSWRKCIHINMELTE  170

Query  1168  VFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYRVNKK  1341
             V RQ+D   V LL  IR G    E    L++      E D  LA +L    DDV   N++
Sbjct  171   VRRQTDKTFVSLLNAIRLGRCTEEVTRQLMQTAAHRSERDGILATRLCTHKDDVEITNER  230

Query  1342  HLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLNARHKLVNG  1515
              L  L  ++  + A+D+  D    +L     P    +EL +GA+VML KNL+    LVNG
Sbjct  231   RLHQLPGEVHVFEALDS--DPMLGKLIDAQCPVGGRVELKLGAQVMLAKNLDVSRGLVNG  288

Query  1516  AAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLI  1695
             A G V GFES     E  G   LP V+F     +LI + E W       +   R+Q+PL 
Sbjct  289   ARGVVAGFES-----EQKG---LPKVRFLCGVTQLI-KMEKWVFKGPSGIHLSRQQLPLK  339

Query  1696  LAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKV  1875
             LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SL GL +  F+P +++  P V
Sbjct  340   LAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARSLAGLRVLDFDPKVVRADPAV  399

Query  1876  LNFDKRL  1896
             L F ++L
Sbjct  400   LQFYRQL  406



>ref|XP_003755701.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Sarcophilus harrisii]
Length=641

 Score =   295 bits (754),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 173/422 (41%), Positives = 243/422 (58%), Gaps = 25/422 (6%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             EQ++VL A+  GKS+F TGSAGTGK++L++ I+  L          VTASTGV+AC + G
Sbjct  208   EQARVLSAVLRGKSIFFTGSAGTGKSYLLKRILGSLPP----KGTVVTASTGVAACHIGG  263

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              TLH+FAGIG G+A   + +  +     VR  W   Q L+IDE+S++   L+DKLE +AR
Sbjct  264   TTLHAFAGIGSGKAPLAQCV-ALAQRANVRQSWVSCQRLVIDEVSMVEASLFDKLEAVAR  322

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQIDLT  1164
              +R       ++  +GGIQ++  GDF QLPP+  KN Q  +F F+A SW+      ++LT
Sbjct  323   AVR------QQDKPFGGIQLIICGDFLQLPPV-TKNNQPPQFCFQAKSWRKCIQLTMELT  375

Query  1165  TVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSN-LEPDP-LAVKLYPRNDDVYRVNK  1338
              V+RQ+D   + LLQ +R G    E    L+    + +E D  LA +L    DDV   N+
Sbjct  376   EVWRQTDQTFISLLQAVRLGRCSDEVTQQLKATAKHKVEHDGILATRLCTHQDDVALTNE  435

Query  1339  KHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGA  1518
             + L  L   +  Y AVD+  D  K           L+L +GA+VML KNL     LVNGA
Sbjct  436   RRLQQLPGQVYSYEAVDSDPDMVKTIDSQCPVSHLLQLKLGAQVMLVKNLAVSQGLVNGA  495

Query  1519  AGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLIL  1698
              G V+GFE+            LP VKF     + +IR E W++      +  R+Q+PL L
Sbjct  496   RGVVVGFEADG--------RGLPRVKFLCGVTE-VIRTERWTVHGPGGQLLTRQQLPLRL  546

Query  1699  AWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVL  1878
             AWALSIHK QGMTL+C+   L R F  G  YVALSR +SL+GL +  F+P++++  P+VL
Sbjct  547   AWALSIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLQGLRVLDFDPSVVRCDPRVL  606

Query  1879  NF  1884
              +
Sbjct  607   KY  608



>ref|XP_008730403.1| hypothetical protein G647_07869 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI21522.1| hypothetical protein G647_07869 [Cladophialophora carrionii CBS 
160.54]
Length=763

 Score =   298 bits (762),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 193/481 (40%), Positives = 264/481 (55%), Gaps = 72/481 (15%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  V+ A+   GKSVF TGSAGTGK+ L++ II +LR  +  S  R  VTASTG+++C 
Sbjct  250   EQKAVMKAVMEEGKSVFFTGSAGTGKSVLMKAIIAQLRHKYRASPDRYAVTASTGLASCI  309

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             L G TLHS++GIGLG+  A EL+ KV  N++ R RW   + LIIDE+S++ G+L+DKLE 
Sbjct  310   LEGQTLHSWSGIGLGKEPAPELVKKVKRNQKSRQRWLRTKVLIIDEVSMVDGQLFDKLEQ  369

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKN-TQKFAFEASSWKLSFDTQID  1158
             +AR IR+  NG      +GGIQ+V +GDFFQLPP+  KN T KF FEA +W       I 
Sbjct  370   VARTIRN--NGRP----FGGIQLVVTGDFFQLPPVPEKNATAKFVFEAVTWNTCIQHTIL  423

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEY------DFEDLNLLENHCSNLEPDPLAVKLYPRNDD  1320
             LT VFRQ D Q   +L  +R G+       +F+ L+        LE    A +LYPR ++
Sbjct  424   LTHVFRQKDEQFASMLNEMRLGKMSPATVREFKALSRPLKVVDELE----ATELYPRREE  479

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVMLTKNLN  1491
             V   N   +  L   ++ + AVD+G    ++ K  L   IAP+ LEL  GA+VML KN++
Sbjct  480   VENANTNRMRKLSGQVMTFTAVDSGNAEPNTRKALLSNFIAPEVLELKKGAQVMLIKNID  539

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTN-------------------------------  1578
                +LVNG+ G V  F    GT+ T+  +                               
Sbjct  540   G--QLVNGSLGIVQSFMD-EGTFFTYKDDEPTFLLAQEGGEDDDEEKKAAREKIREARLK  596

Query  1579  ----------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSI  1716
                       W P+V+F   D   + ++  P+ W       EV+A R Q+PLILAWALSI
Sbjct  597   NSATGETRRLW-PMVRFNLPDGTSRSMLCAPDEWKTEAQNGEVLAKRVQVPLILAWALSI  655

Query  1717  HKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             HK QG TL+ +  DL + F  G  YVALSR ++ EGL +  F+   + VH KVL F  +L
Sbjct  656   HKAQGQTLSRVKVDLGKVFEKGQAYVALSRARTKEGLQVLRFDERKVMVHQKVLEFYAKL  715

Query  1897  C  1899
              
Sbjct  716   A  716



>ref|XP_004359275.1| hypothetical protein DFA_01309 [Dictyostelium fasciculatum]
 gb|EGG21425.1| hypothetical protein DFA_01309 [Dictyostelium fasciculatum]
Length=1554

 Score =   306 bits (784),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 177/458 (39%), Positives = 265/458 (58%), Gaps = 49/458 (11%)
 Frame = +1

Query  625   TVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACAL  804
             T EQ  +++ +  GK++F TGSAGTGK+F+++ I++ LR+++G  +V+VTASTG++AC++
Sbjct  273   TEEQKAIVNYVLEGKNLFFTGSAGTGKSFVLKEIVKCLRQLYGSDKVHVTASTGIAACSV  332

Query  805   NGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFI  984
              G TLHSFAG+ LG+ +A + +  + +N+ V +RW+  +ALI+DE+S+IS +L+DK+E I
Sbjct  333   GGTTLHSFAGVSLGDKSARDYITYIENNQTVFNRWRTCKALIVDEVSMISSDLFDKIEEI  392

Query  985   ARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN------------------------  1092
             AR IR S      +  +GG+QV+  GDFFQL P+ N                        
Sbjct  393   ARSIRKS------KRSFGGVQVILVGDFFQLSPVTNNQQNQNNNNNYGGGGDPADDLLSM  446

Query  1093  -----KNTQKFAFEASSWKLSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE  1257
                  K    + F+A  W+   +  I L  VFRQ D Q V LL  IR G +D++ ++ L 
Sbjct  447   LDQSAKRASPYCFDAKCWESVIERCILLRQVFRQKDSQFVDLLNQIRFGTFDYKSIDYLN  506

Query  1258  NHC--SNLEPDP--LAVKLYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKL  1425
               C  +NL+     +   LYP+   V + N++ LD L  + + + AVD G D++++    
Sbjct  507   QKCVNNNLQRSDGIIPTILYPKRIQVDKENQQKLDQLTTEGMTFTAVDVGSDNYRKTFDN  566

Query  1426  GIAPDFLELCVGARVMLTKNLNARHKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDF  1605
               AP  L L +G++V+L KNL+    LVNGA G VIGF   +           PVV+F  
Sbjct  567   MQAPQSLTLKIGSQVILLKNLDFEQGLVNGARGVVIGFSDSDIVQ--------PVVRF-A  617

Query  1606  KPKKLIIRPETWSIMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGM  1785
                ++++  E W I  G   VA R+Q+PL LAWAL+IHK QGMT++ L  DL+  F  G 
Sbjct  618   SGAEVVVGIEIWKIEIGSLTVASRRQLPLALAWALTIHKSQGMTIDRLIVDLDGTFQNGQ  677

Query  1786  VYVALSRVKSLEGLHL-SSFNPNIIKVHPKVLNFDKRL  1896
              YVALSR  SLEGL L +   P   KV   V+ F +++
Sbjct  678   AYVALSRATSLEGLQLKTPAKPKHFKVDQGVVKFYQKI  715



>ref|XP_009217019.1| hypothetical protein GGTG_00999 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT81010.1| hypothetical protein GGTG_00999 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=784

 Score =   298 bits (762),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 187/460 (41%), Positives = 260/460 (57%), Gaps = 57/460 (12%)
 Frame = +1

Query  670   SVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACALNGYTLHSFAGIGL  843
             SVF TG AGTGK+ L++ II  L++   +   R+ VTASTG++AC + G TLHSF+GIGL
Sbjct  299   SVFFTGPAGTGKSVLMRAIISDLKKKWAKDPDRLAVTASTGLAACNIGGMTLHSFSGIGL  358

Query  844   GEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIRSSINGSDE  1023
             G+  A+ L+ K+  N + ++RW   + LIIDEIS++ G+L+DKL  I R IR+  NG   
Sbjct  359   GKEDAQTLVKKIRRNPKAKNRWLRTKILIIDEISMVDGDLFDKLSQIGRTIRN--NG---  413

Query  1024  EMVWGGIQVVASGDFFQLPPI---FNKNTQKFAFEASSWKLSFDTQIDLTTVFRQSDPQL  1194
                WGGIQ+V +GDFFQLPP+    +K   KFAFEA++W  S D  I LT VFRQ DP+ 
Sbjct  414   -RPWGGIQLVITGDFFQLPPVPDSADKRDIKFAFEAATWNTSIDHTIGLTEVFRQKDPEF  472

Query  1195  VKLLQGIRKGEYDFEDLNLLENHCSNLE-PDPLAV-KLYPRNDDVYRVNKKHLDSLHQDL  1368
               +L  +R G    + +   +  C  L   D L V +L+P   +V   N + L SL    
Sbjct  473   ASMLNEMRLGRISDQTVKNFKALCRPLHFKDGLEVTELFPTRSEVDGSNNRRLKSLQSKQ  532

Query  1369  IGYRAVDNGEDSWKEQ-LKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAGTVIG---  1536
               + A+D G+  ++E+ L+  +AP  LEL  GA+VML KN++    LVNG+ GTV G   
Sbjct  533   HRFDAIDTGDQLFREKLLQNMMAPKTLELRKGAQVMLIKNMD--DTLVNGSLGTVSGFMT  590

Query  1537  ---FESVN--GTYETFGTN-----------------------------WLPVVKF---DF  1605
                F+++N  G Y++   +                               P+V+F   D 
Sbjct  591   EATFQAINPGGDYDSGAEDEDDKDAEARKKRLMAFSRQLEESGSQDNKEYPLVRFHAVDG  650

Query  1606  KPKKLIIRPETW-SIMDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYG  1782
              P+ L+  PE W S +   EV A RKQ+PLILAWALSIHK QG TL  +  DL + F  G
Sbjct  651   SPRVLLCVPEEWKSELPTGEVQASRKQVPLILAWALSIHKAQGQTLERVKVDLGKVFEKG  710

Query  1783  MVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
               YVALSR  S  GL +  F  + +  HP+V++F  +L S
Sbjct  711   QAYVALSRATSQSGLQVLRFEKHKVMAHPRVVDFYNKLYS  750



>ref|XP_007061589.1| PREDICTED: ATP-dependent DNA helicase PIF1-like, partial [Chelonia 
mydas]
Length=555

 Score =   291 bits (746),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 173/432 (40%), Positives = 248/432 (57%), Gaps = 23/432 (5%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             +R++ + EQS VL A+  GK+VF TGSAGTGK++L++ I+  L         Y TASTGV
Sbjct  119   SRMRLSQEQSIVLSAVLTGKNVFFTGSAGTGKSYLLKKIVGSLPP----KSTYATASTGV  174

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + + ++     VR  W   Q LIIDEIS++ G+ +D
Sbjct  175   AACHIGGTTLHAFAGIGSGKAPLNQCI-ELAQRTGVRQHWLSCQHLIIDEISMVEGKFFD  233

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFD  1146
             KLE +AR +R        +  +GGIQ++  GDF QLPP+   N + KF F+A SW+    
Sbjct  234   KLEAVARAVR------KRDDPFGGIQLIICGDFLQLPPVSKGNEETKFCFQAKSWRKCIH  287

Query  1147  TQIDLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDD  1320
               ++LT V RQ++   + LL  +R G    E    L++     +E D  LA +L    DD
Sbjct  288   VNMELTEVRRQTEKSFISLLHTVRLGRCTDEVTKQLMQTATHRVERDGILATRLCTHRDD  347

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARH  1500
             V   N++ L  L  ++  Y AVD+     K          +++L  GA+V+LTKNL+   
Sbjct  348   VELTNERRLQQLPGEMHFYEAVDSDPMLVKAIDAQCPVSRYIQLKPGAQVILTKNLDVSR  407

Query  1501  KLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRK  1680
              LVNGA G V+ FE+            LP V+F     +LI R E W       +   R+
Sbjct  408   GLVNGARGVVVEFEADG--------KGLPQVRFLCGVTELI-RLERWVFKGPSGIYLSRQ  458

Query  1681  QIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIK  1860
             Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SLEGL +  F+P++++
Sbjct  459   QLPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARSLEGLRVLDFDPSVVR  518

Query  1861  VHPKVLNFDKRL  1896
              +P VL F K+L
Sbjct  519   ANPYVLQFYKQL  530



>emb|CDM31007.1| Probable transposable element [Penicillium roqueforti FM164]
Length=764

 Score =   297 bits (760),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 183/477 (38%), Positives = 263/477 (55%), Gaps = 64/477 (13%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  VL  +   GKS+F TGSAGTGK+ L++ II +LR  + +   R+ VTASTG++AC 
Sbjct  274   EQQAVLKTVVERGKSMFFTGSAGTGKSVLMREIIAQLRYKYRKESDRIAVTASTGLAACN  333

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    +L+ ++  N + R+RW   + L++DE+S++ G+L+DKLE 
Sbjct  334   IGGVTLHSFAGIGLGKEPVPDLVKRIKKNPKARNRWLRTKVLVVDEVSMVDGDLFDKLEE  393

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQI  1155
             IAR++R+  NG      +GGIQ+V +GDFFQLPP+ +   +  KFAF A+SW       +
Sbjct  394   IARRMRN--NGRP----FGGIQLVVTGDFFQLPPVPDGGNREAKFAFAAASWTTCIQHTV  447

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL--AVKLYPRNDDVYR  1329
              LT +FRQ DP+   +L  +R G+     +   +     L+      A +L+P   +V  
Sbjct  448   LLTNIFRQRDPEFANMLNEMRLGKITPRTIEAFKRLSRPLDAKDQFEATELFPTRAEVDG  507

Query  1330  VNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKNLNAR  1497
              N   +  L  +++ + AVD+G   +   + +L  G IAP  ++L  GA+VML KN+   
Sbjct  508   ANSARMGRLSGEIMRFNAVDSGAIQDPQQRARLLAGCIAPPMIQLKKGAQVMLIKNME--  565

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTN---------------------------------  1578
               LVNG+ G V+ F S +  +E F  N                                 
Sbjct  566   DSLVNGSIGKVVAFMSED-YFEVFRENDKNFTGDATTGSDEERAHQARKKLKPMGNQEGA  624

Query  1579  ------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQ  1728
                   W P+V F   D   ++L+ +PETW + +   EV A R+Q+PLILAWALSIHK Q
Sbjct  625   ASMARKW-PLVSFLQPDGSERQLLCQPETWKVELPNGEVQAQRQQVPLILAWALSIHKAQ  683

Query  1729  GMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLC  1899
             G TL  +  DL R F  G  YVALSR  S EGL ++ F P  + VHPKV  F  +L 
Sbjct  684   GQTLQRVKVDLGRVFEKGQAYVALSRAVSQEGLQVTRFEPRKVMVHPKVQEFYSKLT  740



>gb|ENH78649.1| mitochondrial dna helicase [Colletotrichum orbiculare MAFF 240422]
Length=840

 Score =   298 bits (764),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 190/485 (39%), Positives = 266/485 (55%), Gaps = 60/485 (12%)
 Frame = +1

Query  625   TVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSA  795
             T EQ  V    +  G+SVF TG AGTGK+ L++ II +L++   R   R+ +TASTG++A
Sbjct  318   TKEQKHVQSLVVDKGQSVFFTGPAGTGKSVLMRSIIAELKKKWARDPERLAITASTGLAA  377

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLHSF+GIGLG+     L+ K+  N + ++RW   +ALIIDE+S++ GEL+DKL
Sbjct  378   CNIGGQTLHSFSGIGLGKEDVPTLVKKIRRNPKAKNRWLRTKALIIDEVSMVDGELFDKL  437

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT---QKFAFEASSWKLSFD  1146
               I R IR+  NG      WGGIQ+V +GDFFQLPP+ + +     KFAFEA++W  + D
Sbjct  438   SQIGRTIRN--NGKP----WGGIQLVVTGDFFQLPPVPDGDKTRDSKFAFEAATWNTAID  491

Query  1147  TQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSN-LEPDPLAV-KLYPRNDD  1320
               I LT VFRQ DP    +L  +R G    E +   +      +  D L V +L+P   +
Sbjct  492   HTIGLTQVFRQRDPVFANMLNEMRLGRISEETVQAFKKLTRPVVSQDGLEVTELFPTRME  551

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ-LKLGIAPDFLELCVGARVMLTKNLNAR  1497
             V R N   L SL      + A+D G+ + +++ L+  +AP  +EL VGA+VML KN++  
Sbjct  552   VDRANVGRLRSLQGQTKKFEAMDTGDPAIRDKLLQNMMAPKSIELKVGAQVMLIKNMD--  609

Query  1498  HKLVNGAAGTVIGFESVNGTYE---------------------------------TFGTN  1578
               LVNG+ G V+ F S  G+++                                 T G +
Sbjct  610   ETLVNGSLGKVVKFMS-EGSFDAWSTTDYGSDMDEDPEARARRKIKAFSREVEDATKGNH  668

Query  1579  WLPVVKF---DFKPKKLIIRPETWSIMDGE-EVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
               PVV+F   D   + ++  PE W +     EV A R Q+PLILAWALSIHK QG TL  
Sbjct  669   EFPVVEFSAVDGTSRTILCVPEDWKVETPTGEVQASRSQLPLILAWALSIHKAQGQTLER  728

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKED  1926
             +  DL + F  G  YVALSR    EGL +  F  + +  HP+V+ F  +L S      E 
Sbjct  729   VKVDLGKVFEKGQAYVALSRATCQEGLQVLRFQKDKVMAHPRVVQFYNKLYS-----AEQ  783

Query  1927  AVTKK  1941
             A+TKK
Sbjct  784   AITKK  788



>gb|EXX73392.1| Rrm3p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX73393.1| Rrm3p [Rhizophagus irregularis DAOM 197198w]
Length=656

 Score =   293 bits (751),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 185/451 (41%), Positives = 259/451 (57%), Gaps = 46/451 (10%)
 Frame = +1

Query  631   EQSQVLDAISAGK-SVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALN  807
             EQ ++ + +   + ++F TGSAGTGK+FL+Q II  L+  +G   V VTA+TG++A  ++
Sbjct  221   EQQRIFNLVVLDRDNIFFTGSAGTGKSFLLQRIITSLKARYGSETVAVTATTGIAAVNIS  280

Query  808   GYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIA  987
             G TLHSFAG+GLG+ ++ EL+  V  +   R+RWK +  LIIDEIS++  +L+DKLE IA
Sbjct  281   GTTLHSFAGVGLGKGSSTELIKHVQKSVAARNRWKSIDTLIIDEISMLDADLFDKLEVIA  340

Query  988   RKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDLTT  1167
             R IR      +    +GGIQ+V +GDFFQLPP+  KN+ KF FEA  WK+     I LT 
Sbjct  341   RTIR------NNNRPFGGIQLVVTGDFFQLPPVA-KNS-KFCFEALKWKICLKHTIQLTK  392

Query  1168  VFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPD-P----LAVKLYPRNDDVYRV  1332
             ++RQ D +L++LL  +R GE   + L LL+   SN EP+ P       +LYP ND V + 
Sbjct  393   IYRQKDSELIELLNEMRYGEVSDKSLKLLD-QLSN-EPNYPNDGIRPTELYPINDMVNKA  450

Query  1333  NKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG---------IAPDFLELCVGARVMLTKN  1485
             N   L  +      Y + D     W E L+ G         +AP+ LEL   A+VML KN
Sbjct  451   NATELGKIPHKSYIYSSTD-----W-EPLRGGQLHNLIKNCLAPERLELKRDAQVMLIKN  504

Query  1486  LNARHKLVNGAAGTVIGFES-------VNGTYETF----GTNWLPVVKFDFKPKKLIIRP  1632
             L+    LVNG+ G V+GF          NG  E      G    P+V+F     ++++  
Sbjct  505   LS--RDLVNGSRGVVVGFHDKEDGSSYYNGDDEGLDRLKGKKLSPIVRFT-NSLEMVMEE  561

Query  1633  ETWSIMD-GEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRV  1809
               W+I   G+ V+A RKQIPL+LAWA+SIHK QG TL  +  DL+R F  G  YVALSR 
Sbjct  562   AEWTITSPGDVVLASRKQIPLVLAWAISIHKSQGQTLERVKVDLSRVFEKGQAYVALSRA  621

Query  1810  KSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              S+  L ++ F  + +  H KV  F   L +
Sbjct  622   TSVHSLQINGFRKDKVMCHEKVKRFYDSLTT  652



>ref|XP_005307201.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Chrysemys picta bellii]
Length=643

 Score =   293 bits (750),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 172/428 (40%), Positives = 248/428 (58%), Gaps = 23/428 (5%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             +R++ + EQS VL A+ +GK+VF TGSAGTGK++L++ I+  L         Y TASTGV
Sbjct  206   SRMRLSQEQSIVLRAVLSGKNVFFTGSAGTGKSYLLKKIVGSLPP----KSTYATASTGV  261

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A  ++ + ++     VR  W   Q LIIDEIS++ G+ +D
Sbjct  262   AACHVGGTTLHAFAGIGSGKAPLDQCI-ELAQRTGVRQHWLTCQHLIIDEISMVEGKFFD  320

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFD  1146
             KLE +AR +R        +  +GGIQ++  GDF QLPP+   N + KF F+A SW+    
Sbjct  321   KLEAVARAVRK------RDDPFGGIQLIICGDFLQLPPVSKSNEETKFCFQAKSWRKCIH  374

Query  1147  TQIDLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDD  1320
               ++LT V RQ++   + LL+ IR G    E    L++   + +E D  LA +L    DD
Sbjct  375   VNMELTEVRRQTEKSFISLLRTIRLGRCTDEVTRQLMQTATNRVERDGILATRLCTHKDD  434

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARH  1500
             V   N++ L  L  ++  Y AVD+     K           ++L  GA+V+LTKNL+   
Sbjct  435   VELTNERRLQQLPGEMRSYEAVDSDPMLVKAIDAQCPVSHCIQLKPGAQVILTKNLDVSR  494

Query  1501  KLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRK  1680
              LVNGA G V+ FE+            LP V+F     + +IR E W       +   R+
Sbjct  495   GLVNGARGVVVEFETEG--------KGLPRVRFLCGVTE-VIRLERWVFKGPSGIYLSRQ  545

Query  1681  QIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIK  1860
             Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SLEGL +  F+PN+++
Sbjct  546   QLPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARSLEGLRVLDFDPNVVR  605

Query  1861  VHPKVLNF  1884
              +P VL F
Sbjct  606   ANPYVLQF  613



>dbj|GAM21820.1| hypothetical protein SAMD00019534_049950 [Acytostelium subglobosum 
LB1]
Length=537

 Score =   290 bits (742),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 175/432 (41%), Positives = 258/432 (60%), Gaps = 25/432 (6%)
 Frame = +1

Query  625   TVEQSQVLDAISAGK-SVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACA  801
             T EQ +V++ I  GK +VF TGSAGTGK+F+++HI+ +LRE H ++ VYVTA+TG++A  
Sbjct  97    TPEQERVVNLIVDGKKNVFFTGSAGTGKSFVLKHIVARLREKHEKA-VYVTAATGIAAVN  155

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGI +G  T E+L+ K+  +R    RW   + L+IDEIS++  EL++KL+ 
Sbjct  156   IGGVTLHSFAGIKMGHGTPEQLVSKILKSRIYTKRWTEAKVLVIDEISMVDAELFEKLDV  215

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQIDL  1161
             IAR ++ +      +  +GGIQ+V  GDFFQLPP+       +AFE  +WK   D  + L
Sbjct  216   IARTLKVN------DKPFGGIQLVLCGDFFQLPPVVG----SYAFECEAWKRCVDECVQL  265

Query  1162  TTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCS---NLEPDPLAVKLYPRNDDVYRV  1332
             TTV RQ +   VK+L  +R+G    E + +L++ C    ++    L  KLY  N  V   
Sbjct  266   TTVMRQKEGVFVKVLNNLRRGYVTPEAIKVLQD-CDRPLDISNGVLPTKLYSTNQHVDDE  324

Query  1333  NKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGI-APDFLELCVGARVMLTKNLN-ARHKL  1506
             N K L++L  +   + ++D+G +  K+ ++    AP  L L VGA+V+L + L+ A+  L
Sbjct  325   NTKALEALEGEPTTFTSIDSGSEELKDNIERDCPAPQQLTLKVGAQVVLLRKLDGAKSHL  384

Query  1507  VNGAAGTVIGFESVNGTYETF----GTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAV  1674
             VNG+ G V+ F  V               +PVV F+    K+ I+P  W+I    E  A 
Sbjct  385   VNGSRGVVVDFVQVKPKKRMAQWYKANTTMPVVLFN-DGSKVTIKPLEWNIW--SERRAS  441

Query  1675  RKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNI  1854
             R Q+PL LAWAL+IH+ QGMTL+ +   L + F  G  YVALSRVK+L+GL L  F+   
Sbjct  442   RTQLPLKLAWALTIHRAQGMTLDKVECRLPKTFANGQGYVALSRVKTLDGLCLHEFSRAS  501

Query  1855  IKVHPKVLNFDK  1890
             I+   KV+ F+K
Sbjct  502   IRTSYKVIQFEK  513



>sp|Q5AXT5.2|PIF1_EMENI RecName: Full=ATP-dependent DNA helicase PIF1; AltName: Full=DNA 
repair and recombination helicase PIF1 [Aspergillus nidulans 
FGSC A4]
Length=745

 Score =   295 bits (756),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 189/496 (38%), Positives = 274/496 (55%), Gaps = 78/496 (16%)
 Frame = +1

Query  628   VEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSAC  798
             + Q  VL A+   G+S+F TGSAGTGK+ L++ II+KLR+ + +   R+ VTASTG++AC
Sbjct  241   LSQKHVLKAVVEKGQSIFFTGSAGTGKSVLMREIIKKLRDKYRKEPDRIAVTASTGLAAC  300

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + L+IDE+S++ G+L+DKLE
Sbjct  301   NIEGVTLHSFAGIGLGKEPVPELVKKIKKNQKARNRWLRTKVLVIDEVSMVDGDLFDKLE  360

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDTQ  1152
              IAR IR+  NG      +GGIQ+V +GDFFQLPP+   + +  KF+F A+SW  S    
Sbjct  361   EIARLIRN--NGRP----FGGIQLVVTGDFFQLPPVPEGHNREAKFSFAAASWNTSIQHT  414

Query  1153  IDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRN  1314
             I LT VFRQ DP+   +L  +R G+        F++L+   +    LE    A +L+P  
Sbjct  415   ILLTHVFRQRDPEFADMLNEMRLGKLSPRTIQAFKELSRPLDFHDALE----ATELFPTR  470

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTK  1482
              +V   N   +  L  + + + AVD+G   +  ++E+L    +AP  + L  G++VML K
Sbjct  471   AEVDNANSARMARLSGETMTFNAVDSGTIQDIQFREKLLSNCMAPQTIHLKKGSQVMLIK  530

Query  1483  NLNARHKLVNGAAGTVIGF--------------ESVNGTYE-------------------  1563
             N+     LVNG+ G V+ F              +  +G ++                   
Sbjct  531   NME--DTLVNGSIGRVVAFMDEATFDFYVENENDFASGKFDEGDEDRAARARKKIKGMGH  588

Query  1564  -----TFGTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSI  1716
                  T    W P+V F   D   + L+ +PE+W I +   EV A R+Q+PLILAWALSI
Sbjct  589   RDGGVTVTRKW-PLVCFIQPDGTERHLLCQPESWKIELPNGEVQAQRQQVPLILAWALSI  647

Query  1717  HKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             HK QG TL  +  DL + F  G  YVALSR  S  GL +  F+P  + VHPKV+ F + L
Sbjct  648   HKAQGQTLQRVKVDLGKVFEKGQAYVALSRATSKAGLQVLRFDPRKVMVHPKVIEFYRNL  707

Query  1897  --------CSQPDQPK  1920
                       QP +P+
Sbjct  708   VHASDLIKSKQPPKPQ  723



>ref|XP_007235511.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Astyanax mexicanus]
Length=643

 Score =   293 bits (749),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 178/429 (41%), Positives = 242/429 (56%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K + EQ+ VLDA+ +GK++F TGSAGTGK+FL++ I+  L         Y TASTGV+AC
Sbjct  210   KLSKEQAAVLDAVLSGKNIFFTGSAGTGKSFLLKRIVGSLPP----KSTYATASTGVAAC  265

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLHSFAGIG G A  E+ L ++     V   W   + LIIDE+S++  + +DKLE
Sbjct  266   HIGGTTLHSFAGIGSGSAPLEQCL-ELAQRPGVLQHWTGCKHLIIDEVSMVEAQFFDKLE  324

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              IAR IR S         +GGIQ++  GDF QLPP+   K    F F+A SW+      +
Sbjct  325   AIARSIRRSTEP------FGGIQLIVCGDFLQLPPVTKGKEKPSFCFQARSWRKCIHANM  378

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    LL++  + +E D  LA +L    DDV  
Sbjct  379   ELTEVRRQTDRAFISLLQAVRVGRVTEEVTTQLLKSANNRIERDGILATRLCTHKDDVEL  438

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N+  L  L   L  + AVD+     K           L+L VGA+VMLTKNL+ +  LV
Sbjct  439   TNENKLKQLPGPLRVFEAVDSDPMLVKTIDAQSPVGAVLQLKVGAQVMLTKNLDVQRGLV  498

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V+ F          G   LP V+F     +++ R E W    G  +   R+Q+P
Sbjct  499   NGARGVVVDFLP--------GNQGLPRVRFLCGAVEVMKR-ERWMFKAGGGIYLSRQQLP  549

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  F+P +++ + 
Sbjct  550   LKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPRVVQANQ  609

Query  1870  KVLNFDKRL  1896
              VL F ++L
Sbjct  610   DVLQFYRKL  618



>ref|XP_005482376.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Zonotrichia 
albicollis]
Length=603

 Score =   291 bits (746),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 182/435 (42%), Positives = 250/435 (57%), Gaps = 27/435 (6%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             R   + + EQ  VL A+ +GKS+F TGSAGTGK+FL++ I+  L      +  Y TASTG
Sbjct  165   RLPARLSAEQEAVLGAVRSGKSIFFTGSAGTGKSFLLKRILGSLPP----NITYATASTG  220

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+AC + G TLH+FAGIG G+A  E+ + ++     VR  W   Q LIIDEIS++ G+ +
Sbjct  221   VAACHIGGTTLHAFAGIGSGKAPLEQCI-QLAERPGVRQHWLACQHLIIDEISMVDGKFF  279

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSF  1143
             DKLE +AR +R      DE   +GGIQ++  GDF QLPP+   N + KF F+A SW+   
Sbjct  280   DKLEAVARAVRKR----DEP--FGGIQLIICGDFLQLPPVHKANEETKFCFQAKSWRKCI  333

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRND  1317
                ++LT V RQ+D   V +L  IR G    E    L++      E D  LA +L    D
Sbjct  334   HINMELTEVRRQTDKTFVSILSAIRLGRCTEEVTRQLMQTAAHKSERDGILATRLCTHKD  393

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLN  1491
             DV   N++ L  L  ++  + A+D+  D    +L     P    +EL +GA+VML KNL+
Sbjct  394   DVEITNERRLQQLPGEVHVFEALDS--DPMLVKLIDAQCPVGGRVELKLGAQVMLAKNLD  451

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVA  1671
                 LVNGA G V+GFES     E  G   LP V+F     +LI + E W I     V  
Sbjct  452   VSQGLVNGARGVVVGFES-----EQRG---LPKVRFLCGVTQLI-KMEKWVIKGPSGVHL  502

Query  1672  VRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPN  1851
              R+Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SL GL +  F+P 
Sbjct  503   SRQQLPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARSLAGLRVLDFDPK  562

Query  1852  IIKVHPKVLNFDKRL  1896
              ++  P VL+F + L
Sbjct  563   AVRADPAVLHFYRHL  577



>ref|XP_007842811.1| mitochondrial dna helicase [Moniliophthora roreri MCA 2997]
 gb|ESK97809.1| mitochondrial dna helicase [Moniliophthora roreri MCA 2997]
Length=641

