BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17691_g1_i1 len=1820 path=[1778:0-814 4333:815-834 2593:835-1348
3107:1349-1819]

Length=1820
                                                                      Score     E

ref|XP_004244279.1|  PREDICTED: rab3 GTPase-activating protein no...    397   0.0      
ref|XP_006348311.1|  PREDICTED: rab3 GTPase-activating protein no...    382   0.0      
ref|XP_009599450.1|  PREDICTED: rab3 GTPase-activating protein no...    381   0.0      
ref|XP_009798853.1|  PREDICTED: rab3 GTPase-activating protein no...    383   0.0      
ref|XP_002285458.1|  PREDICTED: rab3 GTPase-activating protein no...    379   0.0      Vitis vinifera
gb|EYU26320.1|  hypothetical protein MIMGU_mgv1a005910mg                369   0.0      
ref|XP_010644117.1|  PREDICTED: rab3 GTPase-activating protein no...    363   0.0      
ref|XP_011098220.1|  PREDICTED: rab3 GTPase-activating protein no...    370   0.0      
ref|XP_008226542.1|  PREDICTED: rab3 GTPase-activating protein no...    371   0.0      
ref|XP_009334034.1|  PREDICTED: rab3 GTPase-activating protein no...    369   0.0      
ref|XP_007211622.1|  hypothetical protein PRUPE_ppa005570mg             370   0.0      
ref|XP_008382051.1|  PREDICTED: rab3 GTPase-activating protein no...    368   0.0      
ref|XP_010036535.1|  PREDICTED: rab3 GTPase-activating protein no...    354   0.0      
ref|XP_010274475.1|  PREDICTED: rab3 GTPase-activating protein no...    367   0.0      
ref|XP_011102213.1|  PREDICTED: rab3 GTPase-activating protein no...    366   0.0      
ref|XP_006370146.1|  hypothetical protein POPTR_0001s40120g             371   0.0      
ref|XP_011007913.1|  PREDICTED: rab3 GTPase-activating protein no...    370   0.0      
ref|XP_006477742.1|  PREDICTED: rab3 GTPase-activating protein no...    369   0.0      
gb|KDP34770.1|  hypothetical protein JCGZ_10550                         368   0.0      
ref|XP_010552119.1|  PREDICTED: rab3 GTPase-activating protein no...    351   0.0      
ref|XP_004294100.1|  PREDICTED: rab3 GTPase-activating protein no...    354   0.0      
ref|XP_004516083.1|  PREDICTED: rab3 GTPase-activating protein no...    367   0.0      
ref|XP_010675378.1|  PREDICTED: rab3 GTPase-activating protein no...    351   3e-180   
ref|XP_010487305.1|  PREDICTED: rab3 GTPase-activating protein no...    349   7e-180   
ref|XP_010465414.1|  PREDICTED: rab3 GTPase-activating protein no...    350   8e-180   
ref|XP_010502314.1|  PREDICTED: rab3 GTPase-activating protein no...    350   1e-179   
ref|XP_002524520.1|  rab3 gtpase-activating protein non-catalytic...    355   2e-179   Ricinus communis
ref|XP_008386259.1|  PREDICTED: rab3 GTPase-activating protein no...    355   5e-179   
ref|XP_004165412.1|  PREDICTED: rab3 GTPase-activating protein no...    354   1e-178   
ref|XP_010276996.1|  PREDICTED: rab3 GTPase-activating protein no...    377   2e-178   
ref|XP_004146026.1|  PREDICTED: rab3 GTPase-activating protein no...    354   3e-178   
ref|XP_008463738.1|  PREDICTED: rab3 GTPase-activating protein no...    360   1e-177   
ref|XP_010502321.1|  PREDICTED: rab3 GTPase-activating protein no...    349   3e-176   
ref|XP_003525975.1|  PREDICTED: rab3 GTPase-activating protein no...    362   6e-176   
ref|XP_003540058.1|  PREDICTED: rab3 GTPase-activating protein no...    370   9e-176   
ref|XP_009599451.1|  PREDICTED: rab3 GTPase-activating protein no...    352   8e-175   
gb|KEH19569.1|  Rab3 GTPase-activating protein non-catalytic subunit    368   2e-174   
ref|XP_009798854.1|  PREDICTED: rab3 GTPase-activating protein no...    347   3e-173   
ref|XP_007133227.1|  hypothetical protein PHAVU_011G162200g             335   3e-169   
gb|KEH19571.1|  Rab3 GTPase-activating protein non-catalytic subunit    349   8e-169   
ref|XP_010276997.1|  PREDICTED: rab3 GTPase-activating protein no...    377   6e-167   
ref|XP_009394196.1|  PREDICTED: rab3 GTPase-activating protein no...    355   1e-160   
ref|XP_010276998.1|  PREDICTED: rab3 GTPase-activating protein no...    377   4e-157   
ref|XP_006852398.1|  hypothetical protein AMTR_s00021p00018190          335   1e-156   
ref|XP_010087803.1|  hypothetical protein L484_003905                   303   2e-155   
ref|XP_011102228.1|  PREDICTED: rab3 GTPase-activating protein no...    367   3e-154   
ref|XP_008463739.1|  PREDICTED: rab3 GTPase-activating protein no...    359   4e-154   
gb|KDO47004.1|  hypothetical protein CISIN_1g012917mg                   300   8e-153   
ref|XP_010924605.1|  PREDICTED: rab3 GTPase-activating protein no...    347   7e-152   
ref|XP_010489835.1|  PREDICTED: rab3 GTPase-activating protein no...    311   2e-139   
gb|KHN35889.1|  Rab3 GTPase-activating protein non-catalytic subunit    370   5e-136   
gb|KEH19570.1|  Rab3 GTPase-activating protein non-catalytic subunit    368   6e-134   
ref|XP_006442493.1|  hypothetical protein CICLE_v10021305mg             402   5e-133   
ref|NP_001062848.1|  Os09g0315800                                       348   7e-133   Oryza sativa Japonica Group [Japonica rice]
gb|KHN07794.1|  Rab3 GTPase-activating protein non-catalytic subunit    363   4e-132   
ref|XP_008651073.1|  PREDICTED: hypothetical protein isoform X1         338   2e-131   
ref|XP_003577981.1|  PREDICTED: rab3 GTPase-activating protein no...    341   1e-130   
ref|XP_002462180.1|  hypothetical protein SORBIDRAFT_02g021130          342   4e-129   Sorghum bicolor [broomcorn]
ref|XP_004956561.1|  PREDICTED: rab3 GTPase-activating protein no...    343   5e-129   
gb|KDO47005.1|  hypothetical protein CISIN_1g012917mg                   299   6e-129   
ref|XP_006442491.1|  hypothetical protein CICLE_v10021305mg             370   8e-126   
gb|KDO47010.1|  hypothetical protein CISIN_1g012917mg                   369   2e-125   
ref|XP_006661112.1|  PREDICTED: rab3 GTPase-activating protein no...    338   2e-124   
emb|CDP06015.1|  unnamed protein product                                382   2e-122   
ref|XP_007099620.1|  Rab3 GTPase-activating protein non-catalytic...    359   8e-117   
ref|XP_008789377.1|  PREDICTED: rab3 GTPase-activating protein no...    354   7e-112   
gb|EMS54467.1|  hypothetical protein TRIUR3_28411                       350   2e-111   
ref|XP_009146308.1|  PREDICTED: rab3 GTPase-activating protein no...    352   9e-111   
emb|CDX98514.1|  BnaC05g38610D                                          350   3e-110   
ref|XP_006407032.1|  hypothetical protein EUTSA_v10020708mg             350   5e-110   
ref|NP_188109.1|  uncharacterized protein                               348   1e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882901.1|  hypothetical protein ARALYDRAFT_478912             348   3e-109   
gb|KFK38841.1|  hypothetical protein AALP_AA3G167200                    347   7e-109   
ref|NP_001140784.1|  hypothetical protein                               338   2e-108   Zea mays [maize]
gb|EMT29662.1|  Rab3 GTPase-activating protein non-catalytic subunit    343   5e-108   
ref|XP_008345136.1|  PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-...    332   2e-104   
gb|KDO47009.1|  hypothetical protein CISIN_1g012917mg                   300   7e-102   
gb|KDO47007.1|  hypothetical protein CISIN_1g012917mg                   300   1e-101   
emb|CDX97617.1|  BnaA05g24620D                                          341   2e-101   
gb|EPS61151.1|  hypothetical protein M569_13648                         321   8e-99    
ref|XP_007099619.1|  Rab3 GTPase-activating protein non-catalytic...    276   2e-95    
gb|ADE77036.1|  unknown                                                 297   3e-91    
ref|XP_011069445.1|  PREDICTED: rab3 GTPase-activating protein no...    278   4e-86    
dbj|BAJ98280.1|  predicted protein                                      185   3e-83    
ref|XP_001763313.1|  predicted protein                                  186   7e-78    
ref|XP_008793038.1|  PREDICTED: rab3 GTPase-activating protein no...    264   8e-78    
ref|XP_007099609.1|  Rab3 GTPase-activating protein non-catalytic...    251   1e-74    
ref|XP_007099608.1|  Rab3 GTPase-activating protein non-catalytic...    251   2e-74    
ref|XP_007099607.1|  Rab3 GTPase-activating protein non-catalytic...    251   9e-74    
ref|XP_007021776.1|  Uncharacterized protein TCM_031843                 234   2e-67    
ref|XP_002960118.1|  hypothetical protein SELMODRAFT_402130             228   1e-63    
ref|XP_002984023.1|  hypothetical protein SELMODRAFT_119185             228   1e-63    
ref|XP_008793037.1|  PREDICTED: rab3 GTPase-activating protein no...    223   4e-62    
ref|XP_008793036.1|  PREDICTED: rab3 GTPase-activating protein no...    223   9e-62    
ref|XP_007099613.1|  Receptor like protein 33                           209   3e-54    
ref|XP_007099618.1|  Uncharacterized protein TCM_046018                 186   8e-50    
ref|XP_010113082.1|  hypothetical protein L484_000038                 97.4    8e-21    
gb|ELU04193.1|  hypothetical protein CAPTEDRAFT_19824                   105   4e-20    
ref|XP_007574971.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    4e-20    
ref|XP_007021773.1|  Uncharacterized protein TCM_031840               95.5    2e-19    
ref|NP_001120595.1|  rab3 GTPase-activating protein, non-catalyti...    102   5e-19    Xenopus tropicalis [western clawed frog]
ref|XP_010640976.1|  PREDICTED: rab3 GTPase-activating protein no...  99.8    3e-18    
ref|XP_010766356.1|  PREDICTED: rab3 GTPase-activating protein no...  98.6    6e-18    
ref|XP_010766353.1|  PREDICTED: rab3 GTPase-activating protein no...  98.6    6e-18    
gb|EZA61233.1|  Rab3 GTPase-activating protein non-catalytic subunit  98.6    7e-18    
ref|XP_004613073.1|  PREDICTED: rab3 GTPase-activating protein no...  98.6    7e-18    
gb|KFO25393.1|  Rab3 GTPase-activating protein non-catalytic subunit  97.8    1e-17    
gb|EFN79470.1|  Rab3 GTPase-activating protein non-catalytic subunit  96.7    3e-17    
ref|XP_008307451.1|  PREDICTED: rab3 GTPase-activating protein no...  96.7    3e-17    
gb|EFN66870.1|  Rab3 GTPase-activating protein non-catalytic subunit  96.3    3e-17    
ref|XP_001627803.1|  predicted protein                                95.1    4e-17    Nematostella vectensis
gb|KFM80974.1|  Rab3 GTPase-activating protein non-catalytic subunit  95.1    6e-17    
ref|XP_005929682.1|  PREDICTED: rab3 GTPase-activating protein no...  95.1    7e-17    
ref|XP_009579941.1|  PREDICTED: rab3 GTPase-activating protein no...  94.4    7e-17    
ref|XP_006786359.1|  PREDICTED: rab3 GTPase-activating protein no...  95.1    8e-17    
ref|XP_003447880.1|  PREDICTED: rab3 GTPase-activating protein no...  94.7    9e-17    
ref|XP_009074027.1|  PREDICTED: rab3 GTPase-activating protein no...  94.0    1e-16    
ref|XP_008934340.1|  PREDICTED: rab3 GTPase-activating protein no...  94.4    1e-16    
gb|KFQ25872.1|  Rab3 GTPase-activating protein non-catalytic subunit  94.4    1e-16    
ref|XP_008300512.1|  PREDICTED: rab3 GTPase-activating protein no...  94.0    2e-16    
gb|KFP81071.1|  Rab3 GTPase-activating protein non-catalytic subunit  93.6    2e-16    
ref|XP_006608455.1|  PREDICTED: rab3 GTPase-activating protein no...  94.0    2e-16    
gb|KFW78517.1|  Rab3 GTPase-activating protein non-catalytic subunit  94.0    2e-16    
ref|XP_008919240.1|  PREDICTED: rab3 GTPase-activating protein no...  94.0    2e-16    
ref|XP_003697293.1|  PREDICTED: rab3 GTPase-activating protein no...  94.0    2e-16    
ref|XP_006571194.1|  PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-...  93.6    2e-16    
ref|XP_010734699.1|  PREDICTED: rab3 GTPase-activating protein no...  93.6    2e-16    
ref|XP_004082764.1|  PREDICTED: rab3 GTPase-activating protein no...  93.6    2e-16    
ref|XP_010734698.1|  PREDICTED: rab3 GTPase-activating protein no...  93.6    2e-16    
ref|XP_003697292.1|  PREDICTED: rab3 GTPase-activating protein no...  93.6    2e-16    
gb|KFO84451.1|  Rab3 GTPase-activating protein non-catalytic subunit  93.6    2e-16    
ref|XP_008397867.1|  PREDICTED: rab3 GTPase-activating protein no...  93.6    3e-16    
ref|XP_010130123.1|  PREDICTED: rab3 GTPase-activating protein no...  93.2    3e-16    
ref|XP_008397865.1|  PREDICTED: rab3 GTPase-activating protein no...  93.2    3e-16    
ref|XP_008397866.1|  PREDICTED: rab3 GTPase-activating protein no...  93.2    3e-16    
ref|XP_790581.3|  PREDICTED: rab3 GTPase-activating protein non-c...  93.2    3e-16    Strongylocentrotus purpuratus [purple urchin]
ref|XP_008397864.1|  PREDICTED: rab3 GTPase-activating protein no...  93.2    3e-16    
ref|XP_007636782.1|  PREDICTED: rab3 GTPase-activating protein no...  93.2    3e-16    
ref|XP_010704992.1|  PREDICTED: rab3 GTPase-activating protein no...  93.2    3e-16    
gb|KFV78308.1|  Rab3 GTPase-activating protein non-catalytic subunit  93.2    3e-16    
gb|KGL79713.1|  Rab3 GTPase-activating protein non-catalytic subunit  93.2    3e-16    
ref|XP_003999573.2|  PREDICTED: rab3 GTPase-activating protein no...  92.8    3e-16    
ref|XP_005483178.1|  PREDICTED: rab3 GTPase-activating protein no...  93.2    3e-16    
ref|XP_009667378.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    3e-16    
ref|XP_010216511.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    3e-16    
ref|XP_003495044.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    3e-16    
ref|XP_005416340.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
gb|KFQ61339.1|  Rab3 GTPase-activating protein non-catalytic subunit  92.8    4e-16    
ref|XP_009094633.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_009481302.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_007640777.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_005799228.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|NP_001157271.1|  rab3 GTPase-activating protein non-catalytic...  92.8    4e-16    Taeniopygia guttata
gb|EGV92537.1|  Rab3 GTPase-activating protein non-catalytic subunit  92.8    4e-16    
ref|XP_009094632.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_004554870.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_005025931.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_004554871.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_010391879.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_010391876.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_010391878.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_008628754.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_004554872.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_005523374.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_004699965.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_005998474.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
gb|KFO56652.1|  Rab3 GTPase-activating protein non-catalytic subunit  92.8    4e-16    
ref|XP_005523373.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_005043115.1|  PREDICTED: rab3 GTPase-activating protein no...  92.8    4e-16    
ref|XP_005043116.1|  PREDICTED: rab3 GTPase-activating protein no...  92.4    5e-16    
ref|XP_003976453.1|  PREDICTED: rab3 GTPase-activating protein no...  92.4    5e-16    
ref|XP_004878980.1|  PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-...  92.4    5e-16    
ref|XP_003705059.1|  PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-...  92.4    5e-16    
ref|XP_009471285.1|  PREDICTED: rab3 GTPase-activating protein no...  92.4    5e-16    
ref|XP_004867457.1|  PREDICTED: rab3 GTPase-activating protein no...  92.4    5e-16    
ref|XP_007072910.1|  PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-...  92.4    5e-16    
ref|XP_005082491.1|  PREDICTED: rab3 GTPase-activating protein no...  92.4    6e-16    
gb|KFR06154.1|  Rab3 GTPase-activating protein non-catalytic subunit  92.4    6e-16    
ref|XP_005082492.1|  PREDICTED: rab3 GTPase-activating protein no...  92.0    6e-16    
ref|XP_010157566.1|  PREDICTED: rab3 GTPase-activating protein no...  91.3    7e-16    
ref|XP_002121049.1|  PREDICTED: rab3 GTPase-activating protein no...  92.0    7e-16    Ciona intestinalis [sea vase]
ref|XP_006972166.1|  PREDICTED: rab3 GTPase-activating protein no...  92.0    7e-16    
ref|XP_009565496.1|  PREDICTED: rab3 GTPase-activating protein no...  92.0    7e-16    
ref|XP_004627000.1|  PREDICTED: rab3 GTPase-activating protein no...  92.0    7e-16    
ref|XP_003807227.1|  PREDICTED: rab3 GTPase-activating protein no...  92.0    7e-16    
ref|XP_010126855.1|  PREDICTED: rab3 GTPase-activating protein no...  91.3    7e-16    
gb|KFO80827.1|  Rab3 GTPase-activating protein non-catalytic subunit  92.0    8e-16    
ref|XP_005097932.1|  PREDICTED: rab3 GTPase-activating protein no...  91.7    8e-16    
ref|XP_006272969.1|  PREDICTED: rab3 GTPase-activating protein no...  91.7    8e-16    
ref|NP_001157272.1|  rab3 GTPase-activating protein non-catalytic...  91.7    9e-16    Gallus gallus [bantam]
ref|XP_004751513.1|  PREDICTED: rab3 GTPase-activating protein no...  91.7    9e-16    
ref|XP_008559647.1|  PREDICTED: rab3 GTPase-activating protein no...  91.7    9e-16    
ref|XP_005348887.1|  PREDICTED: rab3 GTPase-activating protein no...  91.7    9e-16    
ref|XP_004751512.1|  PREDICTED: rab3 GTPase-activating protein no...  91.7    9e-16    
ref|XP_005348889.1|  PREDICTED: rab3 GTPase-activating protein no...  91.7    1e-15    
ref|XP_005728771.1|  PREDICTED: rab3 GTPase-activating protein no...  91.7    1e-15    
ref|XP_008683902.1|  PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-...  91.3    1e-15    
ref|NP_001157226.1|  rab3 GTPase-activating protein non-catalytic...  91.3    1e-15    Mus musculus [mouse]
ref|XP_007575066.1|  PREDICTED: rab3 GTPase-activating protein no...  91.3    1e-15    
ref|XP_009870073.1|  PREDICTED: rab3 GTPase-activating protein no...  91.3    1e-15    
sp|Q8BMG7.2|RBGPR_MOUSE  RecName: Full=Rab3 GTPase-activating pro...  91.3    1e-15    Mus musculus [mouse]
ref|XP_007575058.1|  PREDICTED: rab3 GTPase-activating protein no...  91.3    1e-15    
ref|XP_006497279.1|  PREDICTED: rab3 GTPase-activating protein no...  91.3    1e-15    
ref|XP_002920055.1|  PREDICTED: rab3 GTPase-activating protein no...  91.3    1e-15    
ref|XP_007575050.1|  PREDICTED: rab3 GTPase-activating protein no...  91.3    1e-15    
ref|XP_004415199.1|  PREDICTED: rab3 GTPase-activating protein no...  91.3    1e-15    
ref|XP_007670657.1|  PREDICTED: rab3 GTPase-activating protein no...  91.3    1e-15    
ref|XP_536122.2|  PREDICTED: rab3 GTPase-activating protein non-c...  91.3    1e-15    Canis lupus familiaris [dogs]
ref|NP_001035244.2|  rab3 GTPase-activating protein non-catalytic...  91.3    1e-15    Rattus norvegicus [brown rat]
sp|Q5U1Z0.2|RBGPR_RAT  RecName: Full=Rab3 GTPase-activating prote...  91.3    1e-15    Rattus norvegicus [brown rat]
ref|XP_008610404.1|  hypothetical protein SDRG_06403                  91.3    1e-15    
ref|XP_008768058.1|  PREDICTED: rab3 GTPase-activating protein no...  91.3    1e-15    
gb|KFO13971.1|  Rab3 GTPase-activating protein non-catalytic subunit  91.3    1e-15    
ref|XP_010307005.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    1e-15    
ref|XP_007986592.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    1e-15    
gb|KFP77197.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.9    1e-15    
ref|XP_006022404.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    1e-15    
ref|XP_001103011.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    1e-15    Macaca mulatta [rhesus macaque]
ref|XP_005409324.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    1e-15    
ref|XP_008768059.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    1e-15    
ref|XP_006022402.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    1e-15    
ref|XP_007986591.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    1e-15    
ref|XP_005409325.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_006894655.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_010366384.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_010366383.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_005409327.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_005540945.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_003265130.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_007986590.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_006022403.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_005409326.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_005500033.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_003474275.2|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_005500034.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_002809484.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_004578686.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_010877413.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_009898389.1|  PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-...  90.9    2e-15    
ref|XP_010339339.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_010877414.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_514211.2|  PREDICTED: rab3 GTPase-activating protein non-c...  90.9    2e-15    Pan troglodytes
ref|XP_004028475.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
gb|EMC80943.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.9    2e-15    
ref|XP_010560450.1|  PREDICTED: rab3 GTPase-activating protein no...  90.9    2e-15    
ref|XP_010560451.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
ref|XP_009924710.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
ref|XP_009185364.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
ref|XP_004670175.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
ref|XP_010200725.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
gb|EHA99389.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.5    2e-15    
ref|XP_008148038.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
ref|XP_004788639.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
ref|XP_007575018.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
ref|XP_007575033.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
ref|XP_007575025.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    2e-15    
gb|KFQ10018.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.5    2e-15    
gb|KFW83851.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.5    2e-15    
gb|KFP54642.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.5    2e-15    
ref|XP_009512780.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
ref|XP_003393169.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
ref|XP_009892607.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
gb|KFR09065.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.5    2e-15    
ref|XP_009814007.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
ref|XP_009892608.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
ref|XP_009976728.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
gb|KFV09518.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.5    2e-15    
ref|XP_005152133.1|  PREDICTED: rab3 GTPase-activating protein no...  90.5    2e-15    
gb|KGL87428.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.1    2e-15    
ref|XP_009956310.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    2e-15    
ref|XP_004524650.1|  PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-...  90.1    2e-15    
ref|XP_007902718.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    2e-15    
ref|XP_009931160.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    2e-15    
gb|KFM05885.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.1    2e-15    
gb|KFW62103.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.1    3e-15    
ref|XP_010281162.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    3e-15    
ref|XP_009701787.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    3e-15    
gb|KFQ71645.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.1    3e-15    
gb|KFP66665.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.1    3e-15    
gb|KFQ00998.1|  Rab3 GTPase-activating protein non-catalytic subunit  89.7    3e-15    
ref|XP_009972933.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    3e-15    
ref|XP_008983433.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    3e-15    
ref|XP_009645136.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    3e-15    
ref|XP_002760544.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    3e-15    
gb|AAC35881.1|  rab3-GAP regulatory domain                            90.1    3e-15    
ref|XP_004480306.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    3e-15    
ref|XP_009275132.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    3e-15    
ref|NP_036546.2|  rab3 GTPase-activating protein non-catalytic su...  90.1    3e-15    
ref|XP_005335918.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    3e-15    
gb|KFQ76769.1|  Rab3 GTPase-activating protein non-catalytic subunit  89.7    3e-15    
gb|KFV39933.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.1    3e-15    
ref|XP_006744988.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    3e-15    
ref|XP_009331984.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    3e-15    
ref|XP_010972303.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    3e-15    
ref|XP_006056003.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    3e-15    
ref|XP_006744989.1|  PREDICTED: rab3 GTPase-activating protein no...  90.1    3e-15    
gb|KFV60694.1|  Rab3 GTPase-activating protein non-catalytic subunit  90.1    3e-15    
ref|XP_010168712.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    3e-15    
ref|XP_001375651.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    3e-15    
gb|KFU87455.1|  Rab3 GTPase-activating protein non-catalytic subunit  89.7    3e-15    
ref|XP_006916295.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    3e-15    
gb|KFV01947.1|  Rab3 GTPase-activating protein non-catalytic subunit  89.7    3e-15    
gb|EFB20323.1|  hypothetical protein PANDA_008738                     89.7    3e-15    
ref|XP_010082749.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    3e-15    
gb|ERE73002.1|  rab3 GTPase-activating protein non-catalytic subu...  89.7    3e-15    
ref|XP_006188212.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    4e-15    
ref|XP_010991281.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    4e-15    
ref|XP_007172130.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    4e-15    
ref|XP_006140297.1|  PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-...  89.7    4e-15    
ref|XP_010972302.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    4e-15    
ref|XP_005690542.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    4e-15    
ref|XP_006198929.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    4e-15    
gb|KFO95668.1|  Rab3 GTPase-activating protein non-catalytic subunit  89.7    4e-15    
ref|XP_004013655.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    4e-15    
ref|XP_007172128.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    4e-15    
ref|XP_009993105.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    4e-15    
ref|XP_008490389.1|  PREDICTED: rab3 GTPase-activating protein no...  89.7    4e-15    
ref|XP_009059205.1|  hypothetical protein LOTGIDRAFT_218187           89.7    4e-15    
gb|KFZ68661.1|  Rab3 GTPase-activating protein non-catalytic subunit  89.4    4e-15    
ref|XP_007129332.1|  PREDICTED: rab3 GTPase-activating protein no...  89.4    4e-15    
ref|XP_007129333.1|  PREDICTED: rab3 GTPase-activating protein no...  89.4    4e-15    
ref|XP_005981358.1|  PREDICTED: rab3 GTPase-activating protein no...  89.4    4e-15    
ref|XP_007172129.1|  PREDICTED: rab3 GTPase-activating protein no...  89.4    5e-15    
ref|XP_008588665.1|  PREDICTED: rab3 GTPase-activating protein no...  89.4    5e-15    
gb|ETN63254.1|  Rab3 GTPase-activating protein regulatory subunit     89.4    5e-15    
ref|XP_003130554.1|  PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-...  89.4    5e-15    
gb|KFP22594.1|  Rab3 GTPase-activating protein non-catalytic subunit  89.4    5e-15    
gb|EFZ22535.1|  hypothetical protein SINV_05735                       89.4    5e-15    
ref|XP_007129334.1|  PREDICTED: rab3 GTPase-activating protein no...  89.4    5e-15    
ref|XP_006115667.1|  PREDICTED: rab3 GTPase-activating protein no...  89.4    5e-15    
ref|XP_004271069.1|  PREDICTED: rab3 GTPase-activating protein no...  89.4    5e-15    
ref|XP_003767768.1|  PREDICTED: rab3 GTPase-activating protein no...  89.4    5e-15    
ref|XP_003489865.1|  PREDICTED: rab3 GTPase-activating protein no...  89.4    5e-15    
ref|XP_008542679.1|  PREDICTED: rab3 GTPase-activating protein no...  89.0    6e-15    
ref|XP_010020644.1|  PREDICTED: rab3 GTPase-activating protein no...  89.0    6e-15    
ref|XP_005306999.1|  PREDICTED: rab3 GTPase-activating protein no...  89.0    6e-15    
ref|XP_008266631.1|  PREDICTED: rab3 GTPase-activating protein no...  89.0    6e-15    
gb|EDL13073.1|  mCG12392                                              89.0    6e-15    
ref|XP_001488184.1|  PREDICTED: rab3 GTPase-activating protein no...  89.0    6e-15    
ref|XP_008177289.1|  PREDICTED: rab3 GTPase-activating protein no...  89.0    6e-15    
ref|XP_005306998.1|  PREDICTED: rab3 GTPase-activating protein no...  89.0    6e-15    
gb|ETE66666.1|  Rab3 GTPase-activating protein non-catalytic subunit  89.0    6e-15    
ref|XP_007455453.1|  PREDICTED: rab3 GTPase-activating protein no...  89.0    6e-15    
ref|XP_003419920.1|  PREDICTED: rab3 GTPase-activating protein no...  89.0    6e-15    
ref|XP_004439725.1|  PREDICTED: rab3 GTPase-activating protein no...  89.0    6e-15    
ref|XP_010851566.1|  PREDICTED: rab3 GTPase-activating protein no...  89.0    6e-15    
ref|XP_005905620.1|  PREDICTED: rab3 GTPase-activating protein no...  89.0    6e-15    
ref|NP_001179128.1|  rab3 GTPase-activating protein non-catalytic...  89.0    7e-15    
ref|XP_007935122.1|  PREDICTED: rab3 GTPase-activating protein no...  89.0    7e-15    
dbj|BAC27296.1|  unnamed protein product                              88.6    7e-15    
gb|EDL94909.1|  rCG20240, isoform CRA_a                               89.0    7e-15    
ref|XP_008825009.1|  PREDICTED: rab3 GTPase-activating protein no...  88.6    7e-15    
ref|XP_001653918.1|  hypothetical protein AaeL_AAEL009668             88.6    7e-15    
gb|AAH57872.1|  Rab3gap2 protein                                      88.6    7e-15    
ref|XP_008825010.1|  PREDICTED: rab3 GTPase-activating protein no...  88.6    8e-15    
gb|ELK08927.1|  Rab3 GTPase-activating protein non-catalytic subunit  88.6    9e-15    
ref|XP_003216038.1|  PREDICTED: rab3 GTPase-activating protein no...  88.6    9e-15    
ref|XP_008124070.1|  PREDICTED: rab3 GTPase-activating protein no...  88.6    9e-15    
ref|XP_011065813.1|  PREDICTED: rab3 GTPase-activating protein no...  88.2    1e-14    
ref|XP_004685500.1|  PREDICTED: rab3 GTPase-activating protein no...  88.2    1e-14    
ref|XP_006094367.1|  PREDICTED: rab3 GTPase-activating protein no...  88.2    1e-14    
ref|XP_004375981.1|  PREDICTED: rab3 GTPase-activating protein no...  88.2    1e-14    
ref|XP_006869763.1|  PREDICTED: rab3 GTPase-activating protein no...  88.2    1e-14    
ref|XP_005879965.1|  PREDICTED: rab3 GTPase-activating protein no...  88.2    1e-14    
ref|XP_006761398.1|  PREDICTED: rab3 GTPase-activating protein no...  88.2    1e-14    
ref|XP_002117272.1|  hypothetical protein TRIADDRAFT_61281            88.2    1e-14    
ref|XP_010192988.1|  PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-...  88.2    1e-14    
gb|EFW41161.2|  hypothetical protein CAOG_06293                       88.2    1e-14    
ref|XP_004345042.1|  predicted protein                                88.2    1e-14    
ref|XP_009526538.1|  hypothetical protein PHYSODRAFT_504554           87.8    1e-14    
ref|XP_005176251.1|  PREDICTED: rab3 GTPase-activating protein re...  87.8    1e-14    
gb|ELR49190.1|  Rab3 GTPase-activating protein non-catalytic subunit  87.8    1e-14    
gb|KDO26110.1|  hypothetical protein SPRG_08471                       87.4    2e-14    
ref|XP_007434392.1|  PREDICTED: rab3 GTPase-activating protein no...  87.4    2e-14    
ref|XP_007064825.1|  PREDICTED: rab3 GTPase-activating protein no...  87.4    2e-14    
ref|XP_008892847.1|  hypothetical protein PPTG_01350                  87.4    2e-14    
gb|ETM45486.1|  hypothetical protein, variant                         87.4    2e-14    
gb|ETI45690.1|  hypothetical protein, variant                         87.4    2e-14    
gb|ETK85635.1|  hypothetical protein L915_09634                       87.0    2e-14    
gb|ETM45485.1|  hypothetical protein L914_09503                       87.0    2e-14    
gb|ETI45689.1|  hypothetical protein F443_09831                       87.0    2e-14    
gb|ETP15503.1|  hypothetical protein, variant                         87.0    2e-14    
gb|ETO74311.1|  hypothetical protein, variant                         87.0    2e-14    
ref|XP_005434036.1|  PREDICTED: rab3 GTPase-activating protein no...  87.0    2e-14    
ref|XP_001989166.1|  GH10197                                          87.0    2e-14    
ref|XP_008892848.1|  hypothetical protein, variant                    87.0    2e-14    
gb|ETP15502.1|  hypothetical protein F441_09780                       87.0    2e-14    
gb|ETO74310.1|  hypothetical protein F444_09925                       87.0    2e-14    
ref|XP_005241936.1|  PREDICTED: rab3 GTPase-activating protein no...  87.0    2e-14    
gb|EMP31169.1|  Rab3 GTPase-activating protein non-catalytic subunit  87.0    3e-14    
ref|XP_002052010.1|  GJ23995                                          87.0    3e-14    
ref|XP_008211313.1|  PREDICTED: rab3 GTPase-activating protein no...  87.0    3e-14    
ref|XP_001601828.2|  PREDICTED: rab3 GTPase-activating protein no...  87.0    3e-14    
gb|EPQ16186.1|  Rab3 GTPase-activating protein non-catalytic subunit  86.7    4e-14    
gb|ELK32161.1|  Rab3 GTPase-activating protein non-catalytic subunit  86.7    4e-14    
ref|XP_001965115.1|  GF23465                                          86.3    4e-14    
ref|XP_001842869.1|  Rab3 GTPase-activating protein regulatory su...  86.3    4e-14    
ref|XP_551287.4|  AGAP001533-PA                                       85.9    6e-14    
gb|EGI58384.1|  Rab3 GTPase-activating protein non-catalytic subunit  85.9    6e-14    
ref|XP_007257652.1|  PREDICTED: rab3 GTPase-activating protein no...  85.5    7e-14    
ref|XP_007257651.1|  PREDICTED: rab3 GTPase-activating protein no...  85.5    7e-14    
ref|XP_001357151.2|  GA20070                                          85.5    7e-14    
ref|XP_002020877.1|  GL14134                                          85.5    7e-14    
ref|XP_003791050.1|  PREDICTED: rab3 GTPase-activating protein no...  85.5    7e-14    
ref|XP_007257653.1|  PREDICTED: rab3 GTPase-activating protein no...  85.5    8e-14    
ref|XP_002001834.1|  GI14853                                          85.5    8e-14    
ref|XP_007257654.1|  PREDICTED: rab3 GTPase-activating protein no...  85.5    8e-14    
ref|XP_007521377.1|  PREDICTED: rab3 GTPase-activating protein no...  85.5    9e-14    
gb|AAI29146.1|  Rab3gap2 protein                                      85.1    1e-13    
gb|EJW76821.1|  hypothetical protein WUBG_12270                       82.4    1e-13    
emb|CDQ68690.1|  unnamed protein product                              84.7    1e-13    
ref|NP_001004528.1|  rab3 GTPase-activating protein non-catalytic...  84.3    2e-13    
ref|XP_008869676.1|  hypothetical protein, variant 1                  84.3    2e-13    
ref|XP_008869675.1|  hypothetical protein H310_06401                  84.3    2e-13    
ref|XP_008869678.1|  hypothetical protein, variant 3                  84.3    2e-13    
ref|XP_008869677.1|  hypothetical protein, variant 2                  84.3    2e-13    
ref|NP_609544.2|  Rab3 GTPase activating protein, isoform A           84.3    2e-13    
ref|NP_723718.2|  Rab3 GTPase activating protein, isoform B           84.3    2e-13    
ref|XP_006103928.1|  PREDICTED: rab3 GTPase-activating protein no...  83.6    2e-13    
ref|XP_002431515.1|  Rab3 GTPase-activating protein regulatory su...  84.0    2e-13    
gb|AAD38657.1|AF145682_1  BcDNA.LD23336                               84.0    2e-13    
gb|KFQ56790.1|  Rab3 GTPase-activating protein non-catalytic subunit  84.0    2e-13    
gb|ETL92184.1|  hypothetical protein, variant                         84.0    2e-13    
gb|ETL92183.1|  hypothetical protein L917_09464                       84.0    3e-13    
ref|XP_001895234.1|  hypothetical protein Bm1_18885                   83.6    3e-13    
ref|XP_002079185.1|  GD22135                                          83.6    3e-13    
ref|XP_007021774.1|  Uncharacterized protein TCM_031841               75.9    3e-13    
ref|XP_002088439.1|  GE12457                                          83.6    3e-13    
ref|XP_002289700.1|  predicted protein                                83.6    3e-13    
ref|XP_002042018.1|  GM26362                                          83.2    3e-13    
gb|ETP43574.1|  hypothetical protein F442_09736                       83.6    3e-13    
emb|CDQ01852.1|  Protein BM-RBG-2, isoform b                          83.2    4e-13    
gb|ETP43575.1|  hypothetical protein, variant                         83.2    4e-13    
ref|XP_009839461.1|  hypothetical protein, variant 1                  83.2    4e-13    
ref|XP_009839459.1|  hypothetical protein, variant 2                  83.2    4e-13    
emb|CCA17995.1|  conserved hypothetical protein                       82.8    6e-13    
ref|XP_001969771.1|  GG10277                                          82.8    6e-13    
gb|EJD74601.1|  hypothetical protein LOAG_18108                       82.4    8e-13    
ref|XP_002069254.1|  GK21099                                          81.3    1e-12    
ref|XP_002897033.1|  conserved hypothetical protein                   80.9    2e-12    
emb|CEF65559.1|  Rab3 GTPase-activating protein non-catalytic sub...  79.0    7e-12    
gb|EKC37435.1|  Rab3 GTPase-activating protein non-catalytic subunit  79.0    7e-12    
dbj|GAA48966.1|  Rab3 GTPase-activating protein non-catalytic sub...  77.4    2e-11    
ref|XP_004988413.1|  hypothetical protein PTSG_13029                  77.4    2e-11    
ref|XP_002178027.1|  predicted protein                                76.3    6e-11    
emb|CBN78750.1|  Rab3 GTPase-activating protein, non-catalytic su...  76.3    6e-11    
ref|XP_002433469.1|  hypothetical protein IscW_ISCW000719             75.5    8e-11    
gb|ENN75474.1|  hypothetical protein YQE_08023                        75.5    1e-10    
gb|ERL83997.1|  hypothetical protein D910_01313                       75.1    1e-10    
ref|XP_009839460.1|  hypothetical protein H257_13590                  74.7    2e-10    
ref|XP_005793713.1|  hypothetical protein EMIHUDRAFT_97510            73.2    2e-10    
gb|EHJ71716.1|  hypothetical protein KGM_15744                        73.9    3e-10    
ref|XP_008479236.1|  PREDICTED: rab3 GTPase-activating protein re...  73.2    4e-10    
gb|EFX89884.1|  hypothetical protein DAPPUDRAFT_299991                73.2    5e-10    
gb|KGB40713.1|  Rab3 GTPase-activating protein non-catalytic subunit  71.2    2e-09    
ref|XP_004366378.1|  hypothetical protein DFA_03968                   70.5    2e-09    
ref|XP_006679193.1|  hypothetical protein BATDEDRAFT_88568            70.9    3e-09    
ref|XP_008197991.1|  PREDICTED: rab3 GTPase-activating protein no...  70.9    3e-09    
ref|XP_007021775.1|  Receptor like protein 33                         70.5    3e-09    
ref|XP_004925590.1|  PREDICTED: rab3 GTPase-activating protein re...  70.1    4e-09    
gb|ERG80967.1|  rab3 gtpase-activating protein non-catalytic subunit  70.1    5e-09    
gb|ERZ99853.1|  hypothetical protein GLOINDRAFT_69683                 68.6    7e-09    
emb|CCD59666.1|  hypothetical protein Smp_130000                      68.9    1e-08    
ref|XP_009163570.1|  hypothetical protein T265_01300                  68.2    2e-08    
ref|XP_001742254.1|  hypothetical protein                             67.8    2e-08    
gb|EXX57475.1|  hypothetical protein RirG_206840                      67.4    3e-08    
ref|XP_005650410.1|  hypothetical protein COCSUDRAFT_60876            66.2    3e-08    
dbj|GAM25065.1|  hypothetical protein SAMD00019534_082400             66.6    4e-08    
gb|KHN79130.1|  Rab3 GTPase-activating protein non-catalytic subunit  66.6    6e-08    
emb|CEJ04975.1|  hypothetical protein RMCBS344292_18923               64.7    9e-08    
emb|CEG81762.1|  hypothetical protein RMATCC62417_15921               63.2    3e-07    
gb|KFH71786.1|  hypothetical protein MVEG_02081                       63.5    4e-07    
emb|CDS02711.1|  hypothetical protein LRAMOSA00115                    62.4    7e-07    
emb|CEG73677.1|  hypothetical protein RMATCC62417_09011               62.0    7e-07    
ref|XP_640782.1|  hypothetical protein DDB_G0281043                   62.4    8e-07    
ref|XP_009032454.1|  hypothetical protein AURANDRAFT_60903            62.8    9e-07    
emb|CEI96231.1|  hypothetical protein RMCBS344292_10397               61.6    1e-06    
ref|XP_003294839.1|  hypothetical protein DICPUDRAFT_44031            62.0    1e-06    
gb|EPB87333.1|  hypothetical protein HMPREF1544_05858                 60.8    3e-06    
ref|XP_002677285.1|  predicted protein                                60.1    3e-06    
gb|ETN75113.1|  hypothetical protein NECAME_03836                     60.1    4e-06    
ref|XP_006442494.1|  hypothetical protein CICLE_v100238811mg          55.8    6e-06    
gb|EIE92548.1|  hypothetical protein RO3G_17146                       59.3    6e-06    
gb|EYB92202.1|  hypothetical protein Y032_0197g1594                   59.3    9e-06    
ref|XP_009020252.1|  hypothetical protein HELRODRAFT_174556           58.5    2e-05    
gb|KHJ94104.1|  hypothetical protein OESDEN_05967                     58.2    2e-05    
ref|XP_008883133.1|  hypothetical protein HHA_258750                  57.4    2e-05    
gb|EFA84188.1|  hypothetical protein PPL_03263                        57.8    2e-05    
gb|KFH00717.1|  putative rab3 GTPase-activating non-catalytic sub...  57.4    3e-05    
gb|KFG29332.1|  putative rab3 GTPase-activating non-catalytic sub...  57.0    3e-05    
gb|KFH13195.1|  putative RAB3 GTPase-activating non-catalytic sub...  56.6    3e-05    
gb|KFG65146.1|  putative RAB3 GTPase-activating non-catalytic sub...  56.6    4e-05    
gb|KFG33856.1|  hypothetical protein TGDOM2_258750                    56.6    4e-05    
gb|EPR62952.1|  hypothetical protein TGGT1_258750                     56.2    5e-05    
gb|EPT29374.1|  hypothetical protein TGME49_258750                    56.2    5e-05    
emb|CDH60674.1|  hypothetical protein RO3G_17146                      56.6    5e-05    
emb|CDW58405.1|  rab3 GTPase activating protein non catalytic         55.5    1e-04    
gb|EJK54344.1|  hypothetical protein THAOC_26038                      55.8    1e-04    
gb|ETO10216.1|  hypothetical protein RFI_27160                        55.1    2e-04    
ref|XP_003145226.1|  hypothetical protein LOAG_09651                  55.1    2e-04    