 Score =   292 bits (748),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 179/477 (38%), Positives = 264/477 (55%), Gaps = 60/477 (13%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTAST  783
             ++V  + EQSQ+L  + +G SVF TGSAGTGK+ L++ II+ +R+ H +S   V +TAST
Sbjct  161   SKVFLSQEQSQILKLVESGLSVFYTGSAGTGKSVLLREIIKTMRKKHAKSMDAVAITAST  220

Query  784   GVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGEL  963
             G++AC + G T+HSFAGIGLG    +EL  K+  N++   RW   + LIIDE+S++ G+L
Sbjct  221   GIAACNIGGVTIHSFAGIGLGLEPPQELATKIRKNKKANTRWLRTKVLIIDEVSMVDGDL  280

Query  964   YDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN--KNTQKFAFEASSWKL  1137
             +DKL  +   +R +         +GGIQV+ +GDFFQLPP+     +T KFAFEA  W  
Sbjct  281   FDKLCEVGSILRKNT------APFGGIQVIVTGDFFQLPPVTKGGPSTVKFAFEAQHWSR  334

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVK  1299
             S     +LT VFRQ+D + V +L  +R G         F+ L+   ++   L P     +
Sbjct  335   SIQRTFNLTKVFRQTDQEFVDMLNEMRFGRLSSRSIQKFKSLSREIHYDDGLGP----TE  390

Query  1300  LYPRNDDVYRVNKKHLDSLH-QDLIGYRAVDNGEDSWKEQLKL---GIAPDFLELCVGAR  1467
             L+PR +DV R N   L+ L  ++ + YRA+D+G    +++ KL    +AP  L L   A+
Sbjct  391   LFPRREDVDRSNSTRLNCLQGEEEMPYRAIDSGTAEPQQREKLLSNFMAPQLLVLRKAAQ  450

Query  1468  VMLTKNLNARHKLVNGAAGTVIGF------------------------------ESVNGT  1557
             VML KNL+    LVNG+ G V+ F                              ++  G+
Sbjct  451   VMLIKNLD--ETLVNGSMGRVVRFCDPAVYGTENDVDTFTMSKDKPPSSAGANSKAPKGS  508

Query  1558  YETFGTNWLPVVKFDFK---PKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKC  1725
                 G    PV++F       ++++I PE + + +   E+ A R Q PLILAWA+SIHK 
Sbjct  509   ASKVGQTRYPVIEFIIPHGGRREVMIVPEAFKVELPSGEIQASRTQFPLILAWAMSIHKS  568

Query  1726  QGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             QG TL  +  DL + F  G  YVALSR  SL+GL +  F+ + +  HPKV  + + L
Sbjct  569   QGQTLERVKVDLGKVFEKGQAYVALSRAISLDGLQVLHFDASKVNAHPKVAQWSQSL  625



>emb|CEG05554.1| unnamed protein product [Fusarium sp. FIESC_5 CS3069]
Length=818

 Score =   296 bits (759),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 189/487 (39%), Positives = 276/487 (57%), Gaps = 57/487 (12%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             +  + EQ  VLD  ++  +SVF TG+AGTGK+ L++ II +L++ + +   RV VTASTG
Sbjct  303   ISLSEEQRHVLDLVVNKNQSVFFTGAAGTGKSVLMRAIITELKKKYAKDPERVAVTASTG  362

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ KV  N + ++RW   + L+IDEIS++ G+L+
Sbjct  363   LAACNIGGITLHSFSGIGLGKEDATALVKKVRRNPKAKNRWLRTKCLVIDEISMVDGDLF  422

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ---KFAFEASSWKL  1137
             DKL  I R IR+  NG      WGGIQ++ +GDFFQLPP+ +  T+   KFAF+AS+W  
Sbjct  423   DKLSQIGRTIRN--NG----RPWGGIQLIITGDFFQLPPVPDHGTKRETKFAFDASTWTT  476

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE-PDPL-AVKLYPR  1311
             S D  I LT VFRQ DP    +L  +R G    + +   +     LE  D L A +L+  
Sbjct  477   SIDHTIGLTQVFRQRDPVFANMLNEMRLGRITEDTVRAFKRLERPLEFTDGLGAAELFST  536

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNL  1488
              ++V   N+K L  L   +  Y A D G+D  +++L    +AP  ++L + A+VML KNL
Sbjct  537   RNEVEGSNEKRLRELPGTVRRYEAQDTGKDDIRDKLLANMMAPKSIDLKMNAQVMLIKNL  596

Query  1489  NARHKLVNGAAGTVIGFESVNGTYE-------------------------------TFGT  1575
             +    LVNG+ G VIGF S   T++                               + G 
Sbjct  597   D--ESLVNGSLGKVIGF-SDEKTFDMSPMDEYDEDDPTAKARRKLLKSFKHEAESSSSGV  653

Query  1576  NWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLN  1743
              + PVV+F   D   + ++ +PE W + +   EV A R Q+PLILAWALSIHK QG TL 
Sbjct  654   KY-PVVQFGATDGTSRVILCQPEEWKVELPNGEVQAKRTQLPLILAWALSIHKAQGQTLE  712

Query  1744  CLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD---Q  1914
              +  +L R F  G  YVALSR  + +GL +  F  + +  HP+V++F  +L S  +   +
Sbjct  713   RVKVNLGRVFEKGQAYVALSRATTQDGLQVLGFQKSKVMAHPRVIDFYNKLYSAEEALGK  772

Query  1915  PKEDAVT  1935
             PK  ++T
Sbjct  773   PKAQSIT  779



>ref|XP_010892114.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Esox lucius]
Length=682

 Score =   293 bits (751),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 175/429 (41%), Positives = 242/429 (56%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K   EQ+ VL A+ +GK+VF TGSAGTGK+FL++ I+  L         Y TASTGV+AC
Sbjct  250   KLNKEQAAVLSAVLSGKNVFFTGSAGTGKSFLLKRIVGSLPP----KSTYATASTGVAAC  305

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLHSFAGIG G A  E+ + ++     V   W   + LIIDEIS++  + +DKLE
Sbjct  306   HIGGTTLHSFAGIGSGPAPLEQCI-ELAQRHGVLQHWTSCRHLIIDEISMVEAQFFDKLE  364

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              IAR +R S         +GGIQ++  GDF QLPP+   K+   F F++ SW+      +
Sbjct  365   AIARSVRRSTEP------FGGIQLIVCGDFLQLPPVSKGKDKASFCFQSRSWRKCIQLNM  418

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    L+E+    +E D  LA +L    DDV  
Sbjct  419   ELTEVRRQTDQVFISLLQAVRVGRVTEEVTAKLMESAYHKIERDGILATRLCTHKDDVEL  478

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N+  L  L   +  + AVD+     K           L+L VGA+VMLTKNL+ +  LV
Sbjct  479   TNENKLLQLPGSVRVFEAVDSDPALVKTIDSQSPVSRLLQLKVGAQVMLTKNLDVQRGLV  538

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V+ F+         G   LP V+F     + +++PE W    G  +   R+Q+P
Sbjct  539   NGARGVVVDFQP--------GKLGLPRVRFLCGTTE-VLKPERWMFKAGGGLYLSRQQLP  589

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  F+P +++  P
Sbjct  590   LKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPRVVRADP  649

Query  1870  KVLNFDKRL  1896
              V+ F ++L
Sbjct  650   DVMLFYRKL  658



>ref|XP_004078945.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Oryzias latipes]
Length=627

 Score =   292 bits (747),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 176/429 (41%), Positives = 241/429 (56%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             + + EQ+ VL A+  GK+VF TGSAGTGK+FL++ I+  L         +VTASTGV+AC
Sbjct  197   RLSKEQTAVLSAVLRGKNVFFTGSAGTGKSFLLKRIMGSLPP----KSTFVTASTGVAAC  252

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLH+FAGIG G A  E+ + ++     V   W   + LIIDEIS++  + +DKLE
Sbjct  253   HIGGTTLHNFAGIGSGSAPLEQCI-ELAQRPSVLQHWTSCRHLIIDEISMVEAQFFDKLE  311

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              +AR ++ S         +GGIQ++  GDF QLPP+   K    F F+A  W+      +
Sbjct  312   AVARSVKRSTQP------FGGIQLIVCGDFLQLPPVSKGKEKASFCFQARCWRKVIQVNM  365

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E  + L+ +    +E D  LA +L    DDV  
Sbjct  366   ELTEVRRQTDQNFISLLQAVRLGRVTEEISMKLMTSSYHRIERDGVLATRLCTHKDDVEL  425

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N+  L  L   +  + AVD+  +  K           ++L VGA+VMLTKNL+    LV
Sbjct  426   TNEDKLQQLPGSVRLFEAVDSDPELVKNIDAHSPVSRLIQLKVGAQVMLTKNLDVARGLV  485

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V  FES     E  G   LP V+F     + ++RPE W       V   R Q+P
Sbjct  486   NGARGVVEAFES-----EKKG---LPRVRFLCGVTE-VLRPERWVFKSASGVHLSRTQLP  536

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  FNP++++  P
Sbjct  537   LKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFNPHVVRADP  596

Query  1870  KVLNFDKRL  1896
              VL F K+L
Sbjct  597   DVLLFYKKL  605



>ref|XP_003438064.1| PREDICTED: ATP-dependent DNA helicase PIF1-like isoform X1 [Oreochromis 
niloticus]
Length=632

 Score =   291 bits (746),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 174/429 (41%), Positives = 241/429 (56%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K   EQ+ VL A+ +GK+VF TGSAGTGK+FL++ I+  L         + TASTGV+AC
Sbjct  201   KLNKEQAAVLSAVLSGKNVFFTGSAGTGKSFLLKRIMGSLPP----KSTFATASTGVAAC  256

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLHSFAGIG G A  E+ + ++     V   W   + LIIDEIS++  + +DKLE
Sbjct  257   HIGGTTLHSFAGIGSGSAPLEQCI-ELAQRPGVLQHWTSCRHLIIDEISMVEAQFFDKLE  315

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              +AR +R S         +GGIQ++  GDF QLPP+   K    F F+A SW       +
Sbjct  316   AVARSVRRSTEP------FGGIQLIVCGDFLQLPPVSKGKEKASFCFQARSWHKVIQINM  369

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    L+++    +E D  LA +L    DDV  
Sbjct  370   ELTEVRRQTDQSFISLLQAVRVGRVTEEVTAKLMKSAYHQIERDGILATRLCTHKDDVDL  429

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N+  L  L      + A+D+     K           ++L VGA+VMLTKNL+    LV
Sbjct  430   TNENKLQQLPGSARLFEALDSDPVLVKTIDAHSPVGRLIQLKVGAQVMLTKNLDVARGLV  489

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V+GFES        G + LP V+F     + +++PE W    G  +   R+Q+P
Sbjct  490   NGARGVVVGFES--------GKHGLPRVRFLCGVTE-VLKPERWVFKSGGGIHLSRQQLP  540

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGMTL+C+   L R F  G  YVALSR ++LEGL +  F+P +++  P
Sbjct  541   LKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARNLEGLRVMDFDPRVVRADP  600

Query  1870  KVLNFDKRL  1896
              VL F ++L
Sbjct  601   DVLLFYRKL  609



>ref|XP_008275686.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Stegastes partitus]
Length=631

 Score =   291 bits (746),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 171/429 (40%), Positives = 242/429 (56%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K   EQ+ VL A+ +GK+VF TGSAGTGK+FL++ II  L         + TASTGV+AC
Sbjct  201   KLNKEQAAVLSAVLSGKNVFFTGSAGTGKSFLLKRIIGSLPP----KSTFATASTGVAAC  256

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLH+FAG+G G A  E+ + ++     V   W   + LIIDE+S++  + +DKLE
Sbjct  257   HIGGTTLHNFAGVGSGSAPLEQCI-ELAQRPGVLQHWTSCRHLIIDEVSMVEAQFFDKLE  315

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              +AR +R S         +GGIQ++  GDF QLPP+   K+   F F+A SW+      +
Sbjct  316   SVARSVRRSTEP------FGGIQLIVCGDFLQLPPVSKGKDKASFCFQARSWRKVIQVNM  369

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    L+ +    +E D  LA +L    DDV  
Sbjct  370   ELTEVRRQTDQSFISLLQAVRVGRVTEEVTAKLMRSAYHPIERDGILATRLCTHKDDVEL  429

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N   L  L   +  + A+D+     K           ++L VGA+VMLTKNL+    LV
Sbjct  430   TNGNKLQQLPGSMRVFEALDSDPALVKTIDAHSPVSRLIQLKVGAQVMLTKNLDVARGLV  489

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V+ FES        G + LP V+F     + +++PE W    G  +   R+Q+P
Sbjct  490   NGARGVVVAFES--------GKHGLPRVRFLCGVTE-VLKPERWVFKSGGGMYLSRQQLP  540

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEG+ +  F+P++++  P
Sbjct  541   LKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGVRVMDFDPSVVRADP  600

Query  1870  KVLNFDKRL  1896
              VL F ++L
Sbjct  601   DVLVFYRKL  609



>ref|NP_942102.1| ATP-dependent DNA helicase PIF1 [Danio rerio]
 sp|Q7ZV90.1|PIF1_DANRE RecName: Full=ATP-dependent DNA helicase PIF1; AltName: Full=DNA 
repair and recombination helicase PIF1 [Danio rerio]
 gb|AAH45956.1| Zgc:56161 [Danio rerio]
Length=639

 Score =   291 bits (745),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 184/433 (42%), Positives = 245/433 (57%), Gaps = 31/433 (7%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K + EQ+ VL+A+ +GK+VF TGSAGTGK+FL++ I+  L         Y TASTGV+AC
Sbjct  206   KLSKEQTAVLNAVLSGKNVFFTGSAGTGKSFLLKRIVGSLPP----KSTYATASTGVAAC  261

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLHSFAGIG G A  E+ +        +RH W   + LIIDEIS++  E +DKLE
Sbjct  262   HIGGTTLHSFAGIGSGSAPLEQCIELAQRPGVLRH-WTSCKHLIIDEISMVEAEFFDKLE  320

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              IAR IR S         +GGIQ++  GDF QLPP+   K    F F++ SW+      +
Sbjct  321   AIARSIRRSTEP------FGGIQLIVCGDFLQLPPVTKGKEKANFCFQSRSWRKCIHMNM  374

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLE--NHCSNLEPDP-LAVKLYPRNDDV  1323
             +L  V RQ+D   + LLQ +R G    E    LL+  NHC  +E D  LA +L    DDV
Sbjct  375   ELMEVRRQTDKTFISLLQAVRVGRVTEEVTAQLLKSANHC--IERDGILATRLCTHKDDV  432

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLNAR  1497
                N+  L  L   +  Y AVD+  D    Q     +P    L+L VGA+VMLTKNL+ +
Sbjct  433   ELTNENKLKQLPGVVRMYEAVDS--DPMLVQTIDAQSPVSRLLQLKVGAQVMLTKNLDVQ  490

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+ F+         G   LP V+F     +++ R E W       +   R
Sbjct  491   RGLVNGARGVVVDFQP--------GNQGLPRVRFLCGAVEVMKR-ERWMFKAPGGLYLSR  541

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  F+P ++
Sbjct  542   QQLPLKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPRVV  601

Query  1858  KVHPKVLNFDKRL  1896
             + +  VL F KRL
Sbjct  602   QANQDVLIFYKRL  614



>emb|CAQ52798.1| pif1 protein [Dicentrarchus labrax]
Length=633

 Score =   291 bits (745),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 172/429 (40%), Positives = 242/429 (56%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K   EQ+ VL A+ +G++VF TGSAGTGK+FL++ I+  L         + TASTGV+AC
Sbjct  201   KLNKEQAAVLSAVLSGRNVFFTGSAGTGKSFLLKRIMGSLPP----KSTFATASTGVAAC  256

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLH+FAGIG G A  E+ + ++     V   W   + LIIDE+S++  + +DKLE
Sbjct  257   YIGGTTLHNFAGIGSGSAPLEQCI-ELAQRPGVLQHWTTCRHLIIDEVSMVEAQFFDKLE  315

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              +AR +R S         +GGIQ++  GDF QLPP+   K    F F+A SW+      +
Sbjct  316   SVARSVRRSTEP------FGGIQLIVCGDFLQLPPVSKGKEKASFCFQARSWRKVIQLNM  369

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    L+E+   ++E D  LA +L    DDV  
Sbjct  370   ELTEVRRQTDQSFISLLQAVRVGRVTEEVTAKLMESAYHHIEKDGILATRLCTHKDDVEL  429

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N+  L  L   +  + A+D+     K           ++L VGA+VMLTKNL+    LV
Sbjct  430   TNENKLLQLPGSVRVFEALDSDPALVKTIDAHSPVSRLIQLKVGAQVMLTKNLDVARGLV  489

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V+ FES        G + LP V F     + +++PE W    G  +   R+Q+P
Sbjct  490   NGARGVVVAFES--------GKHGLPHVHFLCGVTE-VLKPERWVFKSGSGIHLSRQQLP  540

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  F+P +++  P
Sbjct  541   LKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPRVVRADP  600

Query  1870  KVLNFDKRL  1896
              VL F ++L
Sbjct  601   DVLVFYRKL  609



>emb|CCA69121.1| related to PIF1-DNA helicase involved in mitochondrial DNA repair 
and telomere length control [Piriformospora indica DSM 
11827]
Length=639

 Score =   291 bits (745),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 183/469 (39%), Positives = 255/469 (54%), Gaps = 49/469 (10%)
 Frame = +1

Query  616   VKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSR--VYVTASTGV  789
             V  + +Q  +L  +  GK+VF TGSAGTGK+ L++ II++LR  + +S+  + +TASTG+
Sbjct  180   VNLSTQQKNILSVVMEGKNVFFTGSAGTGKSVLLRRIIKELRSKYSKSQDVIAITASTGI  239

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLHSFAG+GLG  T  EL  K+  N++   RW   + LIIDEIS++ G+ +D
Sbjct  240   AACNIGGVTLHSFAGVGLGAGTPAELAAKIKKNQKASSRWSRTKVLIIDEISMLEGDFFD  299

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDT  1149
             KLE  AR +R   N +D+   +GGIQ+V +GDFFQLPP+   ++ KFAF A SW      
Sbjct  300   KLEKTARIVRR--NHADKP--FGGIQLVLTGDFFQLPPVTKGSSPKFAFNAESWSSCLHH  355

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVY  1326
               +LT VFRQ D   V +L  +R+G        +       L  D +   +L+PR +DV 
Sbjct  356   TFNLTKVFRQKDQAFVDILNEMRRGIISDSAAKVFLARSGPLPVDEIEPTELFPRREDVD  415

Query  1327  RVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGI-----APDFLELCVGARVMLTKNLN  1491
             R N + L  L      Y A D G  S +E+ +  +     AP  L L  GA+VM+ KN++
Sbjct  416   RANHERLQRLTGKSHEYVASDGG--SAEERTRANVLANFMAPARLVLKKGAQVMMIKNVD  473

Query  1492  ARHKLVNGAAGTVIGFE--------------SVNGTYETFGT-------------NWLPV  1590
                +LVNG  G VI F+              S+ G  E   +              W PV
Sbjct  474   --EQLVNGTVGKVIDFKTESEWADSQRGYGSSLEGDNEADASKPKDKSKSKAQVQKW-PV  530

Query  1591  VKFDF----KPKKLIIRPETWSIMDGEEVVAV-RKQIPLILAWALSIHKCQGMTLNCLYT  1755
             V++        +  +IR ET+ I      V V R Q+PLILAWA+SIHK QG TL  +  
Sbjct  531   VEWKIVGSRHTRTDLIRAETFKIEGPNNKVEVSRMQLPLILAWAMSIHKSQGQTLERVKV  590

Query  1756  DLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             DLN+ F  G  YVA+SR  SLEGL +  F  N +  HP V+ + K L S
Sbjct  591   DLNKVFEKGQAYVAISRATSLEGLQVVGFQKNKVFAHPAVIEWSKTLSS  639



>ref|XP_005476110.1| PREDICTED: ATP-dependent DNA helicase PIF1-like isoform X2 [Oreochromis 
niloticus]
Length=657

 Score =   291 bits (746),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 174/429 (41%), Positives = 241/429 (56%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K   EQ+ VL A+ +GK+VF TGSAGTGK+FL++ I+  L         + TASTGV+AC
Sbjct  226   KLNKEQAAVLSAVLSGKNVFFTGSAGTGKSFLLKRIMGSLPP----KSTFATASTGVAAC  281

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLHSFAGIG G A  E+ + ++     V   W   + LIIDEIS++  + +DKLE
Sbjct  282   HIGGTTLHSFAGIGSGSAPLEQCI-ELAQRPGVLQHWTSCRHLIIDEISMVEAQFFDKLE  340

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              +AR +R S         +GGIQ++  GDF QLPP+   K    F F+A SW       +
Sbjct  341   AVARSVRRSTEP------FGGIQLIVCGDFLQLPPVSKGKEKASFCFQARSWHKVIQINM  394

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    L+++    +E D  LA +L    DDV  
Sbjct  395   ELTEVRRQTDQSFISLLQAVRVGRVTEEVTAKLMKSAYHQIERDGILATRLCTHKDDVDL  454

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N+  L  L      + A+D+     K           ++L VGA+VMLTKNL+    LV
Sbjct  455   TNENKLQQLPGSARLFEALDSDPVLVKTIDAHSPVGRLIQLKVGAQVMLTKNLDVARGLV  514

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V+GFES        G + LP V+F     + +++PE W    G  +   R+Q+P
Sbjct  515   NGARGVVVGFES--------GKHGLPRVRFLCGVTE-VLKPERWVFKSGGGIHLSRQQLP  565

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGMTL+C+   L R F  G  YVALSR ++LEGL +  F+P +++  P
Sbjct  566   LKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARNLEGLRVMDFDPRVVRADP  625

Query  1870  KVLNFDKRL  1896
              VL F ++L
Sbjct  626   DVLLFYRKL  634



>ref|XP_001908006.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP68679.1| unnamed protein product [Podospora anserina S mat+]
Length=814

 Score =   295 bits (756),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 190/489 (39%), Positives = 268/489 (55%), Gaps = 66/489 (13%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             ++ + EQ  V +  +  G+SVF TG AGTGK+ L++ II  L++ + R   ++ VTASTG
Sbjct  295   IQLSQEQRHVKNLVVEKGQSVFFTGPAGTGKSVLMRSIITDLKKKYARDPEKLAVTASTG  354

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+     L+ K+  N + ++RW   + LIIDEIS++  +L+
Sbjct  355   LAACNIGGITLHSFSGIGLGKEDVNTLVKKIRRNPKAKNRWIKTKTLIIDEISMVDSDLF  414

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSF  1143
             DKL  I R +R+  NG      WGGIQ+V +GDFFQLPP+     + +FAF+A++W LS 
Sbjct  415   DKLSQIGRILRN--NG----RPWGGIQLVITGDFFQLPPVPEGGREHRFAFDAATWSLSI  468

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEY------DFEDLNLLENHCSNLEPDPLAVKLY  1305
             D  I LT VFRQ DP   ++L  +R G+       +F+ L         ++      +L+
Sbjct  469   DHTIGLTEVFRQRDPGFAEMLNEMRLGKISDKTVKNFQALKRPLTFSDGIQ----VTELF  524

Query  1306  PRNDDVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLGIAPDFLELCVGARVML  1476
             P   +V R NK  LDSL      ++A D     E+  ++     +AP  L+L  GA+VML
Sbjct  525   PTRSEVERSNKARLDSLKGSPHTFQAADQSTLPENVREKLFSNMMAPPTLDLKKGAQVML  584

Query  1477  TKNLNARHKLVNGAAGTVIGFESVNGTYETFG------------------TNWL------  1584
              KN++    LVNG+ GTV GF     T + FG                  T+ L      
Sbjct  585   IKNMD--ETLVNGSLGTVEGF----ATEDQFGIDNGLEDESDTKKRVRAFTSALENNKNA  638

Query  1585  ---PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLN  1743
                PVV+F   D   + L+  PE W + +   EV A RKQ+PLILAWALSIHK QG T+ 
Sbjct  639   VKYPVVRFHAVDGSQRVLLCVPEEWKVELPNGEVQASRKQLPLILAWALSIHKAQGQTME  698

Query  1744  CLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKE  1923
              +  DLN+ F  G  YVALSR  + EGL + +FN   +  HP+V+NF   L         
Sbjct  699   RVKVDLNKIFEKGQAYVALSRATTQEGLQVLNFNKTKVMAHPRVINFYNSLYGA------  752

Query  1924  DAVTKKKQG  1950
             D   KKK G
Sbjct  753   DVAVKKKTG  761



>ref|XP_008431609.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Poecilia reticulata]
Length=629

 Score =   291 bits (744),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 170/429 (40%), Positives = 240/429 (56%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K + EQ+ VL A+ +GK+VF TGSAGTGK+FL++ I+  L         + TASTGV+AC
Sbjct  201   KLSKEQAAVLSAVLSGKNVFFTGSAGTGKSFLLKRILGSLPP----KSTFATASTGVAAC  256

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLHSFAGIG G A  E+ + ++     V   W     LIIDE+S++  + +DKLE
Sbjct  257   HIGGTTLHSFAGIGSGSAPLEQCV-ELAQRPAVLQHWTSCHHLIIDEVSMVEAQFFDKLE  315

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              +AR +R S         +GGIQ++  GDF QLPP+   K    F F+A SW+      +
Sbjct  316   SVARSVRRSTQP------FGGIQLIVCGDFLQLPPVPKGKEKASFCFQARSWRKVIQVNM  369

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    LL++    +E D  LA +L    DDV  
Sbjct  370   ELTEVRRQTDQNFISLLQAVRVGRVSEEVTATLLKSAYHQIERDGILATRLCTHKDDVEL  429

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N+  L  L      + A+D+  +  +           ++L VGA+VMLTKNL+    LV
Sbjct  430   TNQNKLQQLPGSSRAFEALDSDPELVRTIDAHSPVSRLIQLKVGAQVMLTKNLDVARGLV  489

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V+ F+S        G    P ++F     + +++PE W       +   R+Q+P
Sbjct  490   NGARGVVVSFDS--------GKQGFPCMRFLCGVTE-VLKPERWVFKSTGGIHLSRQQLP  540

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  F+P++++  P
Sbjct  541   LKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPHVVRADP  600

Query  1870  KVLNFDKRL  1896
              VL F K+L
Sbjct  601   DVLLFYKKL  609



>emb|CDP32149.1| Putative DNA repair and recombination protein PIF1, mitochondrial 
precursor [Podospora anserina S mat+]
Length=835

 Score =   295 bits (755),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 188/489 (38%), Positives = 266/489 (54%), Gaps = 66/489 (13%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             ++ + EQ  V +  +  G+SVF TG AGTGK+ L++ II  L++ + R   ++ VTASTG
Sbjct  316   IQLSQEQRHVKNLVVEKGQSVFFTGPAGTGKSVLMRSIITDLKKKYARDPEKLAVTASTG  375

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+     L+ K+  N + ++RW   + LIIDEIS++  +L+
Sbjct  376   LAACNIGGITLHSFSGIGLGKEDVNTLVKKIRRNPKAKNRWIKTKTLIIDEISMVDSDLF  435

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSF  1143
             DKL  I R +R+  NG      WGGIQ+V +GDFFQLPP+     + +FAF+A++W LS 
Sbjct  436   DKLSQIGRILRN--NG----RPWGGIQLVITGDFFQLPPVPEGGREHRFAFDAATWSLSI  489

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEY------DFEDLNLLENHCSNLEPDPLAVKLY  1305
             D  I LT VFRQ DP   ++L  +R G+       +F+ L         ++      +L+
Sbjct  490   DHTIGLTEVFRQRDPGFAEMLNEMRLGKISDKTVKNFQALKRPLTFSDGIQ----VTELF  545

Query  1306  PRNDDVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLGIAPDFLELCVGARVML  1476
             P   +V R NK  LDSL      ++A D     E+  ++     +AP  L+L  GA+VML
Sbjct  546   PTRSEVERSNKARLDSLKGSPHTFQAADQSTLPENVREKLFSNMMAPPTLDLKKGAQVML  605

Query  1477  TKNLNARHKLVNGAAGTVIGFESVNGTYETFGTN--------------------------  1578
              KN++    LVNG+ GTV GF     T + FG +                          
Sbjct  606   IKNMD--ETLVNGSLGTVEGF----ATEDQFGIDNGLEDESDTKKRVRAFTSALENNKNA  659

Query  1579  -WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLN  1743
                PVV+F   D   + L+  PE W + +   EV A RKQ+PLILAWALSIHK QG T+ 
Sbjct  660   VKYPVVRFHAVDGSQRVLLCVPEEWKVELPNGEVQASRKQLPLILAWALSIHKAQGQTME  719

Query  1744  CLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKE  1923
              +  DLN+ F  G  YVALSR  + EGL + +FN   +  HP+V+NF   L         
Sbjct  720   RVKVDLNKIFEKGQAYVALSRATTQEGLQVLNFNKTKVMAHPRVINFYNSLYGA------  773

Query  1924  DAVTKKKQG  1950
             D   KKK G
Sbjct  774   DVAVKKKTG  782



>gb|EPS32376.1| hypothetical protein PDE_07336 [Penicillium oxalicum 114-2]
Length=727

 Score =   293 bits (749),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 196/494 (40%), Positives = 274/494 (55%), Gaps = 67/494 (14%)
 Frame = +1

Query  631   EQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ  V+DA+ + GKS+F TGSAGTGK+ L++ II+KLR+ + R   RV VTASTG++AC 
Sbjct  241   EQLHVVDAVVTHGKSIFFTGSAGTGKSVLMREIIKKLRDKYKREPDRVAVTASTGLAACN  300

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+    EL+ K+  N++ R+RW   + LIIDE+S++ G+L+DKLE 
Sbjct  301   IEGVTLHSFAGIGLGKEPVPELVKKIKKNQKARNRWLRTKVLIIDEVSMVDGDLFDKLEE  360

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKN--TQKFAFEASSWKLSFDTQI  1155
             IAR+IR+  NG      +GGIQ+V +GDFFQLPP+   +    +FAF A++W  +    I
Sbjct  361   IARRIRN--NGR----AFGGIQLVVTGDFFQLPPVPEGHGREARFAFAAATWNTTIQHTI  414

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE-PDPL-AVKLYPRNDDVYR  1329
              LT VFRQ DP+   +L  +R G+     ++        L+  D L A +L+P   +V  
Sbjct  415   LLTHVFRQKDPEFASMLNEMRLGKISPTTIDAFRKLSRPLDFHDALEATELFPTRAEVEN  474

Query  1330  VNKKHLDSLHQDLIGYRAVDNG--EDSWKEQLKLG--IAPDFLELCVGARVMLTKNLNAR  1497
              N + +  L  +++ ++AVD+G  +D    +  L   +AP  + L  GA+VML KN+   
Sbjct  475   ANSQRMSRLSGEVMTFQAVDSGTIQDPQHREKLLSNCMAPMTIHLKKGAQVMLIKNME--  532

Query  1498  HKLVNGAAGTVIGF--ESVNGTYE-----------------------------------T  1566
               LVNG+ G V+ F  E+    Y+                                   T
Sbjct  533   DTLVNGSIGRVVAFMDETTFDCYKDNEGVFVAGENENEDEAALRARKKLKPLAHKEGGVT  592

Query  1567  FGTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGM  1734
                 W P+V F   D   + L+ +PE W I +   EV A R+Q+PLILAWALSIHK QG 
Sbjct  593   VTRKW-PLVSFVQPDGTERHLLCQPEAWKIELPNGEVQAQRQQVPLILAWALSIHKAQGQ  651

Query  1735  TLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQ  1914
             TL  +  DL R F  G  YVALSR  S  GL +  F+P  + VHP+V  F   L S    
Sbjct  652   TLQRVKVDLGRVFEKGQAYVALSRATSQAGLQVLRFDPRKVMVHPRVTEFYSNLISI---  708

Query  1915  PKEDAVTKKKQGGS  1956
                  V ++KQG S
Sbjct  709   ---TQVMQEKQGKS  719



>gb|KDN66508.1| putative DNA repair and recombination protein pif1 [Colletotrichum 
sublineola]
Length=844

 Score =   295 bits (755),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 196/487 (40%), Positives = 263/487 (54%), Gaps = 64/487 (13%)
 Frame = +1

Query  625   TVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSA  795
             T EQ  V    +  G+SVF TG AGTGK+ L++ II +L++   R   R+ VTASTG++A
Sbjct  321   TKEQKHVQSLVVDKGQSVFFTGPAGTGKSVLMRSIIAELKKKWARDPERLAVTASTGLAA  380

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLHSFAGIGLG+     L+ K+  N + ++RW   + LIIDE+S++ G+L+DKL
Sbjct  381   CNIGGQTLHSFAGIGLGKEDVPTLVKKIRRNPKAKNRWLRTKTLIIDEVSMVDGDLFDKL  440

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT---QKFAFEASSWKLSFD  1146
               I R IR+  NG      WGGIQ+V +GDFFQLPP+ + +     KFAFEA++W  + +
Sbjct  441   SQIGRTIRN--NGK----AWGGIQLVITGDFFQLPPVPDGDKSRESKFAFEAATWNTAIE  494

Query  1147  TQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDL----NLLENHCSNLEPDPLAV-KLYPR  1311
               I LT VFRQ DP    +L  +R G    E +     L     SN   D L V +L+P 
Sbjct  495   HTIGLTQVFRQRDPVFANMLNEMRLGRISEETVGAFNKLKRPIVSN---DGLEVTELFPT  551

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ-LKLGIAPDFLELCVGARVMLTKNL  1488
               +V   N+  L  L      + A D G+   +++ L+  +AP  +EL VGA+VML KN+
Sbjct  552   RQEVDNANQSRLRGLKGKTYRFDAADTGDPQIRDKLLQNMMAPKSIELKVGAQVMLIKNM  611

Query  1489  NARHKLVNGAAGTVIGFES---------------VNGTYE-----------------TFG  1572
             +    LVNG+ G V  F S               V+   E                 T G
Sbjct  612   D--DTLVNGSLGKVTRFMSEASFESWHTTDYGSDVDADSEGNVKRKIKAFSREVEEATKG  669

Query  1573  TNWLPVVKF---DFKPKKLIIRPETW-SIMDGEEVVAVRKQIPLILAWALSIHKCQGMTL  1740
             T   PVV+F   D   + ++  PE W S     EV A R Q+PLILAWALSIHK QG TL
Sbjct  670   TTEFPVVEFAAADGSTRTILCVPEEWKSETPTGEVQASRSQLPLILAWALSIHKAQGQTL  729

Query  1741  NCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPK  1920
               +  DL R F  G  YVALSR  S +GL +  F  + +  HP+V+ F K+L S      
Sbjct  730   ERVKVDLGRVFEKGQAYVALSRATSQQGLQVLRFQKDKVMAHPRVVGFYKKLYS-----A  784

Query  1921  EDAVTKK  1941
             E AVTKK
Sbjct  785   EQAVTKK  791



>ref|XP_001595251.1| hypothetical protein SS1G_03340 [Sclerotinia sclerotiorum 1980]
 gb|EDO00866.1| hypothetical protein SS1G_03340 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=907

 Score =   296 bits (758),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 188/488 (39%), Positives = 264/488 (54%), Gaps = 68/488 (14%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             +  T EQ++V    +  GKSVF TGSAGTGK+ L++ II  L++ + R   RV VTASTG
Sbjct  385   IHLTDEQTRVKSLVVDHGKSVFFTGSAGTGKSVLMRSIIAALKKKYVREGDRVAVTASTG  444

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF GIGLG+     L+ K+  N + + RW   + L+IDEIS++ G+L+
Sbjct  445   LAACNIGGVTLHSFGGIGLGKEDVPSLIRKIKKNNKAKLRWTRTKVLVIDEISMVDGDLF  504

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ----KFAFEASSWK  1134
             DKLE IAR +R+  NG      +GGIQ+V +GDFFQLPP+ + N +    KFAF+A++W 
Sbjct  505   DKLEEIARGMRN--NGRP----FGGIQLVITGDFFQLPPVPDYNQKSRGVKFAFDAATWG  558

Query  1135  LSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE--NHCSNLEPDPLAVKLYP  1308
              +    I LT VFRQ DP    +L  +R G+   + +          N E D  A +L+P
Sbjct  559   TAIHHTIGLTEVFRQKDPVFANMLNEMRLGKVSQDTIKAFAGMKRAINYEDDLTATELFP  618

Query  1309  RNDDVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVML  1476
               ++V   N   L SLH     Y A D+G   ++  +E+L    +AP  +EL  GA+VML
Sbjct  619   TRNEVENSNTFRLRSLHGKSYRYDAADSGSITDEGMREKLLSNMMAPKSIELKKGAQVML  678

Query  1477  TKNLNARHKLVNGAAGTVIGFESVNGTYETFGTN--------------------------  1578
              KN++    LVNG+ G V+ F S   ++E + +N                          
Sbjct  679   IKNMD--DGLVNGSLGKVVAFMS-EKSFEIYDSNPDILNEKEFSDAEEEHNRQSDLARFK  735

Query  1579  ----------------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLIL  1698
                               P+V+F   D   + L+++PE W I +   E+ A R Q+PLIL
Sbjct  736   QTNKELPITGISNNGRLFPLVRFSIPDGTVRDLLVQPEEWKIELPNGEIQAQRTQLPLIL  795

Query  1699  AWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVL  1878
             AWALSIHK QG TL  +  DL R F  G  YVALSR  S  GL + +F+P  +  HP+V 
Sbjct  796   AWALSIHKAQGQTLERVKIDLKRVFENGQAYVALSRATSQAGLEVQNFDPKKVMAHPRVA  855

Query  1879  NFDKRLCS  1902
              F   L S
Sbjct  856   EFYNSLYS  863



>ref|XP_005151302.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent DNA helicase PIF1-like 
[Melopsittacus undulatus]
Length=595

 Score =   289 bits (739),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 174/435 (40%), Positives = 244/435 (56%), Gaps = 27/435 (6%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             R  V+ + EQ  V+  + +GKS+F TG AGTGK+FL++ I+  L         Y TASTG
Sbjct  168   RPSVRLSAEQEAVMGVVRSGKSIFFTGCAGTGKSFLLKKIVGSLPP----KTTYATASTG  223

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+AC + G TLH+FAGIG G+   E+ + ++     VR  W   Q LIIDEIS++ G+ +
Sbjct  224   VAACHIGGTTLHAFAGIGSGKTPLEQCI-QLAERPGVRQHWLSCQHLIIDEISMVDGKFF  282

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQK-FAFEASSWKLSF  1143
             DKLE +AR +R        E  +GGIQ++  GDF QLPP+   N +  F F+A SW+   
Sbjct  283   DKLEAVARAVRK------REEPFGGIQLIICGDFLQLPPVCKANEETTFCFQAKSWRKCI  336

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRND  1317
                ++LT V RQ+D   V LL  IR G    E    L++   +  E D  LA +L    D
Sbjct  337   HINMELTEVRRQTDKTFVSLLSAIRLGRCTEEVTRQLMQTADNRSERDGILATRLCTHKD  396

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLN  1491
             DV   N++ L  L  ++  + A+D+  D    +L     P    +EL +GA+VML KNL+
Sbjct  397   DVEITNERCLQQLSGEVHTFEALDS--DPMLVKLIDAQCPVGGRVELKLGAQVMLAKNLD  454

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVA  1671
                 LVNGA G V+GFES            LP V+F     + +I+ E W       V  
Sbjct  455   VSQGLVNGARGVVVGFESEQ--------KGLPKVRFLCGITQ-VIKMEKWVFKGPSGVHL  505

Query  1672  VRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPN  1851
              R+Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SL GL +  F+P 
Sbjct  506   TRQQLPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARSLAGLRVLDFDPK  565

Query  1852  IIKVHPKVLNFDKRL  1896
             +++  P VL F ++L
Sbjct  566   VVRADPSVLQFYRQL  580



>ref|XP_009828150.1| hypothetical protein H257_05105 [Aphanomyces astaci]
 gb|ETV82481.1| hypothetical protein H257_05105 [Aphanomyces astaci]
Length=609

 Score =   289 bits (740),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 174/434 (40%), Positives = 256/434 (59%), Gaps = 30/434 (7%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K T++Q+QVL AI   ++VF TG AGTGK+FL+ HI R +     +  +++TA+TG++A 
Sbjct  183   KLTMKQAQVLQAIQKKENVFFTGRAGTGKSFLLGHIRRAM----PKQGLFLTATTGIAAF  238

Query  799   ALNGYTLHSFAGIG-LGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
              +NG TLH FAG+  +       L+  V  NR+   RW+    L+IDE+S++ G+++D L
Sbjct  239   NINGMTLHHFAGLPQVDTFDVTMLMAAVQRNRQALIRWRDAVLLVIDEVSMLDGQMFDAL  298

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDTQI  1155
             E IAR +R S      ++ +GGIQ+V SGDF+QLPP+  K    F FE+ +W+   +T I
Sbjct  299   ETIARIVRQS------KLFFGGIQLVLSGDFYQLPPV-TKGEPTFCFESQAWQRGINTSI  351

Query  1156  DLTTVFRQSD-PQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL---AVKLYPRNDDV  1323
              L  VFRQSD P+ V +L  IR G +    +  +   C +         A+ ++  N +V
Sbjct  352   CLDQVFRQSDDPEFVAMLNAIRVGTHTSAMIKTINARCVDRRRHSASNEAIHIFSHNAEV  411

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHK  1503
               +N   L+ L  D+  + A+D G+   K  LK    P  ++L  GARVMLTKNL+    
Sbjct  412   LAMNNARLEHLDGDIHDFFAIDTGD---KGLLKGSPIPVRIQLKQGARVMLTKNLSVAAG  468

Query  1504  LVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQ  1683
             LVNG+ G V+GF S        GTN LP+V+FD      I++ E +S++    VVA R+Q
Sbjct  469   LVNGSRGEVVGFAS--------GTN-LPIVRFDHGVTHPILK-EGFSVVANHTVVANRQQ  518

Query  1684  IPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSS-FNPNIIK  1860
             +PL LA+A+SIHK QG+T +     L + F YG  YVALSR+ SL GL L+S  +   I+
Sbjct  519   LPLTLAYAISIHKSQGLTFDNAVLHLGKVFEYGQAYVALSRLSSLAGLTLASPLSHQTIR  578

Query  1861  VHPKVLNFDKRLCS  1902
             VHP++L  D+  C+
Sbjct  579   VHPRLLVTDETFCT  592



>ref|XP_002188590.2| PREDICTED: ATP-dependent DNA helicase PIF1-like [Taeniopygia 
guttata]
Length=725

 Score =   292 bits (747),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 180/435 (41%), Positives = 247/435 (57%), Gaps = 27/435 (6%)
 Frame = +1

Query  607   RTRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTG  786
             R   + + EQ  VL A+ +GKS+F TGSAGTGK+FL++ I+  L      +  Y TASTG
Sbjct  299   RPPARLSAEQEAVLGAVRSGKSIFFTGSAGTGKSFLLKRIVGSLPP----NVTYPTASTG  354

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             V+AC + G TLH+FAGIG G+A  E+ + ++     VR  W   Q LIIDEIS++ G+ +
Sbjct  355   VAACHIGGTTLHAFAGIGSGKAPLEQCI-QLAERPGVRQHWLACQHLIIDEISMVDGKFF  413

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSF  1143
             DKLE +AR +R      DE   +GGIQ++  GDF QLPP+   N + KF F+A  W+   
Sbjct  414   DKLEAVARAVRKR----DEP--FGGIQLIICGDFLQLPPVSKANEETKFCFQAKCWRKCI  467

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRND  1317
                ++LT V RQ+D   V +L  IR G    E    L++      E D  LA +L    D
Sbjct  468   HINMELTEVRRQADKTFVSILSAIRLGRCTEEVTRQLMQTAAHKSERDGILATRLCTHKD  527

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAP--DFLELCVGARVMLTKNLN  1491
             DV   N++ L  L  ++  + A+D+  D    +L     P    +EL +GA+VML KNL+
Sbjct  528   DVDMTNERRLQQLPGEVHVFEALDS--DPMLVKLIDAQCPVGGRVELKLGAQVMLAKNLD  585

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVA  1671
                 LVNGA G V+GFES            LP V+F     +LI + E W I     V  
Sbjct  586   LSQGLVNGARGVVVGFESEQ--------KGLPKVRFLCGVTQLI-KMEKWVIKGPSGVHL  636

Query  1672  VRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPN  1851
              R+Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SLEGL +  F+P 
Sbjct  637   SRQQLPLKLAWAISIHKSQGMSLDCVEISLSRVFESGQAYVALSRARSLEGLRVLDFDPK  696

Query  1852  IIKVHPKVLNFDKRL  1896
              ++  P VL F + L
Sbjct  697   AVRADPAVLQFYRHL  711


 Score =   117 bits (292),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 90/144 (63%), Gaps = 12/144 (8%)
 Frame = +1

Query  691   AGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNGYTLHSFAGIGLGEATAEELL  870
             A TGK+FL++ I+  L      +  Y TASTGV+AC + G TLH+FAGIG G+A  E+ +
Sbjct  160   AETGKSFLLKRIVGSLPP----NVTYPTASTGVAACHIGGTTLHAFAGIGSGKAPLEQCI  215

Query  871   HKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIRSSINGSDEEMVWGGIQV  1050
              ++     VR  W   Q LIIDEIS++ G+ +DKLE +AR +R      DE   +GGIQ+
Sbjct  216   -QLAERPGVRQHWLACQHLIIDEISMVDGKFFDKLEAVARAVRK----RDEP--FGGIQL  268

Query  1051  VASGDFFQLPPIFNKNTQ-KFAFE  1119
             +  GDF QLPP+   N + KF F+
Sbjct  269   IICGDFLQLPPVSKANEETKFCFQ  292



>ref|XP_004466702.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Dasypus novemcinctus]
Length=638

 Score =   290 bits (741),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 167/429 (39%), Positives = 244/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL  +  G+SVF TGSAGTGK++L++HI+  L           TASTGV
Sbjct  201   TKPQLSEEQAAVLRVVLKGQSVFFTGSAGTGKSYLLKHILGSLPPTG----TVATASTGV  256

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  257   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQSWLNCQRLVIDEISMVEADLFD  315

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       +   +GGIQ++  GDF QLPP+  K +Q  +F F+A SW+   
Sbjct  316   KLEAVARAVR------QQNKPFGGIQLIICGDFLQLPPV-TKGSQPPQFCFQAKSWRRCV  368

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   V LLQ +R G    E    L    ++       +A +L    D
Sbjct  369   PVTLELTEVWRQADQTFVSLLQAVRLGRCSKEVTRQLRATAAHKVGRDGIVATRLCTHQD  428

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N++ L  L  ++  + A+D+  D  +       A   L+L +GA+VML KNL   
Sbjct  429   DVALTNQRRLQELPGEMHSFEAMDSDPDQAQTLDAQCPASRLLQLKLGAQVMLVKNLAVS  488

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+            LP V+F     + IIR + W++      +  R
Sbjct  489   RGLVNGARGVVVGFEAEG--------RGLPQVRFLCGVTE-IIRADRWTVQAAGGQLLSR  539

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  540   RQLPLQLAWAISIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPMVV  599

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  600   RCDPRVLHF  608



>ref|XP_004570630.1| PREDICTED: ATP-dependent DNA helicase PIF1-like isoform X1 [Maylandia 
zebra]
 ref|XP_004570631.1| PREDICTED: ATP-dependent DNA helicase PIF1-like isoform X2 [Maylandia 
zebra]
Length=652

 Score =   290 bits (742),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 174/432 (40%), Positives = 245/432 (57%), Gaps = 29/432 (7%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K   EQ+ VL A+ +GK+VF TGSAGTGK+FL++ I+  L         + TASTGV+AC
Sbjct  201   KLNKEQAAVLSAVLSGKNVFFTGSAGTGKSFLLKRIMGSLPP----KSTFATASTGVAAC  256

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLH+FAGIG G A  E+ + ++     V   W   + LIIDEIS++  + +DKLE
Sbjct  257   HIGGTTLHNFAGIGSGSAPVEQCI-ELAQRPGVLQHWTSCRHLIIDEISMVEAQFFDKLE  315

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              +AR +R S         +GGIQ++  GDF QLPP+   K    F F+A SW+      +
Sbjct  316   AVARSVRRSTEP------FGGIQLIVCGDFLQLPPVSKGKEKASFCFQARSWRKVIQINM  369

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    L+++    +E D  LA +L    DDV  
Sbjct  370   ELTEVRRQTDQSFISLLQAVRVGRVTEEVTAKLIKSANHQIERDGILATRLCTHKDDVDL  429

Query  1330  VNKKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVMLTKNLNARH  1500
              N+  L  L      + A+D+     ++      +G     +EL VGA+VMLTKNL+   
Sbjct  430   TNENKLQQLPGSARLFEALDSDPVLVNTIDAHSPVG---RLIELKVGAQVMLTKNLDVAR  486

Query  1501  KLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRK  1680
              LVNGA G V+ FES        G + LP V+F     + +++PE W    G  +   R+
Sbjct  487   GLVNGARGVVVDFES--------GKHGLPRVRFLCGVTE-VLKPERWVFKSGGGIHLSRQ  537

Query  1681  QIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIK  1860
             Q+PL LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  F+P +++
Sbjct  538   QLPLKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPRVVR  597

Query  1861  VHPKVLNFDKRL  1896
               P+VL F ++L
Sbjct  598   ADPEVLLFYRKL  609



>emb|CCT71284.1| related to PIF1 protein precursor [Fusarium fujikuroi IMI 58289]
Length=821

 Score =   294 bits (752),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 185/490 (38%), Positives = 273/490 (56%), Gaps = 63/490 (13%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             +  + EQ  VLD  ++  +SVF TG+AGTGK+ L++ II +L++ + +   RV VTASTG
Sbjct  306   ISLSEEQRHVLDLVVNKNQSVFFTGAAGTGKSVLMRAIITELKKKYAKDPERVAVTASTG  365

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A+ L+ K+  N + ++RW   + L+IDEIS++ G+L+
Sbjct  366   LAACNIGGITLHSFSGIGLGKEDAQALVKKIRRNPKAKNRWLRTKCLVIDEISMVDGDLF  425

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN---KNTQKFAFEASSWKL  1137
             DKL  I R IR+  NG      WGGIQ++ +GDFFQLPP+     K   KFAF+AS+W  
Sbjct  426   DKLSTIGRTIRN--NGRP----WGGIQLIITGDFFQLPPVPEQGAKRETKFAFDASTWTT  479

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVK  1299
             S D  I LT VFRQ DP    +L  +R G         F+ L    N    L       +
Sbjct  480   SIDHTIGLTQVFRQRDPVFANMLNEMRLGRITEDTVRAFKKLERPLNFNDGLG----TAE  535

Query  1300  LYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVML  1476
             L+   ++V   N++ L  L   +  Y A D G++  +++L +  +AP  ++L + A+VML
Sbjct  536   LFSTRNEVEMSNERRLRELPGTIRRYEAQDTGKEDIRDKLLMNMMAPKSIDLKINAQVML  595

Query  1477  TKNLNARHKLVNGAAGTVIGFESVNGTYE----------------------TF-------  1569
              KNL+    LVNG+ G VIGF S   T++                      TF       
Sbjct  596   IKNLD--ESLVNGSLGKVIGF-SDEKTFDMEPIDEFDEEERMAKARKKLLNTFKRESDSS  652

Query  1570  -GTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGM  1734
              G    PVV+F   D   + ++ +PE W + +   E+ A R Q+PLILAW+LSIHK QG 
Sbjct  653   SGGTKFPVVQFMATDGTSRVILCQPEEWKVELPNGELQAKRTQLPLILAWSLSIHKAQGQ  712

Query  1735  TLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD-  1911
             TL  +  +L R F  G  YVALSR  + +GL +  F  + +  HP+V++F  +L S  + 
Sbjct  713   TLERVKVNLGRVFEKGQAYVALSRATTQDGLQVLGFQKSKVMAHPRVIDFYNKLYSAEEA  772

Query  1912  --QPKEDAVT  1935
               +PK  ++T
Sbjct  773   LGKPKAQSIT  782



>ref|XP_006786840.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Neolamprologus 
brichardi]
Length=632

 Score =   289 bits (740),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 173/429 (40%), Positives = 242/429 (56%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K   EQ+ VL A+ +GK+VF TGSAGTGK+FL++ I+  L         + TASTGV+AC
Sbjct  201   KLNKEQAAVLSAVLSGKNVFFTGSAGTGKSFLLKRIMGSLPP----KSTFATASTGVAAC  256

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLH+FAGIG G A  E+ + ++     V   W   + LIIDEIS++  + +DKLE
Sbjct  257   HIGGTTLHNFAGIGSGSAPLEQCI-ELAQRPGVLQHWTSCRHLIIDEISMVEAQFFDKLE  315

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              +AR +R S         +GGIQ++  GDF QLPP+   K    F F+A SW+      +
Sbjct  316   AVARSVRRSTEP------FGGIQLIVCGDFLQLPPVSKGKEKASFCFQARSWRKVIQINM  369

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    L+++    +E D  LA +L    DDV  
Sbjct  370   ELTEVRRQTDQSFISLLQAVRVGRVTEEVTAKLIKSANHQIERDGILATRLCTHKDDVDL  429

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N+  L  L      + A+D+     K           ++L VGA+VMLTKNL+    LV
Sbjct  430   TNENKLQQLPGSARLFEALDSDPVLVKTIDAHSPVGRLIQLKVGAQVMLTKNLDVARGLV  489

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V+ FES        G + LP V+F     + +++PE W    G  +   R+Q+P
Sbjct  490   NGARGVVVDFES--------GKHGLPRVRFLCGVTE-VLKPERWVFKSGGGIHLSRQQLP  540

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  F+P +++  P
Sbjct  541   LKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPRVVRADP  600

Query  1870  KVLNFDKRL  1896
             +VL F ++L
Sbjct  601   EVLLFYRKL  609



>ref|XP_004570632.1| PREDICTED: ATP-dependent DNA helicase PIF1-like isoform X3 [Maylandia 
zebra]
Length=632

 Score =   289 bits (740),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 174/432 (40%), Positives = 245/432 (57%), Gaps = 29/432 (7%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K   EQ+ VL A+ +GK+VF TGSAGTGK+FL++ I+  L         + TASTGV+AC
Sbjct  201   KLNKEQAAVLSAVLSGKNVFFTGSAGTGKSFLLKRIMGSLPP----KSTFATASTGVAAC  256

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLH+FAGIG G A  E+ + ++     V   W   + LIIDEIS++  + +DKLE
Sbjct  257   HIGGTTLHNFAGIGSGSAPVEQCI-ELAQRPGVLQHWTSCRHLIIDEISMVEAQFFDKLE  315

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              +AR +R S         +GGIQ++  GDF QLPP+   K    F F+A SW+      +
Sbjct  316   AVARSVRRSTEP------FGGIQLIVCGDFLQLPPVSKGKEKASFCFQARSWRKVIQINM  369

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    L+++    +E D  LA +L    DDV  
Sbjct  370   ELTEVRRQTDQSFISLLQAVRVGRVTEEVTAKLIKSANHQIERDGILATRLCTHKDDVDL  429

Query  1330  VNKKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVMLTKNLNARH  1500
              N+  L  L      + A+D+     ++      +G     +EL VGA+VMLTKNL+   
Sbjct  430   TNENKLQQLPGSARLFEALDSDPVLVNTIDAHSPVG---RLIELKVGAQVMLTKNLDVAR  486

Query  1501  KLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRK  1680
              LVNGA G V+ FES        G + LP V+F     + +++PE W    G  +   R+
Sbjct  487   GLVNGARGVVVDFES--------GKHGLPRVRFLCGVTE-VLKPERWVFKSGGGIHLSRQ  537

Query  1681  QIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIK  1860
             Q+PL LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  F+P +++
Sbjct  538   QLPLKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPRVVR  597

Query  1861  VHPKVLNFDKRL  1896
               P+VL F ++L
Sbjct  598   ADPEVLLFYRKL  609



>gb|EUC55635.1| DNA helicase (PIF1), putative [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP54155.1| putative DNA helicase (PIF1) [Rhizoctonia solani 123E]
Length=634

 Score =   289 bits (740),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 173/462 (37%), Positives = 251/462 (54%), Gaps = 43/462 (9%)
 Frame = +1

Query  616   VKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSR--VYVTASTGV  789
             +  + EQSQ+LD +  G ++F TGSAGTGK+ L++ II+ LR+ HG+++  V +TASTG+
Sbjct  173   ITLSYEQSQILDIVKKGSNIFFTGSAGTGKSVLLREIIKALRKKHGKAQDAVAITASTGI  232

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLHSF GIG+GE + E L  KV  N+    RW   + LIIDE+S++ G+L+D
Sbjct  233   AACNIGGVTLHSFGGIGIGEGSPESLAMKVRKNKNALARWLRCKVLIIDEVSMLDGDLFD  292

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFDT  1149
             +L  +A  +R S         +GGIQ++ +GDFFQLPP+      KFAFEA  W    + 
Sbjct  293   RLARVACIVRKSPK------PFGGIQLIVTGDFFQLPPVVKGGQPKFAFEAEKWSECVER  346

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVY  1326
               +L+ VFRQ DP+ V +L  +R G                +  D + A +L+PR +DV 
Sbjct  347   TFNLSKVFRQKDPRFVDMLNEMRFGRLTPASTRTFYELSRPIPDDGIQATELFPRREDVD  406

Query  1327  RVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ----LKLGIAPDFLELCVGARVMLTKNLNA  1494
             R N   + +L      + A D G  +   Q    L+  +AP  + L + A+VML KN++ 
Sbjct  407   RSNSLRMAALPGKEQVFSARDAGTITDPVQRDKMLQNFMAPKEISLKINAQVMLLKNID-  465

Query  1495  RHKLVNGAAGTVIGFESVNGT-----------YE--------------TFGTNWLPVVKF  1599
                LVNG+ G VIGF                 Y                 G    P+V+F
Sbjct  466   -ETLVNGSVGRVIGFYDATEVDVGEKGELIHIYAPEERKKLAKKQKDLPHGLAKYPLVEF  524

Query  1600  DFK--PKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRA  1770
                   +KL++ P+ + + +   EV   R QIPLIL+WA+SIHK QG TL+ +  D  R 
Sbjct  525   RVPRGTRKLLVMPDAFKVELPNGEVQVSRTQIPLILSWAMSIHKSQGQTLDRVKVDCGRI  584

Query  1771  FGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             F  G  YVALSR  SLEGL + +F+P  ++ H KV  + + L
Sbjct  585   FEKGQAYVALSRATSLEGLQVLNFDPKKVQAHDKVKTWSQTL  626



>ref|XP_007568820.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Poecilia formosa]
 ref|XP_007568821.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Poecilia formosa]
 ref|XP_007568822.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Poecilia formosa]
Length=629

 Score =   289 bits (739),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 171/429 (40%), Positives = 240/429 (56%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K + EQ+ VL A+ +GK+VF TGSAGTGK+FL++ I+  L         + TASTGV+AC
Sbjct  201   KLSKEQAAVLSAVLSGKNVFFTGSAGTGKSFLLKRILGSLPP----KSTFATASTGVAAC  256

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLHSFAGIG G A  E+ + ++     V   W   + LIIDE+S++  + +DKLE
Sbjct  257   HIGGTTLHSFAGIGSGSAPLEQCV-ELAQRPAVLQHWTSCRHLIIDEVSMVEAQFFDKLE  315

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              +AR +R S         +GGIQ++  GDF QLPP+   K    F F+A SW+      +
Sbjct  316   SVARSVRRSTQP------FGGIQLIVCGDFLQLPPVPKEKEKASFCFQARSWRKVIQVNM  369

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    LL++    +E D  LA +L    DDV  
Sbjct  370   ELTEVRRQTDQNFISLLQAVRVGRVSEEVTATLLKSAYHQIERDGILATRLCTHKDDVEL  429

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N+  L  L      + A+D+  +  +           ++L VGA+VMLTKNL+    LV
Sbjct  430   TNQNKLQQLPGSSRAFEALDSDPELVRTIDAHSPVSRLIQLKVGAQVMLTKNLDVARGLV  489

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V  F+S        G    P V+F     + +++PE W       +   R+Q+P
Sbjct  490   NGARGVVESFDS--------GKQGFPRVRFLCGVTE-VLKPERWVFKSTGGIHLSRQQLP  540

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  F+P++++  P
Sbjct  541   LKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPHVVRADP  600

Query  1870  KVLNFDKRL  1896
              VL F K+L
Sbjct  601   DVLLFYKKL  609



>gb|AAC26139.1| RRM3/PIF1 helicase homolog [Schizosaccharomyces pombe]
Length=805

 Score =   293 bits (749),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 185/480 (39%), Positives = 268/480 (56%), Gaps = 65/480 (14%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ ++LD  +    S+F TGSAGTGK+ L++ II  L+  + +   RV VTASTG++AC 
Sbjct  313   EQKRILDMVVEQQHSIFFTGSAGTGKSVLLRKIIEVLKSKYRKQSDRVAVTASTGLAACN  372

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAG+GL   + + L+ K+  N++  +RW   + LIIDE+S++  EL DKLE 
Sbjct  373   IGGVTLHSFAGVGLARESVDLLVSKIKKNKKCVNRWLRTRVLIIDEVSMVDAELMDKLEE  432

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI-FNKNTQKFAFEASSWKLSFDTQID  1158
             +AR IR       +   +GGIQ+V +GDFFQLPP+  N    KF FE+ +WK + D  I 
Sbjct  433   VARVIRK------DSKPFGGIQLVLTGDFFQLPPVPENGKESKFCFESQTWKSALDFTIG  486

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE--NHCSNLEPDPLAVKLYPRNDDVYRV  1332
             LT VFRQ D + VK+L  +R G+   E +   +  N     E   L  +L+P   +V R 
Sbjct  487   LTHVFRQKDEEFVKMLNELRLGKLSDESVRKFKVLNRTIEYEDGLLPTELFPTRYEVERS  546

Query  1333  NKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKNLNARH  1500
             N   +  ++Q+ + + A+D+G   +  ++++L  G +AP  L L V A+VML KN++   
Sbjct  547   NDMRMQQINQNPVTFTAIDSGTVRDKEFRDRLLQGCMAPATLVLKVNAQVMLIKNID--D  604

Query  1501  KLVNGAAGTVIGFESVNGTYE------------TFGTNWLPVVKFDF---KPKK------  1617
             +LVNG+ G VIGF   + TY+             F  + L +  FD    K KK      
Sbjct  605   QLVNGSLGKVIGFID-DETYQMEKKDAEMQGRNAFEYDSLDISPFDLPDVKQKKYKLIAM  663

Query  1618  ------------------------LIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHK  1722
                                     ++++ ETW+I +   EV A R QIPLILA+A+SIHK
Sbjct  664   RKASSTAIKWPLVRFKLPNGGERTIVVQRETWNIELPNGEVQASRSQIPLILAYAISIHK  723

Query  1723  CQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              QG TL+ +  DL R F  G  YVALSR  + EGL + +F+P  +  HPKV+ F K+L S
Sbjct  724   AQGQTLDRVKVDLGRVFEKGQAYVALSRATTQEGLQVLNFSPAKVMAHPKVVQFYKQLAS  783



>ref|NP_596488.1| DNA repair and recombination protein [Schizosaccharomyces pombe 
972h-]
 sp|Q9UUA2.1|PIF1_SCHPO RecName: Full=ATP-dependent DNA helicase pfh1; AltName: Full=DNA 
repair and recombination helicase pfh1; AltName: Full=PIF1 
helicase homolog; AltName: Full=RRM3/PIF1 homolog 1; Flags: 
Precursor [Schizosaccharomyces pombe 972h-]
 emb|CAA21899.1| 5' to 3' DNA helicase, involved in DNA recombination and repair 
Pif1 [Schizosaccharomyces pombe]
Length=805

 Score =   293 bits (749),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 185/480 (39%), Positives = 268/480 (56%), Gaps = 65/480 (14%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ ++LD  +    S+F TGSAGTGK+ L++ II  L+  + +   RV VTASTG++AC 
Sbjct  313   EQKRILDMVVEQQHSIFFTGSAGTGKSVLLRKIIEVLKSKYRKQSDRVAVTASTGLAACN  372

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAG+GL   + + L+ K+  N++  +RW   + LIIDE+S++  EL DKLE 
Sbjct  373   IGGVTLHSFAGVGLARESVDLLVSKIKKNKKCVNRWLRTRVLIIDEVSMVDAELMDKLEE  432

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI-FNKNTQKFAFEASSWKLSFDTQID  1158
             +AR IR       +   +GGIQ+V +GDFFQLPP+  N    KF FE+ +WK + D  I 
Sbjct  433   VARVIRK------DSKPFGGIQLVLTGDFFQLPPVPENGKESKFCFESQTWKSALDFTIG  486

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLE--NHCSNLEPDPLAVKLYPRNDDVYRV  1332
             LT VFRQ D + VK+L  +R G+   E +   +  N     E   L  +L+P   +V R 
Sbjct  487   LTHVFRQKDEEFVKMLNELRLGKLSDESVRKFKVLNRTIEYEDGLLPTELFPTRYEVERS  546

Query  1333  NKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTKNLNARH  1500
             N   +  ++Q+ + + A+D+G   +  ++++L  G +AP  L L V A+VML KN++   
Sbjct  547   NDMRMQQINQNPVTFTAIDSGTVRDKEFRDRLLQGCMAPATLVLKVNAQVMLIKNID--D  604

Query  1501  KLVNGAAGTVIGFESVNGTYE------------TFGTNWLPVVKFDF---KPKK------  1617
             +LVNG+ G VIGF   + TY+             F  + L +  FD    K KK      
Sbjct  605   QLVNGSLGKVIGFID-DETYQMEKKDAEMQGRNAFEYDSLDISPFDLPDVKQKKYKLIAM  663

Query  1618  ------------------------LIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHK  1722
                                     ++++ ETW+I +   EV A R QIPLILA+A+SIHK
Sbjct  664   RKASSTAIKWPLVRFKLPNGGERTIVVQRETWNIELPNGEVQASRSQIPLILAYAISIHK  723

Query  1723  CQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              QG TL+ +  DL R F  G  YVALSR  + EGL + +F+P  +  HPKV+ F K+L S
Sbjct  724   AQGQTLDRVKVDLGRVFEKGQAYVALSRATTQEGLQVLNFSPAKVMAHPKVVQFYKQLAS  783



>ref|XP_009861135.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Ciona intestinalis]
Length=616

 Score =   288 bits (737),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 172/431 (40%), Positives = 247/431 (57%), Gaps = 34/431 (8%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             +Q +V++ +  G+++F TGSAGTGK+FL++HI+     I    +  VTASTGV+AC + G
Sbjct  194   DQKKVINLVKQGRNLFFTGSAGTGKSFLLRHIV----GILPPGQTAVTASTGVAACHIGG  249

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              TLHSFAGIG G A+ E  +    S   V  +WK  + LIIDEIS+ISG+ +DK+E +AR
Sbjct  250   VTLHSFAGIGSGSASIENCIQLAKSRPAVVKQWKACRHLIIDEISMISGDFFDKIEAVAR  309

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQIDLTT  1167
              +R S++       +GGIQ++  GDFFQLPP+   K T K  F++ SW+   D   +L  
Sbjct  310   AVRGSMDP------FGGIQLILCGDFFQLPPVSKGKETVKLCFQSKSWQPCVDVCWELKH  363

Query  1168  VFRQSDPQLVKLLQGIRKGEYDFE--------DLNLLENHCSNLEPDPLAVKLYPRNDDV  1323
             V+RQ+D + +++LQ IR G    +         LN  EN+        LA +L    ++V
Sbjct  364   VYRQTDTKFIQMLQDIRIGRCTAKIEEVLKATKLNKTENN------GILATQLCTHKENV  417