>ref|XP_004244279.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Solanum lycopersicum]
Length=455

 Score =   397 bits (1021),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/233 (87%), Positives = 220/233 (94%), Gaps = 0/233 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCA+TVG DAVISAYRLSVD+SRSIVGAILSKVVPATFSTI+SISKMLWRS+P+
Sbjct  223   QSSQRYYCAITVGADAVISAYRLSVDRSRSIVGAILSKVVPATFSTITSISKMLWRSDPS  282

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             PT +PEPKPQPFA+ASPLTC KD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  283   PTKRPEPKPQPFARASPLTCFKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  342

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLF+EML  KD  T +SA+H+H+KSDYCLCLAIHAPRKGIVEIWQMRTGP
Sbjct  343   RLWKGYRDASCLFVEMLAKKDVETSRSAYHDHVKSDYCLCLAIHAPRKGIVEIWQMRTGP  402

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TIPC KGSKILQPTYRF+SSE S+SSY+PLE+FFLNGDSG L VLNRSL+
Sbjct  403   RLLTIPCAKGSKILQPTYRFASSEMSVSSYVPLELFFLNGDSGLLFVLNRSLS  455


 Score =   352 bits (904),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 197/227 (87%), Gaps = 7/227 (3%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR+ HTTELGCIACDDLS+LGAGKEGWLV NPNLLTALDTHS+ALA+RS++L+L W++
Sbjct  1    MARRN-HTTELGCIACDDLSELGAGKEGWLVNNPNLLTALDTHSIALANRSLVLILHWSE  59

Query  327  AGDP---PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQF  497
              DP     KI+P+LSPI+AEY+SA+ WLVFDDIKVLA+GTS GYLLIYSLRGDLIHKQ 
Sbjct  60   GSDPVGNRVKIVPDLSPIEAEYISAIEWLVFDDIKVLALGTSRGYLLIYSLRGDLIHKQI  119

Query  498  VNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD  677
            V+P KIL+LRVR TKRD  QDAS EEVCVVM G +ARF+GSDIQ+ML+RWF+ER+SQ WD
Sbjct  120  VSPGKILRLRVRDTKRDLTQDASSEEVCVVMSGVIARFDGSDIQNMLQRWFRERHSQFWD  179

Query  678  QPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            +  +   E+S D+FGRLPYQLWNVNKYG CVDAAI G+MPPPL+E Q
Sbjct  180  ETES---ENSADTFGRLPYQLWNVNKYGSCVDAAITGLMPPPLLELQ  223



>ref|XP_006348311.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Solanum tuberosum]
Length=455

 Score =   382 bits (982),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/233 (87%), Positives = 220/233 (94%), Gaps = 0/233 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCA+TVG DAVISAYRLSVD+SRSIVGAILSKVVPATFSTI+SISKMLWRS+P+
Sbjct  223   QSSQRYYCAITVGADAVISAYRLSVDRSRSIVGAILSKVVPATFSTITSISKMLWRSDPS  282

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             PT +PEPKPQPFA+ASPLTC KD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  283   PTKRPEPKPQPFARASPLTCFKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  342

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLF+EML  KD  T +SA+HEH+KSDYCLCLAIHAPRKGIVEIWQMRTGP
Sbjct  343   RLWKGYRDASCLFVEMLAKKDIETSRSAYHEHVKSDYCLCLAIHAPRKGIVEIWQMRTGP  402

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TIPC KGSKILQPTYRF+SSE S+SSY+PLE+FFLNGDSG L VLNRSL+
Sbjct  403   RLLTIPCAKGSKILQPTYRFASSEVSVSSYVPLELFFLNGDSGLLFVLNRSLS  455


 Score =   353 bits (905),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/227 (74%), Positives = 197/227 (87%), Gaps = 7/227 (3%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR+ HTTELGCIACDDLS+LGAGKEGWLV NPNLLTALDTHS+ALA+RS++L+L W++
Sbjct  1    MARRN-HTTELGCIACDDLSELGAGKEGWLVNNPNLLTALDTHSIALANRSLVLILHWSE  59

Query  327  AGDP---PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQF  497
              DP     KI+P+LSPI+AEY+SA+ WLVFDDIKVLA+GTS GYLLIYSLRGDLIHKQ 
Sbjct  60   GSDPVGNRVKIVPDLSPIEAEYISAIEWLVFDDIKVLALGTSRGYLLIYSLRGDLIHKQI  119

Query  498  VNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD  677
            V+P KIL+LRVRGTKRD  QDAS EEVCVVM G +ARF+GSDIQ+ML+RWF+ER+SQ WD
Sbjct  120  VSPGKILRLRVRGTKRDLTQDASSEEVCVVMSGVIARFDGSDIQNMLQRWFRERHSQFWD  179

Query  678  QPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            +   R  E+S D+FGRLPYQLWNV KYG CVDAAI G+MPPPL+E Q
Sbjct  180  E---RESENSTDTFGRLPYQLWNVGKYGSCVDAAITGLMPPPLLELQ  223



>ref|XP_009599450.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Nicotiana tomentosiformis]
Length=455

 Score =   381 bits (979),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/233 (87%), Positives = 220/233 (94%), Gaps = 0/233 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCA+T+GDDAVISAYRLSVD+SRSIVGAILSKVVPATFSTI+SISKMLWRS+PT
Sbjct  223   QSSQRYYCAITIGDDAVISAYRLSVDRSRSIVGAILSKVVPATFSTITSISKMLWRSDPT  282

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P  +PEPKPQPFA+ASPLTC KD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  283   PAKRPEPKPQPFARASPLTCFKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  342

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLF+EML +KD  T +SA+ EH+KSDYCLCLAIHAPRKGIVEIWQMRTGP
Sbjct  343   RLWKGYRDASCLFVEMLASKDVETSRSAYGEHVKSDYCLCLAIHAPRKGIVEIWQMRTGP  402

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TI C KGSKILQPTYRF+SSE S+SSY+PLE+FFLNGDSGQL VLNRSL+
Sbjct  403   RLLTISCAKGSKILQPTYRFASSEVSVSSYVPLELFFLNGDSGQLFVLNRSLS  455


 Score =   352 bits (902),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/227 (74%), Positives = 198/227 (87%), Gaps = 7/227 (3%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR+ HTTELGCIAC+DL++LGAGKEGWLV NPNLLTALDTHSLALA+RSI+L+L W++
Sbjct  1    MARRN-HTTELGCIACEDLTELGAGKEGWLVNNPNLLTALDTHSLALANRSIVLILHWSE  59

Query  327  AGDPPA---KIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQF  497
              DP +   KI+PELSPI+AEY+SA+AWLVFDDIKVLA+GTS GYLL YSLRGDLIHKQ 
Sbjct  60   GSDPVSNRVKIVPELSPIEAEYISAIAWLVFDDIKVLALGTSRGYLLTYSLRGDLIHKQI  119

Query  498  VNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD  677
            V+P KIL+LRVRGTKRD  QDAS EEVCVVM G +ARF+GSD Q+ML+RWF+ER+SQ WD
Sbjct  120  VSPGKILRLRVRGTKRDLTQDASSEEVCVVMSGVIARFDGSDFQNMLQRWFRERHSQFWD  179

Query  678  QPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            +   R  E+S D+FGRLPYQLWNV+KYG CVDAAI G+MPPPL+E Q
Sbjct  180  E---RDSENSIDTFGRLPYQLWNVSKYGPCVDAAITGLMPPPLLEIQ  223



>ref|XP_009798853.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Nicotiana sylvestris]
Length=455

 Score =   383 bits (983),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/233 (87%), Positives = 220/233 (94%), Gaps = 0/233 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCA+TVGDDAVISAYRLSVD+SRSIVGAILSKVVPATFSTI+SISKMLWRS+PT
Sbjct  223   QSSQRYYCAITVGDDAVISAYRLSVDRSRSIVGAILSKVVPATFSTITSISKMLWRSDPT  282

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P  +PEPKPQPFA+ASPLTC KD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  283   PAKRPEPKPQPFARASPLTCFKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  342

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLF+EML +KD  T +SA+ EH+KSDYCLCLAIHAPRKGIVEIWQMRTGP
Sbjct  343   RLWKGYRDASCLFVEMLASKDVETSRSAYGEHMKSDYCLCLAIHAPRKGIVEIWQMRTGP  402

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TIPC KGSKILQPTYRF+SSE S+SSY+PLE+FFLNGDSGQL VLNR L+
Sbjct  403   RLLTIPCAKGSKILQPTYRFASSEVSVSSYVPLELFFLNGDSGQLFVLNRYLS  455


 Score =   346 bits (888),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 196/227 (86%), Gaps = 7/227 (3%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR+  TTELGCIAC+DL++LGAGKEGWL+ NPNLL ALDTHSLALA+RSI+L+L W++
Sbjct  1    MARRN-LTTELGCIACEDLTELGAGKEGWLLNNPNLLAALDTHSLALANRSIVLILHWSE  59

Query  327  AGDP---PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQF  497
              DP     KI+PELSPI+AEY+SA+AWLVFDDIKVLA+GTS GYLL YSLRGDLIHKQ 
Sbjct  60   GSDPVRNRVKIVPELSPIEAEYISAIAWLVFDDIKVLALGTSRGYLLTYSLRGDLIHKQI  119

Query  498  VNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD  677
            V+P KIL+LRVRGTKRD  QDAS EEVCVVMPG +ARF+GSD Q+ML+RWF+ER+SQ WD
Sbjct  120  VSPGKILRLRVRGTKRDLTQDASSEEVCVVMPGVIARFDGSDFQNMLQRWFRERHSQFWD  179

Query  678  QPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            +   R  E+S D+FGRLPYQLWNV+KYG CVDAAI G+MPPPL+E Q
Sbjct  180  E---RDSENSIDTFGRLPYQLWNVSKYGPCVDAAITGLMPPPLLEIQ  223



>ref|XP_002285458.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Vitis vinifera]
 emb|CBI20190.3| unnamed protein product [Vitis vinifera]
Length=457

 Score =   379 bits (973),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 190/233 (82%), Positives = 210/233 (90%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+GDDAVISA+RLS D++RS+VGAILSKVVPATFSTI+S SKM+WRSE  
Sbjct  227   QSSQRYYCAVTIGDDAVISAFRLSEDRNRSLVGAILSKVVPATFSTIASFSKMIWRSEQK  286

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                + EPKPQPFA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  287   SPKRSEPKPQPFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  346

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLF EMLV+KD++   S+++E +KSDYCLCLAIHAPRKGIVE+WQMRTGP
Sbjct  347   RLWKGYRDASCLFTEMLVSKDTAASSSSYYEPVKSDYCLCLAIHAPRKGIVEVWQMRTGP  406

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL T+ C KGSKILQPTYRF SS    S Y+PLEVF LNGDSGQLSVLNRSLN
Sbjct  407   RLLTVQCSKGSKILQPTYRFGSSMG--SPYVPLEVFLLNGDSGQLSVLNRSLN  457


 Score =   323 bits (828),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 186/228 (82%), Gaps = 5/228 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR  +TTELGCIAC++LS+LGAGKE WLVENP+L+ ALDT SLALA+RS +LVL W++
Sbjct  1    MARRV-YTTELGCIACNELSELGAGKEAWLVENPSLICALDTDSLALANRSFVLVLGWSE  59

Query  327  AGDP---PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQF  497
             GDP   P KI P LS I+ E ++A+ WLVFD+I+VLAVGTSSGYL+IYSL  DLIHKQ 
Sbjct  60   NGDPYNSPVKIRPTLSQIETERITAVEWLVFDEIRVLAVGTSSGYLMIYSLGADLIHKQM  119