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHK  1503
                NK  L+ L  D I Y A D+         K+      + L  GA+VML KNLN    
Sbjct  418   QLCNKNQLEKLPSDPIVYEAQDSTTAFTDIIDKMLPDTKIITLKKGAQVMLNKNLNVGKG  477

Query  1504  LVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQ  1683
             +VNGA G V GF        T     LP+V+F     +  I+ E W++    +++ VRKQ
Sbjct  478   MVNGARGIVTGF--------TKSEQPLPIVRF-LNGDEHTIKLECWTVKVVCDLIVVRKQ  528

Query  1684  IPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKV  1863
             IPL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR ++LEGL +  F  + ++ 
Sbjct  529   IPLKLAWAISIHKSQGMSLDCVEMSLSRVFECGQAYVALSRARNLEGLRVLDFQASCVRS  588

Query  1864  HPKVLNFDKRL  1896
             +  VL F +R+
Sbjct  589   NVHVLRFYRRI  599



>ref|XP_005939396.1| PREDICTED: ATP-dependent DNA helicase PIF1-like isoform X1 [Haplochromis 
burtoni]
 ref|XP_005939397.1| PREDICTED: ATP-dependent DNA helicase PIF1-like isoform X2 [Haplochromis 
burtoni]
 ref|XP_005939398.1| PREDICTED: ATP-dependent DNA helicase PIF1-like isoform X3 [Haplochromis 
burtoni]
Length=632

 Score =   288 bits (738),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 173/432 (40%), Positives = 246/432 (57%), Gaps = 29/432 (7%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K   EQ+ VL A+ +GK+VF TGSAGTGK+FL++ I+  L         + TASTGV+AC
Sbjct  201   KLNKEQAAVLSAVLSGKNVFFTGSAGTGKSFLLKRIMGSLPP----KSTFATASTGVAAC  256

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLH+FAGIG G A  E+ + ++     V   W   + LIIDEIS++  + +DKLE
Sbjct  257   HIGGTTLHNFAGIGSGSAPVEQCI-ELAQRPGVLQHWTSCRHLIIDEISMVEAQFFDKLE  315

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              +AR +R S         +GGIQ++  GDF QLPP+   K    F F+A SW+      +
Sbjct  316   AVARSVRRSTEP------FGGIQLIVCGDFLQLPPVSKGKEKASFCFQARSWRKVIQINM  369

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    L+++    +E D  LA +L    DDV  
Sbjct  370   ELTEVQRQTDQSFISLLQAVRVGRVTEEVTAKLIKSANHQIERDGILATRLCTHKDDVDL  429

Query  1330  VNKKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVMLTKNLNARH  1500
              N+  L  L      + A+D+     ++      +G     ++L VGA+VMLTKNL+   
Sbjct  430   TNENKLQQLPGSARLFEALDSDPVLVNTIDAHSPVG---RLIQLKVGAQVMLTKNLDVAR  486

Query  1501  KLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRK  1680
              LVNGA G V+ FES        G + LP V+F     + +++PE W    G  +   R+
Sbjct  487   GLVNGARGVVVDFES--------GKHGLPRVRFLCGVTE-VLKPERWVFKSGGGIHLSRQ  537

Query  1681  QIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIK  1860
             Q+PL LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  F+P +++
Sbjct  538   QLPLKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPRVVR  597

Query  1861  VHPKVLNFDKRL  1896
              +P+VL F ++L
Sbjct  598   ANPEVLLFYRKL  609



>emb|CEG02480.1| unnamed protein product [Fusarium pseudograminearum CS3427]
 emb|CEG02918.1| unnamed protein product [Fusarium pseudograminearum CS3487]
Length=821

 Score =   293 bits (749),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 185/484 (38%), Positives = 271/484 (56%), Gaps = 52/484 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             V  + EQ  VLD  ++  +SVF TG+AGTGK+ L++ II++L+  + +   RV VTASTG
Sbjct  306   VTLSEEQRHVLDLVVNKNQSVFFTGAAGTGKSVLMRAIIKELKAKYAKDPERVAVTASTG  365

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ K+  N++ R+RW   + L++DEIS++ G+L+
Sbjct  366   LAACNIGGITLHSFSGIGLGKEDAPTLIKKIRRNQKARNRWLKTKCLVLDEISMVDGDLF  425

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN---KNTQKFAFEASSWKL  1137
             DKL  I R IR+  NG      WGGIQ++ +GDFFQLPP+ +   K   KFAF+AS+W  
Sbjct  426   DKLSQIGRTIRN--NG----RPWGGIQLIITGDFFQLPPVPDHGAKKETKFAFDASTWTT  479

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE-PDPLAV-KLYPR  1311
             S D  I LT VFRQ DP    +L  +R G    + +   ++    L+  D L   +L+  
Sbjct  480   SIDHTIGLTQVFRQRDPVFANMLNEMRLGRITEDTVRAFKSLERPLQFNDGLDTSELFST  539

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNL  1488
               +V   N++ L  L      Y A D G++  +++L    +AP  + L V A+VML KNL
Sbjct  540   RSEVEYSNERRLRDLPGKPRRYDAQDTGKEEVRDKLLANMMAPKSIVLKVNAQVMLIKNL  599

Query  1489  NARHKLVNGAAGTVIGF----------------------------ESVNGTYETFGTNWL  1584
             +    LVNG+ G VIGF                            +S     E+  ++  
Sbjct  600   D--ESLVNGSLGKVIGFSDEKTFDMSPPDEYDEDDQTAKARKKLLKSFQHESESSASDKY  657

Query  1585  PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLY  1752
             PVV+F   D   + ++ +PE W + +   EV A R Q+PLILAWALSIHK QG TL  + 
Sbjct  658   PVVQFMAGDGTSRVILCQPEEWKVELPNGEVQAKRAQLPLILAWALSIHKAQGQTLERVK  717

Query  1753  TDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD---QPKE  1923
              +L R F  G  YVALSR  + +GL +  F    +  HP+V++F  +L S  +   +PK 
Sbjct  718   VNLGRVFEKGQAYVALSRATTQDGLQVLGFQKAKVMAHPRVIDFYNKLYSAEEALGKPKA  777

Query  1924  DAVT  1935
              ++T
Sbjct  778   QSIT  781



>gb|KFX99163.1| hypothetical protein V490_01914 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=953

 Score =   295 bits (755),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 192/475 (40%), Positives = 259/475 (55%), Gaps = 59/475 (12%)
 Frame = +1

Query  631   EQSQVLDAISA-GKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQS VL+ ++   KSVF TGSAGTGK+ L++ II +LR+++ R   RV VTASTG++AC 
Sbjct  436   EQSNVLELVTQQKKSVFFTGSAGTGKSVLMRAIIAELRKVYKREPDRVAVTASTGLAACN  495

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSF GIGLG+    +L+ K+  N++ ++RW   + LI+DE+S++ GEL+DKLE 
Sbjct  496   IGGVTLHSFGGIGLGKEPVPDLVKKIMRNQKAKNRWLRTKVLIVDEVSMVDGELFDKLEG  555

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQID  1158
             IAR IR   NG      +GGIQ+V +GDFFQLPP+ +   Q KFAF+A +W  S    I 
Sbjct  556   IARFIRK--NGRP----FGGIQLVVTGDFFQLPPVPDYGKQVKFAFDADTWSTSIHHTIG  609

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVYRVN  1335
             LT VFRQ DP+   +L  +R G+     +         LE   L A +L+P  ++V   N
Sbjct  610   LTEVFRQRDPEFANMLNEMRLGKISDATMKNFRKLDRPLEASGLDATELFPTRNEVENSN  669

Query  1336  KKHLDSLHQDLIGYRAVDNGEDSWKEQLKL----GIAPDFLELCVGARVMLTKNLNARHK  1503
                +  L      Y A D G     +QL+      +AP  LEL   A+VML KN++    
Sbjct  670   FMKMRQLKGSGKLYLAEDTGTVRDPQQLERLCQNFMAPKKLELKKHAQVMLIKNMD--DN  727

Query  1504  LVNGAAGTVIGF--ESVNGTYETFGTNWL-------------------------------  1584
             LVNG+ G VIGF  E     YE    + L                               
Sbjct  728   LVNGSIGKVIGFMNEKTFEVYEGVDLDPLDDAGSDGDEHDATREAKRRVRGMMNKDLIAD  787

Query  1585  -----PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMT  1737
                  P+V+F   D   + L+ +PE W + +   EV A R+QIPLILAWALSIHK QG T
Sbjct  788   TGKEYPLVRFFAADGTSRDLLCQPEDWKVELPNGEVQAQRRQIPLILAWALSIHKAQGQT  847

Query  1738  LNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             L  +  DL + F  G  YVALSR  + EGL + +FNP  +  HP+V  F   L S
Sbjct  848   LERVKVDLRKVFENGQAYVALSRATTQEGLWVQNFNPRAVMAHPRVGEFYDSLYS  902



>ref|XP_005721083.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Pundamilia nyererei]
Length=632

 Score =   288 bits (737),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 173/432 (40%), Positives = 245/432 (57%), Gaps = 29/432 (7%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K   EQ+ VL A+ +GK+VF TGSAGTGK+FL++ I+  L         + TASTGV+AC
Sbjct  201   KLNKEQAAVLSAVLSGKNVFFTGSAGTGKSFLLRRIMGSLPP----KSTFATASTGVAAC  256

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLH+FAGIG G A  E+ + ++     V   W   + LIIDEIS++  + +DKLE
Sbjct  257   HIGGTTLHNFAGIGSGSAPVEQCI-ELAQRPGVLQHWTSCRHLIIDEISMVEAQFFDKLE  315

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              +AR +R S         +GGIQ++  GDF QLPP+   K    F F+A SW+      +
Sbjct  316   AVARSVRRSTEP------FGGIQLIVCGDFLQLPPVSKGKEKASFCFQARSWRKVIQINM  369

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    L+++    +E D  LA +L    DDV  
Sbjct  370   ELTEVRRQTDQSFISLLQAVRVGRVTEEVTAKLIKSANHQIERDGILATRLCTHKDDVDL  429

Query  1330  VNKKHLDSLHQDLIGYRAVDNGE---DSWKEQLKLGIAPDFLELCVGARVMLTKNLNARH  1500
              N+  L  L      + A+D+     ++      +G     ++L VGA+VMLTKNL+   
Sbjct  430   TNENKLQQLPGSARLFEALDSDPVLVNTIDAHSPVG---RLIQLKVGAQVMLTKNLDVAR  486

Query  1501  KLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRK  1680
              LVNGA G V+ FES        G + LP V+F     + +++PE W    G  +   R+
Sbjct  487   GLVNGARGVVVDFES--------GKHGLPRVRFLCGVTE-VLKPERWVFKSGGGIHLSRQ  537

Query  1681  QIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIK  1860
             Q+PL LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SLEGL +  F+P +++
Sbjct  538   QLPLKLAWAISIHKSQGMTLDCVEISLARVFESGQAYVALSRARSLEGLRVMDFDPRVVR  597

Query  1861  VHPKVLNFDKRL  1896
               P+VL F ++L
Sbjct  598   ADPEVLLFYRKL  609



>ref|XP_003220289.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Anolis carolinensis]
Length=640

 Score =   288 bits (737),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 179/435 (41%), Positives = 247/435 (57%), Gaps = 29/435 (7%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             +RV  + EQS VL+A+ +GK+VF TGSAGTGK++L++ II  L      +  Y TASTGV
Sbjct  204   SRVTLSQEQSMVLNAVLSGKNVFFTGSAGTGKSYLLKRIIASLPP----NGTYATASTGV  259

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH FAGIG G+A   + + ++     VR +W   + LIIDEIS++ G+ +D
Sbjct  260   AACQIGGTTLHGFAGIGSGKAPLSQCI-ELAQRPGVRQQWLNCRRLIIDEISMVEGDFFD  318

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQK--FAFEASSWKLSF  1143
             KLE +AR +R+       E  +GGIQ++  GDF QLPP+ +K T+K  F F+A SW+   
Sbjct  319   KLEAVARDVRNC------EDPFGGIQLIICGDFLQLPPV-SKGTEKPRFCFQAKSWRRCI  371

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFE---DLNLLENHCSNLEPDP-LAVKLYPR  1311
                ++LT V RQ+D + + LL  +R G    E    L L   H   +E D  LA +L   
Sbjct  372   HLNMELTEVRRQTDREFISLLNMVRLGRCTEEVTRQLTLTATH--KVERDGILATQLCTH  429

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLN  1491
              +DV   N + L  L  +   ++AVD+   S K           +EL  GA+VMLTKNL+
Sbjct  430   KEDVELTNARQLQELPGEQRSFKAVDSDPTSVKIIDAQCPVNSVIELKQGAQVMLTKNLD  489

Query  1492  ARHKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVA  1671
                 LVNGA G V GFE+            LP VKF       +   E W +        
Sbjct  490   VSRGLVNGARGVVTGFET--------DGRGLPKVKFLCGVTNAVGM-ERWLLKGPAGTYL  540

Query  1672  VRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPN  1851
              R+Q+PL LAWA+SIHK QGM+L+C    L R F YG  YVALSR +SL GL +  F+P 
Sbjct  541   SRQQLPLKLAWAISIHKSQGMSLDCAEVSLARVFEYGQAYVALSRARSLVGLRVLDFDPK  600

Query  1852  IIKVHPKVLNFDKRL  1896
             +++ +P VL F K+L
Sbjct  601   VVRANPYVLQFYKQL  615



>ref|XP_002848451.1| DNA repair and recombination protein pif1 [Arthroderma otae CBS 
113480]
 gb|EEQ31138.1| DNA repair and recombination protein pif1 [Arthroderma otae CBS 
113480]
Length=780

 Score =   291 bits (745),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 191/499 (38%), Positives = 266/499 (53%), Gaps = 80/499 (16%)
 Frame = +1

Query  622   WTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVS  792
             ++ EQ+QV++ I   GKSVF TGSAGTGK+ L++ +IR+LR  + R    V VTASTG++
Sbjct  258   FSEEQNQVIETIVKRGKSVFYTGSAGTGKSVLMREVIRQLRLKYRRDLDAVAVTASTGLA  317

Query  793   ACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDK  972
             AC + G TLHS+AG+GLG+ + +EL+ KV  N++ ++RW   + LIIDEIS++ G+ +DK
Sbjct  318   ACNIEGVTLHSYAGVGLGKESTQELVKKVKRNQKAKNRWLKTKVLIIDEISMVDGDFFDK  377

Query  973   LEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEAS-SWKLSFDT  1149
             LE +ARKIR   NG      +GGIQ+V +GDFFQLPP+     +     A+ +W  S   
Sbjct  378   LEELARKIRG--NGRP----FGGIQLVTTGDFFQLPPVPEGGKEAKFAFAAATWNTSIQH  431

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPL-------  1290
              I LT VFRQ DP    +L  +R G         F++L+   N   N+E   L       
Sbjct  432   TILLTQVFRQKDPDFANMLNEMRLGRLSPSAIQAFKELSRPLNCGDNIEATELYDTKFQG  491

Query  1291  --------AVKLYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNG----EDSWKEQLKLGIA  1434
                      +  +P   +V   N + ++ L   ++ + A D+G    E    + L   +A
Sbjct  492   YIHLKLIVIIDRFPTRAEVDLANSERMNRLSGSVMTFHAADSGAIKDEQIRAKLLSNCMA  551

Query  1435  PDFLELCVGARVMLTKNLNARHKLVNGAAGTVIGF-------------ESVNGTYETFG-  1572
             P  + L  GA+VML KN +    LVNG+ GTVI F             +  +G +  F  
Sbjct  552   PPTIHLKKGAQVMLIKNKD--ETLVNGSLGTVIAFMDESGFENHIREGQKYDGAFSNFDG  609

Query  1573  -TNW------------------------LPVVKF---DFKPKKLIIRPETWSI-MDGEEV  1665
              T+W                         P+V F   D   ++L+  PETW I +   EV
Sbjct  610   ETDWGKQKINNMAFDQKSGSGGVTTAKQYPLVAFILPDGSERQLLCMPETWKIELPNGEV  669

Query  1666  VAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFN  1845
              A R+Q+PLILAWALSIHK QG TL  +  DL R F  G  YVALSR  S  GL +S F+
Sbjct  670   QAQRQQVPLILAWALSIHKAQGQTLQRVKVDLGRVFERGQAYVALSRATSKNGLQVSRFD  729

Query  1846  PNIIKVHPKVLNFDKRLCS  1902
             P  + VHPKV  F + L S
Sbjct  730   PKKVMVHPKVTQFYQSLSS  748



>emb|CEG64773.1| Putative YALI0B12892p [Rhizopus microsporus]
Length=695

 Score =   289 bits (739),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 180/460 (39%), Positives = 262/460 (57%), Gaps = 47/460 (10%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             R   + EQ +VL+ +    KS+F TGSAGTGK+ L++ II ++   +G + + VTASTG+
Sbjct  247   RPTLSSEQQRVLEMVLHDKKSLFFTGSAGTGKSVLLRAIIDEMSIRYG-AGLAVTASTGI  305

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKV-CSNRRVRHRWKMVQALIIDEISLISGELY  966
             +AC +NG TLHSF GIG+G    + L+ K+   NR+   RWK    LIIDEIS++  EL+
Sbjct  306   AACNINGCTLHSFGGIGIGNDRVDILVDKIKYDNRKAYERWKKTDVLIIDEISMVDAELF  365

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFD  1146
             DKLE IAR++R S       + +GGIQV+A GDFFQLPP+      +FAFEA+SW     
Sbjct  366   DKLEEIARRLRQST------LPFGGIQVIACGDFFQLPPVNPNRPTRFAFEANSWSTVIK  419

Query  1147  TQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLEN----HCSNLEPDPLAVKLYPRN  1314
               + LT VFRQ D   VK+L  +R G    E + + ++       N E +P   +LYP  
Sbjct  420   QTVMLTQVFRQKDEAFVKILNEMRVGHLSDEAIRIFKSLSRKPAGNDEIEP--TELYPLR  477

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNA  1494
             + V   N+  L++L  D + ++A+D G+ S   Q    +AP+ ++L + A+VML KN++ 
Sbjct  478   NQVETSNRLRLEALRGDTVEFKAIDQGDRSKVSQC---LAPEVIQLKMHAQVMLLKNIDG  534

Query  1495  RHKLVNGAA---------------GTVIGFESVNGTYETF--GTN--------WLPVVKF  1599
                LVNG+                 TV    +     +++   TN          PVV+F
Sbjct  535   --DLVNGSLGVVVGFVGRGEYRKYATVQSLRTPQRQKDSYIDSTNDGKLDMKTPYPVVRF  592

Query  1600  DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFG  1776
                 ++L++  E WS  + G +V+A R QIPL+LAWA+SIHK QG TL+ +  DL + F 
Sbjct  593   S-SGRELVLEYEKWSFELPGGKVLASRSQIPLMLAWAISIHKSQGQTLDRVKVDLGKVFE  651

Query  1777  YGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
              G  YVALSR  SLE L + +F+P  +  HP+V  F + L
Sbjct  652   KGQAYVALSRATSLERLQILNFDPAKVLAHPRVTEFYRTL  691



>ref|XP_011117468.1| hypothetical protein AOL_s00004g517 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX53858.1| hypothetical protein AOL_s00004g517 [Arthrobotrys oligospora 
ATCC 24927]
Length=947

 Score =   294 bits (752),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 191/485 (39%), Positives = 260/485 (54%), Gaps = 62/485 (13%)
 Frame = +1

Query  610   TRVKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR-SRVYVTAST  783
             TR   + EQS VLD  ++ GKSVF TGSAGTGK+ L++ II  LR+ H     V +TAST
Sbjct  429   TRHYMSDEQSHVLDMVVNEGKSVFFTGSAGTGKSVLLREIITGLRKKHKNYDSVAITAST  488

Query  784   GVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGEL  963
             G++AC + G TLHSF+GIGLG  + E+L+ K+    + + RW   + LIIDEIS++ G+L
Sbjct  489   GLAACNIGGVTLHSFSGIGLGRESVEQLVKKIRRVPKSKQRWLRAKVLIIDEISMVDGDL  548

Query  964   YDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIF-NKNTQKFAFEASSWKLS  1140
             +DKLE +AR +++  NG      +GGIQ+V +GDFFQLPP+  N    KFAFEA++W   
Sbjct  549   FDKLEGVARTLKN--NGRP----FGGIQLVVTGDFFQLPPVPDNGKAAKFAFEANTWSNC  602

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDP--LAVKLYPRN  1314
              D  I LT +FRQ DP    +L  +R G      +   +    NL  D    A +L+P  
Sbjct  603   VDHTILLTHIFRQKDPVFAGMLNEMRLGTLSPASIANFKKLTRNLNFDDGLQATELFPTR  662

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVMLTK  1482
              +V   N + L  L  D   + AVD     +   +E+L    +AP  LEL  GA+VML K
Sbjct  663   KEVDNANLRQLRGLPGDSYTFTAVDESAILDQQQREKLLTNCMAPQILELKQGAQVMLVK  722

Query  1483  NLNARHKLVNGAAGTVIGFES---------------------------------------  1545
             N++    LVNG+ G V+ F S                                       
Sbjct  723   NMD--ETLVNGSLGRVVAFMSEKTYAMVQDELPGGEDQIFGSQGEGDLRDMSKREREIHE  780

Query  1546  --VNGTYETFGTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWA  1707
               +N    T  T   P+V++   D   ++ ++ PE W   +   EV A RKQ+PLILAWA
Sbjct  781   KYINEQSRTNTTKKYPLVQWSIADGTQRRTLMLPEAWKFELPTGEVQASRKQVPLILAWA  840

Query  1708  LSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFD  1887
             LSIHK QG TL+ +  DLN+ F  G  YVALSR  + EGL +  FN N +  H KV  F 
Sbjct  841   LSIHKAQGQTLDRVKVDLNKVFEKGQAYVALSRATTQEGLQVLGFNANKVMAHEKVRVFY  900

Query  1888  KRLCS  1902
             + L S
Sbjct  901   RSLTS  905



>gb|ENH73204.1| DNA repair and recombination protein pif1, mitochondrial [Fusarium 
oxysporum f. sp. cubense race 1]
Length=820

 Score =   291 bits (746),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 187/491 (38%), Positives = 273/491 (56%), Gaps = 65/491 (13%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             +  + EQ  VLD  ++  +SVF TG+AGTGK+ L++ II +L++ + +   RV VTASTG
Sbjct  305   ISLSEEQRHVLDLVVNKNQSVFFTGAAGTGKSVLMRAIITELKKKYAKDPERVAVTASTG  364

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ K+  N + ++RW   + L+IDEIS++ G+L+
Sbjct  365   LAACNIGGITLHSFSGIGLGKEDAPTLVKKIRRNPKAKNRWLRTKCLVIDEISMVDGDLF  424

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN---KNTQKFAFEASSWKL  1137
             DKL  I R IR+  NG      WGGIQ++ +GDFFQLPP+     K   KFAF+AS+W  
Sbjct  425   DKLSQIGRTIRN--NGRP----WGGIQLIITGDFFQLPPVPEQGAKRETKFAFDASTWTT  478

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVK  1299
             S D  I LT VFRQ DP    +L  +R G         F+ L    N    L       +
Sbjct  479   SIDHTIGLTQVFRQRDPVFANMLNEMRLGRITEDTVRAFKKLERPLNFNDGLG----TAE  534

Query  1300  LYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVML  1476
             L+   ++V   N++ L  L   +  Y A D G++  +++L +  +AP  ++L + A+VML
Sbjct  535   LFSTRNEVEMSNERRLRDLPGTIRRYEAQDTGKEDIRDKLLMNMMAPKSIDLKINAQVML  594

Query  1477  TKNLNARHKLVNGAAGTVIGFESVNGTYE----------------------TF-------  1569
              KNL+    LVNG+ G VIGF S   T++                      TF       
Sbjct  595   IKNLD--ESLVNGSLGKVIGF-SDEKTFDMEPIDEFDEEERMAKARKKLLNTFKRESDSS  651

Query  1570  --GTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQG  1731
               GT + PVV+F   D   + ++ +PE W + +   E+ A R Q+PLILAWALSIHK QG
Sbjct  652   SSGTKF-PVVQFMATDGTSRVILCQPEEWKVELPNGELQAKRTQLPLILAWALSIHKAQG  710

Query  1732  MTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD  1911
              TL  +  +L R F  G  YVALSR  + +GL +  F    +  HP+V++F  +L S  +
Sbjct  711   QTLERVKVNLGRVFEKGQAYVALSRATTQDGLQVLGFQKTKVMAHPRVIDFYNKLYSAEE  770

Query  1912  ---QPKEDAVT  1935
                +PK  ++T
Sbjct  771   ALGKPKAQSIT  781



>gb|KFY28485.1| hypothetical protein V491_00441 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=868

 Score =   293 bits (749),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 189/478 (40%), Positives = 261/478 (55%), Gaps = 60/478 (13%)
 Frame = +1

Query  625   TVEQSQVLDAISA-GKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSA  795
             + EQS VL+ ++   KSVF TGSAGTGK+ L++ II +LR+++ R   RV VTASTG++A
Sbjct  353   SAEQSNVLELVTQHKKSVFFTGSAGTGKSVLMRAIIAELRKVYKREPDRVAVTASTGLAA  412

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLHSF GIGLG+    +L+ K+  N++ ++RW   + L++DE+S++ GEL+DKL
Sbjct  413   CNIGGVTLHSFGGIGLGKEPVPDLVKKIMRNQKAKNRWLRTKVLVVDEVSMVDGELFDKL  472

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQ  1152
             E IAR IR   NG      +GGIQ+V +GDFFQLPP+ +   Q KFAF+A +W  S    
Sbjct  473   EGIARFIRK--NGRP----FGGIQLVVTGDFFQLPPVPDYGKQVKFAFDADTWSTSIHHT  526

Query  1153  IDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVYR  1329
             I LT VFRQ DP    +L  +R G+     +   +     LE   L A +L+P  ++V  
Sbjct  527   IGLTEVFRQRDPVFANMLNEMRLGKISDATMKAFKKLDRPLETTGLDATELFPTRNEVDN  586

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKL----GIAPDFLELCVGARVMLTKNLNAR  1497
              N   +  L      Y + D+G     +QL+      +AP  LEL   A+VML KN++  
Sbjct  587   SNFMKMRQLQGAGKIYLSEDSGSVRDPQQLERLLQNFMAPKKLELKKHAQVMLIKNMD--  644

Query  1498  HKLVNGAAGTVIGF--ESVNGTYETFGTNWL-----------------------------  1584
               LVNG+ G V+GF  E     YE    + L                             
Sbjct  645   DNLVNGSIGKVLGFMNEKTFEAYEGVDLDPLDDAGSDAEDPHDATREARRRVRGMMNKDL  704

Query  1585  --------PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQ  1728
                     P+V+F   D   + L+ +PE W + +   E+ A R+QIPLILAWALSIHK Q
Sbjct  705   IADTGKEYPIVRFYAADGTSRDLLCQPEDWKVELPNGEIQAQRRQIPLILAWALSIHKAQ  764

Query  1729  GMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             G TL  +  DL + F  G  YVALSR  + EGL + +FNP  +  HPKV  F   L S
Sbjct  765   GQTLERVKVDLRKVFENGQAYVALSRATTQEGLWVQNFNPRAVMAHPKVGEFYNSLYS  822



>ref|XP_009256580.1| hypothetical protein FPSE_05187 [Fusarium pseudograminearum CS3096]
 gb|EKJ74641.1| hypothetical protein FPSE_05187 [Fusarium pseudograminearum CS3096]
 emb|CEG02304.1| unnamed protein product [Fusarium pseudograminearum CS3220]
Length=821

 Score =   291 bits (746),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 184/484 (38%), Positives = 271/484 (56%), Gaps = 52/484 (11%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             V  + EQ  VLD  ++  +SVF TG+AGTGK+ L++ II++L+  + +   RV VTASTG
Sbjct  306   VTLSEEQRHVLDLVVNKNQSVFFTGAAGTGKSVLMRAIIKELKAKYAKDPERVAVTASTG  365

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ K+  N++ ++RW   + L++DEIS++ G+L+
Sbjct  366   LAACNIGGITLHSFSGIGLGKEDAPTLIKKIRRNQKAKNRWLKTKCLVLDEISMVDGDLF  425

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN---KNTQKFAFEASSWKL  1137
             DKL  I R IR+  NG      WGGIQ++ +GDFFQLPP+ +   K   KFAF+AS+W  
Sbjct  426   DKLSQIGRTIRN--NG----RPWGGIQLIITGDFFQLPPVPDHGAKKETKFAFDASTWTT  479

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLE-PDPLAV-KLYPR  1311
             S D  I LT VFRQ DP    +L  +R G    + +   ++    L+  D L   +L+  
Sbjct  480   SIDHTIGLTQVFRQRDPVFANMLNEMRLGRITEDTVRAFKSLERPLQFNDGLDTSELFST  539

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVMLTKNL  1488
               +V   N++ L  L      Y A D G++  +++L    +AP  + L V A+VML KNL
Sbjct  540   RSEVEYSNERRLRDLPGKPRRYDAQDTGKEEVRDKLLANMMAPKSIVLKVNAQVMLIKNL  599

Query  1489  NARHKLVNGAAGTVIGF----------------------------ESVNGTYETFGTNWL  1584
             +    LVNG+ G VIGF                            +S     E+  ++  
Sbjct  600   D--ESLVNGSLGKVIGFSDEKTFDMSPPDEYDEDDQTAKARKKLLKSFQHESESSASDKY  657

Query  1585  PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLY  1752
             PVV+F   D   + ++ +PE W + +   EV A R Q+PLILAWALSIHK QG TL  + 
Sbjct  658   PVVQFMAGDGTSRVILCQPEEWKVELPNGEVQAKRAQLPLILAWALSIHKAQGQTLERVK  717

Query  1753  TDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD---QPKE  1923
              +L R F  G  YVALSR  + +GL +  F    +  HP+V++F  +L S  +   +PK 
Sbjct  718   VNLGRVFEKGQAYVALSRATTQDGLQVLGFQKAKVMAHPRVIDFYNKLYSAEEALGKPKA  777

Query  1924  DAVT  1935
              ++T
Sbjct  778   QSIT  781



>emb|CEI95435.1| Putative YALI0B12892p [Rhizopus microsporus]
Length=695

 Score =   288 bits (738),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 180/460 (39%), Positives = 262/460 (57%), Gaps = 47/460 (10%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAI-SAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             R   + EQ +VL+ +    KS+F TGSAGTGK+ L++ II ++   +G + + VTASTG+
Sbjct  247   RPTLSSEQQRVLEMVLHDKKSLFFTGSAGTGKSVLLRAIIDEMSIRYG-AGLAVTASTGI  305

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKV-CSNRRVRHRWKMVQALIIDEISLISGELY  966
             +AC +NG TLHSF GIG+G    + L+ K+   NR+   RWK    LIIDEIS++  EL+
Sbjct  306   AACNINGCTLHSFGGIGIGNDRVDILVDKIKYDNRKAYERWKKTDVLIIDEISMVDAELF  365

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQKFAFEASSWKLSFD  1146
             DKLE IAR++R S       + +GGIQV+A GDFFQLPP+      +FAFEA+SW     
Sbjct  366   DKLEEIARRLRQST------LPFGGIQVIACGDFFQLPPVNPNRPTRFAFEANSWSTVIK  419

Query  1147  TQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLEN----HCSNLEPDPLAVKLYPRN  1314
               + LT VFRQ D   VK+L  +R G    E + + ++       N E +P   +LYP  
Sbjct  420   QTVMLTQVFRQKDEAFVKILNEMRVGHLSDEAIRIFKSLSRKPAGNDEIEP--TELYPLR  477

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNA  1494
             + V   N+  L++L  D + ++A+D G+ S   Q    +AP+ ++L + A+VML KN++ 
Sbjct  478   NQVETSNRLRLEALRGDTVEFKAIDQGDRSKVSQC---LAPEVIQLKMHAQVMLLKNIDG  534

Query  1495  RHKLVNGAA---------------GTVIGFESVNGTYETF--GTN--------WLPVVKF  1599
                LVNG+                 TV    +     +++   TN          PVV+F
Sbjct  535   --DLVNGSLGVVVGFVGRGEYRKYATVQSLRTPQRQKDSYIDSTNDGKLDMKTPYPVVRF  592

Query  1600  DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFG  1776
                 ++L++  E WS  + G +V+A R QIPL+LAWA+SIHK QG TL+ +  DL + F 
Sbjct  593   S-SGRELVLEYEKWSFELPGGKVLASRSQIPLMLAWAISIHKSQGQTLDRVKVDLGKVFE  651

Query  1777  YGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
              G  YVALSR  SLE L + +F+P  +  HP+V  F + L
Sbjct  652   KGQAYVALSRATSLERLQILNFDPAKVLAHPRVTEFYRTL  691



>gb|KFY56242.1| hypothetical protein V497_06412 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=953

 Score =   294 bits (752),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 189/469 (40%), Positives = 257/469 (55%), Gaps = 59/469 (13%)
 Frame = +1

Query  631   EQSQVLDAISA-GKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQS VL+ ++   KSVF TGSAGTGK+ L++ II +LR+++ R   RV VTASTG++AC 
Sbjct  436   EQSNVLELVTQQKKSVFFTGSAGTGKSVLMRAIIAELRKVYKREPDRVAVTASTGLAACN  495

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSF GIGLG+    +L+ K+  N++ ++RW   + L++DE+S++ GEL+DKLE 
Sbjct  496   IGGVTLHSFGGIGLGKEPVPDLVKKIMRNQKAKNRWLRTKVLVVDEVSMVDGELFDKLEG  555

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQID  1158
             IAR IR   NG      +GGIQ+V +GDFFQLPP+ +   Q KFAF+A +W  S    I 
Sbjct  556   IARFIRK--NGRP----FGGIQLVVTGDFFQLPPVPDYGKQVKFAFDADTWSTSIHHTIG  609

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVYRVN  1335
             LT VFRQ DP+   +L  +R G+     +         LE   L A +L+P  ++V   N
Sbjct  610   LTEVFRQRDPEFANMLNEMRLGKISDATMKNFRKLDRPLEASGLDATELFPTRNEVENSN  669