Query  498  VNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD  677
            +NP +ILK RVRGTKRD  Q +S EEVCVVMPG +ARF+G+D+QSML+RWFQ+ +SQ WD
Sbjct  120  INPGRILKFRVRGTKRDLTQGSSSEEVCVVMPGVIARFDGADLQSMLQRWFQDTHSQFWD  179

Query  678  Q-PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            + P  R  EDS  S+GRLPYQLWNV+KYG C DAAI G MPPPLME Q
Sbjct  180  EKPKRRDQEDSEKSYGRLPYQLWNVSKYGPCADAAITGTMPPPLMELQ  227



>gb|EYU26320.1| hypothetical protein MIMGU_mgv1a005910mg [Erythranthe guttata]
Length=465

 Score =   369 bits (947),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 192/234 (82%), Positives = 215/234 (92%), Gaps = 4/234 (2%)
 Frame = +2

Query  839   SSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSeptp  1018
             SS RYYCAVT+GDDAVISA+RLSVDKSRS+VGAILSKVVPATFSTI+S SK+LWRS+ T 
Sbjct  234   SSLRYYCAVTIGDDAVISAFRLSVDKSRSLVGAILSKVVPATFSTIASFSKLLWRSDQTN  293

Query  1019  ttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVR  1198
             T KPE K QPFA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQAL+VVR
Sbjct  294   TKKPEAKSQPFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALIVVR  353

Query  1199  LWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPR  1378
             LWKGYR+ASCLF+EML +KD    K+A++ H KSDYCLCLAIHAPRKGIVEIWQMRTGPR
Sbjct  354   LWKGYREASCLFVEMLASKDKD--KAAYNFHSKSDYCLCLAIHAPRKGIVEIWQMRTGPR  411

Query  1379  LQTIPCPKGSKILQPTYRF--SSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             L TIPCPKGS+ILQPTYRF  ++S++S SSY+PLEVFFLNGDSGQ+SVLNR L+
Sbjct  412   LLTIPCPKGSRILQPTYRFSSAASQSSSSSYVPLEVFFLNGDSGQISVLNRFLH  465


 Score =   317 bits (813),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 188/232 (81%), Gaps = 11/232 (5%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M+RR+ HTTELGCIA +DL+ +GAGKEGWLV+NPNLL +LDTHSLALA+RS+IL+L W+ 
Sbjct  1    MSRRN-HTTELGCIAGEDLTHVGAGKEGWLVDNPNLLVSLDTHSLALANRSLILILNWSQ  59

Query  327  AGDP--------PAKIIPELSPIQAEYLSALAWLVFDD-IKVLAVGTSSGYLLIYSLRGD  479
            + +P          +I P+LSPI++EY+SA+ WLVFDD ++VLAVGTS GYLLI+SL G 
Sbjct  60   SINPRPDPDSRRTVRIRPDLSPIESEYISAVEWLVFDDDVRVLAVGTSCGYLLIFSLYGR  119

Query  480  LIHKQFVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQER  659
            LIH+Q VNP KILK+RVRG K+D  QD S EEVCVVMPG VARFEGSDI++ML+RWFQE 
Sbjct  120  LIHRQIVNPGKILKIRVRGIKQDLTQDTSSEEVCVVMPGVVARFEGSDIKNMLQRWFQET  179

Query  660  YSQLWDQPVNRYME-DSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLME  812
            +SQ WDQ  N   E DS +SF  LPYQLWNV+KYGLC DAAI G+MPPPLME
Sbjct  180  HSQFWDQDYNETFEDDSVNSFTTLPYQLWNVSKYGLCADAAITGLMPPPLME  231



>ref|XP_010644117.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Vitis vinifera]
Length=485

 Score =   363 bits (932),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 190/261 (73%), Positives = 210/261 (80%), Gaps = 30/261 (11%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+GDDAVISA+RLS D++RS+VGAILSKVVPATFSTI+S SKM+WRSE  
Sbjct  227   QSSQRYYCAVTIGDDAVISAFRLSEDRNRSLVGAILSKVVPATFSTIASFSKMIWRSEQK  286

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                + EPKPQPFA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  287   SPKRSEPKPQPFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  346

Query  1196  RLWK----------------------------GYRDASCLFMEMLVNKDSSTLKSAHHEH  1291
             RLWK                            GYRDASCLF EMLV+KD++   S+++E 
Sbjct  347   RLWKVFSHHAHPQIFFMRQPVISPNNGLYFFQGYRDASCLFTEMLVSKDTAASSSSYYEP  406

Query  1292  IKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIP  1471
             +KSDYCLCLAIHAPRKGIVE+WQMRTGPRL T+ C KGSKILQPTYRF SS    S Y+P
Sbjct  407   VKSDYCLCLAIHAPRKGIVEVWQMRTGPRLLTVQCSKGSKILQPTYRFGSSMG--SPYVP  464

Query  1472  LEVFFLNGDSGQLSVLNRSLN  1534
             LEVF LNGDSGQLSVLNRSLN
Sbjct  465   LEVFLLNGDSGQLSVLNRSLN  485


 Score =   323 bits (827),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 186/228 (82%), Gaps = 5/228 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR  +TTELGCIAC++LS+LGAGKE WLVENP+L+ ALDT SLALA+RS +LVL W++
Sbjct  1    MARRV-YTTELGCIACNELSELGAGKEAWLVENPSLICALDTDSLALANRSFVLVLGWSE  59

Query  327  AGDP---PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQF  497
             GDP   P KI P LS I+ E ++A+ WLVFD+I+VLAVGTSSGYL+IYSL  DLIHKQ 
Sbjct  60   NGDPYNSPVKIRPTLSQIETERITAVEWLVFDEIRVLAVGTSSGYLMIYSLGADLIHKQM  119

Query  498  VNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD  677
            +NP +ILK RVRGTKRD  Q +S EEVCVVMPG +ARF+G+D+QSML+RWFQ+ +SQ WD
Sbjct  120  INPGRILKFRVRGTKRDLTQGSSSEEVCVVMPGVIARFDGADLQSMLQRWFQDTHSQFWD  179

Query  678  Q-PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            + P  R  EDS  S+GRLPYQLWNV+KYG C DAAI G MPPPLME Q
Sbjct  180  EKPKRRDQEDSEKSYGRLPYQLWNVSKYGPCADAAITGTMPPPLMELQ  227



>ref|XP_011098220.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Sesamum indicum]
Length=466

 Score =   370 bits (951),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 192/234 (82%), Positives = 214/234 (91%), Gaps = 1/234 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+G+DAVISA+RLSVDK+RS+VGAILSKVVPATFSTI+S SK++WRSE  
Sbjct  233   QSSQRYYCAVTIGEDAVISAFRLSVDKNRSLVGAILSKVVPATFSTIASFSKLIWRSEEK  292

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             PT KPE K QPFA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  293   PTKKPEAKSQPFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  352

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTL-KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             RLWKGYR+ASCLF+EML  KD +   + A+ EH KSDYCLCLAIHAPRKGIVE+WQMRTG
Sbjct  353   RLWKGYREASCLFVEMLARKDKAAASRWAYDEHSKSDYCLCLAIHAPRKGIVEVWQMRTG  412

Query  1373  PRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             PRL TIPCPKGSKILQPTYRFSS+ AS SSY+PL+VFFLNGDSGQ+S+LN  L+
Sbjct  413   PRLLTIPCPKGSKILQPTYRFSSATASSSSYVPLQVFFLNGDSGQISLLNPFLH  466


 Score =   310 bits (795),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 159/234 (68%), Positives = 186/234 (79%), Gaps = 11/234 (5%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M+RR  HTTELGCIA +DLSDLGAGKEGWLV+NP LL +LDTHSLALA+RS+IL+L W+ 
Sbjct  1    MSRRL-HTTELGCIAGEDLSDLGAGKEGWLVDNPTLLVSLDTHSLALANRSLILILHWSQ  59

Query  327  ----AGDPPA----KIIPELSPIQAEYLSALAWLVFDD-IKVLAVGTSSGYLLIYSLRGD  479
                A DP A    KI P+LSPI+AEY+SA+ WLVFDD I+ LAVGTS GYLLI+S+ G 
Sbjct  60   SISGAPDPDARQVVKIRPDLSPIEAEYVSAVEWLVFDDDIRALAVGTSCGYLLIFSVHGY  119

Query  480  LIHKQFVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQER  659
            LIH+Q VNP KILK+RVRGTK+D  QD S EEVC+VMPG +ARFEGS I+++LRRWFQE 
Sbjct  120  LIHRQIVNPGKILKIRVRGTKQDLTQDTSPEEVCIVMPGVIARFEGSGIKNLLRRWFQET  179

Query  660  YSQLWDQPV-NRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             S+ WDQ   +   ED G+S   LPYQLWNV+KYGLC DAAI GVMPPPLME Q
Sbjct  180  DSKFWDQEFYDANSEDYGNSATSLPYQLWNVSKYGLCADAAITGVMPPPLMEIQ  233



>ref|XP_008226542.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Prunus mume]
Length=454

 Score =   371 bits (952),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 209/233 (90%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QS++ YYC +TVG+DAVISA+RLS DK+RS+VGAILSKVVPATFSTI+S+SKM+WRS+ T
Sbjct  224   QSNEHYYCGITVGEDAVISAFRLSEDKNRSLVGAILSKVVPATFSTIASLSKMIWRSDQT  283

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                K + KPQPFA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALV+V
Sbjct  284   SPRKSDEKPQPFARASPLTCLKDFPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVIV  343

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLFMEML  KD++   S+++E  KSDYCLCLAIHAPRKGIVEIWQMRTGP
Sbjct  344   RLWKGYRDASCLFMEMLAKKDTAASGSSYYETTKSDYCLCLAIHAPRKGIVEIWQMRTGP  403

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL++  C KGSK+LQPTYRF SS A  S+Y+PLEVF LNGDSGQ+SVLNR+LN
Sbjct  404   RLRSFQCAKGSKLLQPTYRFGSSIA--STYVPLEVFLLNGDSGQISVLNRTLN  454


 Score =   309 bits (792),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 181/225 (80%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M++R+ HTTELG IAC++L +LGAGKEGWLV+NP+LL ALDTHSLALA+RS+I+VL W +
Sbjct  1    MSKRA-HTTELGSIACEELGELGAGKEGWLVDNPSLLCALDTHSLALANRSVIVVLGWAE  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
                  KI PELSPI AE+++A+ WLVFD+I+V+  GTSSG LL +SL GDLIHKQ V P
Sbjct  60   PDSTRLKIRPELSPISAEFVTAIEWLVFDEIRVVVAGTSSGSLLFFSLAGDLIHKQMVYP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ-P  683
            A+I++LRVRGTKRD   + S EEVCVVMPG VARF+GSDIQ+ML +WFQE  SQ WD  P
Sbjct  120  ARIIRLRVRGTKRDLSHETSSEEVCVVMPGIVARFDGSDIQNMLHQWFQETRSQFWDPIP  179

Query  684  VNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
              R  +D G S+G+LPYQLW+V+KYG C DAAI G+MPPPLME Q
Sbjct  180  RKRSSDDFGRSYGKLPYQLWSVSKYGTCADAAITGIMPPPLMEIQ  224



>ref|XP_009334034.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Pyrus x bretschneideri]
Length=453

 Score =   369 bits (948),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 205/232 (88%), Gaps = 2/232 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSS+ YYC +TVG+DAVISA+RLS DK+RS+VGAILS+VVPATFSTI+S+SKM+WRS+  
Sbjct  224   QSSEHYYCGITVGEDAVISAFRLSEDKNRSLVGAILSRVVPATFSTIASLSKMIWRSDQG  283

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                K E KPQPFA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALV+V
Sbjct  284   SPKKSEEKPQPFARASPLTCLKDFPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVIV  343

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLFMEMLV KD++   S ++E  KSDYCLCLAIHAPRKGIVEIWQMRTGP
Sbjct  344   RLWKGYRDASCLFMEMLVKKDTAASSSRYYEPTKSDYCLCLAIHAPRKGIVEIWQMRTGP  403

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSL  1531
             RL+   C KGSKILQPTYRF SS A  S Y+PLEVF LNGDSGQ+SVLNR+L
Sbjct  404   RLRAFQCAKGSKILQPTYRFGSSHA--SPYVPLEVFLLNGDSGQISVLNRTL  453


 Score =   309 bits (791),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/222 (64%), Positives = 181/222 (82%), Gaps = 1/222 (0%)
 Frame = +3

Query  156  RSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTDAGD  335
            + +HTTELG IAC++L +LGAGKEGWLV+NPNLL ALDTHS+ALA+RS+I+VL W+++  
Sbjct  3    KRTHTTELGSIACEELGELGAGKEGWLVDNPNLLCALDTHSIALANRSVIVVLGWSESDG  62

Query  336  PPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNPAKI  515
               KI PELSPI+AE+++A+ WLVFD+I+V+  GTSSGYLL +SL G LIH+Q V P +I
Sbjct  63   TRLKIRPELSPIEAEFVTAVEWLVFDEIRVVVAGTSSGYLLFFSLGGGLIHRQMVYPVRI  122

Query  516  LKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ-PVNR  692
            ++LRVRGTKRD   + S EEVCVVMPG VARF+GSDIQ+ML +WFQ+  S+ WDQ P  R
Sbjct  123  IRLRVRGTKRDLTHETSSEEVCVVMPGIVARFDGSDIQNMLHQWFQDTQSRFWDQTPKKR  182

Query  693  YMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
              +D G S+G+LPYQLW+V+KYG C DAAI G+MPPPLME Q
Sbjct  183  GSDDFGHSYGKLPYQLWSVSKYGTCADAAITGIMPPPLMEIQ  224



>ref|XP_007211622.1| hypothetical protein PRUPE_ppa005570mg [Prunus persica]
 gb|EMJ12821.1| hypothetical protein PRUPE_ppa005570mg [Prunus persica]
Length=454

 Score =   370 bits (950),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 209/233 (90%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QS++ YYC +TVG+DAVISA+RLS DK+RS+VGAILSKVVPATFSTI+S+SKM+WRS+ T
Sbjct  224   QSNEHYYCGITVGEDAVISAFRLSEDKNRSLVGAILSKVVPATFSTIASLSKMIWRSDQT  283

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                K + KPQPFA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALV+V
Sbjct  284   SPRKSDEKPQPFARASPLTCLKDFPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVIV  343

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLFMEML  KD++   S+++E  KSDYCLCLAIHAPRKGIVEIWQMRTGP
Sbjct  344   RLWKGYRDASCLFMEMLAKKDTAASGSSYYEPTKSDYCLCLAIHAPRKGIVEIWQMRTGP  403

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL++  C KGSK+LQPTYRF SS A  S+Y+PLEVF LNGDSGQ+SVLNR+LN
Sbjct  404   RLRSFQCAKGSKLLQPTYRFGSSIA--STYVPLEVFLLNGDSGQISVLNRTLN  454


 Score =   307 bits (786),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 180/225 (80%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M++R+ HTTELG IAC++L +LGAGKEGWLV+NP+LL ALDTHSLALA+RS+I+VL W +
Sbjct  1    MSKRA-HTTELGSIACEELGELGAGKEGWLVDNPSLLCALDTHSLALANRSVIVVLGWAE  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
                  KI PELSPI AE+++A+ WLVFD+I+V+  GTSSG LL +SL GDLIHKQ V P
Sbjct  60   PDSTRLKIRPELSPISAEFVTAIEWLVFDEIRVVVAGTSSGSLLFFSLAGDLIHKQMVYP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD-QP  683
            A+I++LRVRGTKRD   + S EEVCVVMPG VARF+GSDIQ+ L +WFQE  SQ WD  P
Sbjct  120  ARIIRLRVRGTKRDLSHETSSEEVCVVMPGIVARFDGSDIQNKLHQWFQETQSQFWDPNP  179

Query  684  VNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
              R  +D G S+G+LPYQLW+V+KYG C DAAI G+MPPPLME Q
Sbjct  180  RKRSSDDFGRSYGKLPYQLWSVSKYGTCADAAITGIMPPPLMEIQ  224



>ref|XP_008382051.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Malus domestica]
Length=453

 Score =   368 bits (944),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 205/232 (88%), Gaps = 2/232 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSS+ YYC +TVG+DAVISA+RLS DK+RS+VGAILS+VVPATFSTI+S+SKM+WRS+  
Sbjct  224   QSSEHYYCGITVGEDAVISAFRLSEDKNRSLVGAILSRVVPATFSTIASLSKMIWRSDQG  283

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                K E KPQPFA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALV+V
Sbjct  284   SPKKSEEKPQPFARASPLTCLKDFPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVIV  343

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLFMEMLV KD++   S ++E  KSDYCLCLAIHAPRKGIVEIWQMRTGP
Sbjct  344   RLWKGYRDASCLFMEMLVKKDTAASSSRYYEPTKSDYCLCLAIHAPRKGIVEIWQMRTGP  403

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSL  1531
             RL+   C KGSKILQPTYRF SS A  S Y+PLEVF LNGDSGQ+SVLNR+L
Sbjct  404   RLRAFQCAKGSKILQPTYRFGSSJA--SPYVPLEVFLLNGDSGQISVLNRTL  453


 Score =   308 bits (790),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R+ HTTELG IAC++L +LGAGKEGWLV+NPNLL ALDTHS+ALA+RS+I+VL W++
Sbjct  1    MAKRT-HTTELGSIACEELGELGAGKEGWLVDNPNLLCALDTHSIALANRSVIVVLGWSE  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
            +     KI P LSPI+AE+++A+ WLVFD+I+V+  GTSSGYLL +SL GDLIH+Q V P
Sbjct  60   SDGTRLKIRPVLSPIEAEFVTAVEWLVFDEIRVVVAGTSSGYLLFFSLGGDLIHRQMVYP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ-P  683
             +I++LRVRGTKRD   + S EEVCVVMPG VARF+G DIQ+ML +WFQ+  S+ WDQ P
Sbjct  120  VRIIRLRVRGTKRDLTHETSSEEVCVVMPGMVARFDGXDIQNMLHQWFQDTQSRFWDQTP  179

Query  684  VNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
              R  +D G S+G+LPYQLW+V+KYG C DAAI G+MPPPLME Q
Sbjct  180  KKRGSDDFGHSYGKLPYQLWSVSKYGTCADAAITGIMPPPLMEIQ  224



>ref|XP_010036535.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Eucalyptus grandis]
 gb|KCW48152.1| hypothetical protein EUGRSUZ_K01884 [Eucalyptus grandis]
Length=455

 Score =   354 bits (908),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 204/230 (89%), Gaps = 3/230 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYY A+T+G+DAVISA+RLS D++RSIVGAILSKVVPATFSTI+S SKM+WRS+  
Sbjct  223   QSSQRYYRAITIGEDAVISAFRLSEDRNRSIVGAILSKVVPATFSTIASFSKMIWRSDQA  282

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
              T K E KPQ FA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGR+LLLDTQALVVV
Sbjct  283   STQKSEVKPQSFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRVLLLDTQALVVV  342

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLFMEMLVN +S +  S+H+E  KSDYCLCLAIHAPRKGI+E+WQMRTGP
Sbjct  343   RLWKGYRDASCLFMEMLVN-NSLSSSSSHYEATKSDYCLCLAIHAPRKGIIEVWQMRTGP  401

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNR  1525
             RL  I C KGSK+LQPTYRF +S +  S Y+PLEVF LNGDSGQ+SV+NR
Sbjct  402   RLLAISCAKGSKMLQPTYRFGTSVS--SPYVPLEVFLLNGDSGQISVINR  449


 Score =   322 bits (826),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 180/224 (80%), Gaps = 1/224 (0%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARRS HTT+LGCIACDDL+D+GAGKEGWL +NPNLL ALDTH+LALA RS++LV+ W+D
Sbjct  1    MARRS-HTTDLGCIACDDLADVGAGKEGWLADNPNLLCALDTHALALADRSVVLVIGWSD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI PELSPI AE++SA+ WLVFD+I+V+AVGTS G+LLIYSL GDLIHKQ ++ 
Sbjct  60   PDSPRIKIRPELSPIHAEFISAVEWLVFDEIRVVAVGTSRGHLLIYSLNGDLIHKQIIHT  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            A+IL+LRVRGTK+D   D   EEVC +MPG +ARF+GSDIQSML RW QE  S+ WD+  
Sbjct  120  ARILRLRVRGTKKDLTTDTCAEEVCAIMPGVIARFDGSDIQSMLSRWSQETNSKFWDEME  179

Query  687  NRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             R     G +F +LPYQLWNVNKYG C DAAI G+MPPPLME Q
Sbjct  180  RRKSGFPGSTFEQLPYQLWNVNKYGACADAAITGIMPPPLMEVQ  223



>ref|XP_010274475.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Nelumbo nucifera]
Length=458

 Score =   367 bits (941),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 190/234 (81%), Positives = 205/234 (88%), Gaps = 1/234 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+G DAVISA RLS D++RSIVGAILSKVVPATFSTI+S SKM+WRS  T
Sbjct  225   QSSQRYYCAVTIGVDAVISACRLSEDRNRSIVGAILSKVVPATFSTIASFSKMIWRSGQT  284

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
               T  E KPQPFAKASPLTCLKD PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  285   SATNSEEKPQPFAKASPLTCLKDRPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  344

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLK-SAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             RLWKGYRDA CLF EML+N+D+++   SA+HEH KSDYCLCLAIHAPRKGIVE+WQMR G
Sbjct  345   RLWKGYRDACCLFTEMLINRDTTSKSTSAYHEHSKSDYCLCLAIHAPRKGIVEVWQMRNG  404

Query  1373  PRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             PRL    C KGSKILQPT+RF SS +S SSY+PLEVF LNGDSGQLSVLNR LN
Sbjct  405   PRLLAFQCAKGSKILQPTHRFGSSLSSPSSYVPLEVFLLNGDSGQLSVLNRHLN  458


 Score =   309 bits (791),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 180/227 (79%), Gaps = 5/227 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWT-  323
            MARRS H TELGCIACD+L++LGAGKEGWLV++ N+L+ LDTHSLALA+RS+IL+L W  
Sbjct  1    MARRS-HVTELGCIACDELAELGAGKEGWLVDSANVLSTLDTHSLALANRSVILILGWRY  59

Query  324  -DAGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFV  500
             D    P KI P LSP++ E ++A+ WLVFDD+  LAVGTS+GYLLIYSL  DLIHKQF+
Sbjct  60   DDPSSRPVKIRPSLSPVEGE-ITAIEWLVFDDLHALAVGTSNGYLLIYSLESDLIHKQFI  118

Query  501  NPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ  680
             P +IL+LRV GTK    QD S EEVCVV+PG +ARF+GSDIQS+L+RWFQE +SQ WDQ
Sbjct  119  YPGRILRLRVHGTKSGLTQDTSSEEVCVVIPGIIARFDGSDIQSLLQRWFQEAHSQFWDQ  178

Query  681  -PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             P     E   +S+GRLP QLWNVNKYG CVDAAI G+MPPPLME Q
Sbjct  179  KPKKSETEGMRNSYGRLPLQLWNVNKYGSCVDAAITGIMPPPLMELQ  225



>ref|XP_011102213.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Sesamum indicum]
Length=467

 Score =   366 bits (939),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 190/234 (81%), Positives = 213/234 (91%), Gaps = 1/234 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAV++G+DAVISA+RLSVDK+RS+VGAILSKVVPATFSTI+S SK++WRSE  
Sbjct  234   QSSQRYYCAVSIGEDAVISAFRLSVDKNRSLVGAILSKVVPATFSTIASFSKLIWRSEEK  293

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             PT KPE K QPFA+AS LTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  294   PTKKPEAKSQPFARASALTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  353

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTL-KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             RLWKGYR+ASCLF+EML  KD +   + A+ EH KSDYCLCLAIHAPRKGIVE+WQMRTG
Sbjct  354   RLWKGYREASCLFVEMLARKDKAAASRWAYDEHSKSDYCLCLAIHAPRKGIVEVWQMRTG  413

Query  1373  PRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             PRL TIPCPKGSKILQPTYRFSS+ AS SSY+PL+VFFLNGDSGQ+S+LN  L+
Sbjct  414   PRLLTIPCPKGSKILQPTYRFSSATASSSSYVPLQVFFLNGDSGQISLLNPFLH  467


 Score =   310 bits (793),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 186/235 (79%), Gaps = 12/235 (5%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M+RR  H TELGCIA  DLSDLGAGKEGWLV+NPNLL +LDTHSLALA+RS+IL+L W+ 
Sbjct  1    MSRRL-HMTELGCIAGQDLSDLGAGKEGWLVDNPNLLVSLDTHSLALANRSLILILHWSQ  59

Query  327  ----AGDP----PAKIIPELSPIQAEYLSALAWLVFDD-IKVLAVGTSSGYLLIYSLRGD  479
                A DP      KI P+LSPI+AEY+SA+ WLVFDD I+ LAVGTS GYLLI+S++G 
Sbjct  60   SISGAPDPDTHRAVKIRPDLSPIEAEYVSAVEWLVFDDDIRALAVGTSCGYLLIFSVQGY  119

Query  480  LIHKQFVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQER  659
            LIH+Q VNP KILK+RVRGTK+D  QD S EEVC+VMPG +ARFEGS I+++LRRWFQE 
Sbjct  120  LIHRQIVNPGKILKIRVRGTKQDLTQDTSPEEVCIVMPGVIARFEGSGIKNLLRRWFQET  179

Query  660  YSQLWDQPV--NRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             S+ WDQ    +   EDSG+S   LPYQLWNV+KYGLC DAAI GVMPPPLME Q
Sbjct  180  DSKFWDQEFYDDANSEDSGNSAMSLPYQLWNVSKYGLCADAAITGVMPPPLMEIQ  234



>ref|XP_006370146.1| hypothetical protein POPTR_0001s40120g [Populus trichocarpa]
 gb|ERP66715.1| hypothetical protein POPTR_0001s40120g [Populus trichocarpa]
Length=455

 Score =   371 bits (953),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 193/233 (83%), Positives = 210/233 (90%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYY AVT+G+DAVISAYRLS D+SRS+VGAILSKV+PA FSTISS+SKM+WRSE T
Sbjct  225   QSSQRYYRAVTIGEDAVISAYRLSEDRSRSLVGAILSKVMPAAFSTISSVSKMIWRSERT  284

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             PT KPE KPQ FAKASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  285   PTKKPEVKPQSFAKASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  344

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDA+CLFMEMLV+ +S+   S+HHE  KSDYCLCLAIHAPRKGI+E+WQMRTGP
Sbjct  345   RLWKGYRDANCLFMEMLVSMNSAGASSSHHEPSKSDYCLCLAIHAPRKGIIEVWQMRTGP  404

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TI C KGSK+LQPTYRF SS    S Y+PLEVF LNGDSGQLSVLNRSLN
Sbjct  405   RLLTIQCAKGSKLLQPTYRFGSSLD--SPYVPLEVFLLNGDSGQLSVLNRSLN  455


 Score =   301 bits (771),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 146/227 (64%), Positives = 180/227 (79%), Gaps = 5/227 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M  + SHTTELGCIA ++LSDLGAGKEGWLVENPNLL ALDTHSLALA+RS+IL+  W D
Sbjct  1    MTSKRSHTTELGCIAGEELSDLGAGKEGWLVENPNLLCALDTHSLALANRSLILITGWDD  60

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P +KI PELSPI++E +SAL WLVFD+IKV+AVGTS GY ++YSL G LIH+Q V P
Sbjct  61   G--PRSKIRPELSPIESEIISALEWLVFDEIKVIAVGTSRGYFMVYSLDGLLIHRQLVYP  118

Query  507  AKILKLRVRGTKRDQM--QDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ  680
             +ILKLRVRGTK+D M   + S EEV VV+PG +ARF+G+DI+++L+ WFQE  S  WD+
Sbjct  119  GRILKLRVRGTKKDMMSSHEGSSEEVSVVIPGVIARFDGADIRNILQEWFQETNSHFWDE  178

Query  681  PVNRY-MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
               R   E+ G+ F RLP+QLW+V+K+GLC DAAI G+MPPPLME Q
Sbjct  179  KSKRRDYEELGNGFKRLPHQLWSVDKFGLCADAAITGIMPPPLMEIQ  225



>ref|XP_011007913.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Populus euphratica]
Length=455

 Score =   370 bits (951),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 192/233 (82%), Positives = 209/233 (90%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYY AVT+G+DAVISAYRLS D+SRS+VGAILSKVVPA FSTISS+SKM+WRSE T
Sbjct  225   QSSQRYYRAVTIGEDAVISAYRLSEDRSRSLVGAILSKVVPAAFSTISSVSKMIWRSERT  284

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             PT K E KPQ FAKASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  285   PTKKSEVKPQSFAKASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  344

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDA+CLFMEMLV+ +S+   S+HHE  KSDYCLCLAIHAPRKGI+E+WQMRTGP
Sbjct  345   RLWKGYRDANCLFMEMLVSMNSAGASSSHHEPSKSDYCLCLAIHAPRKGIIEVWQMRTGP  404

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TI C KGSK+LQPTYRF SS    S Y+PLEVF LNGDSGQLSVLNRSL+
Sbjct  405   RLLTIQCAKGSKLLQPTYRFGSSLD--SPYVPLEVFLLNGDSGQLSVLNRSLS  455


 Score =   298 bits (763),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 179/227 (79%), Gaps = 5/227 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M+ + SHTTELGCIA ++L+DLGAGKEGWLVENPNLL ALDTHSLALA+RS+IL+  W D
Sbjct  1    MSSKRSHTTELGCIASEELTDLGAGKEGWLVENPNLLCALDTHSLALANRSLILITGWDD  60

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI PELSPI++E +SAL WLVFD+IKV+AVGTS GY ++YSL G LIH+Q V P
Sbjct  61   G--PRIKIRPELSPIESEIISALEWLVFDEIKVIAVGTSRGYFMVYSLDGLLIHRQLVYP  118

Query  507  AKILKLRVRGTKRDQM--QDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ  680
             +ILKLRVRGTK+D M   + S EEV VV+PG +ARF+G +I+++L+ WFQE  S  WD+
Sbjct  119  GRILKLRVRGTKKDMMSSHEGSSEEVSVVIPGVIARFDGVEIRNILQEWFQETNSHFWDE  178

Query  681  PVNRY-MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
               R   E+ G+ F RLP+QLW+V+K+GLC DAAI G+MPPPLME Q
Sbjct  179  KSKRRDYEELGNGFKRLPHQLWSVDKFGLCADAAITGIMPPPLMEIQ  225



>ref|XP_006477742.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Citrus sinensis]
 gb|KDO47003.1| hypothetical protein CISIN_1g012917mg [Citrus sinensis]
Length=453

 Score =   369 bits (946),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 186/233 (80%), Positives = 210/233 (90%), Gaps = 3/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRY+CAVT+G+D+VISA+RLS D+SRS+VGAILSKVVPATFSTISS+SKM+WRSE +
Sbjct  224   QSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQS  283

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P        Q FA+ASPLTCLKD+PRKGE+LTLSPSG+LAAITDSLGRILLLDTQALVVV
Sbjct  284   PKKSEPKP-QSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVV  342

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASC+FMEMLVNKD++T  SA++  +KSDYCLCLAIHAPRKGI+E+WQMRTGP
Sbjct  343   RLWKGYRDASCVFMEMLVNKDAAT-SSAYYAPVKSDYCLCLAIHAPRKGIIEVWQMRTGP  401

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TI C KGSKILQPTYRF SS AS S Y+PLEVF LNGDSGQLSVLNRSL+
Sbjct  402   RLLTIQCAKGSKILQPTYRFGSSMAS-SPYVPLEVFLLNGDSGQLSVLNRSLS  453


 Score =   300 bits (767),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 178/225 (79%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M++R+ HTTE+G IAC DLSDLGAGKEGWLV +PNLL ALD H++ALA+R   +++ W D
Sbjct  1    MSKRT-HTTEVGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWAD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
                 AKI PELSPI +EY++A+ WLVF++++ LAVGTS GY L+Y L+GDL+H+Q ++P
Sbjct  60   PEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ-P  683
             +ILKLRVRG++RD  QD + EEVCVVMPG +ARF+GS+IQ ML+RWFQ+  S  WDQ P
Sbjct  120  GRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKP  179

Query  684  VNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
              R  ED  +S+ RLP+QLWNV+KYG C DAAI G+MPPPLME Q
Sbjct  180  KQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQ  224



>gb|KDP34770.1| hypothetical protein JCGZ_10550 [Jatropha curcas]
Length=454

 Score =   368 bits (944),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 204/233 (88%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVTVG+DAVISAYRLS D+ RSIVGAILSKVVPATFSTI+S SK++WR+E  
Sbjct  224   QSSQRYYCAVTVGEDAVISAYRLSEDRGRSIVGAILSKVVPATFSTIASFSKIIWRNEQK  283

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                  E KPQ FAKASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  284   SAKNSEAKPQSFAKASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  343

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDA C FMEMLV +D++   S+++E  KSDYCLCLAIHAPRKGI+E+WQMRTGP
Sbjct  344   RLWKGYRDACCFFMEMLVKRDNAGASSSYYEPSKSDYCLCLAIHAPRKGIIEVWQMRTGP  403

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TI C KGSK+LQPTYRF SS  + S Y+PLEVF LNGDSGQLSVLNRSL+
Sbjct  404   RLLTIQCSKGSKLLQPTYRFGSS--ADSPYVPLEVFLLNGDSGQLSVLNRSLS  454


 Score =   300 bits (767),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 179/226 (79%), Gaps = 4/226 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M+ + +HTTELGCIAC++LSD+GAGKEGWLV+NP+LL ALDTHS+ALA+RS+IL+  W D
Sbjct  1    MSSKRNHTTELGCIACEELSDVGAGKEGWLVDNPSLLCALDTHSIALANRSLILITGWDD  60

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI P LSPI++E ++AL WLVFD+I+V+AVGTS GYLL+YSL G LIHKQ V  
Sbjct  61   G--PRLKIRPNLSPIESESITALEWLVFDEIRVIAVGTSCGYLLVYSLDGQLIHKQMVYT  118

Query  507  AKILKLRVRGTKRD-QMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ-  680
             +ILK+RVRGTK+D   Q +S EE+ +V+PG +ARF+GSD Q+ML+ W QE  SQ WD+ 
Sbjct  119  RRILKIRVRGTKKDLTQQTSSSEEISIVIPGVIARFDGSDFQNMLQEWLQETNSQFWDEK  178

Query  681  PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            P  R  +  G++F R+PYQLWNVNKYG C DAAI G+MPPPLME Q
Sbjct  179  PTKRDSDALGNTFKRIPYQLWNVNKYGSCADAAITGIMPPPLMEIQ  224



>ref|XP_010552119.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Tarenaya hassleriana]
Length=456

 Score =   351 bits (901),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 205/234 (88%), Gaps = 2/234 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+G+DAVISAYRLS D+SRS+VGAILSKVVPAT STI+S SKM+WRS+ +
Sbjct  224   QSSQRYYCAVTIGEDAVISAYRLSEDRSRSLVGAILSKVVPATVSTIASFSKMIWRSDQS  283

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P  KP+ K Q FA+AS LTC+KDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  284   PKKKPQAKTQSFARASSLTCIKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  343

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASC+FMEMLV KD     S + E +K DYCLCLAIHAPRKGI+E+WQMRTGP
Sbjct  344   RLWKGYRDASCVFMEMLVKKDKGKSIS-YTEPVKGDYCLCLAIHAPRKGIIEVWQMRTGP  402

Query  1376  RLQTIPCPKGSKILQPTYRFS-SSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TI C KGSK+LQP+YRF  +S +S S YIPLEVF LNGDSGQ+S+LNRSL+
Sbjct  403   RLLTIQCAKGSKLLQPSYRFGSTSPSSSSPYIPLEVFLLNGDSGQISMLNRSLH  456


 Score =   313 bits (802),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 182/225 (81%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R  H TELGCIAC++LS+LGAGKEGWLV++PNLL ALD+HSLA+A+R +ILV+ W D
Sbjct  1    MAKRI-HLTELGCIACEELSELGAGKEGWLVDDPNLLCALDSHSLAIANRFLILVVTWAD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI P+LSPI+AE ++A+ WLVFDD++V+A GTS GYLL+YSL GDLIHKQ V P
Sbjct  60   PDAPRVKIRPDLSPIEAESITAIEWLVFDDVRVIAAGTSCGYLLVYSLAGDLIHKQLVYP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            ++ILKLRVRGTK+D +Q+ S EE C+VMPG +ARF+GS+IQSML++WFQE  S  WDQ  
Sbjct  120  SRILKLRVRGTKKDVIQETSSEEFCIVMPGIIARFDGSNIQSMLQKWFQESNSHFWDQKS  179

Query  687  NRYMEDS-GDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             +   D  G+S  RLPYQ+WNVNKYG C DAAI G+MPPPL+E Q
Sbjct  180  KKGSSDEPGNSHQRLPYQIWNVNKYGTCADAAITGIMPPPLLELQ  224



>ref|XP_004294100.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Fragaria vesca subsp. vesca]
Length=450

 Score =   354 bits (908),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 202/232 (87%), Gaps = 2/232 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSS+ Y+C +TVG+DAVISA+RLS DKSRS VGA+LSKVVPATFSTI++ SK+LWRSE T
Sbjct  221   QSSEHYFCGITVGEDAVISAFRLSEDKSRSFVGALLSKVVPATFSTIATFSKLLWRSEQT  280

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                K E KPQ FA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALV+V
Sbjct  281   SPKKLEEKPQSFARASPLTCLKDFPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVIV  340

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDA+CLF EMLVNKD+S   S ++E  KSDYCLCL IHAPRKGI+EIWQMRTG 
Sbjct  341   RLWKGYRDANCLFTEMLVNKDTSASSSRYYEPTKSDYCLCLVIHAPRKGIIEIWQMRTGQ  400

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSL  1531
             RL++  C KGSKILQPTYRF SS A  S Y+PLEVF LNGDSGQ+SVL+R+L
Sbjct  401   RLRSFVCAKGSKILQPTYRFGSSIA--SPYVPLEVFLLNGDSGQISVLHRTL  450


 Score =   310 bits (794),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 147/224 (66%), Positives = 181/224 (81%), Gaps = 3/224 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR  HTTE+GCIAC++L DLGAGKEGWLV+NPNLL A+DTH +ALA+RS+I+VL W D
Sbjct  1    MARRV-HTTEVGCIACEELGDLGAGKEGWLVDNPNLLCAIDTHCIALANRSVIVVLGWAD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
                  KI PELSPI+AE+++A+ WLVFD+++V+  GTS+G LL YSL G LIHKQ V P
Sbjct  60   PDQTRVKIRPELSPIEAEHVTAIEWLVFDEMRVVVAGTSAGCLLFYSLAGHLIHKQMVYP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            A+I++LRVRGTKRD   D S EEVCVVMPG +ARF+G+DIQ+ML++WFQE  SQ WDQ  
Sbjct  120  ARIIRLRVRGTKRDLNHDTSSEEVCVVMPGILARFDGNDIQNMLQQWFQETQSQFWDQ--  177

Query  687  NRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            NR  +D  +S G+LPYQLW+V+KYG C DAAI G+MPPPLME Q
Sbjct  178  NRRSDDFENSHGKLPYQLWSVSKYGSCADAAITGIMPPPLMEIQ  221



>ref|XP_004516083.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Cicer arietinum]
Length=459

 Score =   367 bits (941),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 209/237 (88%), Gaps = 6/237 (3%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAV VGDDAVISAYRLS DK RS+VGAILSKVVPATFSTI+S SK++WRS+ T
Sbjct  224   QSSQRYYCAVAVGDDAVISAYRLSEDKGRSLVGAILSKVVPATFSTIASFSKLIWRSDHT  283

Query  1016  pt----tkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQA  1183
                    K E KPQPFA+ASPLTC+KD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQA
Sbjct  284   SPVKSPKKSEQKPQPFARASPLTCIKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQA  343

Query  1184  LVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQM  1363
             LVVVRLWKGYRDASCLFMEMLVNKD+++  S ++E  KSDYCLCLAIHAPRKGI+EIWQM
Sbjct  344   LVVVRLWKGYRDASCLFMEMLVNKDTASSSSTYYEPTKSDYCLCLAIHAPRKGIIEIWQM  403

Query  1364  RTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RTG RL+TI C KGSK+LQP+YRF +S +  S Y+PLEVF LNGDSGQ+SVLNR+L+
Sbjct  404   RTGARLRTITCAKGSKMLQPSYRFGASMS--SPYVPLEVFLLNGDSGQISVLNRTLD  458


 Score =   296 bits (759),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 179/225 (80%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M RRS +  ELGCIAC++LS+LGAGK GW+V+NPNLL A+DTHS+ LASRS IL+  W+D
Sbjct  1    MTRRS-YKRELGCIACEELSELGAGKPGWVVDNPNLLCAIDTHSILLASRSTILLFSWSD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
            +     +I PELSPI+AE++SA+ WLVFDD++V+  GTSSGYLLIYSLRG+LIH+Q + P
Sbjct  60   SHGFRLRIRPELSPIEAEFISAVEWLVFDDVRVIVAGTSSGYLLIYSLRGELIHRQMIYP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
             ++LKLRVRGTK+D +QD+S EE C++MPG +ARF+GS +Q+ML +WF E +++ W+Q  
Sbjct  120  GRVLKLRVRGTKKDLIQDSSSEEFCLIMPGVIARFDGSVVQNMLLKWFDEAHAEFWNQKQ  179

Query  687  N-RYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
              +  ED  +S  +LPYQLWN+ KYG C DAA+ G+MPPPLME Q
Sbjct  180  KGQNSEDFENSQVKLPYQLWNIGKYGTCADAAVTGIMPPPLMEQQ  224



>ref|XP_010675378.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Beta vulgaris subsp. vulgaris]
Length=456

 Score =   351 bits (901),  Expect(2) = 3e-180, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 207/233 (89%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             +SS RYY AV +G+DAVISAYRLS DK+RS+VGAILSKVVPATFSTI+S SK++WRS+ +
Sbjct  226   ESSHRYYRAVAIGNDAVISAYRLSEDKNRSLVGAILSKVVPATFSTIASFSKLIWRSDRS  285

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                K EPKPQPFA+A+ LTCLKD PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  286   EPKKSEPKPQPFARAASLTCLKDPPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  345

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDA+C FMEML NK+  T+ +++HE+ KSDYCLCLAIHAPRKGI+E+WQMRTGP
Sbjct  346   RLWKGYRDANCFFMEMLANKE--TVSTSYHENKKSDYCLCLAIHAPRKGIIEVWQMRTGP  403

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TI C KGSKILQPTYRFSSS AS S Y+PLEVF LNG+SG LSV+NRSL+
Sbjct  404   RLLTIQCAKGSKILQPTYRFSSSMASSSLYMPLEVFILNGESGHLSVINRSLH  456


 Score =   310 bits (795),  Expect(2) = 3e-180, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 182/227 (80%), Gaps = 8/227 (4%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR+ HTT LGCIACD+LSDLGAGKE WLV+NP LL+ALDTHSLAL+++S+IL+L W+D
Sbjct  1    MARRN-HTTTLGCIACDELSDLGAGKESWLVDNPFLLSALDTHSLALSNKSLILILGWSD  59

Query  327  AGDP----PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQ  494
              DP      KI PELSPI AE++SA+ WLVFDDI+VLAV TSSGY  IYSL G LIHKQ
Sbjct  60   --DPFNNIKVKIHPELSPIDAEFISAIEWLVFDDIRVLAVATSSGYFFIYSLDGGLIHKQ  117

Query  495  FVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLW  674
             + PA+ILKLRVRGTKRD  QD S EEVC VM   +ARF+GSD+Q+ML+RWFQE  + LW
Sbjct  118  MIYPARILKLRVRGTKRDIAQDISNEEVCFVMDKVIARFDGSDLQNMLQRWFQETQTNLW  177

Query  675  DQP-VNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLME  812
            DQ    R ++D  +SF ++PYQLW+VNKYG C DAAI GVMPPPLME
Sbjct  178  DQKRKKRDLDDFENSFEKVPYQLWSVNKYGACADAAITGVMPPPLME  224



>ref|XP_010487305.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Camelina sativa]
Length=455

 Score =   349 bits (896),  Expect(2) = 7e-180, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 197/234 (84%), Gaps = 3/234 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+G+DAVISAYRLS D+ RS+VGAILSKVVPA  STI+S SK++WRS   
Sbjct  224   QSSQRYYCAVTIGEDAVISAYRLSEDRGRSLVGAILSKVVPAAASTIASFSKLIWRSNDQ  283

Query  1016  pttkp-epkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV  1192
                +  E K Q FA+AS LTC+KDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV
Sbjct  284   SPKRKPEAKTQSFARASSLTCIKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV  343

Query  1193  VRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             VRLWKGYRDASC+FMEML  KD       H E +KSDYCLCLAIHAPRKGI+E+WQMRTG
Sbjct  344   VRLWKGYRDASCVFMEMLAKKDKGK-GVIHTEPVKSDYCLCLAIHAPRKGIIEVWQMRTG  402

Query  1373  PRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             PRL TI C KGSK+LQP YRF S+ +S S YIPLEVF LNGDSGQ+S+LNRSL+
Sbjct  403   PRLLTIQCAKGSKLLQPAYRFGSNSSS-SPYIPLEVFLLNGDSGQVSMLNRSLS  455


 Score =   311 bits (797),  Expect(2) = 7e-180, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 184/226 (81%), Gaps = 4/226 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R  H TELGCIAC++LS+LGAGKEGWLV NPNLL ALD+HSLALA+R++IL++ W D
Sbjct  1    MAKRI-HLTELGCIACEELSELGAGKEGWLVNNPNLLCALDSHSLALANRNLILIVNWGD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI P+LSPI+AE ++A+ WLVFDD++V+  GTS GYLL+YS+ GDLIHKQ V+P
Sbjct  60   PDAPRVKIRPDLSPIEAESITAIEWLVFDDVRVVVAGTSCGYLLVYSVAGDLIHKQMVHP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            ++ILK+RVRGTK+D +Q+ S EE+C VMPG +ARF+GS IQSML++WFQE+ S  WDQ  
Sbjct  120  SRILKIRVRGTKKDLIQETSAEEICFVMPGIIARFDGSHIQSMLQKWFQEKNSNFWDQK-  178

Query  687  NRY--MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            NR   +ED+G    RLPYQ+WNVNK G+CVDA + GVMPPPL+E Q
Sbjct  179  NRKGDVEDTGSLSQRLPYQIWNVNKNGVCVDATVTGVMPPPLLELQ  224



>ref|XP_010465414.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Camelina sativa]
Length=455

 Score =   350 bits (897),  Expect(2) = 8e-180, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 197/234 (84%), Gaps = 3/234 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+G+DAVISAYRLS D+ RS+VGAILSKVVPA  STI+S SK++WRS   
Sbjct  224   QSSQRYYCAVTIGEDAVISAYRLSEDRGRSLVGAILSKVVPAAASTIASFSKLIWRSNDQ  283

Query  1016  pttkp-epkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV  1192
                +  E K Q FA+AS LTC+KDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV
Sbjct  284   SPKRKPEAKTQSFARASSLTCIKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV  343

Query  1193  VRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             VRLWKGYRDASC+FMEML  KD       H E +KSDYCLCLAIHAPRKGI+E+WQMRTG
Sbjct  344   VRLWKGYRDASCVFMEMLAKKDKGK-GVIHTEPVKSDYCLCLAIHAPRKGIIEVWQMRTG  402

Query  1373  PRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             PRL TI C KGSK+LQP YRF S+ +S S YIPLEVF LNGDSGQ+S+LNRSL+
Sbjct  403   PRLLTIQCAKGSKLLQPAYRFGSNSSS-SPYIPLEVFLLNGDSGQVSMLNRSLS  455


 Score =   310 bits (795),  Expect(2) = 8e-180, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 185/226 (82%), Gaps = 4/226 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R  H TELGCIAC++LS+LGAGKEGWLV NPNLL ALD+HSLALA+R++IL++ W D
Sbjct  1    MAKRI-HLTELGCIACEELSELGAGKEGWLVNNPNLLCALDSHSLALANRNLILIVNWGD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI P+LSPI+AE ++A+ WLVFDD++V+  GTS GYLL+YS+ GDLIHKQ V+ 
Sbjct  60   PDAPRVKIRPDLSPIEAESITAIEWLVFDDVRVVVAGTSCGYLLVYSVSGDLIHKQMVHS  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            ++ILK+RVRGTK+D +Q+ S EE+C VMPG +ARF+GS+IQSML++WFQE+ S  WDQ  
Sbjct  120  SRILKIRVRGTKKDLIQETSTEEICFVMPGIIARFDGSNIQSMLQKWFQEKNSNFWDQK-  178

Query  687  NRY--MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            NR   +E++G  + RLPYQ+WNVNK G+CVDA + GVMPPPL+E Q
Sbjct  179  NRKGDVEETGSLYQRLPYQIWNVNKNGVCVDATVTGVMPPPLLELQ  224



>ref|XP_010502314.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X1 [Camelina sativa]
Length=455

 Score =   350 bits (897),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 197/234 (84%), Gaps = 3/234 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+G+DAVISAYRLS D+ RS+VGAILSKVVPA  STI+S SK++WRS   
Sbjct  224   QSSQRYYCAVTIGEDAVISAYRLSEDRGRSLVGAILSKVVPAAASTIASFSKLIWRSNDQ  283

Query  1016  pttkp-epkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV  1192
                +  E K Q FA+AS LTC+KDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV
Sbjct  284   SPKRKPEAKTQSFARASSLTCIKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV  343

Query  1193  VRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             VRLWKGYRDASC+FMEML  KD       H E +KSDYCLCLAIHAPRKGI+E+WQMRTG
Sbjct  344   VRLWKGYRDASCVFMEMLAKKDKGK-GVIHTEPVKSDYCLCLAIHAPRKGIIEVWQMRTG  402

Query  1373  PRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             PRL TI C KGSK+LQP YRF S+ +S S YIPLEVF LNGDSGQ+S+LNRSL+
Sbjct  403   PRLLTIQCAKGSKLLQPAYRFGSNSSS-SPYIPLEVFLLNGDSGQVSMLNRSLS  455


 Score =   310 bits (794),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 184/226 (81%), Gaps = 4/226 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R  H TELGCIAC++LS+LGAGKEGWLV NPNLL ALD+HSLALA+R++IL++ W D
Sbjct  1    MAKRI-HLTELGCIACEELSELGAGKEGWLVNNPNLLCALDSHSLALANRNLILIVNWGD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI P+LSPI+AE ++A+ WLVFDD++V+  GTS GYLL+YS+ GDLIHKQ V+ 
Sbjct  60   PDAPRVKIRPDLSPIEAESITAIEWLVFDDVRVVVAGTSCGYLLVYSVAGDLIHKQMVHA  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            ++ILKLRVRGTK+D +Q+ S EE+C VMPG +ARF+GS+IQSML++WFQE+ S  WDQ  
Sbjct  120  SRILKLRVRGTKKDLIQETSTEEICFVMPGIIARFDGSNIQSMLQKWFQEKNSNFWDQK-  178

Query  687  NRY--MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            NR   +ED+G    RLPYQ+WNVNK G+CVDA + GVMPPPL+E Q
Sbjct  179  NRKGDVEDTGSLSQRLPYQIWNVNKNGVCVDATVTGVMPPPLLELQ  224



>ref|XP_002524520.1| rab3 gtpase-activating protein non-catalytic subunit, putative 
[Ricinus communis]
 gb|EEF37847.1| rab3 gtpase-activating protein non-catalytic subunit, putative 
[Ricinus communis]
Length=484

 Score =   355 bits (910),  Expect(2) = 2e-179, Method: Compositional matrix adjust.
 Identities = 180/237 (76%), Positives = 202/237 (85%), Gaps = 3/237 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+GDDAVISAYRLS D+S+S+VGAILSKVVPATFSTI+S+SKM+WRSE  
Sbjct  223   QSSQRYYCAVTIGDDAVISAYRLSEDRSKSLVGAILSKVVPATFSTIASLSKMIWRSEKA  282

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                K E KPQ FAKASPLTCLKD+PRKGEKLTLSP GTLAAITDSLGRILLLDTQAL+VV
Sbjct  283   SPKKSEAKPQSFAKASPLTCLKDHPRKGEKLTLSPGGTLAAITDSLGRILLLDTQALIVV  342

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASC FMEM V +D++   S+++E  KSDYCLCLAIHAPRKGI+E+WQMRTGP
Sbjct  343   RLWKGYRDASCFFMEMQVKRDNAGASSSYYEPSKSDYCLCLAIHAPRKGIIEVWQMRTGP  402

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQL-SVLNRSLN*NA  1543
             RL TI C +G+K+LQPTYRF SS    S YIPLEVF LNG+SGQL   +N   N NA
Sbjct  403   RLLTIQCARGTKLLQPTYRFGSSPD--SPYIPLEVFVLNGESGQLQQCINERWNSNA  457


 Score =   304 bits (778),  Expect(2) = 2e-179, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 180/225 (80%), Gaps = 3/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M+ + SHTTELGCIAC++LSD+GAGKEGWLV+NPNL  ALDTHS+A+++R +IL+  W D
Sbjct  1    MSSKRSHTTELGCIACEELSDVGAGKEGWLVDNPNLKCALDTHSIAISNRYLILITGWDD  60

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI P+LSPI++E ++AL WLVFD+I+V+AVGTS GY L+YSL G LIHKQ V P
Sbjct  61   G--PRLKIRPDLSPIESESITALEWLVFDEIRVVAVGTSCGYFLVYSLDGHLIHKQMVYP  118

Query  507  AKILKLRVRGTKRD-QMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQP  683
             +ILK+RVRGTK+D   Q +S EE+ +VMPG +ARF+GSD+Q+ML+ W QE++SQ WD+ 
Sbjct  119  GRILKIRVRGTKKDLTQQTSSSEEISIVMPGVIARFDGSDLQNMLQEWIQEKHSQFWDEK  178

Query  684  VNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             NR  +  G ++ RLPYQLWNVNKYG C DAAI GVMPPPLME Q
Sbjct  179  PNRDADGLGITYKRLPYQLWNVNKYGSCADAAITGVMPPPLMEVQ  223



>ref|XP_008386259.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Malus domestica]
Length=452

 Score =   355 bits (912),  Expect(2) = 5e-179, Method: Compositional matrix adjust.
 Identities = 177/232 (76%), Positives = 201/232 (87%), Gaps = 2/232 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QS++ Y C +TVG+DAVISA+RLS D +RS+VGAILSKVVPATFSTI+S+SKM+W S+ T
Sbjct  223   QSTEHYLCGITVGEDAVISAFRLSEDNNRSLVGAILSKVVPATFSTIASLSKMIWGSDQT  282