Query  1336  KKHLDSLHQDLIGYRAVDNGEDSWKEQLKL----GIAPDFLELCVGARVMLTKNLNARHK  1503
                +  L      Y A D G     +QL+      +AP  LEL   A+VML KN++    
Sbjct  670   FMKMRQLKGSGKLYLAEDTGSVRDPQQLERLCQNFMAPKKLELKKHAQVMLIKNMD--DN  727

Query  1504  LVNGAAGTVIGF--ESVNGTYETFGTNWL-------------------------------  1584
             LVNG+ G VIGF  E     YE    + L                               
Sbjct  728   LVNGSIGKVIGFMNEKTFEVYEGVDLDPLDDAGSDGDEHDATREAKRRVRGMMNKDLIAD  787

Query  1585  -----PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMT  1737
                  P+V+F   D   + L+ +PE W + +   EV A R+QIPLILAWALSIHK QG T
Sbjct  788   TGKEYPLVRFFAADGTSRVLLCQPEDWKVELPNGEVQAQRRQIPLILAWALSIHKAQGQT  847

Query  1738  LNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNF  1884
             L  +  DL + F  G  YVALSR  + EGL + +FNP  +  HP+V  F
Sbjct  848   LERVKVDLRKVFENGQAYVALSRATTQEGLWVQNFNPRAVMAHPRVGEF  896



>gb|EQB51081.1| DNA repair and recombination protein pif1 [Colletotrichum gloeosporioides 
Cg-14]
Length=852

 Score =   292 bits (747),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 189/490 (39%), Positives = 267/490 (54%), Gaps = 60/490 (12%)
 Frame = +1

Query  610   TRVKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTAS  780
             T +  T EQ  V +  ++ G+SVF TG AGTGK+ L++ II +L++   R   R+ VTAS
Sbjct  325   TAIALTKEQKHVQNLVVNKGQSVFFTGPAGTGKSVLMRSIITELKKKWARDPERLAVTAS  384

Query  781   TGVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGE  960
             TG++AC + G TLHSF+GIGLG+   + L+ K+  N + ++RW   + LI+DE+S++ GE
Sbjct  385   TGLAACNIGGQTLHSFSGIGLGKEDVQTLVKKIRRNPKAKNRWLRTKTLIMDEVSMVDGE  444

Query  961   LYDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ---KFAFEASSW  1131
             L+DKL  I R IR+  NG      WGGIQ+V +GDFFQLPP+ + +     KFAFEA++W
Sbjct  445   LFDKLSQIGRTIRN--NGKP----WGGIQLVVTGDFFQLPPVPDSDKSRDAKFAFEAATW  498

Query  1132  KLSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL-EPDPLAV-KLY  1305
               + D  I LT VFRQ DP    +L  +R G    + +         +   D L V +L+
Sbjct  499   NTAIDHTIGLTQVFRQRDPVFANMLNEMRLGRISEQTVQAFRKLTRPIVSDDGLEVTELF  558

Query  1306  PRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ-LKLGIAPDFLELCVGARVMLTK  1482
             P   +V   N+  L +L      Y A D G+ + +++ L+  +AP  +EL VGA+VML K
Sbjct  559   PTRWEVENSNQARLRNLPGKPYRYDASDGGDANVRDKLLQNMMAPKTIELKVGAQVMLIK  618

Query  1483  NLNARHKLVNGAAGTVIGFESVNGTYE---------------------------------  1563
             N++    LVNG+ G V+ F S  G++E                                 
Sbjct  619   NMD--DTLVNGSLGKVVKFMS-EGSFESWTMPEYGSDVDVDSEDKAKKKIKAFSREVEEA  675

Query  1564  TFGTNWLPVVKF---DFKPKKLIIRPETWSIMDGE-EVVAVRKQIPLILAWALSIHKCQG  1731
             T GT   PVV+F   D   + ++  PE W +     EV A R Q+PLILAWALSIHK QG
Sbjct  676   TSGTTEFPVVEFAAVDGTTRTILCVPEDWKVETPTGEVQASRSQLPLILAWALSIHKAQG  735

Query  1732  MTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD  1911
              TL  +  DL + F  G  YVALSR    +GL +  F  + +  HP+V+ F  +L S   
Sbjct  736   QTLERVKVDLGKVFEKGQAYVALSRATCQDGLQVLRFQKDKVMAHPRVIQFYNKLYS---  792

Query  1912  QPKEDAVTKK  1941
                E AV KK
Sbjct  793   --AEVAVAKK  800



>gb|KFY02695.1| hypothetical protein O988_01968 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=981

 Score =   294 bits (752),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 191/476 (40%), Positives = 259/476 (54%), Gaps = 60/476 (13%)
 Frame = +1

Query  631   EQSQVLDAISA-GKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQS VL+ ++   KSVF TGSAGTGK+ L++ II +LR+++ R   RV VTASTG++AC 
Sbjct  463   EQSNVLELVTQHKKSVFFTGSAGTGKSVLMRAIIAELRKVYKREPDRVAVTASTGLAACN  522

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSF GIGLG+    +L+ K+  N++ ++RW   + L++DE+S++ GEL+DKLE 
Sbjct  523   IGGVTLHSFGGIGLGKEPVPDLVKKIMRNQKAKNRWLRTKVLVVDEVSMVDGELFDKLEG  582

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQID  1158
             IAR IR   NG      +GGIQ+V +GDFFQLPP+ +   Q KFAF+A +W  S    I 
Sbjct  583   IARFIRK--NGRP----FGGIQLVVTGDFFQLPPVPDYGKQVKFAFDADTWSTSIHHTIG  636

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVYRVN  1335
             LT VFRQ DP+   +L  +R G+     +         LE   L A +L+P  ++V   N
Sbjct  637   LTEVFRQRDPEFANMLNEMRLGKISDATMKNFRKLDRPLEASGLDATELFPTRNEVENSN  696

Query  1336  KKHLDSLHQDLIGYRAVDNGEDSWKEQLKL----GIAPDFLELCVGARVMLTKNLNARHK  1503
                +  L      Y A D G     +QL+      +AP  LEL   A+VML KN++    
Sbjct  697   FMKMRQLKGSGKLYLAEDTGTVRDPQQLERLCQNFMAPKKLELKKHAQVMLIKNMD--DN  754

Query  1504  LVNGAAGTVIGF--ESVNGTYETFGTNWL-------------------------------  1584
             LVNG+ G VIGF  E     YE    + L                               
Sbjct  755   LVNGSIGKVIGFMNEKTFEVYEGVDLDPLADDAGSDPDEHDATREAKRRVRGMMNKDLIA  814

Query  1585  ------PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGM  1734
                   P+V+F   D   + L+ +PE W + +   EV A R+QIPLILAWALSIHK QG 
Sbjct  815   DTGKEYPLVRFFAADGTSRDLLCQPEDWKVELPNGEVQAQRRQIPLILAWALSIHKAQGQ  874

Query  1735  TLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             TL  +  DL + F  G  YVALSR  + EGL + +FNP  +  HP+V  F   L S
Sbjct  875   TLERVKVDLRKVFENGQAYVALSRATTQEGLWVQNFNPRAVMAHPRVGEFYDSLYS  930



>ref|XP_385698.1| hypothetical protein FG05522.1 [Fusarium graminearum PH-1]
 gb|ESU11493.1| hypothetical protein FGSG_05522 [Fusarium graminearum PH-1]
Length=819

 Score =   291 bits (745),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 187/489 (38%), Positives = 269/489 (55%), Gaps = 62/489 (13%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             V  + EQ  VLD  ++  +SVF TG+AGTGK+ L++ II+ L+  + +   RV VTASTG
Sbjct  304   VSLSEEQKHVLDLVVNKNQSVFFTGAAGTGKSVLMRAIIKDLKTKYAKDPERVAVTASTG  363

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ K+  N++ ++RW   + L++DEIS++ G+L+
Sbjct  364   LAACNIGGITLHSFSGIGLGKEDAPTLIKKIRRNQKAKNRWLKTKCLVLDEISMVDGDLF  423

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI----FNKNTQKFAFEASSWK  1134
             DKL  I R IR+  NG      WGGIQ++ +GDFFQLPP+     NK T KFAF+AS+W 
Sbjct  424   DKLSQIGRTIRN--NG----RPWGGIQLIITGDFFQLPPVPDHGANKVT-KFAFDASTWT  476

Query  1135  LSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAV  1296
              S D  I LT VFRQ DP    +L  +R G         F+ L         LE      
Sbjct  477   TSIDHTIGLTQVFRQRDPVFANMLNEMRLGRITEDTVRAFKSLERPLQFNDGLE----TS  532

Query  1297  KLYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVM  1473
             +L+   ++V   N++ L  L      Y A D G++  +++L    +AP  + L V A+VM
Sbjct  533   ELFSTRNEVEYSNERRLRDLPGKPRRYDAQDTGKEEVRDKLLANMMAPKSIVLKVNAQVM  592

Query  1474  LTKNLNARHKLVNGAAGTVIGF----------------------------ESVNGTYETF  1569
             L KNL+    LVNG+ G VIGF                            +S     E+ 
Sbjct  593   LIKNLD--ESLVNGSLGKVIGFSDEKTFDMSPPDEYDEDDQSAKARKKLLKSFQHESESS  650

Query  1570  GTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMT  1737
              ++  PVV+F   D   + ++ +PE W + +   EV A R Q+PLILAWALSIHK QG T
Sbjct  651   ASDKYPVVQFMAGDGTSRVILCQPEEWKVELPNGEVQAKRAQLPLILAWALSIHKAQGQT  710

Query  1738  LNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD--  1911
             L  +  +L R F  G  YVALSR  + +GL +  F    +  HP+V++F  +L S  +  
Sbjct  711   LERVKVNLGRVFEKGQAYVALSRATTQDGLQVLGFQKAKVMAHPRVIDFYNKLYSAEEAL  770

Query  1912  -QPKEDAVT  1935
              +PK  ++T
Sbjct  771   GKPKAQSIT  779



>ref|XP_002174910.2| pif1 helicase Pfh1 [Schizosaccharomyces japonicus yFS275]
 gb|EEB08617.2| pif1 helicase Pfh1 [Schizosaccharomyces japonicus yFS275]
Length=807

 Score =   291 bits (744),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 190/481 (40%), Positives = 272/481 (57%), Gaps = 67/481 (14%)
 Frame = +1

Query  631   EQSQVLDAISAGK-SVFVTGSAGTGKTFLIQHIIRKLR-EIHGR-SRVYVTASTGVSACA  801
             EQ +VL+ +   + SVF TGSAGTGK+ L++ II+ L+   H    RV VTASTG++AC 
Sbjct  314   EQRRVLEMVVDKRHSVFFTGSAGTGKSVLLRKIIKTLKTRFHSDPDRVAVTASTGLAACN  373

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAGIGLG+ +A +L+ K+  N++   RW   + L+IDE+S++  EL DKLE 
Sbjct  374   IGGVTLHSFAGIGLGKDSAVDLVKKIRKNKKCMQRWLRTRVLVIDEVSMVDAELLDKLEE  433

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQID  1158
             IAR +R+  NG      +GGIQ+V +GDFFQLPP+ +   + +F FE+ +W+ + D  I 
Sbjct  434   IARILRN--NGRP----FGGIQLVLTGDFFQLPPVPDSGKEARFCFESKTWESALDYTIC  487

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRNDDVYRV  1332
             LT VFRQ D   VK+L  +R G+   E +    +   N+  E   L  +L+P   +V R 
Sbjct  488   LTHVFRQKDEGFVKILNELRLGKLSRESIQKFHSLSRNIRYEDGLLPTELFPTRSEVERS  547

Query  1333  NKKHLDSLHQDLIGYRAVDNG---EDSWKEQ-LKLGIAPDFLELCVGARVMLTKNLNARH  1500
             N   +  + +D + Y A+D G   + + +E+ L+  +AP  L L V A+VML KN++   
Sbjct  548   NSMRMQQISEDPVVYNAIDGGTIRDRAIREKLLQNCMAPQTLVLKVNAQVMLIKNID--E  605

Query  1501  KLVNGAAGTVIGF------------ESVNG----TYETF---------------------  1569
             +LVNG+ G VIGF              ++G     YET                      
Sbjct  606   QLVNGSLGKVIGFVDEETYQAEKRDADIHGRNPFDYETLDPLSDDTPDILYRKRKLKTLM  665

Query  1570  -----GTNWLPVVKFDF---KPKKLIIRPETWSIM--DGEEVVAVRKQIPLILAWALSIH  1719
                     W P+V+F       + L+++ ETW+I   DG EV A R QIPLILA+A+SIH
Sbjct  666   STSTRAQKW-PLVRFSLVGGDERVLVLQRETWNIELPDG-EVQASRTQIPLILAYAISIH  723

Query  1720  KCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLC  1899
             K QG TL  +  DL + F  G  YVALSR  S  GL + +F+P+ +  HPKV+ F K+L 
Sbjct  724   KAQGQTLERVKVDLGKVFEKGQAYVALSRATSEHGLQILNFSPSKVMAHPKVVEFYKKLD  783

Query  1900  S  1902
             S
Sbjct  784   S  784



>gb|KFY37446.1| hypothetical protein V494_04749 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=934

 Score =   293 bits (750),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 192/477 (40%), Positives = 262/477 (55%), Gaps = 60/477 (13%)
 Frame = +1

Query  625   TVEQSQVLDAISA-GKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSA  795
             + EQS VL+ ++   KSVF TGSAGTGK+ L++ II +LR+++ R   RV VTASTG++A
Sbjct  412   SSEQSNVLELVTQHKKSVFFTGSAGTGKSVLMRAIIAELRKVYRREPDRVAVTASTGLAA  471

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLHSF GIGLG+    +L+ K+  N++ ++RW   + LI+DE+S++ GEL+DKL
Sbjct  472   CNIGGVTLHSFGGIGLGKEPVPDLVKKIMRNQKAKNRWLRTKVLIVDEVSMVDGELFDKL  531

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQ  1152
             E IAR IR   NG      +GGIQ+V +GDFFQLPP+ +   Q KFAF+A +W  S    
Sbjct  532   EGIARFIRK--NGRP----FGGIQLVVTGDFFQLPPVPDYGKQVKFAFDADTWSTSIHHT  585

Query  1153  IDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVYR  1329
             I LT VFRQ DP    +L  +R G+   E +         LE   L A +L+P  ++V  
Sbjct  586   IGLTEVFRQRDPVFANMLNEMRLGKISDETMKAFRKLDRPLEASGLDATELFPTRNEVDN  645

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKL----GIAPDFLELCVGARVMLTKNLNAR  1497
              N   +  L      Y A D+G     +QL+      +AP  LEL   A+VML KN++  
Sbjct  646   SNFMKMRQLKGTGKTYLADDSGSVRDPQQLERLLQNFMAPKKLELKKHAQVMLIKNMD--  703

Query  1498  HKLVNGAAGTVIGFESVNGTYETF-GT---------------------------------  1575
               LVNG+ G VIGF +   T+E + GT                                 
Sbjct  704   DNLVNGSIGKVIGFMN-EKTFEVYEGTDLDPLDDDAAGSDTDATSDARRRVRGMMNKDLI  762

Query  1576  ----NWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQG  1731
                    P+V+F   D   + L+ +PE W + +   EV A R+QIPLILAWALSIHK QG
Sbjct  763   ADTSKEYPLVRFFSADGTSRDLLCQPEDWKVELPNGEVQAQRRQIPLILAWALSIHKAQG  822

Query  1732  MTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              TL  +  DL + F  G  YVALSR  + EGL + +FNP  +  H +V  F   L S
Sbjct  823   QTLERVKVDLRKVFENGQAYVALSRATTQEGLWVQNFNPRAVMAHKRVGEFYDSLYS  879



>ref|XP_005685899.1| PREDICTED: ATP-dependent DNA helicase PIF1, partial [Capra hircus]
Length=504

 Score =   283 bits (723),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 165/429 (38%), Positives = 246/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL A+  G+S+F TGSAGTGK++L++ I+  L      +    TASTGV
Sbjct  66    TKPELSKEQAAVLRAVLKGQSIFFTGSAGTGKSYLLKRILGSLPP----TGTVATASTGV  121

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  122   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQGWLNCQRLVIDEISMVEADLFD  180

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       +   +GGIQ++  GDF QLPP+  K +Q  +F F+A SW+   
Sbjct  181   KLEAVARAVR------QQNKPFGGIQLIICGDFLQLPPV-TKGSQLPQFCFQAKSWRRCV  233

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L    ++       +A +L    D
Sbjct  234   QVTLELTEVWRQTDKTFISLLQAVRLGRCSDEVTRQLRATAAHKVGRDGIVATRLCTHQD  293

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N++ L  L  ++  + A+D+  +  +           L+L +GA+VML KNL   
Sbjct  294   DVALTNERQLQELPGEVHSFEAMDSDPEQARTLDAQCPVSQLLQLKLGAQVMLVKNLAVS  353

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+     E  G   LP V+F     + +IR + W++      +  R
Sbjct  354   RGLVNGARGVVVGFEA-----EGRG---LPQVRFLCGVTE-VIRADRWTVQTTGGQLLSR  404

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SLEGL +  F+P ++
Sbjct  405   QQLPLQLAWAISIHKSQGMSLDCVEMSLGRVFASGQAYVALSRARSLEGLRVLDFDPMVV  464

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  465   RCDPRVLSF  473



>gb|EMT70193.1| DNA repair and recombination protein pif1, mitochondrial [Fusarium 
oxysporum f. sp. cubense race 4]
Length=820

 Score =   291 bits (744),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 187/491 (38%), Positives = 273/491 (56%), Gaps = 65/491 (13%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             +  + EQ  VLD  ++  +SVF TG+AGTGK+ L++ II +L++ + +   RV VTASTG
Sbjct  305   ISLSEEQRHVLDLVVNKNQSVFFTGAAGTGKSVLMRAIITELKKKYAKDPERVAVTASTG  364

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ K+  N + ++RW   + L+IDEIS++ G+L+
Sbjct  365   LAACNIGGITLHSFSGIGLGKEDAPTLVKKIRRNPKAKNRWLRTKCLVIDEISMVDGDLF  424

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN---KNTQKFAFEASSWKL  1137
             DKL  I R IR+  NG      WGGIQ++ +GDFFQLPP+     K   KFAF+AS+W  
Sbjct  425   DKLSQIGRTIRN--NG----RPWGGIQLIITGDFFQLPPVPEQGAKRETKFAFDASTWTT  478

Query  1138  SFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVK  1299
             S D  I LT VFRQ DP    +L  +R G         F+ L    N    L       +
Sbjct  479   SIDHTIGLTQVFRQRDPVFANMLNEMRLGRITEDTVRAFKKLERPLNFNDGLG----TAE  534

Query  1300  LYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVML  1476
             L+   ++V   N++ L  L   +  Y A D G++  +++L    +AP  ++L + A+VML
Sbjct  535   LFSTRNEVEMSNERRLRDLPGTIRRYEAQDTGKEDIRDKLLTNMMAPKSIDLKINAQVML  594

Query  1477  TKNLNARHKLVNGAAGTVIGFESVNGTYE----------------------TF-------  1569
              KNL+    LVNG+ G VIGF S   T++                      TF       
Sbjct  595   IKNLD--ESLVNGSLGKVIGF-SDEKTFDMEPIDEFDEEERMAKARKKLLNTFKRESDSS  651

Query  1570  --GTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQG  1731
               GT + PVV+F   D   + ++ +PE W + +   E+ A R Q+PLILAWALSIHK QG
Sbjct  652   SSGTKF-PVVQFMATDGTSRVILCQPEEWKVELPNGELQAKRTQLPLILAWALSIHKAQG  710

Query  1732  MTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD  1911
              TL  +  +L R F  G  YVALSR  + +GL +  F  + +  HP+V++F  +L S  +
Sbjct  711   QTLERVKVNLGRVFEKGQAYVALSRATTQDGLQVLGFQKSKVMAHPRVIDFYNKLYSAEE  770

Query  1912  ---QPKEDAVT  1935
                +PK  ++T
Sbjct  771   ALGKPKAQSIT  781



>emb|CCF44443.1| DNA repair and recombination protein pif1 [Colletotrichum higginsianum]
Length=838

 Score =   291 bits (745),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 189/485 (39%), Positives = 264/485 (54%), Gaps = 60/485 (12%)
 Frame = +1

Query  625   TVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSA  795
             T EQ  V    ++ G+SVF TG AGTGK+ L++ II +L++   R   R+ VTASTG++A
Sbjct  319   TKEQKHVQSLVVNKGQSVFFTGPAGTGKSVLMRSIIAELKKKWARDPERLAVTASTGLAA  378

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLHSFAGIGLG+     L+ K+  N + ++RW   + LIIDE+S++ GEL+DKL
Sbjct  379   CNIGGQTLHSFAGIGLGKDDIPTLVKKIRRNPKAKNRWLRTKTLIIDEVSMVDGELFDKL  438

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT---QKFAFEASSWKLSFD  1146
               I R IR+  NG      WGGIQ+V +GDFFQLPP+ + +     KFAFEA++W  + D
Sbjct  439   SSIGRTIRN--NGKP----WGGIQLVITGDFFQLPPVPDGDKSRESKFAFEAATWNTAID  492

Query  1147  TQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL-EPDPLAV-KLYPRNDD  1320
               I LT VFRQ DP    +L  +R G+   E +         +   D L V +L+P   +
Sbjct  493   HTIGLTQVFRQRDPVFANMLNEMRLGKISEETVQAFRKLTRPIVSDDGLEVTELFPTRYE  552

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ-LKLGIAPDFLELCVGARVMLTKNLNAR  1497
             V   N+  L SL      + A D+G+   +++ L+  +A   ++L VGA+VML KN++  
Sbjct  553   VENANQGRLRSLPGKTYRFDAADSGDPQVRDKLLQNMMAAKTIDLKVGAQVMLIKNMD--  610

Query  1498  HKLVNGAAGTVIGFESVNGTYETF---------------------------------GTN  1578
               LVNG+ G V  F S  G++E++                                 GT 
Sbjct  611   DTLVNGSLGKVTRFMS-EGSFESWHMTDYGSDVDASEEGDLKRKIKAFSREVEEATKGTT  669

Query  1579  WLPVVKF---DFKPKKLIIRPETWSIMDGE-EVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
               PVV+F   D   + ++  PE W +     EV A R Q+PLILAWALSIHK QG TL  
Sbjct  670   EFPVVEFAAVDGSTRTILCVPEDWKVETPTGEVQASRSQLPLILAWALSIHKAQGQTLER  729

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKED  1926
             +  DL + F  G  YVALSR  S +GL +  F  + +  HP+V+ F  +L S      E 
Sbjct  730   VKVDLGKVFEKGQAYVALSRATSQQGLQVLRFQKDKVMAHPRVVGFYNKLYS-----AEQ  784

Query  1927  AVTKK  1941
             AV KK
Sbjct  785   AVAKK  789



>gb|ESZ96563.1| hypothetical protein SBOR_3065 [Sclerotinia borealis F-4157]
Length=898

 Score =   292 bits (748),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 191/488 (39%), Positives = 266/488 (55%), Gaps = 68/488 (14%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             +  T EQS+V D  +   KSVF TGSAGTGK+ L++ II  L++ + R   RV VTASTG
Sbjct  375   IHLTDEQSRVKDLVVDQAKSVFFTGSAGTGKSVLMRSIIAALKKKYVREGDRVAVTASTG  434

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF GIGLG+     L+ K+  N + + RW   + L++DEIS++ G+L+
Sbjct  435   LAACNIGGVTLHSFGGIGLGKEDVPTLIKKIKKNNKAKLRWTRTKVLVVDEISMVDGDLF  494

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ----KFAFEASSWK  1134
             DKLE IAR IR+  NG      +GGIQ+V +GDFFQLPP+ + N +    KFAF+A++W 
Sbjct  495   DKLEAIARGIRN--NGRP----FGGIQLVITGDFFQLPPVPDYNQKSRGVKFAFDATTWG  548

Query  1135  LSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLL--ENHCSNLEPDPLAVKLYP  1308
              +    I LT VFRQ DP    +L  +R G+   + +N         N E D  A +L+P
Sbjct  549   TAIHHTIGLTEVFRQKDPVFANMLNEMRLGKVSQDTINAFVGMKRAINYEDDLTATELFP  608

Query  1309  RNDDVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVML  1476
               ++V   N   L SLH     Y AVD+G   ++  +E+L    +AP  +EL  GA+VML
Sbjct  609   TRNEVENSNTFRLRSLHGKSYKYEAVDSGTITDEGMREKLLANMMAPKSVELKKGAQVML  668

Query  1477  TKNLNARHKLVNGAAGTVIGFESVNGTYETFGTN--------------------------  1578
              KN++    LVNG+ G V+ F S   ++E + +N                          
Sbjct  669   IKNMD--DGLVNGSLGKVVAFMS-EKSFEIYDSNPEILNEKEFSDAEEENNRQSDLAKFK  725

Query  1579  ----------------WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLIL  1698
                               P+V+F   D   + L+++PE W I +   EV A R Q+PLIL
Sbjct  726   QTNRELPSTGISSSGRLFPLVRFSIPDGTVRDLLVQPEEWKIELPNGEVQAQRSQLPLIL  785

Query  1699  AWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVL  1878
             AWALSIHK QG TL  +  DL + F  G  YVALSR  S  GL + +F+P  +  HP+V 
Sbjct  786   AWALSIHKAQGQTLERVKIDLKKVFENGQAYVALSRATSQAGLEVQNFDPRKVMAHPRVA  845

Query  1879  NFDKRLCS  1902
              F   L S
Sbjct  846   EFYNSLYS  853



>emb|CAO86064.1| putative DNA-helicase, partial [Paraphaeosphaeria minitans]
Length=832

 Score =   291 bits (744),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 185/475 (39%), Positives = 258/475 (54%), Gaps = 53/475 (11%)
 Frame = +1

Query  613   RVKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTAST  783
             R+  + EQ  VL+  +   KSVF TGSAGTGK+ L++ II  LR  + R   RV VTAST
Sbjct  355   RIFLSEEQQNVLNMVVENKKSVFFTGSAGTGKSVLLREIIVGLRRKYVRESDRVAVTAST  414

Query  784   GVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGEL  963
             G++AC + G TLHSF+GIGLG+   E+L+ K+  N + + RW   + L+IDE+S++ G+L
Sbjct  415   GLAACNIGGVTLHSFSGIGLGKEPVEDLVKKIRRNAKAKQRWMRTKVLVIDEVSMVDGDL  474

Query  964   YDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLS  1140
             +DKLE IAR IR+  NG      +GGIQ++ +GDFFQLPP+ +     +FAF+A +W  S
Sbjct  475   FDKLEQIARTIRN--NGRP----FGGIQLIITGDFFQLPPVPDYGKVARFAFDAGTWTTS  528

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEY---DFEDLNLLENHCSNLEPDPLAVKLYPR  1311
              +  I LT VFRQ DP    +L  +R+G            L+      E +  A +L+P 
Sbjct  529   IEHTIGLTHVFRQKDPVFAGMLNEMREGRLTTASIAKFRQLDRPLPASEDNIEATELFPT  588

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ----LKLGIAPDFLELCVGARVMLT  1479
               +V R N+  ++ L   +  + + D G  + KE+    L+  + P  + L  GA+VML 
Sbjct  589   RQEVERANQARMNQLQGQIYEFESRDGGTVTDKEKRDKLLQSCMVPANIYLKKGAQVMLV  648

Query  1480  KNLNARHKLVNGAAGTVIGF-----------------ESVNGTYE----------TFGTN  1578
             KN++    LVNG+ G V GF                 E  + T E          T G N
Sbjct  649   KNMD--DTLVNGSLGKVTGFMTEQMFAFYRENEDAFLEGADNTTELDALKKLKEKTLGVN  706

Query  1579  ---WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMT  1737
                  PVV+F   D   + L+ + E W I +   EV A R QIPLILAWALSIHK QG T
Sbjct  707   TAQLYPVVRFAISDGTTRDLLCKREPWKIELPNGEVQASRDQIPLILAWALSIHKAQGQT  766

Query  1738  LNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             L  +  DL R F  G  YVALSR  ++ GL +  F+ + +  H KV  F   L +
Sbjct  767   LERVRVDLGRVFEKGQAYVALSRATNMAGLQVMRFDASKVMAHEKVRAFYSSLST  821



>emb|CDQ77528.1| unnamed protein product [Oncorhynchus mykiss]
Length=742

 Score =   289 bits (739),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 175/429 (41%), Positives = 240/429 (56%), Gaps = 23/429 (5%)
 Frame = +1

Query  619   KWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSAC  798
             K   EQ+ VL A+ +GK+VF TGSAGTGK+FL++ I+  L         Y TASTGV+AC
Sbjct  311   KLNKEQAAVLSAVLSGKNVFFTGSAGTGKSFLLKRIVGSLPP----KSTYATASTGVAAC  366

Query  799   ALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLE  978
              + G TLH+FAGIG G A  E+ + ++     V   W   + LIIDEIS++  + +DKLE
Sbjct  367   HIGGTTLHNFAGIGSGSAPLEQCI-ELAQRPGVLQHWTSCRHLIIDEISMVEAQFFDKLE  425

Query  979   FIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQI  1155
              IAR +R S         +GGI ++  GDF QLPPI   K+   F F++ SW+      +
Sbjct  426   AIARCLRRSTEP------FGGIHLIVCGDFLQLPPISKEKDKATFCFQSRSWRKCIHLNM  479

Query  1156  DLTTVFRQSDPQLVKLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYR  1329
             +LT V RQ+D   + LLQ +R G    E    L+++    +E D  LA +L    DDV  
Sbjct  480   ELTEVRRQTDQSFISLLQAVRVGRVTEEVTAKLIKSAYHKIERDGILATRLCTHKDDVEL  539

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLV  1509
              N   L  L   +  + AVD+     K           L+L VGA+VMLTKNL+ +  LV
Sbjct  540   TNDNKLQQLPGSVRVFEAVDSDPALVKTIDSQSPVSRLLQLKVGAQVMLTKNLDVQRGLV  599

Query  1510  NGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIP  1689
             NGA G V+ F+         G   LP V+F     +  ++PE W    G  +   R+Q+P
Sbjct  600   NGARGVVVDFQP--------GKLGLPRVRFLCGTTE-ALKPERWMFKAGGGLYLSRQQLP  650

Query  1690  LILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHP  1869
             L LAWA+SIHK QGMTL+C+   L R F  G  YVALSR KSLEGL +  F+P++++  P
Sbjct  651   LKLAWAISIHKSQGMTLDCVEISLARVFERGQAYVALSRAKSLEGLRVMDFDPHVVRADP  710

Query  1870  KVLNFDKRL  1896
              VL+F  +L
Sbjct  711   DVLHFYSKL  719



>gb|EYB26197.1| hypothetical protein FG05_05522 [Fusarium graminearum]
Length=883

 Score =   291 bits (746),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 187/489 (38%), Positives = 269/489 (55%), Gaps = 62/489 (13%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             V  + EQ  VLD  ++  +SVF TG+AGTGK+ L++ II+ L+  + +   RV VTASTG
Sbjct  358   VSLSEEQKHVLDLVVNKNQSVFFTGAAGTGKSVLMRAIIKDLKTKYAKDPERVAVTASTG  417

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ K+  N++ ++RW   + L++DEIS++ G+L+
Sbjct  418   LAACNIGGITLHSFSGIGLGKEDAPTLIKKIRRNQKAKNRWLKTKCLVLDEISMVDGDLF  477

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI----FNKNTQKFAFEASSWK  1134
             DKL  I R IR+  NG      WGGIQ++ +GDFFQLPP+     NK T KFAF+AS+W 
Sbjct  478   DKLSQIGRTIRN--NG----RPWGGIQLIITGDFFQLPPVPDHGANKVT-KFAFDASTWT  530

Query  1135  LSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAV  1296
              S D  I LT VFRQ DP    +L  +R G         F+ L         LE      
Sbjct  531   TSIDHTIGLTQVFRQRDPVFANMLNEMRLGRITEDTVRAFKSLERPLQFNDGLE----TS  586

Query  1297  KLYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVM  1473
             +L+   ++V   N++ L  L      Y A D G++  +++L    +AP  + L V A+VM
Sbjct  587   ELFSTRNEVEYSNERRLRDLPGKPRRYDAQDTGKEEVRDKLLANMMAPKSIVLKVNAQVM  646

Query  1474  LTKNLNARHKLVNGAAGTVIGF----------------------------ESVNGTYETF  1569
             L KNL+    LVNG+ G VIGF                            +S     E+ 
Sbjct  647   LIKNLD--ESLVNGSLGKVIGFSDEKTFDMSPPDEYDEDDQSAKARKKLLKSFQHESESS  704

Query  1570  GTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMT  1737
              ++  PVV+F   D   + ++ +PE W + +   EV A R Q+PLILAWALSIHK QG T
Sbjct  705   ASDKYPVVQFMAGDGTSRVILCQPEEWKVELPNGEVQAKRAQLPLILAWALSIHKAQGQT  764

Query  1738  LNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD--  1911
             L  +  +L R F  G  YVALSR  + +GL +  F    +  HP+V++F  +L S  +  
Sbjct  765   LERVKVNLGRVFEKGQAYVALSRATTQDGLQVLGFQKAKVMAHPRVIDFYNKLYSAEEAL  824

Query  1912  -QPKEDAVT  1935
              +PK  ++T
Sbjct  825   GKPKAQSIT  833



>emb|CAO85914.1| putative DNA-helicase [Paraphaeosphaeria minitans]
Length=845

 Score =   291 bits (745),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 185/475 (39%), Positives = 258/475 (54%), Gaps = 53/475 (11%)
 Frame = +1

Query  613   RVKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTAST  783
             R+  + EQ  VL+  +   KSVF TGSAGTGK+ L++ II  LR  + R   RV VTAST
Sbjct  355   RIFLSEEQQNVLNMVVENKKSVFFTGSAGTGKSVLLREIIVGLRRKYVRESDRVAVTAST  414