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
              + K E KPQPFA+ASPLTCLKD+PRKGEKLTLSPSGTL AITDSLGRILLLDTQALV+V
Sbjct  283   SSKKSEEKPQPFAQASPLTCLKDFPRKGEKLTLSPSGTLTAITDSLGRILLLDTQALVIV  342

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLFMEMLV KD++   S+H+E  KSDYCLCL IHAPRKGI+EIW MRTGP
Sbjct  343   RLWKGYRDASCLFMEMLVKKDTAASNSSHYEPTKSDYCLCLVIHAPRKGIIEIWXMRTGP  402

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSL  1531
             RL+   C KGSKILQPTYRF SS A  S Y+PLEVF LNGDS Q+SVLNR+L
Sbjct  403   RLRAFQCAKGSKILQPTYRFGSSIA--SPYVPLEVFLLNGDSXQISVLNRTL  452


 Score =   301 bits (772),  Expect(2) = 5e-179, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 180/225 (80%), Gaps = 3/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R+ HTTELG IAC++L +LGAGKEGW  +NPNLL ALDT SLALA+RS+I+ L W D
Sbjct  1    MAKRT-HTTELGSIACEELGELGAGKEGWF-DNPNLLCALDTQSLALANRSVIVFLGWAD  58

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
            +   P KI PELSPI+AE+++A+ WLVFD+++V+  GTSSGYLL +SL GDLIHKQ V P
Sbjct  59   SDGTPLKIRPELSPIEAEFVTAVEWLVFDEVRVVVAGTSSGYLLFFSLDGDLIHKQMVYP  118

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
             +I++LRVRGTKRD   + S EEVCVVMPG VARF+GSDIQ+ML +WF++  SQ WDQ +
Sbjct  119  ERIIRLRVRGTKRDFTHETSSEEVCVVMPGIVARFDGSDIQNMLLQWFEDTQSQFWDQTL  178

Query  687  -NRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
              R  +D   S+G+LPYQLW+V+KYG C DAAI G+MPPPLME Q
Sbjct  179  KKRGSDDFEHSYGKLPYQLWSVSKYGTCADAAITGIMPPPLMEIQ  223



>ref|XP_004165412.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Cucumis sativus]
Length=456

 Score =   354 bits (909),  Expect(2) = 1e-178, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 206/234 (88%), Gaps = 4/234 (2%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSS+RY+CAVTVG+DAVISA+RLS DKSRS+VGAILSKVVPATFSTI+S SKM+WRSEP 
Sbjct  225   QSSERYFCAVTVGEDAVISAFRLSEDKSRSLVGAILSKVVPATFSTIASFSKMIWRSEPK  284

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
              + KP+ K Q FA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  285   TSKKPDAKGQAFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  344

Query  1196  RLWKGYRDASCLFMEMLVNKD--SSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRT  1369
             RLWKGYRDA+CLFMEMLVN+D  SS+  S  +E  K+DYCLCLAIHAPRKGIVEIWQMRT
Sbjct  345   RLWKGYRDANCLFMEMLVNRDTASSSSNSMDYEPAKNDYCLCLAIHAPRKGIVEIWQMRT  404

Query  1370  GPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSL  1531
             G RL+TI C KGSK+LQP++R  SS    S Y+PLEVF LNGDSGQ+ V+NR+L
Sbjct  405   GRRLRTIRCTKGSKLLQPSFRLGSSMD--SPYVPLEVFLLNGDSGQICVINRTL  456


 Score =   302 bits (773),  Expect(2) = 1e-178, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 179/226 (79%), Gaps = 3/226 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR+  TTELGCIAC+DL+D GAGKEGWLV++PNLL ALD+HSLALASRSIILVL W+ 
Sbjct  1    MARRT-FTTELGCIACEDLADFGAGKEGWLVDSPNLLCALDSHSLALASRSIILVLGWSG  59

Query  327  AGDPPAKIIP-ELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVN  503
            +   P KI P +LSPI+AEY+SAL WLV D+IKV+ VGTS GY LIYSLRGDLI KQ ++
Sbjct  60   SDGYPLKIRPSDLSPIEAEYISALEWLVLDEIKVILVGTSCGYFLIYSLRGDLILKQMIH  119

Query  504  PAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD-Q  680
            P +ILK+RV G+KRD    +SLEEV + MPG +AR EGSDIQ+ L++WFQE  SQ WD +
Sbjct  120  PGRILKIRVHGSKRDLSHGSSLEEVSIAMPGVIARIEGSDIQNTLQKWFQESSSQFWDPK  179

Query  681  PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
               R M DS +S  +L YQ+WNV+KYG C DAAI GVMPPPLME Q
Sbjct  180  SHQRDMNDSENSVEKLAYQVWNVSKYGACADAAITGVMPPPLMELQ  225



>ref|XP_010276996.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X1 [Nelumbo nucifera]
Length=458

 Score =   377 bits (967),  Expect(2) = 2e-178, Method: Compositional matrix adjust.
 Identities = 190/234 (81%), Positives = 210/234 (90%), Gaps = 1/234 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+GDDAVISAYRLS D+SRSI+GA LSKV+P TFSTI S SKM+W+S+ T
Sbjct  225   QSSQRYYCAVTIGDDAVISAYRLSEDRSRSILGAFLSKVMPTTFSTIVSFSKMIWQSDQT  284

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
              TT  E +PQPFA+ASPLTCLKD PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  285   STTNSEVQPQPFARASPLTCLKDKPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  344

Query  1196  RLWKGYRDASCLFMEMLVNKDS-STLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             RLWKGYRDA CLFMEMLVN+D+ S+  SA++EH K+DYCLCLAIHAPRKGI+E+WQMRTG
Sbjct  345   RLWKGYRDAFCLFMEMLVNRDTASSSTSAYYEHTKNDYCLCLAIHAPRKGIIEVWQMRTG  404

Query  1373  PRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             PRL+TI C KGSKILQPT+RF SS  S SSYIPLEVF LNGDSGQLSVLNR L+
Sbjct  405   PRLRTIQCAKGSKILQPTHRFGSSLTSPSSYIPLEVFLLNGDSGQLSVLNRYLS  458


 Score =   278 bits (712),  Expect(2) = 2e-178, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 172/227 (76%), Gaps = 5/227 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWT-  323
            MARRS H TE GCIACD+L++LGAG+EGWLV+NPN+L+ALD HSLALA+ S+IL+L W  
Sbjct  1    MARRS-HVTEFGCIACDELAELGAGREGWLVDNPNILSALDAHSLALANHSVILILGWNY  59

Query  324  -DAGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFV  500
             D    P KI P L+P++ + ++A+ WLVFDD+  LAVGTS+GYL+IYSL  DLIHKQ +
Sbjct  60   DDPSSRPVKIRPSLTPVEGD-ITAIEWLVFDDLHALAVGTSNGYLIIYSLESDLIHKQMI  118

Query  501  NPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ  680
             P  I KLRV GTK    Q+ S EEVC+VMP  +ARF+GS+I+ +L+RWFQE  SQ  DQ
Sbjct  119  YPECIRKLRVHGTKSGLTQETSSEEVCIVMPDVIARFDGSEIRKLLQRWFQEARSQFRDQ  178

Query  681  PVNRY-MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
               +   ED  +S+GR+PYQLWNV+KYG  VDAAI G+M PPLME Q
Sbjct  179  RWKKSETEDLRNSYGRVPYQLWNVSKYGSTVDAAITGIMLPPLMELQ  225



>ref|XP_004146026.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Cucumis sativus]
 gb|KGN55068.1| hypothetical protein Csa_4G627180 [Cucumis sativus]
Length=456

 Score =   354 bits (908),  Expect(2) = 3e-178, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 206/234 (88%), Gaps = 4/234 (2%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSS+RY+CAVTVG+DAVISA+RLS DKSRS+VGAILSKVVPATFSTI+S SKM+WRSEP 
Sbjct  225   QSSERYFCAVTVGEDAVISAFRLSEDKSRSLVGAILSKVVPATFSTIASFSKMIWRSEPK  284

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
              + KP+ K Q FA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  285   TSKKPDAKGQAFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  344

Query  1196  RLWKGYRDASCLFMEMLVNKD--SSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRT  1369
             RLWKGYRDA+CLFMEMLVN+D  SS+  S  +E  K+DYCLCLAIHAPRKGIVEIWQMRT
Sbjct  345   RLWKGYRDANCLFMEMLVNRDTASSSSNSMDYEPAKNDYCLCLAIHAPRKGIVEIWQMRT  404

Query  1370  GPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSL  1531
             G RL+TI C KGSK+LQP++R  SS    S Y+PLEVF LNGDSGQ+ V+NR+L
Sbjct  405   GRRLRTIRCTKGSKLLQPSFRLGSSMD--SPYVPLEVFLLNGDSGQICVINRTL  456


 Score =   300 bits (769),  Expect(2) = 3e-178, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 179/226 (79%), Gaps = 3/226 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR+  TTELGCIAC+DL+D GAGKEGWLV++PNLL ALD+HSLALA+RSIILVL W+ 
Sbjct  1    MARRT-FTTELGCIACEDLADFGAGKEGWLVDSPNLLCALDSHSLALANRSIILVLGWSG  59

Query  327  AGDPPAKIIP-ELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVN  503
            +   P KI P +LSPI+AEY+SAL WLV D+IKV+ VGTS GY LIYSLRGDLI KQ ++
Sbjct  60   SDGYPLKIRPSDLSPIEAEYISALEWLVLDEIKVILVGTSCGYFLIYSLRGDLILKQMIH  119

Query  504  PAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD-Q  680
            P +ILK+RV G+KRD    +SLEEV + MPG +AR EGSDIQ+ L++WFQE  SQ WD +
Sbjct  120  PGRILKIRVHGSKRDLSHGSSLEEVSIAMPGVIARIEGSDIQNTLQKWFQESSSQFWDPK  179

Query  681  PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
               R M DS +S  +L YQ+WNV+KYG C DAAI GVMPPPLME Q
Sbjct  180  SHQRDMNDSENSVEKLAYQVWNVSKYGACADAAITGVMPPPLMELQ  225



>ref|XP_008463738.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Cucumis melo]
Length=456

 Score =   360 bits (923),  Expect(2) = 1e-177, Method: Compositional matrix adjust.
 Identities = 185/234 (79%), Positives = 208/234 (89%), Gaps = 4/234 (2%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSS+RY+CAVTVG+DAVISA+RLS DKSRS+VGAILSKVVPATFSTI+S SKM+WRSEP 
Sbjct  225   QSSERYFCAVTVGEDAVISAFRLSEDKSRSLVGAILSKVVPATFSTIASFSKMIWRSEPK  284

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
              + KP+ K Q FA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  285   TSKKPDAKGQAFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  344

Query  1196  RLWKGYRDASCLFMEMLVNKD--SSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRT  1369
             RLWKGYRDA+CLFMEMLVN+D  SS+  S  +E  K+DYCLCLAIHAPRKGIVEIWQMRT
Sbjct  345   RLWKGYRDANCLFMEMLVNRDTASSSSNSMDYEPAKNDYCLCLAIHAPRKGIVEIWQMRT  404

Query  1370  GPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSL  1531
             G RL+TI C KGSK+LQP+ RF SS   +S Y+PLEVF LNGDSGQ+SVLNR+L
Sbjct  405   GRRLRTIRCSKGSKLLQPSSRFGSS--MVSPYVPLEVFLLNGDSGQISVLNRTL  456


 Score =   293 bits (750),  Expect(2) = 1e-177, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 177/226 (78%), Gaps = 3/226 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR+  TTELGCIAC+DL+D GAGKEGWLV+NPNLL ALD+HSLALA+RSIILVL W+ 
Sbjct  1    MARRT-FTTELGCIACEDLADFGAGKEGWLVDNPNLLCALDSHSLALANRSIILVLGWSG  59

Query  327  AGDPPAKIIP-ELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVN  503
            +     KI P +LSPI+AEY+SAL WLV D+IKV+ VGTS GY LIYSL GDLI KQ ++
Sbjct  60   SDGYRLKIRPSDLSPIEAEYISALEWLVLDEIKVILVGTSCGYFLIYSLSGDLILKQMIH  119

Query  504  PAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD-Q  680
            P +ILK+RV G+KRD    +SLEEV V MPG +AR EGSDIQ+ L++WFQE  ++ WD +
Sbjct  120  PGRILKIRVHGSKRDLSHGSSLEEVSVAMPGVIARIEGSDIQNTLQKWFQESNARFWDPK  179

Query  681  PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
               + M DS +S  +L YQ+WNV+KYG C DAAI GVMPPPLME Q
Sbjct  180  SQQQDMNDSENSVEKLAYQVWNVSKYGACADAAITGVMPPPLMELQ  225



>ref|XP_010502321.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X2 [Camelina sativa]
Length=451

 Score =   349 bits (896),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 177/234 (76%), Positives = 197/234 (84%), Gaps = 3/234 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+G+DAVISAYRLS D+ RS+VGAILSKVVPA  STI+S SK++WRS   
Sbjct  220   QSSQRYYCAVTIGEDAVISAYRLSEDRGRSLVGAILSKVVPAAASTIASFSKLIWRSNDQ  279

Query  1016  pttkp-epkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV  1192
                +  E K Q FA+AS LTC+KDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV
Sbjct  280   SPKRKPEAKTQSFARASSLTCIKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV  339

Query  1193  VRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             VRLWKGYRDASC+FMEML  KD       H E +KSDYCLCLAIHAPRKGI+E+WQMRTG
Sbjct  340   VRLWKGYRDASCVFMEMLAKKDKGK-GVIHTEPVKSDYCLCLAIHAPRKGIIEVWQMRTG  398

Query  1373  PRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             PRL TI C KGSK+LQP YRF S+ +S S YIPLEVF LNGDSGQ+S+LNRSL+
Sbjct  399   PRLLTIQCAKGSKLLQPAYRFGSNSSS-SPYIPLEVFLLNGDSGQVSMLNRSLS  451


 Score =   299 bits (765),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 180/226 (80%), Gaps = 8/226 (4%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R  H TELGCIAC++LS+LGAGKEGWLV NPNLL ALD+HSLALA+R++IL++ W D
Sbjct  1    MAKRI-HLTELGCIACEELSELGAGKEGWLVNNPNLLCALDSHSLALANRNLILIVNWGD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI P+LSPI+AE ++A+ WLVFDD++V+  GTS GYLL+YS+ GDLIHKQ V+ 
Sbjct  60   PDAPRVKIRPDLSPIEAESITAIEWLVFDDVRVVVAGTSCGYLLVYSVAGDLIHKQMVHA  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            ++ILKLRVRGTK+D +Q+ S EE+C VMPG +ARF+GS+IQ    +WFQE+ S  WDQ  
Sbjct  120  SRILKLRVRGTKKDLIQETSTEEICFVMPGIIARFDGSNIQ----KWFQEKNSNFWDQK-  174

Query  687  NRY--MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            NR   +ED+G    RLPYQ+WNVNK G+CVDA + GVMPPPL+E Q
Sbjct  175  NRKGDVEDTGSLSQRLPYQIWNVNKNGVCVDATVTGVMPPPLLELQ  220



>ref|XP_003525975.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Glycine max]
Length=460

 Score =   362 bits (929),  Expect(2) = 6e-176, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 209/233 (90%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QS+QRYYCAV VG+DAVISAYRLS +K RS+VGAILSKVVPATFSTISS SK++WR+E +
Sbjct  229   QSNQRYYCAVAVGEDAVISAYRLSENKGRSLVGAILSKVVPATFSTISSFSKLIWRNERS  288

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                K + KP+PFA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  289   SPKKSDLKPRPFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  348

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLFMEMLVNKD ++  S++ E +KSDYCLCLAIHAPRKGI+EIWQMRTG 
Sbjct  349   RLWKGYRDASCLFMEMLVNKDIASSSSSYSEPLKSDYCLCLAIHAPRKGIIEIWQMRTGQ  408

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL+TI C KGSK+LQP+YRF +S +  S Y+PLEVF LNGDSGQ+SVLNR+L+
Sbjct  409   RLRTISCTKGSKMLQPSYRFGASVS--SPYVPLEVFLLNGDSGQISVLNRTLD  459


 Score =   285 bits (729),  Expect(2) = 6e-176, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 175/229 (76%), Gaps = 6/229 (3%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQW--  320
            M+RRS + TELGCIACD+L +LGAGK  WLVE P LL A+DTHSL LA+RS IL+L W  
Sbjct  1    MSRRS-YKTELGCIACDELGELGAGKPHWLVETPQLLCAIDTHSLLLANRSTILLLSWSS  59

Query  321  --TDAGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQ  494
              T A  PP KI P+LSPI AE +SAL WL F D +V+  GTSSGYLL+YSL+G+LIH+Q
Sbjct  60   DSTAAAPPPLKIRPDLSPIDAESISALEWLAFRDHRVIVAGTSSGYLLLYSLQGELIHRQ  119

Query  495  FVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLW  674
             + P ++LKLRVRGTK+D +QD S EE C++M G +ARF+GSDIQ+ML++WF+E  S+  
Sbjct  120  MIYPERVLKLRVRGTKKDLIQDTSSEEFCLIMSGVIARFDGSDIQNMLQKWFEEANSRFS  179

Query  675  DQ-PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            DQ P ++  ED  ++  ++PYQLWN+ KYG C DAAI G+MPPPLME Q
Sbjct  180  DQNPKSQDSEDFENTDVKIPYQLWNIGKYGTCADAAITGIMPPPLMEQQ  228



>ref|XP_003540058.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Glycine max]
Length=459

 Score =   370 bits (949),  Expect(2) = 9e-176, Method: Compositional matrix adjust.
 Identities = 186/233 (80%), Positives = 210/233 (90%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAV VG+DAVISAYRLS +K RS+VGAILSKVVPATFSTISS SK++WRSE +
Sbjct  228   QSSQRYYCAVAVGEDAVISAYRLSENKGRSLVGAILSKVVPATFSTISSFSKLIWRSEQS  287

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                K + KPQPFA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  288   SPKKSDQKPQPFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  347

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLFMEMLVNKD ++  S++ E +KSDYCLCLAIHAPRKGI+EIWQMRTGP
Sbjct  348   RLWKGYRDASCLFMEMLVNKDIASSSSSYSEPLKSDYCLCLAIHAPRKGIIEIWQMRTGP  407

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL+TI C KGSK+LQP+YRF +S +  S Y+PLEVF LNGDSGQ+SVLNR+L+
Sbjct  408   RLRTISCAKGSKMLQPSYRFGASMS--SPYVPLEVFLLNGDSGQISVLNRTLD  458


 Score =   277 bits (708),  Expect(2) = 9e-176, Method: Compositional matrix adjust.
 Identities = 136/228 (60%), Positives = 175/228 (77%), Gaps = 5/228 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARRS + TELGCIAC++L +LGAGK  WLVE P LL A+DTHSL LA+RS IL+L W+ 
Sbjct  1    MARRS-YKTELGCIACEELGELGAGKPHWLVETPQLLCAIDTHSLILANRSTILLLSWSS  59

Query  327  ---AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQF  497
               A  PP KI P+LSPI AE +SAL WL F D +V+  GTSSG +L YSLRG+LIH+Q 
Sbjct  60   DSSAAPPPLKIRPDLSPIDAESISALEWLAFRDHRVIVAGTSSGNVLFYSLRGELIHRQM  119

Query  498  VNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD  677
            + P+++LKLRVRGTK+D +QD S EE C++M G +A F+GSDIQ+ML++WF+E +S+ WD
Sbjct  120  IYPSRVLKLRVRGTKKDLIQDTSSEEFCLIMSGVIAHFDGSDIQNMLQKWFEESHSRFWD  179

Query  678  Q-PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            Q P +   ED G++  ++PYQLWN+ KYG C +AAI G+MPPPLME Q
Sbjct  180  QNPKSHDSEDFGNTDVKIPYQLWNIGKYGTCAEAAITGIMPPPLMEQQ  227



>ref|XP_009599451.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Nicotiana tomentosiformis]
Length=401

 Score =   352 bits (903),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 169/227 (74%), Positives = 198/227 (87%), Gaps = 7/227 (3%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR+ HTTELGCIAC+DL++LGAGKEGWLV NPNLLTALDTHSLALA+RSI+L+L W++
Sbjct  1    MARRN-HTTELGCIACEDLTELGAGKEGWLVNNPNLLTALDTHSLALANRSIVLILHWSE  59

Query  327  AGDPPA---KIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQF  497
              DP +   KI+PELSPI+AEY+SA+AWLVFDDIKVLA+GTS GYLL YSLRGDLIHKQ 
Sbjct  60   GSDPVSNRVKIVPELSPIEAEYISAIAWLVFDDIKVLALGTSRGYLLTYSLRGDLIHKQI  119

Query  498  VNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD  677
            V+P KIL+LRVRGTKRD  QDAS EEVCVVM G +ARF+GSD Q+ML+RWF+ER+SQ WD
Sbjct  120  VSPGKILRLRVRGTKRDLTQDASSEEVCVVMSGVIARFDGSDFQNMLQRWFRERHSQFWD  179

Query  678  QPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            +   R  E+S D+FGRLPYQLWNV+KYG CVDAAI G+MPPPL+E Q
Sbjct  180  E---RDSENSIDTFGRLPYQLWNVSKYGPCVDAAITGLMPPPLLEIQ  223


 Score =   291 bits (745),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCA+T+GDDAVISAYRLSVD+SRSIVGAILSKVVPATFSTI+SISKMLWRS+PT
Sbjct  223   QSSQRYYCAITIGDDAVISAYRLSVDRSRSIVGAILSKVVPATFSTITSISKMLWRSDPT  282

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P  +PEPKPQPFA+ASPLTC KD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  283   PAKRPEPKPQPFARASPLTCFKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  342

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVE  1351
             RLWKGYRDASCLF+EML +KD  T +SA+ EH+KSDYCLCLAIHAPRKGIVE
Sbjct  343   RLWKGYRDASCLFVEMLASKDVETSRSAYGEHVKSDYCLCLAIHAPRKGIVE  394



>gb|KEH19569.1| Rab3 GTPase-activating protein non-catalytic subunit [Medicago 
truncatula]
Length=464

 Score =   368 bits (944),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 188/237 (79%), Positives = 209/237 (88%), Gaps = 6/237 (3%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAV VGDDAVISAYRLS DK RS+VGAILSKVVPATFSTI+S SK++WRSE T
Sbjct  229   QSSQRYYCAVAVGDDAVISAYRLSEDKGRSLVGAILSKVVPATFSTIASFSKLIWRSEHT  288

Query  1016  pttkp----epkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQA  1183
                K     E KPQPFA+ASPLTC+KD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQA
Sbjct  289   SPVKSPKKLEQKPQPFARASPLTCIKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQA  348

Query  1184  LVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQM  1363
             LVVVRLWKGYRDASCLFMEMLVNKD ++  S  +E +KSDYCLCLAIHAPRKGI+EIWQM
Sbjct  349   LVVVRLWKGYRDASCLFMEMLVNKDLASSSSTCYESMKSDYCLCLAIHAPRKGIIEIWQM  408

Query  1364  RTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RTGPRL+TI C KGSK+LQP+YRF +S +  S Y+PLEVF LNGDSGQ+SVLNR+L+
Sbjct  409   RTGPRLRTISCAKGSKMLQPSYRFGASMS--SPYVPLEVFLLNGDSGQISVLNRTLD  463


 Score =   274 bits (700),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 178/226 (79%), Gaps = 4/226 (2%)
 Frame = +3

Query  153  RRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTDAG  332
            +R S+  ELGCIAC +L ++GAGK GW+V+NPNLL+A+D HS+ LA+RS IL+L W+   
Sbjct  4    KRRSYKKELGCIACKELGEVGAGKPGWVVDNPNLLSAIDNHSILLANRSTILLLSWSSDS  63

Query  333  DP-PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNPA  509
               P +I P+LSPI++E++SA+ WLVFD+I+V+  GTSSGYLLIYSLR +LIH+Q + P 
Sbjct  64   SQSPIRIRPDLSPIESEFISAVEWLVFDEIRVIVAGTSSGYLLIYSLRAELIHRQMIYPG  123

Query  510  KILKLRVRGTKRDQMQD--ASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQP  683
            ++LKLRVRGTK+D +QD  +S EE C++MPG +ARF+GS +Q+ML++WF+E ++QLW+Q 
Sbjct  124  RVLKLRVRGTKKDLIQDNSSSSEEFCLIMPGVIARFDGSVVQNMLQKWFEEAHAQLWNQK  183

Query  684  VN-RYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
               +  ED  +S  +LPYQLWN+ KYG C DAAI G+MPPPLME Q
Sbjct  184  QKGQDSEDFDNSQQKLPYQLWNIGKYGTCADAAITGIMPPPLMEQQ  229



>ref|XP_009798854.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Nicotiana sylvestris]
Length=401

 Score =   347 bits (889),  Expect(2) = 3e-173, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 196/227 (86%), Gaps = 7/227 (3%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR+  TTELGCIAC+DL++LGAGKEGWL+ NPNLL ALDTHSLALA+RSI+L+L W++
Sbjct  1    MARRN-LTTELGCIACEDLTELGAGKEGWLLNNPNLLAALDTHSLALANRSIVLILHWSE  59

Query  327  AGDP---PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQF  497
              DP     KI+PELSPI+AEY+SA+AWLVFDDIKVLA+GTS GYLL YSLRGDLIHKQ 
Sbjct  60   GSDPVRNRVKIVPELSPIEAEYISAIAWLVFDDIKVLALGTSRGYLLTYSLRGDLIHKQI  119

Query  498  VNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD  677
            V+P KIL+LRVRGTKRD  QDAS EEVCVVMPG +ARF+GSD Q+ML+RWF+ER+SQ WD
Sbjct  120  VSPGKILRLRVRGTKRDLTQDASSEEVCVVMPGVIARFDGSDFQNMLQRWFRERHSQFWD  179

Query  678  QPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            +   R  E+S D+FGRLPYQLWNV+KYG CVDAAI G+MPPPL+E Q
Sbjct  180  E---RDSENSIDTFGRLPYQLWNVSKYGPCVDAAITGLMPPPLLEIQ  223


 Score =   291 bits (745),  Expect(2) = 3e-173, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCA+TVGDDAVISAYRLSVD+SRSIVGAILSKVVPATFSTI+SISKMLWRS+PT
Sbjct  223   QSSQRYYCAITVGDDAVISAYRLSVDRSRSIVGAILSKVVPATFSTITSISKMLWRSDPT  282

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P  +PEPKPQPFA+ASPLTC KD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  283   PAKRPEPKPQPFARASPLTCFKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  342

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVE  1351
             RLWKGYRDASCLF+EML +KD  T +SA+ EH+KSDYCLCLAIHAPRKGIVE
Sbjct  343   RLWKGYRDASCLFVEMLASKDVETSRSAYGEHMKSDYCLCLAIHAPRKGIVE  394



>ref|XP_007133227.1| hypothetical protein PHAVU_011G162200g [Phaseolus vulgaris]
 gb|ESW05221.1| hypothetical protein PHAVU_011G162200g [Phaseolus vulgaris]
Length=462

 Score =   335 bits (858),  Expect(2) = 3e-169, Method: Compositional matrix adjust.
 Identities = 178/236 (75%), Positives = 200/236 (85%), Gaps = 6/236 (3%)
 Frame = +2

Query  839   SSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWR----S  1006
             SSQRYYCAV VG+DAVISAYRLS  K RS+VGAILSKVVPATFST+SS SK++WR    S
Sbjct  228   SSQRYYCAVAVGEDAVISAYRLSESKGRSLVGAILSKVVPATFSTLSSFSKLIWRTEPSS  287

Query  1007  eptpttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQAL  1186
                P  K + KPQPFA+AS LT L D+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQAL
Sbjct  288   PKNPPRKSDQKPQPFARASSLTSLIDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQAL  347