Query  784   GVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGEL  963
             G++AC + G TLHSF+GIGLG+   E+L+ K+  N + + RW   + L+IDE+S++ G+L
Sbjct  415   GLAACNIGGVTLHSFSGIGLGKEPVEDLVKKIRRNAKAKQRWMRTKVLVIDEVSMVDGDL  474

Query  964   YDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLS  1140
             +DKLE IAR IR+  NG      +GGIQ++ +GDFFQLPP+ +     +FAF+A +W  S
Sbjct  475   FDKLEQIARTIRN--NGRP----FGGIQLIITGDFFQLPPVPDYGKVARFAFDAGTWTTS  528

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEY---DFEDLNLLENHCSNLEPDPLAVKLYPR  1311
              +  I LT VFRQ DP    +L  +R+G            L+      E +  A +L+P 
Sbjct  529   IEHTIGLTHVFRQKDPVFAGMLNEMREGRLTTASIAKFRQLDRPLPASEDNIEATELFPT  588

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ----LKLGIAPDFLELCVGARVMLT  1479
               +V R N+  ++ L   +  + + D G  + KE+    L+  + P  + L  GA+VML 
Sbjct  589   RQEVERANQARMNQLQGQIYEFESRDGGTVTDKEKRDKLLQSCMVPANIYLKKGAQVMLV  648

Query  1480  KNLNARHKLVNGAAGTVIGF-----------------ESVNGTYE----------TFGTN  1578
             KN++    LVNG+ G V GF                 E  + T E          T G N
Sbjct  649   KNMD--DTLVNGSLGKVTGFMTEQMFAFYRENEDAFLEGADNTTELDALKKLKEKTLGVN  706

Query  1579  ---WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMT  1737
                  PVV+F   D   + L+ + E W I +   EV A R QIPLILAWALSIHK QG T
Sbjct  707   TAQLYPVVRFAISDGTTRDLLCKREPWKIELPNGEVQASRDQIPLILAWALSIHKAQGQT  766

Query  1738  LNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             L  +  DL R F  G  YVALSR  ++ GL +  F+ + +  H KV  F   L +
Sbjct  767   LERVRVDLGRVFEKGQAYVALSRATNMAGLQVMRFDASKVMAHEKVRAFYSSLST  821



>ref|XP_006734921.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Leptonychotes weddellii]
Length=642

 Score =   286 bits (732),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 165/429 (38%), Positives = 248/429 (58%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL  +  G+S+F TGSAGTGK++L++ I+  L           TASTGV
Sbjct  203   TKPQLSQEQAAVLRVVLKGQSIFFTGSAGTGKSYLLKRILGSLPPTG----TVATASTGV  258

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  259   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPAVRQGWLNCQRLVIDEISMVEADLFD  317

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       ++  +GGIQ++  GDF QLPP+  K +Q  KF F+A SW+   
Sbjct  318   KLEAVARAVR------QQDKPFGGIQLIICGDFLQLPPV-TKGSQPPKFCFQAKSWRRCV  370

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSN-LEPDPL-AVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L+   S+ +E D + A +L    D
Sbjct  371   PVTLELTEVWRQADQIFISLLQAVRLGRCSDEVTRQLQATASHKVERDGIVATRLCTHQD  430

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N++ L  L  ++  ++A+D+  +  +           L+L +GA+VML KNL   
Sbjct  431   DVALTNRRRLQELPGEVHSFKAMDSDPEQARILDAQCPVSQILQLKLGAQVMLVKNLAVS  490

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+            LP V+F     + +IR + W++      +  R
Sbjct  491   RGLVNGARGVVVGFETEG--------RGLPQVRFLCGVTE-VIRADRWTVQATGGQLLSR  541

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  542   QQLPLQLAWAISIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPMVV  601

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  602   RCDPRVLSF  610



>emb|CCA68862.1| related to PIF1 protein precursor [Piriformospora indica DSM 
11827]
Length=560

 Score =   284 bits (726),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 178/493 (36%), Positives = 263/493 (53%), Gaps = 71/493 (14%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             EQ  V+    AG S+F TGSAGTGK+  ++ +IR+LR ++    V+VTASTG++A  + G
Sbjct  65    EQEHVVRQCEAGHSIFFTGSAGTGKSVTLKEVIRRLRRMYSSGSVFVTASTGIAAINVGG  124

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              TLHS+AGIGLG+  AE L+  +    + + RW   + L+IDEIS++ G L+DKLE I+R
Sbjct  125   TTLHSYAGIGLGKEPAEVLIKNIRKGTKAKGRWWATRVLVIDEISMVDGNLFDKLEQISR  184

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIF------NKNTQKFAFEASSWKLSFDTQ  1152
              IR    G++E   +GGIQ+V  GDFFQLPP+        ++T KFAFEA SW       
Sbjct  185   AIR----GNNEP--FGGIQLVICGDFFQLPPVSKAPSAGQRDTTKFAFEAESWSRCVKQM  238

Query  1153  IDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRN  1314
             I L TVFRQ D +L+++L  +R G+ D      F  L+    +   +EP     +L+P  
Sbjct  239   ITLRTVFRQRDNELIEMLDMMRMGQVDAIGLWYFRKLDREVEYDDGIEP----TELFPLR  294

Query  1315  DDVYRVNKKHLDSLHQDLIGYRAVDNG-EDSWKEQLKL---------GIAPDFLELCVGA  1464
               V   N   L++L  + + + A+D    D + + +K           +AP  L L VGA
Sbjct  295   AQVEGANNARLNALPGEELRFIAMDYAFHDMYGKSIKPEAASKLLDDTLAPRVLTLRVGA  354

Query  1465  RVMLTKNLNARHKLVNGAAGTVIGFESVNGTY----------------------------  1560
             +VML KN+    KLVNG+ GT++ FE+  G Y                            
Sbjct  355   QVMLIKNI-PETKLVNGSIGTIVSFETTEGAYYHGISAAGDDNSTRREASQLDDANTDDS  413

Query  1561  --------ETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGE-EVVAVRKQIPLILAWALS  1713
                      ++     P+VKF    +  I+ P  + +++      A+R+Q+PLILAWALS
Sbjct  414   GGDLERNPSSYTLPRWPMVKF-ITGEVRIMPPMPFEVVNAHGNSEAMRQQVPLILAWALS  472

Query  1714  IHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKR  1893
             IHK QG TL  +  DLN  F  G  YVA+SR  S  GL + +F+ + +  HP+V+ + + 
Sbjct  473   IHKSQGQTLERVKVDLNGIFEKGQAYVAVSRATSFAGLQVKNFSQDKVMAHPRVVAWAQS  532

Query  1894  LCSQPDQPKEDAV  1932
             +  +P    ED +
Sbjct  533   IEKKPQPVAEDEM  545



>gb|EPY50497.1| pif1 helicase Pfh1 [Schizosaccharomyces cryophilus OY26]
Length=788

 Score =   290 bits (741),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 184/484 (38%), Positives = 266/484 (55%), Gaps = 73/484 (15%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ ++LD  +    S+F TGSAGTGK+ L++ II  L+  H +   RV VTASTG++AC 
Sbjct  300   EQKRILDMVVEQQHSIFFTGSAGTGKSVLLRKIIEALKNKHRKQTDRVAVTASTGLAACN  359

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFAG GL   + + L+ K+  N++   RW   + LIIDE+S++  +L DKLE 
Sbjct  360   IGGVTLHSFAGAGLARESVDFLVSKIKKNKKSMTRWLRTKVLIIDEVSMVDADLMDKLEE  419

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQID  1158
             +AR IR       +   +GGIQ+V +GDFFQLPP+ +   + KF+FE+++WK + D  I 
Sbjct  420   VARVIRK------DARPFGGIQLVLTGDFFQLPPVPDSGKEAKFSFESNTWKTALDYTIG  473

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAVKLYPRNDD  1320
             LT VFRQ D + V +L  +R G         F  L+   N+   L    L  +L+P   +
Sbjct  474   LTHVFRQKDEEFVGMLNELRLGRLSENSVRKFRYLSREINYADGL----LPTELFPTRHE  529

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNGEDSWKE----QLKLGIAPDFLELCVGARVMLTKNL  1488
             V R N   +  +HQD + + A+D+G    KE     L+  +AP  L L + A+VML KN+
Sbjct  530   VERSNGMRMQQIHQDPLTFTAIDSGTVRDKEFRDKLLQNCMAPANLVLKINAQVMLIKNI  589

Query  1489  NARHKLVNGAAGTVIGF------------ESVNG----TYETF-----------------  1569
             +   +LVNG+ G VIGF              + G     Y+T                  
Sbjct  590   D--DQLVNGSLGKVIGFIDEETYQMEKKDAEMQGRNPFEYDTLDVLPYDLPDVKQKKHKL  647

Query  1570  ---------GTNWLPVVKFDFK---PKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWAL  1710
                       T W P+V+F       + ++++ ETW+I +   E+ A R QIPLILA+A+
Sbjct  648   LAMKKASSISTKW-PLVRFKLANGGERTIVVQRETWNIELPNGEIQASRSQIPLILAYAI  706

Query  1711  SIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDK  1890
             SIHK QG TL+ +  DL R F  G  YVALSR  S +GL + +F+P+ +  HPKV+ F K
Sbjct  707   SIHKAQGQTLDRVKVDLGRVFEKGQAYVALSRATSQKGLQILNFSPSKVMAHPKVVQFYK  766

Query  1891  RLCS  1902
             +L S
Sbjct  767   QLDS  770



>gb|EPQ04506.1| ATP-dependent DNA helicase PIF1 [Myotis brandtii]
Length=467

 Score =   281 bits (719),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 162/421 (38%), Positives = 239/421 (57%), Gaps = 23/421 (5%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             EQ+ VL  +  G+S+F TGSAGTGK++L++ I+  L      +    TASTGV+AC + G
Sbjct  36    EQAAVLRVVLKGQSIFFTGSAGTGKSYLLKRILGSLPP----TGTVTTASTGVAACHIGG  91

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+DKLE +AR
Sbjct  92    TTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQGWLNCQRLVIDEISMVEADLFDKLEAVAR  150

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNK-NTQKFAFEASSWKLSFDTQIDLTT  1167
              +R       ++  +GGIQ++  GDF QLPP+       +F F+A SW+      ++LT 
Sbjct  151   TVR------QQDKPFGGIQLIICGDFLQLPPVTKGFQPPQFCFQAKSWRRCVPVTLELTK  204

Query  1168  VFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRNDDVYRVNKK  1341
             V+RQ+D   + LLQ +R G    E    L+   ++       +A +L    DDV   N+K
Sbjct  205   VWRQADQTFISLLQAVRLGRCSNEVTRQLQATATHKVGRDGIVATRLCTHQDDVALTNEK  264

Query  1342  HLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAA  1521
              L  L  ++  + A+D+  +  +           L+L +GA+VML KNL     LVNGA 
Sbjct  265   RLRDLPGEVHSFEAMDSDPEQARTLDAQCPVSKLLQLKLGAQVMLVKNLAVSQGLVNGAR  324

Query  1522  GTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLILA  1701
             G V+GFE+     E  G   LP V+F     + +IR E W++      +  R+Q+PL LA
Sbjct  325   GVVVGFET-----EGRG---LPQVRFLCGVTE-VIRAERWTVQTTGGRLLSRQQLPLQLA  375

Query  1702  WALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLN  1881
             WA+SIHK QGM+L+C+   L R F  G  YVALSR +SL+GL +  F+P +++  P+VL 
Sbjct  376   WAMSIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPTVVRCDPRVLR  435

Query  1882  F  1884
             F
Sbjct  436   F  436



>emb|CEF87539.1| unnamed protein product [Fusarium graminearum]
Length=872

 Score =   291 bits (745),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 187/489 (38%), Positives = 269/489 (55%), Gaps = 62/489 (13%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTG  786
             V  + EQ  VLD  ++  +SVF TG+AGTGK+ L++ II+ L+  + +   RV VTASTG
Sbjct  357   VSLSEEQKHVLDLVVNKNQSVFFTGAAGTGKSVLMRAIIKDLKTKYAKDPERVAVTASTG  416

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A  L+ K+  N++ ++RW   + L++DEIS++ G+L+
Sbjct  417   LAACNIGGITLHSFSGIGLGKEDAPTLIKKIRRNQKAKNRWLKTKCLVLDEISMVDGDLF  476

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI----FNKNTQKFAFEASSWK  1134
             DKL  I R IR+  NG      WGGIQ++ +GDFFQLPP+     NK T KFAF+AS+W 
Sbjct  477   DKLSQIGRTIRN--NG----RPWGGIQLIITGDFFQLPPVPDHGANKVT-KFAFDASTWT  529

Query  1135  LSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAV  1296
              S D  I LT VFRQ DP    +L  +R G         F+ L         LE      
Sbjct  530   TSIDHTIGLTQVFRQRDPVFANMLNEMRLGRITEDTVRAFKSLERPLQFNDGLE----TS  585

Query  1297  KLYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG-IAPDFLELCVGARVM  1473
             +L+   ++V   N++ L  L      Y A D G++  +++L    +AP  + L V A+VM
Sbjct  586   ELFSTRNEVEYSNERRLRDLPGKPRRYDAQDTGKEEVRDKLLANMMAPKSIVLKVNAQVM  645

Query  1474  LTKNLNARHKLVNGAAGTVIGF----------------------------ESVNGTYETF  1569
             L KNL+    LVNG+ G VIGF                            +S     E+ 
Sbjct  646   LIKNLD--ESLVNGSLGKVIGFSDEKTFDMSPPDEYDEDDQSAKARKKLLKSFQHESESS  703

Query  1570  GTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMT  1737
              ++  PVV+F   D   + ++ +PE W + +   EV A R Q+PLILAWALSIHK QG T
Sbjct  704   ASDKYPVVQFMAGDGTSRVILCQPEEWKVELPNGEVQAKRAQLPLILAWALSIHKAQGQT  763

Query  1738  LNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD--  1911
             L  +  +L R F  G  YVALSR  + +GL +  F    +  HP+V++F  +L S  +  
Sbjct  764   LERVKVNLGRVFEKGQAYVALSRATTQDGLQVLGFQKAKVMAHPRVIDFYNKLYSAEEAL  823

Query  1912  -QPKEDAVT  1935
              +PK  ++T
Sbjct  824   GKPKAQSIT  832



>ref|XP_007278884.1| mitochondrial dna helicase [Colletotrichum gloeosporioides Nara 
gc5]
 gb|ELA32077.1| mitochondrial dna helicase [Colletotrichum gloeosporioides Nara 
gc5]
Length=853

 Score =   291 bits (744),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 189/490 (39%), Positives = 267/490 (54%), Gaps = 60/490 (12%)
 Frame = +1

Query  610   TRVKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTAS  780
             T +  T EQ  V +  ++ G+SVF TG AGTGK+ L++ II +L++   R   R+ VTAS
Sbjct  326   TAIALTKEQKHVQNLVVNKGQSVFFTGPAGTGKSVLMRSIITELKKKWARDPERLAVTAS  385

Query  781   TGVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGE  960
             TG++AC + G TLHSF+GIGLG+   + L+ K+  N + ++RW   + LI+DE+S++ GE
Sbjct  386   TGLAACNIGGQTLHSFSGIGLGKEDVQTLVKKIRRNPKAKNRWLRTKTLIMDEVSMVDGE  445

Query  961   LYDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ---KFAFEASSW  1131
             L+DKL  I R IR+  NG      WGGIQ+V +GDFFQLPP+ + +     KFAFEA++W
Sbjct  446   LFDKLSQIGRTIRN--NGKP----WGGIQLVVTGDFFQLPPVPDGDKSRDAKFAFEAATW  499

Query  1132  KLSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL-EPDPLAV-KLY  1305
               + D  I LT VFRQ DP    +L  +R G    + +         +   D L V +L+
Sbjct  500   NTAIDHTIGLTQVFRQRDPVFANMLNEMRLGRISEQTVQAFRKLTRPIVSDDGLEVTELF  559

Query  1306  PRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ-LKLGIAPDFLELCVGARVMLTK  1482
             P   +V   N+  L +L      Y A D G+ + +++ L+  +AP  +EL VGA+VML K
Sbjct  560   PTRWEVENSNQARLRNLPGKPHRYDASDGGDANVRDKLLQNMMAPKTIELKVGAQVMLIK  619

Query  1483  NLNARHKLVNGAAGTVIGFESVNGTYE---------------------------------  1563
             N++    LVNG+ G V+ F S  G++E                                 
Sbjct  620   NMD--DTLVNGSLGKVVKFMS-EGSFESWTMPEYGSDVDVDSEDKAKKKIKAFSREVEEA  676

Query  1564  TFGTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQG  1731
             T GT   PVV+F   D   + ++  PE W +     EV A R Q+PLILAWALSIHK QG
Sbjct  677   TSGTTEFPVVEFAAVDGTTRTILCVPEDWKVETPTGEVQASRSQLPLILAWALSIHKAQG  736

Query  1732  MTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD  1911
              TL  +  DL + F  G  YVALSR    +GL +  F  + +  HP+V+ F  +L S   
Sbjct  737   QTLERVKVDLGKVFEKGQAYVALSRATCQDGLQVLRFQKDKVMAHPRVIQFYNKLYS---  793

Query  1912  QPKEDAVTKK  1941
                E AV KK
Sbjct  794   --AEVAVAKK  801



>ref|XP_006093517.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Myotis lucifugus]
Length=467

 Score =   280 bits (717),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/421 (38%), Positives = 239/421 (57%), Gaps = 23/421 (5%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             EQ+ VL  +  G+S+F TGSAGTGK++L++ I+  L      +    TASTGV+AC + G
Sbjct  36    EQAAVLRVVLKGQSIFFTGSAGTGKSYLLKRILGSLPP----TGTVTTASTGVAACHIGG  91

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+DKLE +AR
Sbjct  92    TTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQGWLNCQRLVIDEISMVEADLFDKLEAVAR  150

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNK-NTQKFAFEASSWKLSFDTQIDLTT  1167
              +R       ++  +GGIQ++  GDF QLPP+       +F F+A SW+      ++LT 
Sbjct  151   TVR------QQDKPFGGIQLIICGDFLQLPPVTKGFQPPQFCFQAKSWRRCVPVTLELTK  204

Query  1168  VFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRNDDVYRVNKK  1341
             V+RQ+D   + LLQ +R G    E    L+   ++       +A +L    DDV   N++
Sbjct  205   VWRQADQTFISLLQAVRLGRCSNEVTRQLQATATHKVGRDGIVATRLCTHQDDVALTNER  264

Query  1342  HLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAA  1521
              L  L  ++  + A+D+  +  +           L+L +GA+VML KNL     LVNGA 
Sbjct  265   RLRDLPGEVHSFEAMDSDPEQARTLDAQCPVSKLLQLKLGAQVMLVKNLAVSQGLVNGAR  324

Query  1522  GTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLILA  1701
             G V+GFE+     E  G   LP V+F     + +IR E W++      +  R+Q+PL LA
Sbjct  325   GVVVGFET-----EGRG---LPQVRFLCGVTE-VIRAERWTVQTTGGRLLSRQQLPLQLA  375

Query  1702  WALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLN  1881
             WA+SIHK QGM+L+C+   L R F  G  YVALSR +SL+GL +  F+P +++  P+VL 
Sbjct  376   WAMSIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPTVVRCDPRVLR  435

Query  1882  F  1884
             F
Sbjct  436   F  436



>ref|XP_005963349.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Pantholops hodgsonii]
Length=641

 Score =   285 bits (730),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 164/429 (38%), Positives = 244/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL A+  G+S+F TGSAGTGK++L++ I+  L           TASTGV
Sbjct  203   TKPELSKEQAAVLRAVLKGQSIFFTGSAGTGKSYLLKRILGSLPPTG----TVATASTGV  258

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  259   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQGWLNCQRLVIDEISMVEADLFD  317

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       +   +GGIQ++  GDF QLPP+  K +Q  +F F+A SW+   
Sbjct  318   KLEAVARAVR------QQNKPFGGIQLIICGDFLQLPPV-TKGSQLPQFCFQAKSWRRCV  370

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L+   ++       +A +L    D
Sbjct  371   QVTLELTEVWRQTDKTFISLLQAVRLGRCSDEVTRQLQATATHKVGRDGIVATRLCTHQD  430

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N++ L  L  ++  + A+D+  +  +           L+L +GA+VML KNL   
Sbjct  431   DVALTNERQLQELPGEVHSFEAMDSDPEQARTLDAQCPVSQLLQLKLGAQVMLVKNLAVS  490

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G VIGFE+            LP V+F     + +IR + W++      +  R
Sbjct  491   RGLVNGARGVVIGFEAEG--------RGLPQVRFLCGVTE-VIRADRWTVQTTGGQLLSR  541

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SLEGL +  F+P ++
Sbjct  542   QQLPLQLAWAISIHKSQGMSLDCVEMSLGRVFASGQAYVALSRARSLEGLRVLDFDPMVV  601

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  602   RCDPRVLSF  610



>ref|XP_005437461.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Falco cherrug]
Length=540

 Score =   282 bits (722),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 180/447 (40%), Positives = 252/447 (56%), Gaps = 39/447 (9%)
 Frame = +1

Query  661   AGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNGYTLHSFAGIG  840
              GKS+F TG AGTGK+FL++ I+  L      S  Y TASTGV+AC + G TLH+FAGIG
Sbjct  25    GGKSIFFTGCAGTGKSFLLKKIVGSLPP----SVTYTTASTGVAACHIGGTTLHAFAGIG  80

Query  841   LGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIARKIRSSINGSD  1020
              G+A  E+ + ++     VR  W   Q LIIDEIS++ G+ +DKLE +AR +R      D
Sbjct  81    SGKAPLEQCV-QLAERPGVRQHWLACQHLIIDEISMVDGKFFDKLEAVARVVRKR----D  135

Query  1021  EEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQIDLTTVFRQSDPQLV  1197
             E   +GGIQ++  GDF QLPP+   N + KF F+A SW+      ++LT V RQ+D   V
Sbjct  136   EP--FGGIQLIICGDFLQLPPVCKANEETKFCFQAKSWRKCIHVNMELTEVRRQTDKTFV  193

Query  1198  KLLQGIRKGEYDFE-DLNLLENHCSNLEPDP-LAVKLYPRNDDVYRVNKKHLDSLHQDLI  1371
              LL  IR G    E    L++   +  E D  LA +L    DDV   N++ L  L  ++ 
Sbjct  194   SLLSAIRLGRCTEEVTRQLMQTAANRSERDGILATRLCTHKDDVEITNERCLQQLSGEVH  253

Query  1372  GYRAVDNGEDSWK---EQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAAGTVIGFE  1542
              + A+D+  +  K    Q  +G     +EL +GA+VML KNL+    LVNGA G V+GFE
Sbjct  254   AFEALDSDPELVKLIDAQCPVG---GRVELKLGAQVMLAKNLDVSQGLVNGARGVVVGFE  310

Query  1543  SVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLILAWALSIHK  1722
             S     E  G   LP V+F     + +I+ E W           R+Q+PL LAWA+SIHK
Sbjct  311   S-----EQKG---LPKVRFLCGVTQ-VIKMEKWVFKGPSGAHLSRQQLPLKLAWAISIHK  361

Query  1723  CQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              QGM+L+C+   L+R F  G  YVALSR +SL GL +  F+P +++  P VL F ++L  
Sbjct  362   SQGMSLDCVEISLSRVFESGQAYVALSRARSLAGLRVLDFDPKVVRADPSVLQFYRQL--  419

Query  1903  QPDQPKEDAVTKKKQ----GGSSTCNQ  1971
                  + + VT+ K+    G  + CN+
Sbjct  420   ----RRHELVTQVKKNLMLGKPALCNE  442



>gb|KFY66495.1| hypothetical protein V496_02037 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=894

 Score =   291 bits (744),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 189/477 (40%), Positives = 259/477 (54%), Gaps = 61/477 (13%)
 Frame = +1

Query  631   EQSQVLDAISA-GKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQS VL+ ++   KSVF TGSAGTGK+ L++ II +LR+++ R   RV VTASTG++AC 
Sbjct  377   EQSNVLELVTQQKKSVFFTGSAGTGKSVLMRAIIAELRKVYRREPDRVAVTASTGLAACN  436

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSF GIGLG+    +L+ K+  N + ++RW   + L++DE+S++ GEL+DKLE 
Sbjct  437   IGGVTLHSFGGIGLGKEPVPDLVKKIMRNSKAKNRWLRTKVLVVDEVSMVDGELFDKLEG  496

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQID  1158
             IAR IR   NG      +GGIQ+V +GDFFQLPP+ +   Q KFAF+A +W  S    I 
Sbjct  497   IARFIRK--NGRP----FGGIQLVVTGDFFQLPPVPDYGKQVKFAFDADTWSTSVHHTIG  550

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVYRVN  1335
             LT +FRQ DP+   +L  +R G+     +         LE   L A +L+P  ++V   N
Sbjct  551   LTEIFRQRDPEFANMLNEMRLGKITDATMKAFRRLDRPLETSGLDATELFPTRNEVDNSN  610

Query  1336  KKHLDSLHQDLIGYRAVDNGEDSWKEQLKL----GIAPDFLELCVGARVMLTKNLNARHK  1503
                +  L      Y + D+G     +QL+      +AP  LEL   A+VML KN++    
Sbjct  611   FMKMRQLKGAGKIYLSEDSGSVRDPQQLERLLQNFMAPKKLELKKHAQVMLIKNMD--DN  668

Query  1504  LVNGAAGTVIGF--ESVNGTYETFGTNWL-------------------------------  1584
             LVNG+ G VIGF  E     YE    + L                               
Sbjct  669   LVNGSIGKVIGFMNEKTFEVYEGVDLDPLDDTGLSDTDDPHDATREAKRRVRGMMNKDLI  728

Query  1585  -------PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQG  1731
                    P+V+F   D   + L+ +PE W + +   EV A R+QIPLILAWALSIHK QG
Sbjct  729   ADTGKEYPLVRFFAADGTSRDLLCQPEDWKVELPNGEVQAQRRQIPLILAWALSIHKAQG  788

Query  1732  MTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              TL  +  DL + F  G  YVALSR  + EGL + +FNP  +  HP+V  F   L S
Sbjct  789   QTLERVKVDLRKVFENGQAYVALSRATTQEGLWVQNFNPRAVMAHPRVGEFYDSLYS  845



>ref|XP_004758756.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X2 [Mustela 
putorius furo]
 ref|XP_004758757.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X3 [Mustela 
putorius furo]
 ref|XP_004758758.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X4 [Mustela 
putorius furo]
 ref|XP_004758759.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X5 [Mustela 
putorius furo]
 ref|XP_004795778.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X2 [Mustela 
putorius furo]
 ref|XP_004795779.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X3 [Mustela 
putorius furo]
 ref|XP_004795780.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X4 [Mustela 
putorius furo]
 ref|XP_004795781.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X5 [Mustela 
putorius furo]
Length=641

 Score =   285 bits (729),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 163/429 (38%), Positives = 244/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL  +  G+S+F TGSAGTGK++L++ I+  L           TASTG 
Sbjct  203   TKPQLSKEQAAVLRVVLKGQSIFFTGSAGTGKSYLLKRILGSLPPTG----TVATASTGA  258

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  259   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPAVRQGWLNCQRLVIDEISMVEADLFD  317

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       ++  +GGIQ++  GDF QLPP+  K +Q  KF F+A SW+   
Sbjct  318   KLEAVARAVR------QQDKPFGGIQLIICGDFLQLPPV-TKGSQPPKFCFQAKSWRRCV  370

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L+   S+       +A +L    D
Sbjct  371   PVTLELTEVWRQADQNFISLLQAVRLGRCSDEVTRQLQATASHKVGRDGIVATRLCTHQD  430

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N++ L  L  ++  ++A+D+  +  +           L+L +GA+VML KNL   
Sbjct  431   DVALTNERRLQELPGEMHTFKAMDSDPEQARSLDAQCPVSQILQLKLGAQVMLVKNLAVS  490

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G VIGFE+            LP V+F     + +IR + W++      +  R
Sbjct  491   RGLVNGARGVVIGFETEG--------RGLPQVRFLCGVTE-VIRADRWTVQATGGQLLSR  541

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  542   QQLPLQLAWAISIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPMVV  601

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  602   RCDPRVLSF  610



>ref|XP_006054521.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X1 [Bubalus 
bubalis]
 ref|XP_006054522.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X2 [Bubalus 
bubalis]
Length=641

 Score =   285 bits (729),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 164/429 (38%), Positives = 246/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL A+  G+S+F TGSAGTGK++L++ I+  L           TASTGV
Sbjct  203   TKPELSKEQAAVLRAVLKGQSIFFTGSAGTGKSYLLKRILGSLPPTG----TVATASTGV  258

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  259   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQGWLNCQRLVIDEISMVEADLFD  317

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       +   +GGIQ++  GDF QLPP+  K +Q  +F F+A SW+   
Sbjct  318   KLEAVARAVR------QQNKPFGGIQLIICGDFLQLPPV-TKGSQLPQFCFQAKSWRRCV  370

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSN-LEPDPL-AVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L    ++ +E D + A +L    D
Sbjct  371   PVTLELTEVWRQTDKTFISLLQAVRLGRCSDEVTRQLRATAAHKVERDGIVATRLCTHQD  430

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N++ L  L  ++  + A+D+  +  +           L+L +GA+VML KNL   
Sbjct  431   DVALTNERQLQELPGEVHSFEAMDSDPEQARTLDAQCPVSQLLQLKLGAQVMLVKNLAVS  490

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+            LP V+F     + +IR + W++      +  R
Sbjct  491   RGLVNGARGVVVGFEAEG--------RGLPQVRFLCGVTE-VIRADRWTVQTTGGQLLSR  541

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  542   QQLPLQLAWAISIHKSQGMSLDCVEMSLGRVFASGQAYVALSRARSLQGLRVLDFDPMVV  601

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  602   RCDPRVLSF  610



>gb|KFY94580.1| hypothetical protein V498_03847 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=912

 Score =   291 bits (744),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 189/477 (40%), Positives = 259/477 (54%), Gaps = 61/477 (13%)
 Frame = +1

Query  631   EQSQVLDAISA-GKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQS VL+ ++   KSVF TGSAGTGK+ L++ II +LR+++ R   RV VTASTG++AC 
Sbjct  395   EQSNVLELVTQQKKSVFFTGSAGTGKSVLMRAIIAELRKVYRREPDRVAVTASTGLAACN  454

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSF GIGLG+    +L+ K+  N + ++RW   + L++DE+S++ GEL+DKLE 
Sbjct  455   IGGVTLHSFGGIGLGKEPVPDLVKKIMRNSKAKNRWLRTKVLVVDEVSMVDGELFDKLEG  514

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQID  1158
             IAR IR   NG      +GGIQ+V +GDFFQLPP+ +   Q KFAF+A +W  S    I 
Sbjct  515   IARFIRK--NGRP----FGGIQLVVTGDFFQLPPVPDYGKQVKFAFDADTWSTSVHHTIG  568

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVYRVN  1335
             LT +FRQ DP+   +L  +R G+     +         LE   L A +L+P  ++V   N
Sbjct  569   LTEIFRQRDPEFANMLNEMRLGKITDATMKAFRRLDRPLETSGLDATELFPTRNEVDNSN  628

Query  1336  KKHLDSLHQDLIGYRAVDNGEDSWKEQLKL----GIAPDFLELCVGARVMLTKNLNARHK  1503
                +  L      Y + D+G     +QL+      +AP  LEL   A+VML KN++    
Sbjct  629   FMKMRQLKGAGKIYLSEDSGSVRDPQQLERLLQNFMAPKKLELKKHAQVMLIKNMD--DN  686

Query  1504  LVNGAAGTVIGF--ESVNGTYETFGTNWL-------------------------------  1584
             LVNG+ G VIGF  E     YE    + L                               
Sbjct  687   LVNGSIGKVIGFMNEKTFEVYEGVDLDPLDDTGLSDTDDPHDATREAKRRVRGMMNKDLI  746

Query  1585  -------PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQG  1731
                    P+V+F   D   + L+ +PE W + +   EV A R+QIPLILAWALSIHK QG
Sbjct  747   ADTGKEYPLVRFFAADGTSRDLLCQPEDWKVELPNGEVQAQRRQIPLILAWALSIHKAQG  806

Query  1732  MTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
              TL  +  DL + F  G  YVALSR  + EGL + +FNP  +  HP+V  F   L S
Sbjct  807   QTLERVKVDLRKVFENGQAYVALSRATTQEGLWVQNFNPRAVMAHPRVGEFYDSLYS  863



>ref|XP_007590472.1| DNA repair and recombination protein pif1 [Colletotrichum fioriniae 
PJ7]
 gb|EXF85888.1| DNA repair and recombination protein pif1 [Colletotrichum fioriniae 
PJ7]
Length=921

 Score =   291 bits (744),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 183/478 (38%), Positives = 259/478 (54%), Gaps = 64/478 (13%)
 Frame = +1

Query  625   TVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSA  795
             T EQ  V +  I+ G+SVF TG AGTGK+ L++ II +LR+   R   R+ +TASTG++A
Sbjct  395   TQEQKHVQNLVINQGQSVFFTGPAGTGKSVLMRSIIAELRKKWARDPERLAITASTGLAA  454

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLHSF+GIGLG+   + L+ K+  N + ++RW   + L++DE+S++ G+L+DKL
Sbjct  455   CNIGGQTLHSFSGIGLGKEDVQTLVKKIRRNPKAKNRWLRTKILVLDEVSMVDGDLFDKL  514

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNT---QKFAFEASSWKLSFD  1146
               I R IR+  NG      WGGIQ+V +GDFFQLPP+ + +     KFAFEA++W  + D
Sbjct  515   SQIGRSIRN--NGKP----WGGIQLVVTGDFFQLPPVPDGDKGRDSKFAFEAATWNTTID  568

Query  1147  TQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLA-----VKLYPR  1311
               I LT VFRQ DP    +L  +R G    E +    N      P P+       +L+P 
Sbjct  569   HTIGLTQVFRQRDPVFANMLNEMRLGRISDETVQAFRNLT---RPVPVTDGLEVTELFPT  625

Query  1312  NDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ-LKLGIAPDFLELCVGARVMLTKNL  1488
               +V   N+  L  L      Y A DNG+   +++ L+  +AP  +EL VGA+VML KN+
Sbjct  626   RYEVENANQSRLRRLPGTPKRYDAGDNGDPQIRDKLLQNMMAPKMIELKVGAQVMLIKNM  685

Query  1489  NARHKLVNGAAGTVIGFESVNGTYETF---------------------------------  1569
             +    LVNG+ G V  F S  G +ET+                                 
Sbjct  686   D--DTLVNGSLGKVTHFMS-EGDFETWNPALMMQSVEDVDEDGESRAKRKIKAFSREVEE  742

Query  1570  ---GTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQ  1728
                G    PVV+F   D   + ++  PE W + +   EV A R Q+PLILAWALSIHK Q
Sbjct  743   ATRGKAEYPVVEFAAVDGSTRTILCVPEDWKVELPNGEVQASRSQLPLILAWALSIHKAQ  802

Query  1729  GMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             G TL  +  DL + F  G  YVALSR    +GL + +F  + +  HP+V+ F  +L S
Sbjct  803   GQTLERVKVDLGKVFEKGQAYVALSRATCQQGLQVLNFRKDKVMAHPRVVGFYNKLYS  860



>emb|CCG81646.1| putative Mitochondrial DNA helicase [Taphrina deformans PYCC 
5710]
Length=821

 Score =   289 bits (739),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 186/496 (38%), Positives = 266/496 (54%), Gaps = 76/496 (15%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR-SRVYVTASTGV  789
             +V  + EQ  V++ +  GKSVF TGSAGTGK+ L++  I++LR+ H +   V VTASTG+
Sbjct  280   KVFLSAEQRGVIEMLKTGKSVFFTGSAGTGKSVLLRSAIQELRQKHKKLETVAVTASTGL  339

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLHSFAG+GLG  +  E++ KV  N++   RW   + LI+DEIS++  + +D
Sbjct  340   AACNIGGITLHSFAGVGLGRESVAEMIKKVKRNKKNLTRWLKTKVLIVDEISMVDADFFD  399

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNK-NTQKFAFEASSWKLSFD  1146
             KLE +ARK+R++      +  WGGIQ+VA+GDFFQLPP+ +     KFAFEA  W  S D
Sbjct  400   KLEAVARKLRAN------DKPWGGIQLVATGDFFQLPPVPDSGKVSKFAFEAEKWG-SLD  452

Query  1147  TQIDLTTVFRQSDPQLVKLLQGIRKGEY------DFEDLNLLENHCSNLEPDPLAVKLYP  1308
               I LTTVFRQ D + V++L  +R G        +F++L+   N    + P     +L+P
Sbjct  453   ATIQLTTVFRQKDEEFVEMLNQMRTGSLSARTISNFKELSRPLNFNDGIIP----TELFP  508

Query  1309  RNDDVYRVNKKHLDSLHQDLIGYRAVDNGE--DSWKEQLKLG--IAPDFLELCVGARVML  1476
               ++V   N   +  L   +  Y A D+G   D+ +    L   +AP  L+L  GA+VML
Sbjct  509   TRNEVENANALRMRQLPGSIYSYEADDSGSILDTVQRTKLLANCMAPARLDLKKGAQVML  568

Query  1477  TKNLNARHKLVNGAAGTVIGFESVNG-TYETFG------------TNWL-----------  1584
              KN +    LVNG+ G VIGF +    TY T G            + W            
Sbjct  569   IKNRD--DGLVNGSLGVVIGFMNEKTYTYATEGGEAEFDESVLRDSPWTDAELEVMSQTP  626

Query  1585  ----------------------PVVKFDF----KPKKLIIRPETWSI-MDGEEVVAVRKQ  1683
                                   P+V+F      +    ++ PE+W I +   +V A RKQ
Sbjct  627   AGQRKFLKLKQMQDTAATQRCWPLVRFKSPNGGQDMTQLMSPESWKIELPNGDVQACRKQ  686

Query  1684  IPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKV  1863
             +PLILA+A+SIHK QG T+  +  DL + F  G  YVALSR  S EGL +  F+   +  
Sbjct  687   VPLILAYAISIHKAQGQTIERVKVDLGKVFEKGQAYVALSRAVSKEGLQVLRFDVKRVMA  746

Query  1864  HPKVLNFDKRLCSQPD  1911
             HPKV  F + L +  D
Sbjct  747   HPKVSAFYRELMAASD  762



>gb|EFX02820.1| mitochondrial DNA helicase [Grosmannia clavigera kw1407]
Length=819

 Score =   289 bits (739),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 191/488 (39%), Positives = 267/488 (55%), Gaps = 64/488 (13%)
 Frame = +1

Query  616   VKWTVEQSQVLDAIS-AGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             +  + EQ  V + +     SVF TG AGTGK+ L++ IIR LR+   +   R+ VTASTG
Sbjct  330   ISLSTEQQHVKNLVCHKNASVFFTGPAGTGKSVLMRAIIRDLRKRFAKEPERLGVTASTG  389

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSFAGIGLG+   + L+ K+  N + + RW   + L+IDEIS++ G+L+
Sbjct  390   LAACNIGGMTLHSFAGIGLGKEDVQTLVRKIRRNPKAKARWLKTKILVIDEISMVDGDLF  449

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLS  1140
             DKL  I R IR+  NG      WGGIQ+V +GDFFQLPP+ ++  +  KFAFEAS+W  S
Sbjct  450   DKLSSIGRTIRN--NGRP----WGGIQLVLTGDFFQLPPVPDREKRDVKFAFEASTWNTS  503

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPLAVKLYPRNDD  1320
              D  I L+ VFRQ DP  +   + I      F+ L+        LE      +L+P   +
Sbjct  504   IDHTIGLSEVFRQKDPGALSKQRTI------FKSLSRPVQIDDELE----VTELFPTRAE  553

Query  1321  VYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQL-KLGIAPDFLELCVGARVMLTKNLNAR  1497
             V   N++ L +L      Y A+D+GE   +E+L +  +AP  L L  GA+VML KN++  
Sbjct  554   VDSSNERRLHALKGKPRRYDALDSGEQDKREKLLQNMMAPKSLVLREGAQVMLIKNMD--  611

Query  1498  HKLVNGAAGTVIGF------ESVNGTYE-----------------------TFGTNWLPV  1590
               LVNG+ GTV+ F      E V   +E                         G+   P 
Sbjct  612   ETLVNGSVGTVVKFMTESEFEQVGDNFEWTTDPVIKKRASMLNQYLNDGDNGSGSPVFPY  671

Query  1591  VKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTD  1758
             V+F   D   + +++R E W + +   EV A R Q+PLILAWALSIHK QG TL  +  D
Sbjct  672   VRFHAVDGTQRGILVRQEEWKVELPTGEVQASRHQLPLILAWALSIHKAQGQTLERVKVD  731

Query  1759  LNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKEDAVTK  1938
             L R F  G  YVALSR  S +GL +  F  + +  HP+V++F  +L S      E A+  
Sbjct  732   LGRVFERGQAYVALSRATSKDGLQVLRFEKHKVMAHPRVVSFYSKLYS-----AESAL--  784

Query  1939  KKQGGSST  1962
             K  GGSS+
Sbjct  785   KSIGGSSS  792



>ref|XP_006209655.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Vicugna pacos]
Length=449

 Score =   279 bits (714),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 164/429 (38%), Positives = 246/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL  +  G+S+F TGSAGTGK++L++ I+  L      +    TASTGV
Sbjct  11    TKPQLSKEQAAVLRVVLKGQSIFFTGSAGTGKSYLLKRILGSLPP----TGTVATASTGV  66

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  67    AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQGWLNCQRLVIDEISMVEADLFD  125

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       +   +GGIQ++  GDF QLPP+  K +Q  +F F+A SW+   
Sbjct  126   KLEAVARAVR------QQNKPFGGIQLIICGDFLQLPPV-TKGSQPPQFCFQAKSWRRCV  178

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E  + L    ++       +A +L    D
Sbjct  179   PVILELTEVWRQADKTFISLLQAVRLGRCSDEVTSQLRATAAHKVGRDGIVATRLCTHQD  238

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N+K L  L  ++  + A+D+  +  +           L+L +GA+VML KNL   
Sbjct  239   DVALTNEKRLQELPGEIHSFEAMDSDPEQARTLDAQCPVSQLLQLKLGAQVMLVKNLAVS  298

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+     E  G   LP V F     + +IR + W++      +  R
Sbjct  299   RGLVNGARGVVVGFEA-----EGRG---LPQVLFLCGVTE-VIRADRWTVQATGGQLLSR  349

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  350   QQLPLQLAWAISIHKSQGMSLDCVEISLSRVFASGQAYVALSRARSLQGLRVLDFDPMVV  409

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  410   RCDPRVLSF  418



>ref|XP_011112799.1| hypothetical protein H072_7026 [Dactylellina haptotyla CBS 200.50]
 gb|EPS39197.1| hypothetical protein H072_7026 [Dactylellina haptotyla CBS 200.50]
Length=826

 Score =   289 bits (739),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 189/488 (39%), Positives = 259/488 (53%), Gaps = 69/488 (14%)
 Frame = +1

Query  610   TRVKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR-SRVYVTAST  783
             TR   + EQS VLD  ++ GKSVF TGSAGTGK+ L++ II  +R+ H     V +TAST
Sbjct  294   TRHYMSNEQSHVLDMVVNEGKSVFFTGSAGTGKSVLLREIITGMRKKHKNYDSVAITAST  353

Query  784   GVSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGEL  963
             G++AC + G TLHSF+GIGLG    E+L+ K+  N + + RW   + LIIDEIS++ GEL
Sbjct  354   GLAACNIGGVTLHSFSGIGLGREPVEQLVKKIRRNPKSKQRWLRTKVLIIDEISMVDGEL  413

Query  964   YDKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIF-NKNTQKFAFEASSWKLS  1140
             +DKLE +AR +++  NG      +GGIQ+V +GDFFQLPP+  N    KFAFE ++W   
Sbjct  414   FDKLEGVARTLKN--NGRP----FGGIQLVVTGDFFQLPPVPDNGRAAKFAFEGNTWSNC  467

Query  1141  FDTQIDLTTVFRQSDPQLVKLLQGIRKGEY------DFEDLNLLENHCSNLEPDPLAVKL  1302
              D  I LT +FRQ DP    +L  +R G        +F+ LN        L+    A +L
Sbjct  468   VDHTILLTHIFRQKDPVFASMLNEMRLGMLSPASVANFKKLNRKLEFDDGLQ----ATEL  523

Query  1303  YPRNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ----LKLGIAPDFLELCVGARV  1470
             +P   +V   N   L  L      Y A D      ++Q    L   +AP  LEL VGA+V
Sbjct  524   FPTRKEVDNANNMQLRKLTTTSEIYTAQDESAVLDQQQRDKLLANCMAPHVLELKVGAQV  583

Query  1471  MLTKNLNARHKLVNGAAGTVIGFES-----------------------------------  1545
             ML KN++    LVNG+ G ++ F S                                   
Sbjct  584   MLVKNMD--ETLVNGSLGRIVAFMSEKTYAMVTDEIPGGEELLFGSQGAEYEGLSTKQKA  641

Query  1546  -----VNGTYETFGTNWLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLIL  1698
                   N   +T  T   P+V++   D   ++ ++ PE W   +   E+ A RKQ+PLIL
Sbjct  642   VFERYTNEQSKTSTTKRYPLVQWSIADGTQRRTLMLPEAWKFELPTGEIQASRKQVPLIL  701

Query  1699  AWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVL  1878
             AWALSIHK QG TL+ +  DLN+ F  G  YVALSR  + EGL + +F+   +  H KV 
Sbjct  702   AWALSIHKAQGQTLDRVKVDLNKVFEKGQAYVALSRATTQEGLQVLNFDARKVMAHDKVR  761

Query  1879  NFDKRLCS  1902
             +F K L S
Sbjct  762   SFYKSLTS  769



>ref|XP_009248182.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X1 [Pongo 
abelii]
Length=641

 Score =   285 bits (728),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 165/429 (38%), Positives = 243/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL A+  G+S+F TGSAGTGK++L++ I+  L           TASTGV
Sbjct  203   TKPQLSEEQAAVLRAVLKGQSIFFTGSAGTGKSYLLKRILGSLPPTG----TVATASTGV  258

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  259   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQGWLNCQRLVIDEISMVEADLFD  317

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       +   +GGIQ++  GDF QLPP+  K++Q  +F F+A SWK   
Sbjct  318   KLEAVARAVR------QQNKPFGGIQLIICGDFLQLPPV-TKDSQPPRFCFQAKSWKRCV  370

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L+   S+       +A +L    D
Sbjct  371   SVTLELTKVWRQADQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDGIVATRLCTHQD  430

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N++ L  L   +  + A+D+  +              L+L +GA+VML KNL+  
Sbjct  431   DVALTNERRLQELPGKVHRFEAMDSNPELASTLDAQCPVSQLLQLKLGAQVMLVKNLSVS  490

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+            LP V+F     + +IR + W++      +  R
Sbjct  491   RGLVNGARGVVVGFEAEG--------RGLPQVRFLCGVTE-VIRADRWTVQATGSQLLSR  541

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SL+GL +  F+P  +
Sbjct  542   QQLPLQLAWAMSIHKSQGMTLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPTAV  601

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  602   RCDPRVLHF  610



>emb|CCX05452.1| Similar to DNA repair and recombination protein pif1, mitochondrial; 
acc. no. Q9UUA2 [Pyronema omphalodes CBS 100304]
Length=874

 Score =   290 bits (741),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 179/456 (39%), Positives = 265/456 (58%), Gaps = 38/456 (8%)
 Frame = +1

Query  631   EQSQVLDAISAG-KSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ++V++ ++A  +SVF TGSAGTGK+ L++ +I+ L+  + +    V VTASTG++AC 
Sbjct  391   EQNRVVELVAAQEQSVFFTGSAGTGKSVLLRELIKVLKRKYRKDPDAVAVTASTGLAACN  450

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSFA IGLG+    +L+ K+  N++ R+RW   + LI+DEIS++ G+L+DKLE 
Sbjct  451   IGGVTLHSFAAIGLGKEAVPDLVRKIKKNQKARNRWARTKVLILDEISMVDGDLFDKLES  510

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFN-KNTQKFAFEASSWKLSFDTQID  1158
             +AR+IR+  NG      +GGIQ+V +GDFFQLPP+       KFAF+A+SW    +  I 
Sbjct  511   VARQIRN--NGRP----FGGIQLVMTGDFFQLPPVPEGGKAAKFAFDANSWSSCIEHTIG  564

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDP--LAVKLYPRNDDVYRV  1332
             L+ VFRQ DP+   +L  +R G+     ++  ++    L  D    A +L+   ++V   
Sbjct  565   LSQVFRQRDPEFANMLNEMRVGKLSNATVDTFKSLSRELHYDDGIQATELFSTRNEVDSA  624

Query  1333  NKKHLDSLHQDLIGYRAVDNGEDSWKEQ----LKLGIAPDFLELCVGARVMLTKNLNARH  1500
             N++ +  L  + + + AVD+G  +  ++    L+  +AP  +EL + ++VML KN++   
Sbjct  625   NRRKMQGLPGEAMKFIAVDSGTITDVQRRDKLLQNCMAPREIELKLHSQVMLIKNVD--D  682

Query  1501  KLVNGAAGTVIGF---------------ESVNGTYETFGTNWLPVVKF---DFKPKKLII  1626
              LVNG+ G V+GF               E   G     G  W P+V+F   D   ++L+ 
Sbjct  683   SLVNGSLGRVVGFMSEKMFDLMSDEGLSEKEAGKGIETGHRW-PLVQFAMIDGTSRQLLC  741

Query  1627  RPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALS  1803
             +PETW + +   EV A R Q+PLILAWALSIHK QG TL  +  DL RAF  G  YVALS
Sbjct  742   QPETWKVELPNGEVQAQRAQVPLILAWALSIHKAQGQTLERVKVDLRRAFEKGQAYVALS  801

Query  1804  RVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPD  1911
             R    EGL +  F    +  H KV  F   L S  D
Sbjct  802   RATCKEGLQVLGFEERKVMAHDKVREFYNSLYSATD  837



>ref|XP_007084712.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Panthera tigris altaica]
Length=561

 Score =   282 bits (722),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 166/429 (39%), Positives = 248/429 (58%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             ++ + + EQ+ VL  +  G+S+F TGSAGTGK++L++ I+  L      +    TASTGV
Sbjct  123   SKPQLSEEQAAVLRVVLKGQSIFFTGSAGTGKSYLLKRILGLLPP----TGTVATASTGV  178

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  179   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPAVRQGWLNCQRLVIDEISMVEADLFD  237

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR IR       +   +GGIQ++  GDF QLPP+  K +Q  KF F+A SW+   
Sbjct  238   KLEAMARAIR------QQNKPFGGIQLIICGDFLQLPPV-TKGSQPPKFCFQAKSWRRCV  290

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E  + L+   S+       +A +L    D
Sbjct  291   PVTLELTKVWRQADQTFISLLQAVRLGRCSDEVTHQLQATASHKVGRDGIVATRLCTHQD  350

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N++ L  L  ++  ++A+D+  +  +           L+L +GA+VML KNL   
Sbjct  351   DVALTNERRLQELPGEVHSFKAMDSDPEQARTLDAHCPVSQILQLKLGAQVMLVKNLAVS  410

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+     E  G   LP V+F     + +IR + W++      +  R
Sbjct  411   RGLVNGARGVVVGFET-----EGRG---LPQVRFLCGVTE-VIRADRWTVQATGGQLLSR  461

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGMTL+C+   L R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  462   QQLPLQLAWAISIHKSQGMTLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPMVV  521

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  522   RCDPRVLSF  530



>ref|XP_007841313.1| hypothetical protein PFICI_14541 [Pestalotiopsis fici W106-1]
 gb|ETS73595.1| hypothetical protein PFICI_14541 [Pestalotiopsis fici W106-1]
Length=915

 Score =   290 bits (742),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 181/489 (37%), Positives = 274/489 (56%), Gaps = 55/489 (11%)
 Frame = +1

Query  625   TVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR--SRVYVTASTGVSA  795
             + EQ QV +  +  G+SVF TG AGTGK+ L++ I+  L+    R   RV +TASTG++A
Sbjct  410   SAEQQQVHELVVDKGQSVFFTGPAGTGKSILMRAIVASLKRKWARDPERVSITASTGLAA  469

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLHSF+GIGLG+     L+ K+  N + ++RW   + LI+DE+S++ G+L+DKL
Sbjct  470   CHIGGQTLHSFSGIGLGKEDVPTLVKKIRRNAKAKNRWLKTRVLIMDEVSMVDGDLFDKL  529

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSFDT  1149
             + IAR+IR+  NG      WGGIQ+V +GDFFQLPP+ ++N +  KFAF+A++W  S D 
Sbjct  530   DQIARQIRN--NG----RPWGGIQLVITGDFFQLPPVPDRNKRDTKFAFDAATWSTSIDH  583

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDP--LAVKLYPRNDDV  1323
              I LT VFRQ D +  ++L  +R G    + +    +    L  D    A +L+P   +V
Sbjct  584   TIGLTQVFRQKDHEFAEMLNEMRLGRVSEQTVQTFRSLSRPLVYDDGITATELFPTRGEV  643

Query  1324  YRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQ-LKLGIAPDFLELCVGARVMLTKNLNARH  1500
                N   L +L  ++  + A D+G+ + +++ L+  +AP  ++L  GA+VML KNL+   
Sbjct  644   ESSNSMRLRALPGEIRTFAAQDSGDPNIRDKLLENMMAPKTIDLKKGAQVMLIKNLD--D  701

Query  1501  KLVNGAAGTVIGFES------------------VNGTYETFGT-----------NWLPVV  1593
              LVNG  G VIGF S                  V+ + +   +              PVV
Sbjct  702   TLVNGTLGKVIGFSSEAFFTANPSKFDLSVADLVDESMKKIKSFAVRDSSLKDLTEYPVV  761

Query  1594  KF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTDL  1761
             +F   D   + + + PE W + +   EV A R  +P+ILAWALSIHK QG TL  +  DL
Sbjct  762   EFHAADGSFRVMHVTPEEWKVELPNGEVQAKRTALPMILAWALSIHKAQGQTLERVKVDL  821

Query  1762  NRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQPDQPKEDAVTKK  1941
              + F  G  YVALSR  S +GL +  F+ + +  HPKV+ F  +L S       D++ +K
Sbjct  822   GKIFEKGQAYVALSRATSKDGLEVQRFDKSKVMAHPKVIQFYNKLYS------PDSIVQK  875

Query  1942  KQGGSSTCN  1968
             K+  ++  +
Sbjct  876   KKKPATISD  884



>ref|XP_006979388.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Peromyscus maniculatus 
bairdii]
Length=637

 Score =   284 bits (727),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 166/429 (39%), Positives = 245/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             ++ K + EQ+ VL A+  G+S+F TGSAGTGK++L++HI+  L           TASTGV
Sbjct  199   SKPKLSEEQAAVLRAVLKGQSIFFTGSAGTGKSYLLKHILGSLPPTG----TVATASTGV  254

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  255   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAHRPGVRQGWLNCQRLVIDEISMVEADLFD  313

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       ++  +GGIQ++  GDF QLPP+  K +Q  +F F+A SW+   
Sbjct  314   KLEAVARAVR------QQKKPFGGIQLIICGDFLQLPPV-TKGSQLPRFCFQAKSWRRCV  366

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L    ++       +A +L    D
Sbjct  367   PVTLELTEVWRQADQTFISLLQAVRLGRCSDEVTRQLRATAAHKVGRDGIVATRLCTHQD  426

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N+K L  L  ++  + A+D+  +  +       A   L+L +GA+VML KNL+  
Sbjct  427   DVALTNEKRLKELPGEIHSFEAIDSDPELARTLDAQCPASRVLQLKLGAQVMLVKNLSVS  486

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFES            LP V+F     + +IR + W+I         R
Sbjct  487   RGLVNGARGVVVGFESEG--------RGLPQVRFLCGVTE-VIRMDRWTIQVTGGQFLSR  537

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  538   QQLPLQLAWAMSIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPTVV  597

Query  1858  KVHPKVLNF  1884
             +   +VL+F
Sbjct  598   RCDSRVLHF  606



>emb|CCU75089.1| DNA-helicase [Blumeria graminis f. sp. hordei DH14]
Length=830

 Score =   288 bits (738),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 184/466 (39%), Positives = 247/466 (53%), Gaps = 56/466 (12%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSACA  801
             EQ +VL+  ++  KSVF TGSAGTGK+ L++ II +L++ + R   RV VTASTG++AC 
Sbjct  357   EQKRVLNLVVNKSKSVFFTGSAGTGKSILMRAIITELKKKYCRENDRVAVTASTGLAACN  416

Query  802   LNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEF  981
             + G TLHSF GIGLG+     L+ ++  N + R RW   + LIIDEIS++ GEL+DKLE 
Sbjct  417   IGGVTLHSFGGIGLGKEDVAALVRRIKKNPKARSRWIRTKILIIDEISMVDGELFDKLES  476

Query  982   IARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIF----NKNTQKFAFEASSWKLSFDT  1149
             +AR +R+  NG      +GGIQ+V +GDFFQLPP+     N    KFAF+AS+W  + D 
Sbjct  477   VARAMRN--NGRP----FGGIQLVITGDFFQLPPVPERDDNSRAVKFAFDASTWSTTIDH  530

Query  1150  QIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVY  1326
              I LT VFRQ DP    +L  +R G+   E +   +     +    L A +L+P   +V 
Sbjct  531   TIGLTQVFRQKDPMFANMLNEMRIGKITDETVTAFQKLNRPVSDQGLEATELFPTRHEVD  590

Query  1327  RVNKKHLDSLHQDLIGYRAVDNG----EDSWKEQLKLGIAPDFLELCVGARVMLTKNLNA  1494
             R N   + +L      Y + D G      S +  L   +AP  LEL  GA+VML KN++ 
Sbjct  591   RANASRIGNLSGTSYKYVSQDGGAIKDPKSLERLLSNMMAPKILELKKGAQVMLIKNMD-  649

Query  1495  RHKLVNGAAGTVIGFE--------------------------------SVNGTYETFGTN  1578
                LVNG  G V  F                                 S NG   T    
Sbjct  650   -ESLVNGTLGKVQSFMSEKDFKHLEDIEGGLDALEYESENDVGGKSRISTNGVSTTGSGR  708

Query  1579  WLPVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
               P V F   D   + ++I PE W + +   EV A R Q+PLILAWALSIHK QG TL  
Sbjct  709   LYPYVSFKLADGTKRMMLILPEEWKVELPNGEVQAQRSQVPLILAWALSIHKAQGQTLER  768

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNF  1884
             +  DL + F  G  YVALSR  S  GL + +F+   +  HP+V  F
Sbjct  769   VKIDLKKIFEKGQAYVALSRATSQAGLQVLNFDKVKVNAHPRVAQF  814



>ref|XP_010991867.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Camelus dromedarius]
Length=523

 Score =   281 bits (718),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 164/429 (38%), Positives = 246/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL  +  G+S+F TGSAGTGK++L++ I+  L      +    TASTGV
Sbjct  85    TKPQLSKEQAAVLRVVLKGQSIFFTGSAGTGKSYLLKRILGSLPP----TGTVATASTGV  140

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  141   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQGWLNCQRLVIDEISMVEADLFD  199

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       +   +GGIQ++  GDF QLPP+  K +Q  +F F+A SW+   
Sbjct  200   KLEAVARAVR------QQNKPFGGIQLIICGDFLQLPPV-TKGSQPPQFCFQAKSWRRCV  252

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L    ++       +A +L    D
Sbjct  253   PVILELTEVWRQADKTFISLLQAVRLGRCSDEVTRQLRATAAHKVGRDGIVATRLCTHQD  312

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N+K L  L  ++  + A+D+  +  +           L+L +GA+VML KNL   
Sbjct  313   DVALTNEKRLQELPGEIHSFEAMDSDPEQARTLDAQCPVSQLLQLKLGAQVMLVKNLAVS  372

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+     E  G   LP V+F     + +IR + W++      +  R
Sbjct  373   RGLVNGARGVVVGFEA-----EGRG---LPQVRFLCGVTE-VIRADRWTVQATGGQLLSR  423

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  424   QQLPLQLAWAISIHKSQGMSLDCVEISLSRVFASGQAYVALSRARSLQGLRVLDFDPMVV  483

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  484   RCDPRVLSF  492



>gb|KDN35967.1| hypothetical protein RSAG8_11178, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=531

 Score =   281 bits (719),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 186/480 (39%), Positives = 271/480 (56%), Gaps = 57/480 (12%)
 Frame = +1

Query  613   RVKWTVEQSQVLDAISAGKS-VFVTGSAGTGKTFLIQHIIRKLREIHG-RSRVYVTASTG  786
             R+  T EQ  +L  +   K+ +F TGSAGTGK+ L++ +IR+LRE  G  +R+ VTASTG
Sbjct  54    RITLTEEQRFILSKVINDKANLFFTGSAGTGKSVLLREVIRRLRETVGDPARLQVTASTG  113

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++A  + G TLHSFAGIGLGE   ++LL ++   +   +RW   Q L+IDEIS++SG+L+
Sbjct  114   IAALNIGGITLHSFAGIGLGELPVQDLLARIRGVKSTYNRWLKTQVLVIDEISMVSGKLF  173

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNK---NT-----QKFAFEA  1122
             D ++ +AR+IR S         +GGIQ+V SGDFFQLPPI ++   NT       FAFE+
Sbjct  174   DLIDRVAREIRQSTRP------FGGIQLVVSGDFFQLPPISDERDINTGYEIDPPFAFES  227

Query  1123  SSWKLSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDP--LAV  1296
               WK +F     LT VFRQ+D   ++LL  +R G    + +N+L+     ++ +   L  
Sbjct  228   KCWKTTFPQAYKLTRVFRQTDTAFIRLLDELRHGITTDDTINILKGLHRPIKCNDGILPT  287

Query  1297  KLYPRNDDVYRVNKKHLDSLHQDLIGYRAVDN-GEDSWKEQLKLG--------IAPDFLE  1449
             ++YP    V R N  HL  L      Y+++D  G D     +++          AP  L 
Sbjct  288   EIYPHRHSVQRANLYHLAKLDTHQYTYQSIDKYGIDRHGYPVRIPDAEVMLEKRAPRTLA  347

Query  1450  LCVGARVMLTKNLNARHKLVNGAAGTVIGFE-------------------SVNGTYETFG  1572
             L VGA+VM T N+   + LVNG+ G VIGF                    S +GT +   
Sbjct  348   LQVGAQVMCTHNITDSN-LVNGSIGRVIGFATPEQALDEGYPIAGAALTISDDGTLKRPS  406

Query  1573  TN-------WLPVVKFDFKPKKLIIRPETWSIMDG-EEVVAVRKQIPLILAWALSIHKCQ  1728
              N       W P+VKF     + ++ P  +++ +G   V A R+QIPLILAWAL+IH+ Q
Sbjct  407   INKQFRVQSW-PLVKF-VNSGEFLMPPVDFTLDNGVGGVRARRRQIPLILAWALTIHRAQ  464

Query  1729  GMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCSQP  1908
             G T++ L  DL + F  G  YVA+SR KSLEGL + +F+P+ + V+ KV+++D  L   P
Sbjct  465   GQTIDRLRVDLGKTFAPGQAYVAISRCKSLEGLQVVNFSPSSVFVNKKVIDWDNNLDVAP  524



>gb|EQL02356.1| DNA helicase PIF1, ATP-dependent [Ophiocordyceps sinensis CO18]
Length=763

 Score =   287 bits (734),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 182/476 (38%), Positives = 265/476 (56%), Gaps = 57/476 (12%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLRE--IHGRSRVYVTASTG  786
             +  + EQ QVLD  ++   SVF TG AG GK+ L++ IIR+L+   +    RV VTASTG
Sbjct  283   ISLSSEQRQVLDLVVNKEASVFFTGPAGAGKSVLMRAIIRELKRKFLRDPERVAVTASTG  342

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF+GIGLG+  A EL+ KV  N + ++RW   + LIIDEIS++ G+L+
Sbjct  343   LAACNIGGITLHSFSGIGLGKEDATELVKKVRRNPKAKNRWLKTKYLIIDEISMVDGDLF  402

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ----KFAFEASSWK  1134
             DKL  + R IR+  NG      WGGIQ++ +GDFFQLPP+ + + +    KFAF++++W 
Sbjct  403   DKLSHVGRLIRN--NGRP----WGGIQLIITGDFFQLPPVPDHDKKREGTKFAFDSATWS  456

Query  1135  LSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDP--LAVKLYP  1308
              S D  I LT VFRQ DP    +L  +R G+     +   +     L+ D    + +LYP
Sbjct  457   TSIDHTIGLTQVFRQRDPVFAGMLNEMRLGKISNTTVEAFKALSRPLKFDDGVDSAELYP  516

Query  1309  RNDDVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLG--IAPDFLELCVGARVMLTK  1482
                 V   N++ L  L   +  Y A+D G+ + +++L LG  ++P  L+L + A+VML K
Sbjct  517   TRSQVDGSNERRLRELPGQVYRYEAMDMGDPAIRDKL-LGNMMSPKSLDLKINAQVMLIK  575

Query  1483  NLNARHKLVNGAAGTVIGFESVNGTYETFG------------------------------  1572
             NL+    LVNG+ G VI F S   T+E  G                              
Sbjct  576   NLD--ETLVNGSLGKVIAF-SDEKTFEMTGVESYDSDMDDNMSKAKRKLKGFSRDADVSS  632

Query  1573  --TNWLPVVKFDFK---PKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGM  1734
               +   PVV+F      P+ ++ +PE W + +   +V A R Q+PLILAWALSIHK QG 
Sbjct  633   SNSRKFPVVQFVSTGGVPRVILCQPEEWKVELPNGDVQAKRTQLPLILAWALSIHKAQGQ  692

Query  1735  TLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             TL  +  +L R F  G  YVALSR    +GL +  F+ + +  H +V++F  +L S
Sbjct  693   TLERVTVNLGRVFEKGQAYVALSRATCQQGLRVLGFDKSKVMAHARVVDFYDKLYS  748



>ref|XP_004409469.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Odobenus rosmarus 
divergens]
Length=641

 Score =   284 bits (727),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 165/429 (38%), Positives = 246/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL  +  G+SVF TGSAGTGK++L++ I+  L           TASTGV
Sbjct  203   TKPQLSKEQAAVLRVVLKGQSVFFTGSAGTGKSYLLKRILGSLPPTG----TVATASTGV  258

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  259   AACHIGGTTLHAFAGIGSGRAPLAQCV-ALAQRPAVRQGWLNCQRLVIDEISMVEADLFD  317

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       ++  +GGIQ++  GDF QLPP+  K +Q  KF F+A +W+   
Sbjct  318   KLEAVARAVR------QQDKPFGGIQLIICGDFLQLPPV-TKGSQPPKFCFQAKTWRRCV  370

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSN-LEPDPL-AVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L+   S+ +E D + A +L    D
Sbjct  371   PVTLELTEVWRQADQIFISLLQAVRLGRCSEEVTRQLQATASHKVERDGIVATRLCTHQD  430

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N++ L  L  ++  ++A+D+  +  +           L+L +GA+VML KNL   
Sbjct  431   DVALTNRRRLQELPGEVHSFKAMDSDPEQARILDAQCPVSRILQLKLGAQVMLVKNLAVS  490

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+            LP V+F     + +IR + W++      +  R
Sbjct  491   RGLVNGARGVVVGFETEG--------RGLPQVRFLCGVTE-VIRADRWTVQATGGQLLSR  541

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SL+GL +  F+P  +
Sbjct  542   QQLPLQLAWAISIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPTAV  601

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  602   RCDPRVLSF  610



>ref|XP_005861195.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Myotis brandtii]
Length=537

 Score =   281 bits (719),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 162/421 (38%), Positives = 239/421 (57%), Gaps = 23/421 (5%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             EQ+ VL  +  G+S+F TGSAGTGK++L++ I+  L      +    TASTGV+AC + G
Sbjct  106   EQAAVLRVVLKGQSIFFTGSAGTGKSYLLKRILGSLPP----TGTVTTASTGVAACHIGG  161