Query  1187  VVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMR  1366
             VVVRLWKGYRDASCLFMEMLVNKD  +  S++ E  KSDY LCLAIHAPRKGI+EIWQMR
Sbjct  348   VVVRLWKGYRDASCLFMEMLVNKDIGSSSSSYSEPSKSDYSLCLAIHAPRKGIIEIWQMR  407

Query  1367  TGPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             TGPRL+TI C KGSK+LQP+YRF +S +  S Y+PLEVF  NGDSGQ+S+LNR+L+
Sbjct  408   TGPRLRTISCAKGSKMLQPSYRFGASMS--SPYVPLEVFLFNGDSGQISILNRTLD  461


 Score =   290 bits (741),  Expect(2) = 3e-169, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 178/227 (78%), Gaps = 4/227 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+RS + TELGCIACD+L +LGAGK  WLVE P++L A+D HS+ LA+RS IL+L W+ 
Sbjct  1    MAKRS-YKTELGCIACDELGELGAGKPHWLVETPHVLCAIDNHSILLANRSTILLLSWSS  59

Query  327  --AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFV  500
              A  PP KI P+LSPI AE ++AL WL F D +V+  GTSSGYLL+YSLRGDLIH+Q +
Sbjct  60   NSAVAPPLKIRPDLSPIDAESITALEWLAFRDHRVIVAGTSSGYLLLYSLRGDLIHRQMI  119

Query  501  NPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ  680
             P ++LKLRVRGTK+D +QD S EE C++MPG +ARF+GSD+Q+ML++WF+E +S+ WDQ
Sbjct  120  YPGRVLKLRVRGTKKDLIQDTSSEEFCLIMPGVIARFDGSDVQNMLQQWFEEAHSRFWDQ  179

Query  681  -PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             P ++  ED G++  ++PYQLWN+ K G C DAAI G+MPPPLME Q
Sbjct  180  KPKSQDSEDFGNTDVKIPYQLWNIGKNGTCSDAAITGIMPPPLMEQQ  226



>gb|KEH19571.1| Rab3 GTPase-activating protein non-catalytic subunit [Medicago 
truncatula]
Length=501

 Score =   349 bits (896),  Expect(2) = 8e-169, Method: Compositional matrix adjust.
 Identities = 188/274 (69%), Positives = 209/274 (76%), Gaps = 43/274 (16%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAV VGDDAVISAYRLS DK RS+VGAILSKVVPATFSTI+S SK++WRSE T
Sbjct  229   QSSQRYYCAVAVGDDAVISAYRLSEDKGRSLVGAILSKVVPATFSTIASFSKLIWRSEHT  288

Query  1016  pttkp----epkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQA  1183
                K     E KPQPFA+ASPLTC+KD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQA
Sbjct  289   SPVKSPKKLEQKPQPFARASPLTCIKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQA  348

Query  1184  LVVVRLWK-------------------------------------GYRDASCLFMEMLVN  1252
             LVVVRLWK                                     GYRDASCLFMEMLVN
Sbjct  349   LVVVRLWKVYFFKTFGPKSVTFPPPKNLQIKKALYSLNIKFSILQGYRDASCLFMEMLVN  408

Query  1253  KDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
             KD ++  S  +E +KSDYCLCLAIHAPRKGI+EIWQMRTGPRL+TI C KGSK+LQP+YR
Sbjct  409   KDLASSSSTCYESMKSDYCLCLAIHAPRKGIIEIWQMRTGPRLRTISCAKGSKMLQPSYR  468

Query  1433  FSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             F +S +  S Y+PLEVF LNGDSGQ+SVLNR+L+
Sbjct  469   FGASMS--SPYVPLEVFLLNGDSGQISVLNRTLD  500


 Score =   274 bits (701),  Expect(2) = 8e-169, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 178/226 (79%), Gaps = 4/226 (2%)
 Frame = +3

Query  153  RRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTDAG  332
            +R S+  ELGCIAC +L ++GAGK GW+V+NPNLL+A+D HS+ LA+RS IL+L W+   
Sbjct  4    KRRSYKKELGCIACKELGEVGAGKPGWVVDNPNLLSAIDNHSILLANRSTILLLSWSSDS  63

Query  333  DP-PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNPA  509
               P +I P+LSPI++E++SA+ WLVFD+I+V+  GTSSGYLLIYSLR +LIH+Q + P 
Sbjct  64   SQSPIRIRPDLSPIESEFISAVEWLVFDEIRVIVAGTSSGYLLIYSLRAELIHRQMIYPG  123

Query  510  KILKLRVRGTKRDQMQD--ASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQP  683
            ++LKLRVRGTK+D +QD  +S EE C++MPG +ARF+GS +Q+ML++WF+E ++QLW+Q 
Sbjct  124  RVLKLRVRGTKKDLIQDNSSSSEEFCLIMPGVIARFDGSVVQNMLQKWFEEAHAQLWNQK  183

Query  684  VN-RYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
               +  ED  +S  +LPYQLWN+ KYG C DAAI G+MPPPLME Q
Sbjct  184  QKGQDSEDFDNSQQKLPYQLWNIGKYGTCADAAITGIMPPPLMEQQ  229



>ref|XP_010276997.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X2 [Nelumbo nucifera]
Length=440

 Score =   377 bits (968),  Expect(2) = 6e-167, Method: Compositional matrix adjust.
 Identities = 190/234 (81%), Positives = 210/234 (90%), Gaps = 1/234 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+GDDAVISAYRLS D+SRSI+GA LSKV+P TFSTI S SKM+W+S+ T
Sbjct  207   QSSQRYYCAVTIGDDAVISAYRLSEDRSRSILGAFLSKVMPTTFSTIVSFSKMIWQSDQT  266

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
              TT  E +PQPFA+ASPLTCLKD PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  267   STTNSEVQPQPFARASPLTCLKDKPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  326

Query  1196  RLWKGYRDASCLFMEMLVNKDS-STLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             RLWKGYRDA CLFMEMLVN+D+ S+  SA++EH K+DYCLCLAIHAPRKGI+E+WQMRTG
Sbjct  327   RLWKGYRDAFCLFMEMLVNRDTASSSTSAYYEHTKNDYCLCLAIHAPRKGIIEVWQMRTG  386

Query  1373  PRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             PRL+TI C KGSKILQPT+RF SS  S SSYIPLEVF LNGDSGQLSVLNR L+
Sbjct  387   PRLRTIQCAKGSKILQPTHRFGSSLTSPSSYIPLEVFLLNGDSGQLSVLNRYLS  440


 Score =   240 bits (612),  Expect(2) = 6e-167, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 156/227 (69%), Gaps = 23/227 (10%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWT-  323
            MARRS H TE GCIACD+L++LGAG+EGWLV+NPN+L+ALD HSLALA+ S+IL+L W  
Sbjct  1    MARRS-HVTEFGCIACDELAELGAGREGWLVDNPNILSALDAHSLALANHSVILILGWNY  59

Query  324  -DAGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFV  500
             D    P KI P L+P++ + ++A+ WLVFDD+  LAVGTS+GYL+IYSL  DLIHKQ +
Sbjct  60   DDPSSRPVKIRPSLTPVEGD-ITAIEWLVFDDLHALAVGTSNGYLIIYSLESDLIHKQMI  118

Query  501  NPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ  680
             P  I KLRV GTK    Q+ S EE                   +L+RWFQE  SQ  DQ
Sbjct  119  YPECIRKLRVHGTKSGLTQETSSEE------------------KLLQRWFQEARSQFRDQ  160

Query  681  PVNRY-MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
               +   ED  +S+GR+PYQLWNV+KYG  VDAAI G+M PPLME Q
Sbjct  161  RWKKSETEDLRNSYGRVPYQLWNVSKYGSTVDAAITGIMLPPLMELQ  207



>ref|XP_009394196.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Musa acuminata subsp. malaccensis]
Length=501

 Score =   355 bits (912),  Expect(2) = 1e-160, Method: Compositional matrix adjust.
 Identities = 183/230 (80%), Positives = 201/230 (87%), Gaps = 2/230 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYY AVTVGD++VISAYRLS D+SRS+VG ILSKVVP TFSTI+S SK++WRSE +
Sbjct  271   QSSQRYYGAVTVGDNSVISAYRLSEDRSRSLVGTILSKVVPVTFSTIASFSKLIWRSEQS  330

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
              T K  P  QPFAKASPLTCLKD PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  331   ATRKSHPTSQPFAKASPLTCLKDPPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  390

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLF+EMLVN+D ++  S  +E+ KSDYCLCLAIHAPRK I+EIW+MRTGP
Sbjct  391   RLWKGYRDASCLFVEMLVNRDKASSSSRCYEYTKSDYCLCLAIHAPRKEIIEIWKMRTGP  450

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNR  1525
             RL TI CPKGSKILQP+ RF SS  S + YIPLEVF LNGDSGQLSVLNR
Sbjct  451   RLLTIQCPKGSKILQPSTRFVSS--SQTPYIPLEVFILNGDSGQLSVLNR  498


 Score =   240 bits (613),  Expect(2) = 1e-160, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 170/238 (71%), Gaps = 14/238 (6%)
 Frame = +3

Query  138  GNLMARRSSHTTELGCIACDDLSDLGAG-KEGWLVENPNLLTALDTHSLALAS--RSIIL  308
            G  MARRS H TE+GCIACD+L++LGAG +EGWL ++P+LL AL ++SLA+AS  R ++L
Sbjct  37   GRRMARRS-HLTEIGCIACDELAELGAGDREGWL-DDPSLLAALHSYSLAVASAARPLVL  94

Query  309  VLQW-TDAGDP-----PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSL  470
            VL W  D   P     P KI P LSP     ++AL WL F D+  LA+GTSSG LL+YS+
Sbjct  95   VLGWDPDRRSPSSPRHPVKIHPSLSPSDGR-ITALEWLPFGDLLALALGTSSGLLLVYSV  153

Query  471  RGDLIHKQFVNPAKILKLRVRGT--KRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRR  644
             GDLIHKQFV+P ++L+LR R T  K    QD+  EE+CVV+PG VARF+G+DIQS+LRR
Sbjct  154  GGDLIHKQFVHPGRVLRLRFRETESKGGFAQDSVSEELCVVLPGVVARFDGTDIQSLLRR  213

Query  645  WFQERYSQLWDQPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            W QE  S++W+   ++   +   S+G +P+QLWNV K+G C DAAI GV PPPL+E Q
Sbjct  214  WLQEAGSRMWENSRHKLESEDEISYGNIPFQLWNVGKFGNCSDAAITGVKPPPLLELQ  271



>ref|XP_010276998.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X3 [Nelumbo nucifera]
Length=413

 Score =   377 bits (967),  Expect(2) = 4e-157, Method: Compositional matrix adjust.
 Identities = 190/234 (81%), Positives = 210/234 (90%), Gaps = 1/234 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+GDDAVISAYRLS D+SRSI+GA LSKV+P TFSTI S SKM+W+S+ T
Sbjct  180   QSSQRYYCAVTIGDDAVISAYRLSEDRSRSILGAFLSKVMPTTFSTIVSFSKMIWQSDQT  239

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
              TT  E +PQPFA+ASPLTCLKD PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  240   STTNSEVQPQPFARASPLTCLKDKPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  299

Query  1196  RLWKGYRDASCLFMEMLVNKDS-STLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             RLWKGYRDA CLFMEMLVN+D+ S+  SA++EH K+DYCLCLAIHAPRKGI+E+WQMRTG
Sbjct  300   RLWKGYRDAFCLFMEMLVNRDTASSSTSAYYEHTKNDYCLCLAIHAPRKGIIEVWQMRTG  359

Query  1373  PRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             PRL+TI C KGSKILQPT+RF SS  S SSYIPLEVF LNGDSGQLSVLNR L+
Sbjct  360   PRLRTIQCAKGSKILQPTHRFGSSLTSPSSYIPLEVFLLNGDSGQLSVLNRYLS  413


 Score =   208 bits (529),  Expect(2) = 4e-157, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 141/227 (62%), Gaps = 50/227 (22%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWT-  323
            MARRS H TE GCIACD+L++LGAG+EGWLV+NPN+L+ALD HSLALA+ S+IL+L W  
Sbjct  1    MARRS-HVTEFGCIACDELAELGAGREGWLVDNPNILSALDAHSLALANHSVILILGWNY  59

Query  324  -DAGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFV  500
             D    P KI P L+P++ + ++A+ WLVFDD+  LAVGTS+GYL+IYSL  DLIHK   
Sbjct  60   DDPSSRPVKIRPSLTPVEGD-ITAIEWLVFDDLHALAVGTSNGYLIIYSLESDLIHK---  115

Query  501  NPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ  680
                                                      Q +L+RWFQE  SQ  DQ
Sbjct  116  ------------------------------------------QKLLQRWFQEARSQFRDQ  133

Query  681  PVNRY-MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
               +   ED  +S+GR+PYQLWNV+KYG  VDAAI G+M PPLME Q
Sbjct  134  RWKKSETEDLRNSYGRVPYQLWNVSKYGSTVDAAITGIMLPPLMELQ  180



>ref|XP_006852398.1| hypothetical protein AMTR_s00021p00018190 [Amborella trichopoda]
 gb|ERN13865.1| hypothetical protein AMTR_s00021p00018190 [Amborella trichopoda]
Length=451

 Score =   335 bits (860),  Expect(2) = 1e-156, Method: Compositional matrix adjust.
 Identities = 169/233 (73%), Positives = 193/233 (83%), Gaps = 1/233 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             +SSQRYYCAV +G DAVISA+RLS D+ RS+VG ILSKVVPATFST++S+SKM+WRS+  
Sbjct  220   ESSQRYYCAVIIGHDAVISAFRLSEDRKRSLVGTILSKVVPATFSTLTSLSKMIWRSDEA  279

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
              T   E KPQ FAKAS LTCLKD+PRKGEKLTLSP G+LA ITDSLGRILLLDTQALVV+
Sbjct  280   STRPVEVKPQAFAKASLLTCLKDHPRKGEKLTLSPGGSLAVITDSLGRILLLDTQALVVI  339

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDA C FMEMLV KD  +  S  + + KSDYCLCLAIHAPR+ +VE+W+MR GP
Sbjct  340   RLWKGYRDACCFFMEMLVGKDMPS-NSVEYGNSKSDYCLCLAIHAPRREVVEVWKMRMGP  398

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL T+PC KGS ILQPT +  SS AS SSY PLEVF LNGDSGQL+VLNR +N
Sbjct  399   RLLTLPCAKGSMILQPTSKLESSLASPSSYTPLEVFLLNGDSGQLTVLNRFIN  451


 Score =   247 bits (631),  Expect(2) = 1e-156, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 164/226 (73%), Gaps = 8/226 (4%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M RR+ H TELGCI C++L  LGAGKEGWL ++PNL  ALD++SLALA+ +++LVL W D
Sbjct  1    MGRRA-HLTELGCIVCEELEQLGAGKEGWL-DSPNLYHALDSNSLALANENLVLVLGWID  58

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P   I P     + + +SA+ WL+FDD +VLA+ TS GYLL+YSL  +LIHKQ + P
Sbjct  59   DSRP-ITIRPSFLSHEGK-ISAIEWLIFDDHRVLALATSQGYLLLYSLASELIHKQMLYP  116

Query  507  AKILKLRVRGTKRDQM-QDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLW-DQ  680
             +I+KLR   T R    QD S  EVCVV P  + RF  SDI+S++ RWFQER S+LW D+
Sbjct  117  ERIIKLR--STHRQGFHQDHSSAEVCVVFPSVIVRFNASDIESLVHRWFQERSSRLWGDK  174

Query  681  PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
               R  ED G+S+GRLP+QLWNVNK+G CVDAA+IG+MPPPLME++
Sbjct  175  MQKREAEDIGNSYGRLPHQLWNVNKFGPCVDAAVIGIMPPPLMEYE  220



>ref|XP_010087803.1| hypothetical protein L484_003905 [Morus notabilis]
 gb|EXB30039.1| hypothetical protein L484_003905 [Morus notabilis]
Length=408

 Score =   303 bits (775),  Expect(2) = 2e-155, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 185/227 (81%), Gaps = 4/227 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+RS HTTELGCIAC++LS+LG GKEGWLV+NPNLL ALDTHSLALA+RS+IL L W+ 
Sbjct  1    MAKRS-HTTELGCIACEELSELGTGKEGWLVDNPNLLCALDTHSLALANRSLILTLSWSH  59

Query  327  AGDPP--AKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFV  500
            +       KI P+LSPI+AE++SA+ WLVFDDI+ +AVGTS GYLLIYSL G+LIHKQF+
Sbjct  60   SDSDSSRVKIRPDLSPIEAEFISAVEWLVFDDIRAIAVGTSCGYLLIYSLAGELIHKQFI  119

Query  501  NPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ  680
             P ++LKLRVRGTKRD +++ S EEVCVVMPG +ARF GS+IQSML++W+ +  S+ WD+
Sbjct  120  YPGRVLKLRVRGTKRDLIEETSSEEVCVVMPGVIARFYGSEIQSMLQQWYHDSSSRFWDK  179

Query  681  -PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             P  +  +D G+ +GRL +QLWNV+K G C DAAI G+MPPPLME Q
Sbjct  180  RPRKQESDDFGNPYGRLSFQLWNVSKSGTCADAAISGMMPPPLMELQ  226


 Score =   276 bits (705),  Expect(2) = 2e-155, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCA+TVG++AVISA+RLS DKSRS+VGAI+SKVVPA FSTI+S SKM+WRSE  
Sbjct  226   QSSQRYYCAITVGENAVISAFRLSEDKSRSLVGAIISKVVPAAFSTIASFSKMIWRSEQN  285

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                K   KPQ FA+ASPLT LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  286   SPRKSNIKPQAFARASPLTSLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  345

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVE  1351
             RLWKGYRDASCLFMEMLVN+D++   S ++E +KSDYCLCLAIHAPRKGI+E
Sbjct  346   RLWKGYRDASCLFMEMLVNRDTAASSSNYYEPVKSDYCLCLAIHAPRKGIIE  397



>ref|XP_011102228.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like, 
partial [Sesamum indicum]
Length=382

 Score =   367 bits (943),  Expect(2) = 3e-154, Method: Compositional matrix adjust.
 Identities = 191/234 (82%), Positives = 213/234 (91%), Gaps = 1/234 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+G+DAVISA+RLSVDK+RS+VGAILSKVVPATFSTI+S SK++WRSE  
Sbjct  149   QSSQRYYCAVTIGEDAVISAFRLSVDKNRSLVGAILSKVVPATFSTIASFSKLIWRSEEK  208

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             PT KPE K QPFA+AS LTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  209   PTKKPEAKSQPFARASALTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  268

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTL-KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             RLWKGYR+ASCLF+EML  KD +   + A+ EH KSDYCLCLAIHAPRKGIVE+WQMRTG
Sbjct  269   RLWKGYREASCLFVEMLARKDKAAASRWAYDEHSKSDYCLCLAIHAPRKGIVEVWQMRTG  328

Query  1373  PRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             PRL TIPCPKGSKILQPTYRFSS+ AS SSY+PL+VFFLNGDSGQ+S+LN  L+
Sbjct  329   PRLLTIPCPKGSKILQPTYRFSSATASSSSYVPLQVFFLNGDSGQISLLNPFLH  382


 Score =   207 bits (528),  Expect(2) = 3e-154, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 118/148 (80%), Gaps = 3/148 (2%)
 Frame = +3

Query  384  LSALAWLVFDD-IKVLAVGTSSGYLLIYSLRGDLIHKQFVNPAKILKLRVRGTKRDQMQD  560
            +SA+ WLVFDD I+ LAVGTS GYLLI+S+ G LIH+Q VNP KILK+RVRGTK+D  QD
Sbjct  2    VSAVEWLVFDDDIRALAVGTSCGYLLIFSVHGYLIHRQIVNPGKILKIRVRGTKQDLTQD  61

Query  561  ASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV--NRYMEDSGDSFGRLPY  734
             S EEVC+VMPG +ARFEGS I+++LRRWFQE  S+ WDQ    +   EDSG+S   LPY
Sbjct  62   TSPEEVCIVMPGVIARFEGSGIKNLLRRWFQETDSKFWDQEFYDDANSEDSGNSATSLPY  121

Query  735  QLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            QLWNV+KYGLC DAAI GVMPPPLME Q
Sbjct  122  QLWNVSKYGLCADAAITGVMPPPLMEIQ  149



>ref|XP_008463739.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Cucumis melo]
Length=411

 Score =   359 bits (922),  Expect(2) = 4e-154, Method: Compositional matrix adjust.
 Identities = 185/234 (79%), Positives = 208/234 (89%), Gaps = 4/234 (2%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSS+RY+CAVTVG+DAVISA+RLS DKSRS+VGAILSKVVPATFSTI+S SKM+WRSEP 
Sbjct  180   QSSERYFCAVTVGEDAVISAFRLSEDKSRSLVGAILSKVVPATFSTIASFSKMIWRSEPK  239

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
              + KP+ K Q FA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  240   TSKKPDAKGQAFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  299

Query  1196  RLWKGYRDASCLFMEMLVNKD--SSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRT  1369
             RLWKGYRDA+CLFMEMLVN+D  SS+  S  +E  K+DYCLCLAIHAPRKGIVEIWQMRT
Sbjct  300   RLWKGYRDANCLFMEMLVNRDTASSSSNSMDYEPAKNDYCLCLAIHAPRKGIVEIWQMRT  359

Query  1370  GPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSL  1531
             G RL+TI C KGSK+LQP+ RF SS   +S Y+PLEVF LNGDSGQ+SVLNR+L
Sbjct  360   GRRLRTIRCSKGSKLLQPSSRFGSS--MVSPYVPLEVFLLNGDSGQISVLNRTL  411


 Score =   215 bits (548),  Expect(2) = 4e-154, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 143/226 (63%), Gaps = 48/226 (21%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MARR+  TTELGCIAC+DL+D GAGKEGWLV+NPNLL ALD+HSLALA+RSIILVL W+ 
Sbjct  1    MARRT-FTTELGCIACEDLADFGAGKEGWLVDNPNLLCALDSHSLALANRSIILVLGWSG  59

Query  327  AGDPPAKIIP-ELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVN  503
            +     KI P +LSPI+AEY+SAL WLV D+IKV+ VGTS GY LIYSL GDLI K    
Sbjct  60   SDGYRLKIRPSDLSPIEAEYISALEWLVLDEIKVILVGTSCGYFLIYSLSGDLILK----  115

Query  504  PAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD-Q  680
                                                     Q+ L++WFQE  ++ WD +
Sbjct  116  -----------------------------------------QNTLQKWFQESNARFWDPK  134

Query  681  PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
               + M DS +S  +L YQ+WNV+KYG C DAAI GVMPPPLME Q
Sbjct  135  SQQQDMNDSENSVEKLAYQVWNVSKYGACADAAITGVMPPPLMELQ  180



>gb|KDO47004.1| hypothetical protein CISIN_1g012917mg [Citrus sinensis]
Length=414

 Score =   300 bits (767),  Expect(2) = 8e-153, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 178/225 (79%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M++R+ HTTE+G IAC DLSDLGAGKEGWLV +PNLL ALD H++ALA+R   +++ W D
Sbjct  1    MSKRT-HTTEVGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWAD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
                 AKI PELSPI +EY++A+ WLVF++++ LAVGTS GY L+Y L+GDL+H+Q ++P
Sbjct  60   PEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ-P  683
             +ILKLRVRG++RD  QD + EEVCVVMPG +ARF+GS+IQ ML+RWFQ+  S  WDQ P
Sbjct  120  GRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKP  179

Query  684  VNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
              R  ED  +S+ RLP+QLWNV+KYG C DAAI G+MPPPLME Q
Sbjct  180  KQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQ  224


 Score =   270 bits (691),  Expect(2) = 8e-153, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 157/172 (91%), Gaps = 2/172 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRY+CAVT+G+D+VISA+RLS D+SRS+VGAILSKVVPATFSTISS+SKM+WRSE +
Sbjct  224   QSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQS  283

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P        Q FA+ASPLTCLKD+PRKGE+LTLSPSG+LAAITDSLGRILLLDTQALVVV
Sbjct  284   PKKSEPKP-QSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVV  342

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVE  1351
             RLWKGYRDASC+FMEMLVNKD++T  SA++  +KSDYCLCLAIHAPRKGI+E
Sbjct  343   RLWKGYRDASCVFMEMLVNKDAAT-SSAYYAPVKSDYCLCLAIHAPRKGIIE  393



>ref|XP_010924605.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Elaeis guineensis]
Length=458

 Score =   347 bits (889),  Expect(2) = 7e-152, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 200/233 (86%), Gaps = 4/233 (2%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYY AVT+G+DAVISAYRLS D+SRS+VGAILSKVVPATFST++S SKM+WRSE T
Sbjct  230   QSSQRYYRAVTIGEDAVISAYRLSEDRSRSLVGAILSKVVPATFSTLASFSKMIWRSEQT  289

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                KP  KPQPFAKASPLTCLKD PRKGEKLTLSP GTLAAITDSLGRILLLDTQALV V
Sbjct  290   SPKKPSIKPQPFAKASPLTCLKDPPRKGEKLTLSPGGTLAAITDSLGRILLLDTQALVAV  349

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDA CLF+E+ VN+D ++  SA + + KSDYCLCLAIHAPRKGI+EIW+MRTGP
Sbjct  350   RLWKGYRDACCLFIEIPVNRDKAS-SSAFYGYTKSDYCLCLAIHAPRKGIIEIWKMRTGP  408

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             R+ TI CPKGSKILQP+ RF SS    SSY PLEVF LNGDSGQLSVLN S  
Sbjct  409   RVLTIQCPKGSKILQPSTRFVSST---SSYTPLEVFLLNGDSGQLSVLNGSFG  458


 Score =   220 bits (561),  Expect(2) = 7e-152, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 165/234 (71%), Gaps = 14/234 (6%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAG-KEGWLVENPNLLTALDTHSLALA--SRSIILVLQ  317
            MARRS H T   CIACDDL +LGAG +EGWL ++P+LL AL   +LALA  +RS++LVL 
Sbjct  1    MARRS-HLTHRWCIACDDLEELGAGEREGWL-DDPSLLAALHPDALALAHSARSVVLVLG  58

Query  318  WTDAGDP-----PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDL  482
            W    DP     P KI P L+     ++SA+ WL F D+  LA+GTS+G L +YSL GDL
Sbjct  59   WDRDPDPSSPRQPLKIRPSLAADDG-HISAIEWLPFGDLLALALGTSAGLLFVYSLTGDL  117

Query  483  IHKQFVNPAKILKLRVRGTKRDQMQDASLE-EVCVVMPGAVARFEGSDIQSMLRRWFQER  659
            IHKQ ++P ++L+LR R TK D  QD+    E+CVV PG +ARF+GSDIQS+L+RWFQE 
Sbjct  118  IHKQIIHPGRVLRLRFRETKVDSSQDSVSSMELCVVFPGVIARFDGSDIQSLLQRWFQEE  177

Query  660  YSQLWDQPV-NRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             S++ +    NR +ED  +S+ R+ +QLWNVNK+G C DAAI G+MPPPL+E Q
Sbjct  178  GSRIMENRFQNRDIEDE-NSYARIRFQLWNVNKFGSCADAAITGLMPPPLLEVQ  230



>ref|XP_010489835.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like, 
partial [Camelina sativa]
Length=363

 Score =   311 bits (797),  Expect(2) = 2e-139, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 184/226 (81%), Gaps = 4/226 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R  H TELGCIAC++LS+LGAGKEGWLV NPNLL ALD+HSLALA+R++IL++ W D
Sbjct  1    MAKRI-HLTELGCIACEELSELGAGKEGWLVNNPNLLCALDSHSLALANRNLILIVNWGD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI P+LSPI+AE ++A+ WLVFDD++V+  GTS GYLL+YS+ GDLIHKQ V+P
Sbjct  60   PDAPRVKIRPDLSPIEAESITAIEWLVFDDVRVVVAGTSCGYLLVYSVAGDLIHKQMVHP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            ++ILK+RVRGTK+D +Q+ S EE+C VMPG +ARF+GS IQSML++WFQE+ S  WDQ  
Sbjct  120  SRILKIRVRGTKKDLIQETSAEEICFVMPGIIARFDGSHIQSMLQKWFQEKNSNFWDQK-  178

Query  687  NRY--MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            NR   +ED+G    RLPYQ+WNVNK G+CVDA + GVMPPPL+E Q
Sbjct  179  NRKGDVEDTGSLSQRLPYQIWNVNKNGVCVDATVTGVMPPPLLELQ  224


 Score =   214 bits (545),  Expect(2) = 2e-139, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+G+DAVISAYRLS D+ RS+VGAILSKVVPA  STI+S SK++WRS   
Sbjct  224   QSSQRYYCAVTIGEDAVISAYRLSEDRGRSLVGAILSKVVPAAASTIASFSKLIWRSNDQ  283

Query  1016  pttkp-epkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV  1192
                +  E K Q FA+AS LTC+KDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV
Sbjct  284   SPKRKPEAKTQSFARASSLTCIKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVV  343

Query  1193  VRLWKGYRDASCLFMEML  1246
             VRLWKGYRDASC+FMEML
Sbjct  344   VRLWKGYRDASCVFMEML  361



>gb|KHN35889.1| Rab3 GTPase-activating protein non-catalytic subunit [Glycine 
soja]
Length=341

 Score =   370 bits (949),  Expect(2) = 5e-136, Method: Compositional matrix adjust.
 Identities = 186/233 (80%), Positives = 210/233 (90%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAV VG+DAVISAYRLS +K RS+VGAILSKVVPATFSTISS SK++WRSE +
Sbjct  110   QSSQRYYCAVAVGEDAVISAYRLSENKGRSLVGAILSKVVPATFSTISSFSKLIWRSEQS  169

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                K + KPQPFA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  170   SPKKSDQKPQPFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  229

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLFMEMLVNKD ++  S++ E +KSDYCLCLAIHAPRKGI+EIWQMRTGP
Sbjct  230   RLWKGYRDASCLFMEMLVNKDIASSSSSYSEPLKSDYCLCLAIHAPRKGIIEIWQMRTGP  289

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL+TI C KGSK+LQP+YRF +S +  S Y+PLEVF LNGDSGQ+SVLNR+L+
Sbjct  290   RLRTISCAKGSKMLQPSYRFGASMS--SPYVPLEVFLLNGDSGQISVLNRTLD  340


 Score =   144 bits (364),  Expect(2) = 5e-136, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = +3

Query  495  FVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLW  674
             + P+++LKLRVRGTK+D +QD S EE C++M G +A F+GSDIQ+ML++WF+E +S+ W
Sbjct  1    MIYPSRVLKLRVRGTKKDLIQDTSSEEFCLIMSGVIAHFDGSDIQNMLQKWFEESHSRFW  60

Query  675  DQ-PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            DQ P +   ED G++  ++PYQLWN+ KYG C +AAI G+MPPPLME Q
Sbjct  61   DQNPKSHDSEDFGNTDVKIPYQLWNIGKYGTCAEAAITGIMPPPLMEQQ  109



>gb|KEH19570.1| Rab3 GTPase-activating protein non-catalytic subunit [Medicago 
truncatula]
Length=346

 Score =   368 bits (945),  Expect(2) = 6e-134, Method: Compositional matrix adjust.
 Identities = 188/237 (79%), Positives = 209/237 (88%), Gaps = 6/237 (3%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAV VGDDAVISAYRLS DK RS+VGAILSKVVPATFSTI+S SK++WRSE T
Sbjct  111   QSSQRYYCAVAVGDDAVISAYRLSEDKGRSLVGAILSKVVPATFSTIASFSKLIWRSEHT  170

Query  1016  pttkp----epkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQA  1183
                K     E KPQPFA+ASPLTC+KD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQA
Sbjct  171   SPVKSPKKLEQKPQPFARASPLTCIKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQA  230

Query  1184  LVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQM  1363
             LVVVRLWKGYRDASCLFMEMLVNKD ++  S  +E +KSDYCLCLAIHAPRKGI+EIWQM
Sbjct  231   LVVVRLWKGYRDASCLFMEMLVNKDLASSSSTCYESMKSDYCLCLAIHAPRKGIIEIWQM  290

Query  1364  RTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RTGPRL+TI C KGSK+LQP+YRF +S +  S Y+PLEVF LNGDSGQ+SVLNR+L+
Sbjct  291   RTGPRLRTISCAKGSKMLQPSYRFGASMS--SPYVPLEVFLLNGDSGQISVLNRTLD  345


 Score =   139 bits (349),  Expect(2) = 6e-134, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 85/111 (77%), Gaps = 3/111 (3%)
 Frame = +3

Query  495  FVNPAKILKLRVRGTKRDQMQD--ASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQ  668
             + P ++LKLRVRGTK+D +QD  +S EE C++MPG +ARF+GS +Q+ML++WF+E ++Q
Sbjct  1    MIYPGRVLKLRVRGTKKDLIQDNSSSSEEFCLIMPGVIARFDGSVVQNMLQKWFEEAHAQ  60

Query  669  LWDQPVN-RYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            LW+Q    +  ED  +S  +LPYQLWN+ KYG C DAAI G+MPPPLME Q
Sbjct  61   LWNQKQKGQDSEDFDNSQQKLPYQLWNIGKYGTCADAAITGIMPPPLMEQQ  111



>ref|XP_006442493.1| hypothetical protein CICLE_v10021305mg [Citrus clementina]
 gb|ESR55733.1| hypothetical protein CICLE_v10021305mg [Citrus clementina]
Length=254

 Score =   402 bits (1032),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 199/257 (77%), Positives = 231/257 (90%), Gaps = 3/257 (1%)
 Frame = +2

Query  764   VCRCCHHWCDAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAIL  943
             +CRC ++W +A +++G++AAFIVGQSSQRY+CAVT+G+DAVISA+RLS D+SRS+VGAIL
Sbjct  1     MCRCSNYWSNASTTDGSAAAFIVGQSSQRYFCAVTIGEDAVISAFRLSEDRSRSLVGAIL  60

Query  944   SKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPS  1123
             SKVVPATFSTISS+SKM+WRSE +P        Q FA+ASPLTCLKD+PRKGE+LTLSPS
Sbjct  61    SKVVPATFSTISSLSKMIWRSEQSPKKSEPKP-QSFARASPLTCLKDHPRKGERLTLSPS  119

Query  1124  GTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSD  1303
             G+LAAITDSLGRILLLDTQALVVVRLWKGYRDASC+FMEMLVNKD++T  SA++  +KSD
Sbjct  120   GSLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLVNKDAAT-SSAYYAPVKSD  178

Query  1304  YCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVF  1483
             YCLCLAIHAPRKGI+E+WQMRTGPRL TI C KGSKILQPTYRF SS AS S Y+PLEVF
Sbjct  179   YCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKILQPTYRFGSSMAS-SPYVPLEVF  237

Query  1484  FLNGDSGQLSVLNRSLN  1534
              LNGDSGQLSVLNRSL+
Sbjct  238   LLNGDSGQLSVLNRSLS  254



>ref|NP_001062848.1| Os09g0315800 [Oryza sativa Japonica Group]
 dbj|BAD36414.1| rab3-GAP regulatory domain-like [Oryza sativa Japonica Group]
 dbj|BAF24762.1| Os09g0315800 [Oryza sativa Japonica Group]
 gb|EEC84331.1| hypothetical protein OsI_30840 [Oryza sativa Indica Group]
 gb|EEE69440.1| hypothetical protein OsJ_28835 [Oryza sativa Japonica Group]
Length=469

 Score =   348 bits (892),  Expect(2) = 7e-133, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 203/233 (87%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQR+YCA+TVG+DAV+SAYRLS D+SRSIVGAILS+ V ATFSTISS+SK++WRSEP+
Sbjct  239   QSSQRHYCAITVGEDAVVSAYRLSEDRSRSIVGAILSRGVAATFSTISSLSKIIWRSEPS  298

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             PT K  PKPQ FAK SPLTCLKD PRKGE+LTLSPSGTLAAITDSLGRILLLDT ALV V
Sbjct  299   PTKKSRPKPQSFAKTSPLTCLKDSPRKGERLTLSPSGTLAAITDSLGRILLLDTHALVAV  358

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLF+EML+NKD ++  S H E+ KSDYCLCLAIHAPRKGI+EIWQMRTG 
Sbjct  359   RLWKGYRDASCLFVEMLLNKDKAS-SSLHTEYTKSDYCLCLAIHAPRKGIIEIWQMRTGA  417

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TIPCPKGS+ILQP+ RF SS  S S Y PLEV+  NGDSGQLSVLNR + 
Sbjct  418   RLLTIPCPKGSRILQPSTRFMSSPFS-SLYSPLEVYLFNGDSGQLSVLNRHIG  469


 Score =   156 bits (394),  Expect(2) = 7e-133, Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 139/241 (58%), Gaps = 19/241 (8%)
 Frame = +3

Query  147  MARRSSH----TTELGCIACDDLSDLGAG-KEGWLVENPNLLTAL---DTHSLALASRSI  302
            MARR  H       L   A +DL+ +GAG +EGWL ++P +L +L          ++   
Sbjct  1    MARRGHHHHLAEVALLASASEDLAAVGAGEREGWL-DDPAVLPSLAPRARALAVASAARS  59

Query  303  ILVLQWTDAGDPPAKIIPELSPIQAEYLSALAW--LVFDDIK-------VLAVGTSSGYL  455
            +L +           + P L P     +SA+ W  LV +D +        +AVGT +G+L
Sbjct  60   VLAVVPVAGVGGGVTVRPALGPDDGR-ISAVEWVPLVGEDAEEAGGEGVAVAVGTDAGWL  118

Query  456  LIYSLRGDLIHKQFVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSM  635
            L YSL GDL+HKQ + P+KILKL  R  K +  +D+  +E+ VV PG +ARF+G+D+Q+M
Sbjct  119  LFYSLAGDLLHKQSIYPSKILKLNFRERKENAWEDSGSDELSVVFPGVIARFDGADLQNM  178

Query  636  LRRWFQERYSQLWDQPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEH  815
            L++   E  S LW     +   +   SFGR+P+Q+WNV+K+  C DAAI+G+MPPPL+E 
Sbjct  179  LQKSLHEVKSHLWKDKSEQEDAEEDSSFGRIPFQIWNVSKFSSCADAAIVGLMPPPLLEL  238

Query  816  Q  818
            Q
Sbjct  239  Q  239



>gb|KHN07794.1| Rab3 GTPase-activating protein non-catalytic subunit [Glycine 
soja]
Length=341

 Score =   363 bits (931),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 182/233 (78%), Positives = 209/233 (90%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QS+QRYYCAV VG+DAVISAYRLS +K RS+VGAILSKVVPATFSTISS SK++WR+E +
Sbjct  110   QSNQRYYCAVAVGEDAVISAYRLSENKGRSLVGAILSKVVPATFSTISSFSKLIWRNERS  169

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
                K + KP+PFA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  170   SPKKSDLKPRPFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  229

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLFMEMLVNKD ++  S++ E +KSDYCLCLAIHAPRKGI+EIWQMRTG 
Sbjct  230   RLWKGYRDASCLFMEMLVNKDIASSSSSYSEPLKSDYCLCLAIHAPRKGIIEIWQMRTGQ  289

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL+TI C KGSK+LQP+YRF +S +  S Y+PLEVF LNGDSGQ+SVLNR+L+
Sbjct  290   RLRTISCTKGSKMLQPSYRFGASVS--SPYVPLEVFLLNGDSGQISVLNRTLD  340


 Score =   138 bits (348),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 83/109 (76%), Gaps = 1/109 (1%)
 Frame = +3

Query  495  FVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLW  674
             + P ++LKLRVRGTK+D +QD S EE C++M G +ARF+GSDIQ+ML++WF+E  S+  
Sbjct  1    MIYPERVLKLRVRGTKKDLIQDTSSEEFCLIMSGVIARFDGSDIQNMLQKWFEEANSRFS  60

Query  675  DQ-PVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            DQ P ++  ED  ++  ++PYQLWN+ KYG C DAAI G+MPPPLME Q
Sbjct  61   DQNPKSQDSEDFENTDVKIPYQLWNIGKYGTCADAAITGIMPPPLMEQQ  109



>ref|XP_008651073.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA61016.1| TPA: hypothetical protein ZEAMMB73_415761 [Zea mays]
Length=468

 Score =   338 bits (867),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 177/233 (76%), Positives = 202/233 (87%), Gaps = 1/233 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQR+YCA+TVG+DAV+SAYRLS D++RSIVGAILS+ V ATFSTISS+SK+LWRSEP+
Sbjct  237   QSSQRHYCAITVGEDAVVSAYRLSEDRTRSIVGAILSRGVAATFSTISSLSKILWRSEPS  296

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P  K  PKPQ FAK SPLTCLKD PRKGE+LTLSPSGTLAAITDSLGRILLLDT ALV V
Sbjct  297   PPKKSRPKPQSFAKTSPLTCLKDSPRKGERLTLSPSGTLAAITDSLGRILLLDTHALVAV  356

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLF+EML+NKD ++  S H E+ KSDYCLCLAIHAPRKGI+E+W+MRTG 
Sbjct  357   RLWKGYRDASCLFVEMLLNKDKASSGSMHIEYTKSDYCLCLAIHAPRKGIIEVWKMRTGS  416

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TIPCPKGS+ILQP+ R S+S +   SY PLEV+  NGDSGQLSVLNR + 
Sbjct  417   RLLTIPCPKGSRILQPSARLSTS-SFSPSYSPLEVYLFNGDSGQLSVLNRHIG  468


 Score =   160 bits (405),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 135/211 (64%), Gaps = 14/211 (7%)
 Frame = +3

Query  222  KEGWLVENPNLLTALD--THSLALAS--RSIILVLQWTDAGDPPAKIIPELSPIQAEYLS  389
            +EGWL ++P +L +L     SLA+AS   S+++++     G     + P L P +   +S
Sbjct  29   REGWL-DDPAILPSLGPRARSLAVASAAHSVLVIVAVAGGGGGGVTVEPALGPDEGR-IS  86

Query  390  ALAWLVF---DDIK-----VLAVGTSSGYLLIYSLRGDLIHKQFVNPAKILKLRVRGTKR  545
            A+ W+ F   DD +      + +GT +G+LL YSL GDL+HKQ + PAKILKL  R  K 
Sbjct  87   AVEWVPFAGEDDAEGEEGVSVVIGTDAGWLLFYSLAGDLLHKQSIYPAKILKLNFRERKE  146

Query  546  DQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPVNRYMEDSGDSFGR  725
            +  +D+  +E+ VV PG +ARF+G+D+Q++L++ FQ+  S+LW         +  ++FGR
Sbjct  147  NAWEDSGSDELSVVFPGVIARFDGADLQNVLKKAFQDVKSRLWKDKFEEQDAEDEETFGR  206

Query  726  LPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            +P+Q+WNVNK+  C DAAI+G+MPPPL+E Q
Sbjct  207  IPFQIWNVNKFSSCADAAIVGLMPPPLLELQ  237



>ref|XP_003577981.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Brachypodium distachyon]
Length=464

 Score =   341 bits (875),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/233 (77%), Positives = 201/233 (86%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQR+YCA+TVG+DAV+SAYRLS D+SRS+VGAILS+ V ATFSTISS+SK+LWRSEP+
Sbjct  234   QSSQRHYCAITVGEDAVVSAYRLSEDRSRSLVGAILSRGVAATFSTISSLSKILWRSEPS  293

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             PT K  PKPQ FAK SPLTCLKD PRKGE+LTLSPSGTLAAITDSLGRILLLDT+ALV V
Sbjct  294   PTKKSRPKPQSFAKTSPLTCLKDTPRKGERLTLSPSGTLAAITDSLGRILLLDTRALVAV  353

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLF+EML+NKD  +  S H EH K DYCLCLAIHAPRKGI+E+WQMRTGP
Sbjct  354   RLWKGYRDASCLFVEMLLNKDKESSSSMHLEHTKGDYCLCLAIHAPRKGIIEVWQMRTGP  413

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TIPCPKGS+ILQP+     S +  SSY PLEV+  NGDSGQLSVLNR + 
Sbjct  414   RLLTIPCPKGSRILQPST--RFSSSQFSSYSPLEVYLFNGDSGQLSVLNRHIG  464


 Score =   154 bits (390),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 138/237 (58%), Gaps = 16/237 (7%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDD--LSDLGAG-KEGWLVENPNLLTALD---THSLALASRSIIL  308
            MARR  H TE+  +A     L+  GAG +EGW+ ++P +  +L          ++   +L
Sbjct  1    MARRGHHLTEVALLASASGYLAAAGAGEREGWM-DDPAVFPSLGPRARALAMASAARSVL  59

Query  309  VLQWTDAGDPPAKIIPELSPIQAEYLSALAWLVF-------DDIKVLAVGTSSGYLLIYS  467
            V+    AG     + P L P +   +SA+ W+         D+   +AVGT +G+LL Y+
Sbjct  60   VIV-PIAGGGGVTVKPALGPDEGR-ISAVEWVPLAGDEAGGDEGVAVAVGTDAGWLLFYT  117

Query  468  LRGDLIHKQFVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRW  647
            L GDL+HKQ + PAKILKL     K +  +D+  +E+ VV PG +A  +G D+Q+ML++ 
Sbjct  118  LAGDLLHKQSIYPAKILKLNFSERKENAWEDSGSDELSVVFPGVIAHCDGDDLQTMLQKS  177

Query  648  FQERYSQLWDQPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            F+E  S++W         D   SFGR+P ++WNV+K+G C DAAI+G+MPPPL+E Q
Sbjct  178  FEEVKSRMWKDKFEHEDADDESSFGRIPIRIWNVSKFGSCADAAIVGLMPPPLLELQ  234



>ref|XP_002462180.1| hypothetical protein SORBIDRAFT_02g021130 [Sorghum bicolor]
 gb|EER98701.1| hypothetical protein SORBIDRAFT_02g021130 [Sorghum bicolor]
Length=468

 Score =   342 bits (876),  Expect(2) = 4e-129, Method: Compositional matrix adjust.
 Identities = 178/233 (76%), Positives = 204/233 (88%), Gaps = 1/233 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQR+YCA+TVG+DAV+SAYRLS D+SRSIVGAILS+ V ATFSTISS+S++LWRSEP+
Sbjct  237   QSSQRHYCAITVGEDAVVSAYRLSEDRSRSIVGAILSRGVAATFSTISSLSRILWRSEPS  296

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P  K  PKPQ FAK SPLTCLKD PRKGE+LTLSPSGTLAAITDSLGRILLLDTQALV V
Sbjct  297   PPKKSRPKPQSFAKTSPLTCLKDSPRKGERLTLSPSGTLAAITDSLGRILLLDTQALVAV  356

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLF+EML+NKD + L+S H E+ KSDYCLCLAIHAPRKGI+E+W+MRTG 
Sbjct  357   RLWKGYRDASCLFVEMLLNKDKALLRSMHIEYTKSDYCLCLAIHAPRKGIIEVWKMRTGS  416

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             R+ TIPCPKGS+ILQP+ R S+  +  SSY PLEV+  NGDSGQLSVLNR + 
Sbjct  417   RVLTIPCPKGSRILQPSARLSTQ-SFSSSYSPLEVYLFNGDSGQLSVLNRHIG  468


 Score =   149 bits (377),  Expect(2) = 4e-129, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 107/163 (66%), Gaps = 9/163 (6%)
 Frame = +3

Query  354  PELSPIQAEYLSALAWLVF--------DDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNPA  509
            P L P +   +SA+ W+          D+   +AVGT +G+LL YSL GDL+HKQ + PA
Sbjct  76   PALGPDEGR-ISAVEWVPLAGEDDADGDEGVAVAVGTDAGWLLFYSLAGDLLHKQSIYPA  134

Query  510  KILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPVN  689
            KILKL  R  K +  +D+  +E+  V PG +ARF+G+D+QS+L++ FQ+  S+LW     
Sbjct  135  KILKLNFRERKENAWEDSGSDELSAVFPGVIARFDGADLQSILKKTFQDVKSRLWKDKFE  194

Query  690  RYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
                +  ++FGR+P+Q+WNV+K+  C DAAI+G+MPPPL+E Q
Sbjct  195  EQDAEDEETFGRIPFQIWNVSKFSSCADAAIVGLMPPPLLELQ  237



>ref|XP_004956561.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Setaria italica]
Length=465

 Score =   343 bits (879),  Expect(2) = 5e-129, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 198/229 (86%), Gaps = 4/229 (2%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQR+YCA+TVG+DAV+SAYRLS D+ RSIVGAILS+ V ATFSTISS+SK+LWRSEP+
Sbjct  237   QSSQRHYCAITVGEDAVVSAYRLSEDRGRSIVGAILSRGVAATFSTISSLSKILWRSEPS  296

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P  K  PKPQ FAK SPLTCLKD PRKGE+LTLSPSGTLAAITDSLGRILLLDT ALV V
Sbjct  297   PPKKSRPKPQSFAKTSPLTCLKDSPRKGERLTLSPSGTLAAITDSLGRILLLDTHALVAV  356

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLF+EML+NKD ++  S H E+ KSDYCLCLAIHAPRKGI+E+W+MRTG 
Sbjct  357   RLWKGYRDASCLFVEMLLNKDKASSSSMHIEYTKSDYCLCLAIHAPRKGIIEVWKMRTGS  416

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLN  1522
             RL TIPCPKGS+ILQP+ R SS+     SY PLEV+  NGDSGQLSVLN
Sbjct  417   RLLTIPCPKGSRILQPSARLSST----YSYTPLEVYLFNGDSGQLSVLN  461


 Score =   148 bits (373),  Expect(2) = 5e-129, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 98/133 (74%), Gaps = 4/133 (3%)
 Frame = +3

Query  426  LAVGTSSGYLLIYSLRGDLIHKQFVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVA  605
            +A+GT +G+LL YSL GDL+HKQ + PAKILKL  R  K +  +D+   E+ VV PG +A
Sbjct  107  VAIGTDTGWLLFYSLAGDLLHKQSIYPAKILKLNFRERKENAWEDSGSNELSVVFPGVIA  166

Query  606  RFEGSDIQSMLRRWFQERYSQLWDQPVNRYMEDSGD--SFGRLPYQLWNVNKYGLCVDAA  779
            RF+G+D+QS+L++ FQ+  S+LW        ED+ D  SFGR+P+++WNV+K+G C DAA
Sbjct  167  RFDGADLQSILQKSFQDVKSRLWKDKFEE--EDASDEGSFGRIPFRIWNVSKFGSCADAA  224

Query  780  IIGVMPPPLMEHQ  818
            I+G+MPPPL+E Q
Sbjct  225  IVGLMPPPLLELQ  237



>gb|KDO47005.1| hypothetical protein CISIN_1g012917mg [Citrus sinensis]
 gb|KDO47006.1| hypothetical protein CISIN_1g012917mg [Citrus sinensis]
Length=374

 Score =   299 bits (765),  Expect(2) = 6e-129, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 178/225 (79%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M++R+ HTTE+G IAC DLSDLGAGKEGWLV +PNLL ALD H++ALA+R   +++ W D
Sbjct  1    MSKRT-HTTEVGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWAD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
                 AKI PELSPI +EY++A+ WLVF++++ LAVGTS GY L+Y L+GDL+H+Q ++P
Sbjct  60   PEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ-P  683
             +ILKLRVRG++RD  QD + EEVCVVMPG +ARF+GS+IQ ML+RWFQ+  S  WDQ P
Sbjct  120  GRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKP  179

Query  684  VNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
              R  ED  +S+ RLP+QLWNV+KYG C DAAI G+MPPPLME Q
Sbjct  180  KQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQ  224


 Score =   192 bits (487),  Expect(2) = 6e-129, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 118/139 (85%), Gaps = 6/139 (4%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRY+CAVT+G+D+VISA+RLS D+SRS+VGAILSKVVPATFSTISS+SKM+WRSE +
Sbjct  224   QSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQS  283

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P        Q FA+ASPLTCLKD+PRKGE+LTLSPSG+LAAITDSLGRILLLDTQALVVV
Sbjct  284   PKKSEPKP-QSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVV  342

Query  1196  RLWK-----GYRDASCLFM  1237
             RLWK      Y    C+F+
Sbjct  343   RLWKVFCELPYISLFCMFL  361



>ref|XP_006442491.1| hypothetical protein CICLE_v10021305mg [Citrus clementina]
 ref|XP_006442492.1| hypothetical protein CICLE_v10021305mg [Citrus clementina]
 gb|ESR55731.1| hypothetical protein CICLE_v10021305mg [Citrus clementina]
 gb|ESR55732.1| hypothetical protein CICLE_v10021305mg [Citrus clementina]
Length=307

 Score =   370 bits (951),  Expect(2) = 8e-126, Method: Compositional matrix adjust.
 Identities = 187/233 (80%), Positives = 210/233 (90%), Gaps = 3/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRY+CAVT+G+DAVISA+RLS D+SRS+VGAILSKVVPATFSTISS+SKM+WRSE +
Sbjct  78    QSSQRYFCAVTIGEDAVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQS  137

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P        Q FA+ASPLTCLKD+PRKGE+LTLSPSG+LAAITDSLGRILLLDTQALVVV
Sbjct  138   PKKSEPKP-QSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVV  196

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASC+FMEMLVNKD++T  SA++  +KSDYCLCLAIHAPRKGI+E+WQMRTGP
Sbjct  197   RLWKGYRDASCVFMEMLVNKDAAT-SSAYYAPVKSDYCLCLAIHAPRKGIIEVWQMRTGP  255

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TI C KGSKILQPTYRF SS AS S Y+PLEVF LNGDSGQLSVLNRSL+
Sbjct  256   RLLTIQCAKGSKILQPTYRFGSSMAS-SPYVPLEVFLLNGDSGQLSVLNRSLS  307


 Score =   110 bits (274),  Expect(2) = 8e-126, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +3

Query  588  MPGAVARFEGSDIQSMLRRWFQERYSQLWDQ-PVNRYMEDSGDSFGRLPYQLWNVNKYGL  764
            MPG +ARF+GS+IQ ML+RWFQ+  S  WDQ P  R  ED  +S+ RLP+QLWNV+KYG 
Sbjct  1    MPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGP  60

Query  765  CVDAAIIGVMPPPLMEHQ  818
            C DAAI G+MPPPLME Q
Sbjct  61   CADAAITGLMPPPLMEVQ  78



>gb|KDO47010.1| hypothetical protein CISIN_1g012917mg [Citrus sinensis]
 gb|KDO47011.1| hypothetical protein CISIN_1g012917mg [Citrus sinensis]
Length=307

 Score =   369 bits (947),  Expect(2) = 2e-125, Method: Compositional matrix adjust.
 Identities = 186/233 (80%), Positives = 210/233 (90%), Gaps = 3/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRY+CAVT+G+D+VISA+RLS D+SRS+VGAILSKVVPATFSTISS+SKM+WRSE +
Sbjct  78    QSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRSEQS  137