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+DKLE +AR
Sbjct  162   TTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQGWLNCQRLVIDEISMVEADLFDKLEAVAR  220

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNK-NTQKFAFEASSWKLSFDTQIDLTT  1167
              +R       ++  +GGIQ++  GDF QLPP+       +F F+A SW+      ++LT 
Sbjct  221   TVR------QQDKPFGGIQLIICGDFLQLPPVTKGFQPPQFCFQAKSWRRCVPVTLELTK  274

Query  1168  VFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRNDDVYRVNKK  1341
             V+RQ+D   + LLQ +R G    E    L+   ++       +A +L    DDV   N+K
Sbjct  275   VWRQADQTFISLLQAVRLGRCSNEVTRQLQATATHKVGRDGIVATRLCTHQDDVALTNEK  334

Query  1342  HLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKLVNGAA  1521
              L  L  ++  + A+D+  +  +           L+L +GA+VML KNL     LVNGA 
Sbjct  335   RLRDLPGEVHSFEAMDSDPEQARTLDAQCPVSKLLQLKLGAQVMLVKNLAVSQGLVNGAR  394

Query  1522  GTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQIPLILA  1701
             G V+GFE+     E  G   LP V+F     + +IR E W++      +  R+Q+PL LA
Sbjct  395   GVVVGFET-----EGRG---LPQVRFLCGVTE-VIRAERWTVQTTGGRLLSRQQLPLQLA  445

Query  1702  WALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLN  1881
             WA+SIHK QGM+L+C+   L R F  G  YVALSR +SL+GL +  F+P +++  P+VL 
Sbjct  446   WAMSIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPTVVRCDPRVLR  505

Query  1882  F  1884
             F
Sbjct  506   F  506



>ref|XP_003640106.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Canis lupus familiaris]
Length=641

 Score =   284 bits (726),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 166/429 (39%), Positives = 243/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL  +  G+SVF TGSAGTGK++L++ I+  L      +    TASTGV
Sbjct  203   TKPQLSEEQAAVLRVVLKGQSVFFTGSAGTGKSYLLKRILGSLPP----TGTVATASTGV  258

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     V+  W   Q L+IDEIS++  +L+D
Sbjct  259   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPAVKQGWLNCQRLVIDEISMVEADLFD  317

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       +   +GGIQ++  GDF QLPP+  K +Q  KF F+A SWK   
Sbjct  318   KLEAVARTVR------QQNKPFGGIQLIICGDFLQLPPV-TKGSQPPKFCFQAKSWKRCV  370

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L+   S+       +A +L    D
Sbjct  371   PVTLELTEVWRQADQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDGIVATRLCTHQD  430

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N+K L  L  ++  ++A+D+     +           L+L +GA+VML KNL   
Sbjct  431   DVALTNEKRLQELPGEVHSFKAMDSDPKQARTLDAQCPVSQILQLKLGAQVMLVKNLAVS  490

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+            LP V+F     K +I  + W++      +  R
Sbjct  491   RGLVNGARGVVVGFETEG--------RGLPQVRFLCGVTK-VIHADRWTVQATGGQLLSR  541

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SLEGL +  F+P ++
Sbjct  542   RQLPLQLAWAISIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLEGLRVLDFDPMVV  601

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  602   RCDPRVLSF  610



>gb|KDQ61420.1| hypothetical protein JAAARDRAFT_54792 [Jaapia argillacea MUCL 
33604]
Length=644

 Score =   284 bits (726),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 175/470 (37%), Positives = 251/470 (53%), Gaps = 60/470 (13%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLRE--IHGRSRVYVTASTGVSACAL  804
             EQ+ +L  ++ G S+F TGSAGTGK+ L++ II+ L++  I     V +TASTG++AC +
Sbjct  182   EQTHILGLVNDGMSLFYTGSAGTGKSVLLREIIKTLKKKFIKIPDAVAITASTGIAACNI  241

Query  805   NGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFI  984
              G T+HSFAGIGLG  +AE+L  K+  N++   RW   + LIIDE+S++ G+L+DKL  I
Sbjct  242   GGVTIHSFAGIGLGIESAEDLTMKIRKNKKASARWLRTKVLIIDEVSMVDGDLFDKLARI  301

Query  985   ARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQIDL  1161
                +R           +GGIQ+V +GDFFQLPP+   N Q KFAFEA+ W        +L
Sbjct  302   GSLLRK------RPEPFGGIQLVVTGDFFQLPPVTKGNVQVKFAFEATRWNECVQKTFNL  355

Query  1162  TTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDP--LAVKLYPRNDDVYRVN  1335
             T VFRQ+D   V +L  +R G      +         +E D      +L+PR +DV R N
Sbjct  356   TKVFRQTDQTFVDMLNEMRFGRLSANSIARFRALSREVEYDDGLGPTELFPRREDVDRSN  415

Query  1336  KKHLDSLHQDLIGYRAVDNGEDSWKEQLKL---GIAPDFLELCVGARVMLTKNLNARHKL  1506
                L  L      + A D G+    ++ K+    +AP  L L V ++VML KN++    L
Sbjct  416   TTRLSRLPTQSQTFFASDTGQIEGPQREKMLANFMAPSQLTLRVDSQVMLIKNVD--ETL  473

Query  1507  VNGAAGTVIGFESVNGTYETFGTN-----------------------------------W  1581
             VNG+ G V+ F        T+GT                                     
Sbjct  474   VNGSMGKVVRFVD----PATYGTESDMDGEVDEIGGGDGKGGKAGSGGKVEKKPAGSGKL  529

Query  1582  LPVVKFDF----KPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNC  1746
             LP+V F      + +++++ PE+W + +   +V   R Q+PLILAWA+SIHK QG TL  
Sbjct  530   LPIVDFVIPGRRETRRVLVTPESWKVELPNGDVQVARSQLPLILAWAMSIHKSQGQTLER  589

Query  1747  LYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             +  DL + F  G  YVALSR  SLEGL + +F+P  + VHPKV+ + K L
Sbjct  590   VKVDLGKVFEKGQAYVALSRATSLEGLQVLNFDPKKVTVHPKVVEWSKTL  639



>ref|XP_004712039.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Echinops telfairi]
Length=638

 Score =   284 bits (726),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 169/429 (39%), Positives = 243/429 (57%), Gaps = 26/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ K + EQ  VL  +  G+SVF TGSAGTGK++L++ I+  L           TASTGV
Sbjct  203   TKPKLSEEQVTVLSVVLKGQSVFFTGSAGTGKSYLLKRILGSLPPTG----TVATASTGV  258

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G A   + +  +     V+  W   Q L+IDEIS++  +L+D
Sbjct  259   AACHIGGTTLHAFAGIGSGRAPLAQCV-ALAQRPGVQQGWLNCQRLVIDEISMVEADLFD  317

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       ++  +GGIQ++  GDF QLPP+  K +Q  +F F+A SWK   
Sbjct  318   KLEAVARAVRR------QDKPFGGIQLIICGDFLQLPPV-TKGSQAPQFCFQAKSWKRCV  370

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSN-LEPDPL-AVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L+   ++ +E D + A +L    D
Sbjct  371   PVTLELTEVWRQADQAFISLLQAVRLGRCTDEMTRQLQATAAHKVERDGIVATRLCTHQD  430

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N++ L  L  ++  + A D+  +  +       A   L+L +GA+VML KNL   
Sbjct  431   DVALTNQRWLQELPGEVHSFEATDSDPEQARTLDAQCPANRLLQLKLGAQVMLLKNLAVS  490

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE   G         LP V+F     + +IR + W++      +  R
Sbjct  491   RGLVNGARGVVVGFEEGKG---------LPQVRFLCGVTE-VIRADRWTVQVTGGQLLSR  540

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             KQ+PL LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SL+GL +  FNP ++
Sbjct  541   KQLPLQLAWAISIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFNPTVV  600

Query  1858  KVHPKVLNF  1884
                P+VL F
Sbjct  601   CCDPQVLRF  609



>gb|EWC48606.1| hypothetical protein DRE_01828 [Drechslerella stenobrocha 248]
Length=694

 Score =   285 bits (729),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 184/473 (39%), Positives = 256/473 (54%), Gaps = 59/473 (12%)
 Frame = +1

Query  631   EQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGR-SRVYVTASTGVSACAL  804
             EQS VLD  ++ GKS+F TGSAGTGK+ L++ II  LR  H     V +TASTG++AC +
Sbjct  187   EQSHVLDMVVNEGKSMFFTGSAGTGKSVLLREIITALRMKHKNFDSVAITASTGLAACNV  246

Query  805   NGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFI  984
              G TLHSF+GIGLG    ++L+ K+    + + RW   + LIIDEIS++ G+L+DKLE +
Sbjct  247   GGVTLHSFSGIGLGRDAVDQLVKKIRRVPKSKQRWLRTKVLIIDEISMVDGDLFDKLEGV  306

Query  985   ARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIF-NKNTQKFAFEASSWKLSFDTQIDL  1161
             AR +++  NG      +GGIQ+V +GDFFQLPP+  N    KFAFEA++W    D  I L
Sbjct  307   ARVLKN--NGRP----FGGIQLVVTGDFFQLPPVPDNGRAAKFAFEANTWNSCVDHTILL  360

Query  1162  TTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDP--LAVKLYPRNDDVYRVN  1335
             T +FRQ D     +L  +R G    + +   +    +L+ D    A +L+P   +V   N
Sbjct  361   THIFRQKDAVFASMLNEMRLGALTPDSIARFKKLSRSLDFDDGLQATELFPTRREVENAN  420

Query  1336  KKHLDSLHQDLIGYRAVDNG----EDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHK  1503
              + L  L  D   Y ++D+     E + ++ L   +AP  LEL +GA+VML KN++    
Sbjct  421   NRQLQGLKADFERYTSIDDSPSLDEAAREKLLSNCMAPRVLELKIGAQVMLIKNID--ET  478

Query  1504  LVNGAAGTVIGFESV---------NGTYETFGTNWLPVVKFDFKPKKLIIR---------  1629
             LVNG+ G ++GF +          +G    FG+          K + L  R         
Sbjct  479   LVNGSLGRIVGFLTEKMYAMVVENDGEDALFGSQGADAADMSSKHRALHERYASEQSRTT  538

Query  1630  --PE----TWSIMDGE------------------EVVAVRKQIPLILAWALSIHKCQGMT  1737
               P+     WSI DG                   EV A RKQ+PLILAWALSIHK QG T
Sbjct  539   TAPKYPLVQWSIADGTQRSTLMLPESWKFELPTGEVQASRKQVPLILAWALSIHKAQGQT  598

Query  1738  LNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRL  1896
             L+ +  DLN+ F  G  YVALSR  + EGL + +F+   +  H KV  F K L
Sbjct  599   LDRVKVDLNKVFEKGQAYVALSRATTQEGLQVLNFDARKVMAHEKVRAFYKSL  651



>gb|KFZ03217.1| hypothetical protein V502_11138 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=924

 Score =   290 bits (741),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 188/476 (39%), Positives = 258/476 (54%), Gaps = 58/476 (12%)
 Frame = +1

Query  625   TVEQSQVLDAISA-GKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTGVSA  795
             + EQS VL+ ++   KSVF TGSAGTGK+ L++ II +LR+++ R   RV VTASTG++A
Sbjct  409   SSEQSNVLELVTQQKKSVFFTGSAGTGKSVLMRAIIAELRKVYKREPDRVAVTASTGLAA  468

Query  796   CALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKL  975
             C + G TLHSF GIGLG+    +L+ K+  N + ++RW   + L++DE+S++ GEL+DKL
Sbjct  469   CNIGGVTLHSFGGIGLGKEPVPDLVKKIMRNAKAKNRWLRTKVLVVDEVSMVDGELFDKL  528

Query  976   EFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ-KFAFEASSWKLSFDTQ  1152
             E IAR IR   NG      +GGIQ+V +GDFFQLPP+ +   Q KFAF+A +W  S    
Sbjct  529   EGIARFIRK--NGRP----FGGIQLVVTGDFFQLPPVPDYGKQVKFAFDADTWSTSIHHT  582

Query  1153  IDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNLEPDPL-AVKLYPRNDDVYR  1329
             I LT VFRQ DP+   +L  +R G+     +         LE   L A +L+P  ++V  
Sbjct  583   IGLTEVFRQRDPEFANMLNEMRLGKISDATMKAFRKLDRPLEASGLDATELFPTRNEVDN  642

Query  1330  VNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKL----GIAPDFLELCVGARVMLTKNLNAR  1497
              N   +  L      Y + D G     +QL+      +AP  LEL   A+VML KN++  
Sbjct  643   SNFMKMRQLQGAGKIYLSEDTGSVRDPQQLERLLQNFMAPKKLELKKHAQVMLIKNMD--  700

Query  1498  HKLVNGAAGTVIGF--ESVNGTYETFGTNWL-----------------------------  1584
               LVNG+ G VIGF  E     YE    + L                             
Sbjct  701   DNLVNGSIGKVIGFMNEKTFEVYEGVDLDPLDDDAGSDTDDPKREAKRRVRGMMNKDLIA  760

Query  1585  ------PVVKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGM  1734
                   P+V+F   D   + L+ +PE W + +   E+ A R+QIPLILAWALSIHK QG 
Sbjct  761   DTGKEYPLVRFFAADGTSRDLLCQPEDWKVELPNGEIQAQRRQIPLILAWALSIHKAQGQ  820

Query  1735  TLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             TL  +  DL + F  G  YVALSR  + EGL + +FNP  +  H +V  F   L S
Sbjct  821   TLERVKVDLRKVFENGQAYVALSRATTQEGLWVQNFNPRAVMAHKRVGEFYDSLYS  876



>ref|XP_003480064.2| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent DNA helicase PIF1 
[Cavia porcellus]
Length=591

 Score =   282 bits (722),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 162/429 (38%), Positives = 244/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             ++ + + EQ+ VL  +  G+SVF TGSAGTGK++L++ I+  L      +    TASTG+
Sbjct  153   SKPQLSEEQAAVLGHVLKGQSVFFTGSAGTGKSYLLKRILGSLPP----TGTVATASTGI  208

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR RW   Q L+IDEIS++  +L+D
Sbjct  209   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQRWLSCQRLVIDEISMVEADLFD  267

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       ++  +GGIQ++  GDF QLPP+  K +Q  +F F+A SW+   
Sbjct  268   KLEAVARAVR------QQQKPFGGIQLIICGDFLQLPPV-TKGSQPPRFCFQARSWRRCV  320

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+DP  + LLQ +R G    E    L    ++       +A +L    D
Sbjct  321   PVSLELTEVWRQADPTFISLLQAVRVGRCSDEVTQQLRATAAHKVGRDGIVATRLCTHQD  380

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N++ L  L  ++  ++A+D+  +  +           L+L +GA+VML KNL   
Sbjct  381   DVALTNERQLQELPGEVHSFKALDSHPELAQTLDAQCPVSQLLQLKLGAQVMLVKNLAVS  440

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+            LP V+F     + II  + W++      V  R
Sbjct  441   RGLVNGARGVVVGFEAEG--------RGLPQVRFLCGVTE-IIHTDRWTVQATGSQVLTR  491

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWALSIHK QGM+L+C+   L+R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  492   QQLPLQLAWALSIHKSQGMSLDCVEISLSRVFASGQAYVALSRARSLQGLRVLDFDPLVV  551

Query  1858  KVHPKVLNF  1884
             +   + L F
Sbjct  552   RCDARALRF  560



>ref|XP_008566201.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Galeopterus variegatus]
Length=523

 Score =   280 bits (717),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 165/429 (38%), Positives = 244/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL  +  G+S+F TGSAGTGK++L++ I+  L      +    TASTGV
Sbjct  85    TKPQLSEEQAAVLQVVLKGQSIFFTGSAGTGKSYLLKRILGSLPP----TGTVATASTGV  140

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  141   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQGWLSCQRLVIDEISMVEADLFD  199

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQK--FAFEASSWKLSF  1143
             KLE +AR +R       +   +GGIQ++  GDF QLPP+  K +Q+  F F+A SW+   
Sbjct  200   KLEAVARAVR------QQNKPFGGIQLIICGDFLQLPPV-TKGSQRPQFCFQAKSWRRCV  252

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L    ++       +A +L    D
Sbjct  253   PVTLELTEVWRQADQTFISLLQAVRLGRCSDEVTRQLRATAAHKVGRDGIVATRLCTHQD  312

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N+  L  L  ++  + AVD+  +  +       A   L+L +GA+VML KNL   
Sbjct  313   DVALTNEMQLQELPGEVHSFEAVDSHPELSRTLDAQCPASQLLQLKLGAQVMLVKNLAVS  372

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+     E  G   LP V+F     + +IR + W++         R
Sbjct  373   RGLVNGARGVVVGFEA-----EGRG---LPQVRFLCGVTE-VIRADRWTVQATGGQFLSR  423

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  424   QQLPLQLAWAISIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPMVV  483

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  484   RCDPRVLHF  492



>ref|XP_008079638.1| P-loop containing nucleoside triphosphate hydrolase [Glarea lozoyensis 
ATCC 20868]
 gb|EPE33021.1| P-loop containing nucleoside triphosphate hydrolase [Glarea lozoyensis 
ATCC 20868]
Length=931

 Score =   290 bits (741),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 193/489 (39%), Positives = 264/489 (54%), Gaps = 72/489 (15%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             +  + EQ +VLD  ++  KSVF TGSAGTGK+ L++ II +LR+ + +   RV VTASTG
Sbjct  407   ISLSQEQQRVLDLVVNQSKSVFFTGSAGTGKSVLMRAIIAELRKKYRKESDRVAVTASTG  466

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF GIGLG+     L+ K+  N + ++RW   + L+IDEIS++ G+L+
Sbjct  467   LAACNVGGVTLHSFGGIGLGKEDVPTLVKKIRRNPKAKNRWIKTKILVIDEISMVDGDLF  526

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ----KFAFEASSWK  1134
             DKLE IAR +R+  NG      +GGIQ+V +GDFFQLPP+ + + +    KFAF+A +W 
Sbjct  527   DKLEGIARLMRN--NG----RPFGGIQLVITGDFFQLPPVPDSDNKARGIKFAFDAGTWS  580

Query  1135  LSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYD------FEDLNLLENHCSNLEPDPLAV  1296
              +    I LT VFRQ DP    +L  +R G+        F+ LN   N   +LE    A 
Sbjct  581   TAIHHTIGLTEVFRQKDPVFANMLNEMRLGKITDSTVAAFKKLNRKPNFEDSLE----AT  636

Query  1297  KLYPRNDDVYRVNKKHLDSLHQDLIGYRAVDNG----EDSWKEQLKLGIAPDFLELCVGA  1464
             +L+P   +V   N   + SL      Y AVD G    ++   + L   +AP  +EL  GA
Sbjct  637   ELFPMRHEVENSNAYRMRSLVGRSYRYDAVDTGTVTDQNMRDKLLSNMMAPKTIELKKGA  696

Query  1465  RVMLTKNLNARHKLVNGAAGTVIG------FESVNGTYETFGTNWLPV------------  1590
             +VML KN++    LVNG+ G VI       FE  +   E FG +  PV            
Sbjct  697   QVMLIKNMD--EGLVNGSLGKVIAFMSEVTFEIYDKNPELFGDDAEPVDEEARKATQKTS  754

Query  1591  --VKF----DFKP------------------KKLIIRPETWSI-MDGEEVVAVRKQIPLI  1695
                KF    D  P                  + L++ PE W I +   EV A R Q+PLI
Sbjct  755   LTAKFASNKDANPNTGREYPLVQFSLADGTERSLLVMPEEWKIELPSGEVQAQRTQLPLI  814

Query  1696  LAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKV  1875
             LAWALSIHK QG TL  +  DL R F  G  YVALSR  S EGL + +F+ + +  HP+V
Sbjct  815   LAWALSIHKAQGQTLERVKIDLKRIFENGQAYVALSRAVSQEGLEVHNFDKSKVMAHPRV  874

Query  1876  LNFDKRLCS  1902
               F   L S
Sbjct  875   AQFYNSLYS  883



>ref|XP_007294906.1| DNA repair and recombination protein pif1 [Marssonina brunnea 
f. sp. 'multigermtubi' MB_m1]
 gb|EKD14806.1| DNA repair and recombination protein pif1 [Marssonina brunnea 
f. sp. 'multigermtubi' MB_m1]
Length=873

 Score =   288 bits (738),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 185/468 (40%), Positives = 264/468 (56%), Gaps = 48/468 (10%)
 Frame = +1

Query  616   VKWTVEQSQVLD-AISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRS--RVYVTASTG  786
             +  + EQ +VLD  ++  KSVF TGSAGTGK+ L++ II +LR  + R   R+ VTASTG
Sbjct  364   ITLSSEQQKVLDLVVNQSKSVFFTGSAGTGKSVLMRAIIAELRRKYMREPDRIAVTASTG  423

Query  787   VSACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELY  966
             ++AC + G TLHSF GIGLG+     L+ K+  N + ++RW   + LI+DEIS++ G+L+
Sbjct  424   LAACNIGGVTLHSFGGIGLGKEEVPVLVKKIRRNAKAKNRWIRTKILIVDEISMVDGDLF  483

Query  967   DKLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPI--FNKNTQ--KFAFEASSWK  1134
             DKLE IAR +R+  NG      +GGIQ+V +GDFFQLPP+  F   T+  KFAF+A +W 
Sbjct  484   DKLEGIARAMRN--NGRP----FGGIQLVITGDFFQLPPVPDFENKTRGAKFAFDAGTWP  537

Query  1135  LSFDTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYP  1308
              +    I LT VFRQ DP    +L  +R G+   E +   +     +  E    A +L+P
Sbjct  538   TAIHHTIGLTEVFRQKDPVFANMLNEMRLGKITDETIAAFKKLSRPIPYEDGLAATELFP  597

Query  1309  RNDDVYRVNKKHLDSLHQDLIGYRAVDNG---EDSWKEQLKLG-IAPDFLELCVGARVML  1476
               ++V   N   + +L    + + A D G   + + +++L    +AP  LEL  GA+VML
Sbjct  598   TRNEVENSNAFRMRNLQGQSMKFEARDTGTIMDIAMRDKLLSNMMAPKVLELKKGAQVML  657

Query  1477  TKNLNARHKLVNGAAGTVIGFESVNGTYETF---------------------GTNW-LPV  1590
              KN++    LVNG+ GTV+ F     T+E +                     GT    P+
Sbjct  658   IKNMD--DGLVNGSLGTVMAFMD-EKTFEMYDKRPELFQKEDDPELKSIRPQGTGMAYPL  714

Query  1591  VKF---DFKPKKLIIRPETWSI-MDGEEVVAVRKQIPLILAWALSIHKCQGMTLNCLYTD  1758
             VKF   D   ++++++PE W + +   EV A R QIPLILAWALSIHK QG TL  +  D
Sbjct  715   VKFAVADGSYREILVQPEEWKVELPSGEVQAQRAQIPLILAWALSIHKAQGQTLERVKID  774

Query  1759  LNRAFGYGMVYVALSRVKSLEGLHLSSFNPNIIKVHPKVLNFDKRLCS  1902
             L + F  G  YVALSR  S  GL + +F+   +  HP+V  F   L S
Sbjct  775   LKKIFEKGQAYVALSRATSQAGLEVQNFDKTKVMAHPRVAQFYDSLYS  822



>ref|XP_647539.1| hypothetical protein DDB_G0268430 [Dictyostelium discoideum AX4]
 gb|EAL73668.1| hypothetical protein DDB_G0268430 [Dictyostelium discoideum AX4]
Length=933

 Score =   289 bits (740),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 176/427 (41%), Positives = 250/427 (59%), Gaps = 20/427 (5%)
 Frame = +1

Query  631   EQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGVSACALNG  810
             EQ  VL+ +  G+++F TGSAGTGK++L++ I+R LR ++  S +Y+TASTG++AC + G
Sbjct  513   EQRDVLNLVVGGENIFFTGSAGTGKSYLLKEIVRVLRLMYPNS-IYLTASTGIAACNIGG  571

Query  811   YTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYDKLEFIAR  990
              T+HS+ GIGLG+ +  E    +  N + + RW+  + LIIDE+S+IS  L DKLE IA+
Sbjct  572   TTIHSYGGIGLGDKSVREHASAILKNTQSKTRWQTTKVLIIDEVSMISAALLDKLEAIAK  631

Query  991   KIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKN----TQKFAFEASSWKLSFDTQID  1158
              +++S      +  +GGIQV+  GDF QLPP+   +    T KF F A  W    D  I 
Sbjct  632   IVKNS------KERFGGIQVLLCGDFCQLPPVSKASKDDPTSKFCFMAQCWDGLVDRSIQ  685

Query  1159  LTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHC--SNLEPDPLAVK--LYPRNDDVY  1326
             L  VFRQ D   + +L  +R G  + E + +L N C    L  D   V   LYP  D V 
Sbjct  686   LRKVFRQKDQYFIDILNKLRMGIVEDESIEVL-NQCFGRQLSVDDGIVPTILYPHRDKVN  744

Query  1327  RVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNARHKL  1506
               N+  L  L+ +   Y+A DN + ++ + LK   AP+ L L +GA+V+L KNL+  ++L
Sbjct  745   NENEHRLSILNTEARIYKANDNFQPNYADSLKNCPAPETLTLKIGAQVILIKNLDMENEL  804

Query  1507  VNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVRKQI  1686
             VNG+ G VI +   + +        LP+VKF     ++I R E W    GE V++ R+QI
Sbjct  805   VNGSRGVVIDW--TDSSLSPSKEESLPIVKFTNGLTRIIGR-EVWRNEFGEIVISSRRQI  861

Query  1687  PLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHL-SSFNPNIIKV  1863
             PL+LAWALSIHK QGMT++ L  +L+  F  G  YVALSR   L GL L S F  + IKV
Sbjct  862   PLMLAWALSIHKSQGMTIDKLVINLDGIFENGQTYVALSRSSGLNGLQLVSKFKKSHIKV  921

Query  1864  HPKVLNF  1884
                V  F
Sbjct  922   DENVKTF  928



>ref|XP_006184109.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Camelus ferus]
Length=540

 Score =   280 bits (717),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 164/429 (38%), Positives = 246/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL  +  G+S+F TGSAGTGK++L++ I+  L      +    TASTGV
Sbjct  102   TKPQLSKEQAAVLRVVLKGQSIFFTGSAGTGKSYLLKRILGSLPP----TGTVATASTGV  157

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  158   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQGWLNCQRLVIDEISMVEADLFD  216

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       +   +GGIQ++  GDF QLPP+  K +Q  +F F+A SW+   
Sbjct  217   KLEAVARAVR------QQNKPFGGIQLIICGDFLQLPPV-TKGSQPPQFCFQAKSWRRCV  269

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L    ++       +A +L    D
Sbjct  270   PVILELTEVWRQADKTFISLLQAVRLGRCSDEVTRQLRATAAHKVGRDGIVATRLCTHQD  329

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N+K L  L  ++  + A+D+  +  +           L+L +GA+VML KNL   
Sbjct  330   DVALTNEKRLQELPGEIHSFEAMDSDPEQARTLDAQCPVSQLLQLKLGAQVMLVKNLAVS  389

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+     E  G   LP V+F     + +IR + W++      +  R
Sbjct  390   RGLVNGARGVVVGFEA-----EGRG---LPQVRFLCGVTE-VIRADRWTVQATGGQLLSR  440

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  441   QQLPLQLAWAISIHKSQGMSLDCVEISLSRVFASGQAYVALSRARSLQGLRVLDFDPMVV  500

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  501   RCDPRVLSF  509



>ref|XP_004758755.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X1 [Mustela 
putorius furo]
 ref|XP_004795777.1| PREDICTED: ATP-dependent DNA helicase PIF1 isoform X1 [Mustela 
putorius furo]
Length=698

 Score =   285 bits (728),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 165/429 (38%), Positives = 246/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL  +  G+S+F TGSAGTGK++L++ I+  L           TASTG 
Sbjct  260   TKPQLSKEQAAVLRVVLKGQSIFFTGSAGTGKSYLLKRILGSLPPTG----TVATASTGA  315

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  316   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPAVRQGWLNCQRLVIDEISMVEADLFD  374

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       ++  +GGIQ++  GDF QLPP+  K +Q  KF F+A SW+   
Sbjct  375   KLEAVARAVR------QQDKPFGGIQLIICGDFLQLPPV-TKGSQPPKFCFQAKSWRRCV  427

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L+   S+       +A +L    D
Sbjct  428   PVTLELTEVWRQADQNFISLLQAVRLGRCSDEVTRQLQATASHKVGRDGIVATRLCTHQD  487

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N++ L  L  ++  ++A+D+  +  +           L+L +GA+VML KNL   
Sbjct  488   DVALTNERRLQELPGEMHTFKAMDSDPEQARSLDAQCPVSQILQLKLGAQVMLVKNLAVS  547

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G VIGFE+     E  G   LP V+F     + +IR + W++      +  R
Sbjct  548   RGLVNGARGVVIGFET-----EGRG---LPQVRFLCGVTE-VIRADRWTVQATGGQLLSR  598

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  599   QQLPLQLAWAISIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPMVV  658

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  659   RCDPRVLSF  667



>ref|XP_010953999.1| PREDICTED: ATP-dependent DNA helicase PIF1 [Camelus bactrianus]
Length=580

 Score =   281 bits (720),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 164/429 (38%), Positives = 246/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL  +  G+S+F TGSAGTGK++L++ I+  L           TASTGV
Sbjct  142   TKPQLSKEQAAVLRVVLKGQSIFFTGSAGTGKSYLLKRILGSLPPTG----TVATASTGV  197

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  198   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPGVRQGWLNCQRLVIDEISMVEADLFD  256

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       +   +GGIQ++  GDF QLPP+  K +Q  +F F+A SW+   
Sbjct  257   KLEAVARAVR------QQNKPFGGIQLIICGDFLQLPPV-TKGSQPPQFCFQAKSWRRCV  309

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V+RQ+D   + LLQ +R G    E    L+   ++       +A +L    D
Sbjct  310   PVILELTEVWRQADKTFISLLQAVRLGRCSDEVTRQLQATAAHKVGRDGIVATRLCTHQD  369

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N+K L  L  ++  + A+D+  +  +           L+L +GA+VML KNL   
Sbjct  370   DVALTNEKRLQELPGEIHSFEAMDSDPEQARTLDAQCPVSQLLQLKLGAQVMLVKNLAVS  429

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G V+GFE+     E  G   LP V+F     + +IR + W++      +  R
Sbjct  430   RGLVNGARGVVVGFEA-----EGRG---LPQVRFLCGVTE-VIRADRWTVQATGGQLLSR  480

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L+R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  481   QQLPLQLAWAISIHKSQGMSLDCVEISLSRVFASGQAYVALSRARSLQGLRVLDFDPMVV  540

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  541   RCDPRVLSF  549



>ref|XP_002914318.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent DNA helicase PIF1-like 
[Ailuropoda melanoleuca]
Length=610

 Score =   282 bits (721),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 163/429 (38%), Positives = 244/429 (57%), Gaps = 25/429 (6%)
 Frame = +1

Query  610   TRVKWTVEQSQVLDAISAGKSVFVTGSAGTGKTFLIQHIIRKLREIHGRSRVYVTASTGV  789
             T+ + + EQ+ VL  +  G+S+F TGSAGTGK++L++ I+  L      +    TASTGV
Sbjct  172   TKPQLSEEQAAVLRVVLKGQSIFFTGSAGTGKSYLLKRILGSLPP----TGTVATASTGV  227

Query  790   SACALNGYTLHSFAGIGLGEATAEELLHKVCSNRRVRHRWKMVQALIIDEISLISGELYD  969
             +AC + G TLH+FAGIG G+A   + +  +     VR  W   Q L+IDEIS++  +L+D
Sbjct  228   AACHIGGTTLHAFAGIGSGQAPLAQCV-ALAQRPAVRQGWLNCQRLVIDEISMVEADLFD  286

Query  970   KLEFIARKIRSSINGSDEEMVWGGIQVVASGDFFQLPPIFNKNTQ--KFAFEASSWKLSF  1143
             KLE +AR +R       ++  +GGIQ++  GDF QLPP+  K +Q  KF F+A SW+   
Sbjct  287   KLEAVARAVR------QQDKPFGGIQLIICGDFLQLPPV-TKGSQPPKFCFQAKSWRRCV  339

Query  1144  DTQIDLTTVFRQSDPQLVKLLQGIRKGEYDFEDLNLLENHCSNL--EPDPLAVKLYPRND  1317
                ++LT V RQ+D   + LLQ +R G    E    L+   S+       +A +L    D
Sbjct  340   PVTLELTEVRRQADQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDGIVATRLCTHQD  399

Query  1318  DVYRVNKKHLDSLHQDLIGYRAVDNGEDSWKEQLKLGIAPDFLELCVGARVMLTKNLNAR  1497
             DV   N++ L  L  ++  ++A+D+  +  +           L+L +GA+VML KNL   
Sbjct  400   DVALTNERRLRELPGEVHSFKAMDSDPEQARTLDAQCPVSQILQLKLGAQVMLVKNLAVS  459

Query  1498  HKLVNGAAGTVIGFESVNGTYETFGTNWLPVVKFDFKPKKLIIRPETWSIMDGEEVVAVR  1677
               LVNGA G VIGFE+            LP V+F     + +I  + W++      +  R
Sbjct  460   RGLVNGARGVVIGFETEG--------RGLPQVRFLCGVTE-VIHADRWTVQATGGQLLSR  510

Query  1678  KQIPLILAWALSIHKCQGMTLNCLYTDLNRAFGYGMVYVALSRVKSLEGLHLSSFNPNII  1857
             +Q+PL LAWA+SIHK QGM+L+C+   L R F  G  YVALSR +SL+GL +  F+P ++
Sbjct  511   RQLPLQLAWAISIHKSQGMSLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPMVV  570

Query  1858  KVHPKVLNF  1884
             +  P+VL+F
Sbjct  571   RCDPRVLSF  579



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7423706613760