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P        Q FA+ASPLTCLKD+PRKGE+LTLSPSG+LAAITDSLGRILLLDTQALVVV
Sbjct  138   PKKSEPKP-QSFARASPLTCLKDHPRKGERLTLSPSGSLAAITDSLGRILLLDTQALVVV  196

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASC+FMEMLVNKD++T  SA++  +KSDYCLCLAIHAPRKGI+E+WQMRTGP
Sbjct  197   RLWKGYRDASCVFMEMLVNKDAAT-SSAYYAPVKSDYCLCLAIHAPRKGIIEVWQMRTGP  255

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TI C KGSKILQPTYRF SS AS S Y+PLEVF LNGDSGQLSVLNRSL+
Sbjct  256   RLLTIQCAKGSKILQPTYRFGSSMAS-SPYVPLEVFLLNGDSGQLSVLNRSLS  307


 Score =   110 bits (274),  Expect(2) = 2e-125, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +3

Query  588  MPGAVARFEGSDIQSMLRRWFQERYSQLWDQ-PVNRYMEDSGDSFGRLPYQLWNVNKYGL  764
            MPG +ARF+GS+IQ ML+RWFQ+  S  WDQ P  R  ED  +S+ RLP+QLWNV+KYG 
Sbjct  1    MPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKPKQRDSEDLENSYERLPHQLWNVSKYGP  60

Query  765  CVDAAIIGVMPPPLMEHQ  818
            C DAAI G+MPPPLME Q
Sbjct  61   CADAAITGLMPPPLMEVQ  78



>ref|XP_006661112.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Oryza brachyantha]
Length=389

 Score =   338 bits (866),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/233 (77%), Positives = 201/233 (86%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQR+YCA+TVG+DAV+SAYRLS D+SRSIVGAILS+ V ATFSTISS+SK+LWRSEP+
Sbjct  159   QSSQRHYCAITVGEDAVVSAYRLSEDRSRSIVGAILSRGVAATFSTISSLSKILWRSEPS  218

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             PT K  PKPQ FAK SPLTCLKD PRKGE+LTLSPSGTLAAITDSLGRILLLDT ALV V
Sbjct  219   PTKKSRPKPQSFAKTSPLTCLKDSPRKGERLTLSPSGTLAAITDSLGRILLLDTHALVAV  278

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLF+EML+NKD ++  S H E+ K DYCLCLAIHAPRKGI+EIWQMRTG 
Sbjct  279   RLWKGYRDASCLFVEMLLNKDKAS-SSLHTEYTKGDYCLCLAIHAPRKGIIEIWQMRTGA  337

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TIPCPKGS+ILQP+ RF+SS  S S    LEV+  NGDSGQLSVLNR + 
Sbjct  338   RLLTIPCPKGSRILQPSTRFTSSPFSSSYSP-LEVYLFNGDSGQLSVLNRHIG  389


 Score =   137 bits (346),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 88/127 (69%), Gaps = 0/127 (0%)
 Frame = +3

Query  438  TSSGYLLIYSLRGDLIHKQFVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEG  617
            T +G+LL YSL GDL+HKQ + PAKILKL  R  K +  +D+  +E+ VV PG +ARF+G
Sbjct  33   TDAGWLLFYSLAGDLLHKQSIYPAKILKLNFRERKENAWEDSGSDELSVVFPGVIARFDG  92

Query  618  SDIQSMLRRWFQERYSQLWDQPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMP  797
            +D+Q+ML++ F E    +W     +   D   SFGR+P+Q+WNV+K+    DAAI+G+MP
Sbjct  93   ADLQNMLQKSFNEVKPHVWKDNSEQEDADDDSSFGRIPFQIWNVSKFSSSADAAIVGLMP  152

Query  798  PPLMEHQ  818
            PPL+E Q
Sbjct  153  PPLLELQ  159



>emb|CDP06015.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   382 bits (981),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 204/262 (78%), Positives = 224/262 (85%), Gaps = 5/262 (2%)
 Frame = +2

Query  752   QIWVVCRCCHHWC-DAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRSI  928
             Q+W V +  +  C DA  +       +  QSSQRYYCAVTVGDDAVISAYRLS D+SRSI
Sbjct  200   QLWNVSK--YGLCADAAITGIMPPPLMEPQSSQRYYCAVTVGDDAVISAYRLSEDRSRSI  257

Query  929   VGAILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTCLKDYPRKGEKL  1108
             VGAILSKVVPATFSTISSISKM+WRS+ T   + E   QP A+ASPLTCLKDYPRKGEKL
Sbjct  258   VGAILSKVVPATFSTISSISKMIWRSDTTTKKQEEKP-QPLARASPLTCLKDYPRKGEKL  316

Query  1109  TLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHHE  1288
             TLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLF+EMLV K+S+T+ SA ++
Sbjct  317   TLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFVEMLVKKNSATVGSAGYQ  376

Query  1289  HIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSYI  1468
             + KSDYCLCLAIHAPRKGIVE+WQMRTGPRL TIPC KGSKILQPTYRF SS +S SSY+
Sbjct  377   YEKSDYCLCLAIHAPRKGIVEVWQMRTGPRLLTIPCAKGSKILQPTYRFVSSISS-SSYV  435

Query  1469  PLEVFFLNGDSGQLSVLNRSLN  1534
             PLEVFFLNGDSGQLSVLN SLN
Sbjct  436   PLEVFFLNGDSGQLSVLNGSLN  457


 Score =   335 bits (860),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/228 (72%), Positives = 190/228 (83%), Gaps = 5/228 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M+RR  HTTELG IAC+DLS++GAGKEGWLV +P+LLTALDTHSLALA+RSI+LVL W+D
Sbjct  1    MSRRY-HTTELGSIACEDLSEVGAGKEGWLVSDPDLLTALDTHSLALANRSIVLVLHWSD  59

Query  327  AGDPPA---KIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQF  497
              DP +   KI+PELSPI AEY+SA+ WLVFDD++VLA+GTSSG+LLIYSL+GDLIHKQ 
Sbjct  60   DADPSSYRLKIVPELSPIAAEYISAIEWLVFDDVRVLAIGTSSGFLLIYSLQGDLIHKQL  119

Query  498  VNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWD  677
            VN AKI+KLRVRGT +D  +D S EEVCVVM   VARF+GSDIQSML RWF+ER    WD
Sbjct  120  VNNAKIIKLRVRGTNKDLSEDTSSEEVCVVMRATVARFDGSDIQSMLHRWFRERQLNFWD  179

Query  678  QP-VNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            Q  + R  E SG SFGRLPYQLWNV+KYGLC DAAI G+MPPPLME Q
Sbjct  180  QSYMRRDQEYSGASFGRLPYQLWNVSKYGLCADAAITGIMPPPLMEPQ  227



>ref|XP_007099620.1| Rab3 GTPase-activating protein non-catalytic subunit isoform 
2 [Theobroma cacao]
 gb|EOY20421.1| Rab3 GTPase-activating protein non-catalytic subunit isoform 
2 [Theobroma cacao]
Length=239

 Score =   359 bits (922),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 185/233 (79%), Positives = 204/233 (88%), Gaps = 2/233 (1%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QS+QRYYCAVT+GDDAVISA+RLS D++RS+VGAILSKVVPATFSTI+S SKM+WRSE T
Sbjct  9     QSNQRYYCAVTIGDDAVISAFRLSEDRNRSLVGAILSKVVPATFSTIASFSKMIWRSEQT  68

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P  K E KPQ FA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  69    PKRKSEEKPQSFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  128

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASC FMEMLVNK++    S+++E  KSDYCLCLAIHAPRKGIVE+WQMRTGP
Sbjct  129   RLWKGYRDASCFFMEMLVNKEAIGSGSSYYEPGKSDYCLCLAIHAPRKGIVEVWQMRTGP  188

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TI C KG ++LQPT RF SS    S Y+PLEV  LNGDSGQLSVLNR LN
Sbjct  189   RLLTIQCAKGCRLLQPTSRFGSSLD--SPYVPLEVVLLNGDSGQLSVLNRFLN  239



>ref|XP_008789377.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Phoenix dactylifera]
Length=456

 Score =   354 bits (909),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 190/264 (72%), Positives = 214/264 (81%), Gaps = 11/264 (4%)
 Frame = +2

Query  752   QIWVVCR---CCHHWCDAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSR  922
             Q+W V +   C     DA  +       + GQSSQ YYCAVT+G+DAVISAYRLS D+SR
Sbjct  201   QLWNVSKFGPCA----DAAITGLMPPPLLEGQSSQFYYCAVTIGEDAVISAYRLSEDRSR  256

Query  923   SIVGAILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTCLKDYPRKGE  1102
             S+VGAILSKVVPAT ST+SS SKM+W SE T T KP  KPQPFAKA PLTCLKD PRKGE
Sbjct  257   SLVGAILSKVVPATISTLSSFSKMIWWSEQTSTKKPHTKPQPFAKALPLTCLKDPPRKGE  316

Query  1103  KLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH  1282
             KLTLSP GTLAAITDSLGRILLLDT+ALVVVRLWKGYRDA CLFMEMLV++D ++  S +
Sbjct  317   KLTLSPGGTLAAITDSLGRILLLDTKALVVVRLWKGYRDACCLFMEMLVSRDKAS-SSTY  375

Query  1283  HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSS  1462
             HEH K+DYCLCLAIHAPRKGI+EIW+MRTGPR+  I CPKGSKILQP+ RF   E+S SS
Sbjct  376   HEHTKNDYCLCLAIHAPRKGIIEIWKMRTGPRVLAIQCPKGSKILQPSTRF---ESSTSS  432

Query  1463  YIPLEVFFLNGDSGQLSVLNRSLN  1534
             YIPLEVF LNGDSGQLSVL+ S+ 
Sbjct  433   YIPLEVFLLNGDSGQLSVLHGSIG  456


 Score =   214 bits (546),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 168/232 (72%), Gaps = 12/232 (5%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAG-KEGWLVENPNLLTALDTHSLALAS--RSIILVLQ  317
            MARRS H TE+GCIACD+L +LGAG +EGWL ++P+LL AL  H+LALA   RS++LVL 
Sbjct  1    MARRS-HLTEVGCIACDELEELGAGQREGWL-DDPSLLAALHPHALALAHAARSLVLVLS  58

Query  318  WTDAGDPP---AKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIH  488
            W      P    KI P L+     ++SAL WL F D+  LA+GTS+G LL+YS  GDL+H
Sbjct  59   WDPDPSSPRHSVKIRPSLATDDG-HISALEWLPFGDLLALALGTSAGLLLVYSRTGDLVH  117

Query  489  KQFVNPAKILKLRVRGTKRDQMQD-ASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYS  665
            KQ ++P +++++R R TK    QD A+ EE+CVV+PGA+ARF+GSDIQS LRRWFQE   
Sbjct  118  KQILHPGRVMRMRFRETKGVFSQDSAASEELCVVLPGAIARFDGSDIQSSLRRWFQEEGL  177

Query  666  QLWDQPV-NRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            ++W+    NR  ED  +S+ R+P+QLWNV+K+G C DAAI G+MPPPL+E Q
Sbjct  178  RVWENRFQNREAEDE-NSYRRIPFQLWNVSKFGPCADAAITGLMPPPLLEGQ  228



>gb|EMS54467.1| hypothetical protein TRIUR3_28411 [Triticum urartu]
Length=378

 Score =   350 bits (899),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 180/235 (77%), Positives = 205/235 (87%), Gaps = 2/235 (1%)
 Frame = +2

Query  830   VGQSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSe  1009
             +  SSQR+YCA+TVG+DAV+SAYRLS D+SRS+VGAILS+ V ATFSTISS+SK+LWRSE
Sbjct  146   IWNSSQRHYCAITVGEDAVVSAYRLSEDRSRSLVGAILSRGVAATFSTISSLSKILWRSE  205

Query  1010  ptpttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALV  1189
             P+PT K  PKPQ FAK SPLTCLKD PRKGE+LTLSPSGTLAAITDSLGRILLLDT+ALV
Sbjct  206   PSPTKKSRPKPQAFAKTSPLTCLKDSPRKGERLTLSPSGTLAAITDSLGRILLLDTRALV  265

Query  1190  VVRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRT  1369
              VRLWKGYRDASCLF+EML NKD ++  S H ++ KSDYCLCLAIHAPRKGI+E+WQMRT
Sbjct  266   AVRLWKGYRDASCLFVEMLRNKDKASSSSMHLDYTKSDYCLCLAIHAPRKGIIEVWQMRT  325

Query  1370  GPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             G RL TIPCPKGS+ILQP+ RFSSS  + SSY PLEV+  NGDSGQLSVLNR + 
Sbjct  326   GQRLLTIPCPKGSRILQPSTRFSSS--AFSSYTPLEVYLFNGDSGQLSVLNRHIG  378


 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 72/153 (47%), Gaps = 39/153 (25%)
 Frame = +3

Query  426  LAVGTSSGYLLIYSLRGDLIHKQFVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVA  605
            L  GT +G+LL YSL GDL+HKQ + PAKILKL     K +  +DA  +E+ VV PG +A
Sbjct  3    LVAGTDAGWLLFYSLAGDLLHKQSIYPAKILKLNFSERKENAWEDAGSDELSVVFPGVIA  62

Query  606  RFEGSD---------------------------------------IQSMLRRWFQERYSQ  668
            R +G+D                                       +Q ML++ FQE  S+
Sbjct  63   RCDGADLQIFKVLHPIELYSAIGPMFNLASRFYHFACMLILVICFLQIMLQKSFQEVKSR  122

Query  669  LWDQPVNRYMEDSGDSFGRLPYQLWNVNKYGLC  767
            +W     +   +   SF ++P Q+WN ++   C
Sbjct  123  MWKDKFEQEDGEDTSSFEKIPLQIWNSSQRHYC  155



>ref|XP_009146308.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Brassica rapa]
Length=455

 Score =   352 bits (902),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 186/265 (70%), Positives = 210/265 (79%), Gaps = 10/265 (4%)
 Frame = +2

Query  752   QIWVVCR--CCHHWCDAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRS  925
             QIW V +   C    DA  +       +  QSSQRYYCAVT+G+DAVISAYRLS D+ RS
Sbjct  197   QIWNVNKNGVC---VDATITGIMPPPLLEHQSSQRYYCAVTIGEDAVISAYRLSEDRGRS  253

Query  926   IVGAILSKVVPATFSTISSISKMLWRSeptpttkp-epkpQPFAKASPLTCLKDYPRKGE  1102
             +VGAILSKVVPA  STI+S SK++WRS      +  E K Q FA+AS LTC+KDYPRKGE
Sbjct  254   LVGAILSKVVPAAASTIASFSKLIWRSNDQSPKRKPEAKTQSFARASSLTCIKDYPRKGE  313

Query  1103  KLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH  1282
             KLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC+FMEML  KD    KS +
Sbjct  314   KLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLAKKDKG--KSVY  371

Query  1283  H-EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLS  1459
             H E +KSDYCLCLAIHAPRKGI+E+WQMRTGPRL TI C KGSK+LQP YRF S+ +S S
Sbjct  372   HTEPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKLLQPAYRFGSNSSS-S  430

Query  1460  SYIPLEVFFLNGDSGQLSVLNRSLN  1534
              YIPLEVF LNGDSGQ+S+LNRSL+
Sbjct  431   PYIPLEVFLLNGDSGQVSMLNRSLS  455


 Score =   307 bits (786),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 182/225 (81%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R  H TELGCIAC++L++LGAGKEGWLV NPNL++ALD+HS+ALA R +IL++ W D
Sbjct  1    MAKRI-HLTELGCIACEELTELGAGKEGWLVNNPNLISALDSHSIALAHRFLILIVNWAD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
                  KI P+LSPI+AE ++A+ WLVFDD++V+  GTS GYLL+YS+ GDLIHKQ V+P
Sbjct  60   PDSLRVKIRPDLSPIEAESITAIEWLVFDDVRVVLAGTSCGYLLVYSIAGDLIHKQLVHP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            ++ILKLRVRGTK+D MQ+ S EE+ +V+PG +ARF+GS+IQSML++WFQE+ S  WDQ  
Sbjct  120  SRILKLRVRGTKKDLMQETSSEEISIVLPGIIARFDGSNIQSMLQKWFQEKNSNFWDQKS  179

Query  687  NRY-MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             +   ED+G    RLPYQ+WNVNK G+CVDA I G+MPPPL+EHQ
Sbjct  180  KKGDPEDTGSLHQRLPYQIWNVNKNGVCVDATITGIMPPPLLEHQ  224



>emb|CDX98514.1| BnaC05g38610D [Brassica napus]
Length=455

 Score =   350 bits (898),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 186/265 (70%), Positives = 209/265 (79%), Gaps = 10/265 (4%)
 Frame = +2

Query  752   QIWVVCR--CCHHWCDAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRS  925
             QIW V +   C    DA  +       +  QSSQRYYCAVT+G+DAVISAYRLS D+ RS
Sbjct  197   QIWNVNKNGVC---VDATITGIMPPPLLEHQSSQRYYCAVTIGEDAVISAYRLSEDRGRS  253

Query  926   IVGAILSKVVPATFSTISSISKMLWRSeptpttkp-epkpQPFAKASPLTCLKDYPRKGE  1102
             +VGAILSKVVPA  STI+S SK++WRS      +  E K Q FA+AS LTC+KDYPRKGE
Sbjct  254   LVGAILSKVVPAAASTIASFSKLIWRSNDQSPKRKPEAKTQSFARASSLTCIKDYPRKGE  313

Query  1103  KLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH  1282
             KLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC+FMEML  KD    KS  
Sbjct  314   KLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLAKKDKG--KSVF  371

Query  1283  H-EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLS  1459
             H E +KSDYCLCLAIHAPRKGI+E+WQMRTGPRL TI C KGSK+LQP YRF S+ +S S
Sbjct  372   HSEPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCGKGSKLLQPAYRFGSNSSS-S  430

Query  1460  SYIPLEVFFLNGDSGQLSVLNRSLN  1534
              YIPLEVF LNGDSGQ+S+LNRSL+
Sbjct  431   PYIPLEVFLLNGDSGQVSMLNRSLS  455


 Score =   308 bits (790),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 182/225 (81%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R  H TELGCIAC++L++LGAGKEGWLV NPNLL+ALD+HS+ALA R +IL++ W D
Sbjct  1    MAKRI-HLTELGCIACEELTELGAGKEGWLVNNPNLLSALDSHSIALAHRFLILIVNWAD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
                  KI P+LSPI+AE ++A+ WLVFDD++V+  GTS GYLL+YS+ GDLIHKQ V+P
Sbjct  60   PDSLRVKIRPDLSPIEAESITAIEWLVFDDVRVVLAGTSCGYLLVYSIAGDLIHKQLVHP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            ++ILKLRVRGTK+D MQ+ S EE+ +V+PG +ARF+GS+IQSML++WFQE+ S  WDQ  
Sbjct  120  SRILKLRVRGTKKDLMQETSSEEISIVLPGIIARFDGSNIQSMLQKWFQEKNSNFWDQKS  179

Query  687  NRY-MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             +   ED+G    RLPYQ+WNVNK G+CVDA I G+MPPPL+EHQ
Sbjct  180  KKSDPEDTGSLHQRLPYQIWNVNKNGVCVDATITGIMPPPLLEHQ  224



>ref|XP_006407032.1| hypothetical protein EUTSA_v10020708mg [Eutrema salsugineum]
 gb|ESQ48485.1| hypothetical protein EUTSA_v10020708mg [Eutrema salsugineum]
Length=455

 Score =   350 bits (897),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 184/263 (70%), Positives = 208/263 (79%), Gaps = 6/263 (2%)
 Frame = +2

Query  752   QIWVVCRCCHHWC-DAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRSI  928
             QIW V +  +  C DA  +       +  QSSQRYYCAVT+G+DAVISAYRLS D+ RS+
Sbjct  197   QIWSVNK--NGVCVDATVTGIMPPPLLEHQSSQRYYCAVTIGEDAVISAYRLSEDRGRSL  254

Query  929   VGAILSKVVPATFSTISSISKMLWRSeptpttkp-epkpQPFAKASPLTCLKDYPRKGEK  1105
             VGA+LSKVVPA  STI+S SK++WRS      +  E K Q FA+AS LTC+KDYPRKGEK
Sbjct  255   VGALLSKVVPAAASTIASFSKLIWRSNDQSPKRKPEAKTQSFARASSLTCIKDYPRKGEK  314

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC+FMEML  KD       H 
Sbjct  315   LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLAKKDKGK-SVIHT  373

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
             E +KSDYCLCLAIHAPRKGI+E+WQMRTGPRL TI C KGSK+LQP YRF S+ +S S Y
Sbjct  374   EPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKLLQPAYRFGSN-SSASPY  432

Query  1466  IPLEVFFLNGDSGQLSVLNRSLN  1534
             IPLEVF LNGDSGQLS+LNRSL+
Sbjct  433   IPLEVFLLNGDSGQLSMLNRSLS  455


 Score =   311 bits (796),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 185/226 (82%), Gaps = 4/226 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R  H TELGCIAC++LS+LGAGKEGWLV +PNLL ALD+HS+ALA+R +IL++ W D
Sbjct  1    MAKRI-HLTELGCIACEELSELGAGKEGWLVNSPNLLCALDSHSIALANRFLILIVNWGD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI P+LSPI+AE ++A+ WLVFDD++V+  GTS GYLL+YS+ GDLIHKQ V+P
Sbjct  60   PDAPRVKIRPDLSPIEAESITAIEWLVFDDVRVVVAGTSCGYLLVYSIAGDLIHKQMVHP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            ++ILKLRVRGTK+D MQ+ S EE+CVV+PG +ARF+GS+IQSML++W QE+ S  WDQ  
Sbjct  120  SRILKLRVRGTKKDLMQETSSEEICVVLPGIIARFDGSNIQSMLQKWVQEKNSNFWDQN-  178

Query  687  NRYM--EDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            NR    EDSG  + RLPYQ+W+VNK G+CVDA + G+MPPPL+EHQ
Sbjct  179  NRKGEPEDSGSLYQRLPYQIWSVNKNGVCVDATVTGIMPPPLLEHQ  224



>ref|NP_188109.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAA97054.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAY34165.1| At3g14910 [Arabidopsis thaliana]
 gb|ABJ17116.1| At3g14910 [Arabidopsis thaliana]
 gb|AEE75587.1| uncharacterized protein AT3G14910 [Arabidopsis thaliana]
Length=455

 Score =   348 bits (894),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 183/263 (70%), Positives = 208/263 (79%), Gaps = 6/263 (2%)
 Frame = +2

Query  752   QIWVVCRCCHHWC-DAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRSI  928
             QIW V +  +  C DA  +       +  QSSQRYYCAVT+G+D+VISAYRLS D+ RS+
Sbjct  197   QIWNVNK--NGVCVDATVTGVMPPPLLELQSSQRYYCAVTIGEDSVISAYRLSEDRGRSL  254

Query  929   VGAILSKVVPATFSTISSISKMLWRSeptpttkp-epkpQPFAKASPLTCLKDYPRKGEK  1105
             VGAILSKVVPA  STI+S SK++WRS      +  E K Q FA+AS LTC+KDYPRKGEK
Sbjct  255   VGAILSKVVPAAASTIASFSKLIWRSNDQSPKRKPEAKTQSFARASSLTCIKDYPRKGEK  314

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC+FMEML  KD       H 
Sbjct  315   LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLAKKDKGK-SVIHT  373

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
             E +KSDYCLCLAIHAPRKGI+E+WQMRTGPRL TI C KGSK+LQP YRF S+ +S S Y
Sbjct  374   EPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKLLQPAYRFGSNSSS-SPY  432

Query  1466  IPLEVFFLNGDSGQLSVLNRSLN  1534
             IPLEVF LNGDSGQ+S+LNRSL+
Sbjct  433   IPLEVFLLNGDSGQVSMLNRSLS  455


 Score =   307 bits (786),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 184/226 (81%), Gaps = 4/226 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R  H TELGCIAC++L++LGAGKEGWLV NPNLL+ALD+HSLALA+R +IL++ W D
Sbjct  1    MAKRI-HLTELGCIACEELTELGAGKEGWLVNNPNLLSALDSHSLALANRFLILIVNWGD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI P+LSPI+AE ++A+ WLVFDD++V+  GTS GYLL+YS+ GDLIHKQ V+ 
Sbjct  60   PDAPRVKIRPDLSPIEAESITAIEWLVFDDVRVVVAGTSCGYLLVYSVTGDLIHKQIVHQ  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            ++ILK+RVRGTK+D MQ+ S EE+C+V+PG +ARF+GS+IQSM+++W QE+ S  WDQ  
Sbjct  120  SRILKIRVRGTKKDLMQETSSEEICIVLPGVIARFDGSNIQSMVQKWVQEKNSNFWDQK-  178

Query  687  NRY--MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            NR    ED+G  + RLPYQ+WNVNK G+CVDA + GVMPPPL+E Q
Sbjct  179  NRKGDAEDTGSLYQRLPYQIWNVNKNGVCVDATVTGVMPPPLLELQ  224



>ref|XP_002882901.1| hypothetical protein ARALYDRAFT_478912 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59160.1| hypothetical protein ARALYDRAFT_478912 [Arabidopsis lyrata subsp. 
lyrata]
Length=455

 Score =   348 bits (892),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 183/263 (70%), Positives = 207/263 (79%), Gaps = 6/263 (2%)
 Frame = +2

Query  752   QIWVVCRCCHHWC-DAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRSI  928
             QIW V +  +  C DA  +       +  QSSQRYYCAVT+G+DAVISAYRLS D+ RS+
Sbjct  197   QIWNVNK--NGVCVDATVTGVMPPPLLELQSSQRYYCAVTIGEDAVISAYRLSEDRGRSL  254

Query  929   VGAILSKVVPATFSTISSISKMLWRSeptpttkp-epkpQPFAKASPLTCLKDYPRKGEK  1105
             VGAILSKVVPA  STI+S SK++WRS      +  E K Q FA+AS LTC+KDYPRKGEK
Sbjct  255   VGAILSKVVPAAASTIASFSKLIWRSNDQSPKRKPEAKTQSFARASSLTCIKDYPRKGEK  314

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC+FMEML  KD       H 
Sbjct  315   LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLAKKDKGK-SVIHT  373

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
             E +KSDYCLCLAIHAPRKGI+E+WQMRTGPRL TI C  GSK+LQP YRF S+ +S S Y
Sbjct  374   EPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCANGSKLLQPAYRFGSNSSS-SPY  432

Query  1466  IPLEVFFLNGDSGQLSVLNRSLN  1534
             IPLEVF LNGDSGQ+S+LNRSL+
Sbjct  433   IPLEVFLLNGDSGQVSMLNRSLS  455


 Score =   315 bits (807),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 187/226 (83%), Gaps = 4/226 (2%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R  H TELGCIAC++LS+LGAGKEGWLV NPNLL+ALD+HSLALA+R +IL++ W D
Sbjct  1    MAKRI-HLTELGCIACEELSELGAGKEGWLVNNPNLLSALDSHSLALANRFLILIVNWGD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI P+LSPI+AE ++A+ WLVFDD++V+  GTS GYLL+YS+ GDLIHKQ V+P
Sbjct  60   PDAPRLKIRPDLSPIEAESITAIEWLVFDDVRVVVAGTSCGYLLVYSVAGDLIHKQMVHP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            ++ILK+RVRGTK+D MQ+ S EE+C+V+PG +ARF+GS+IQSML++WFQE+ S  WDQ  
Sbjct  120  SRILKIRVRGTKKDLMQETSSEEICIVLPGIIARFDGSNIQSMLQKWFQEKNSNFWDQK-  178

Query  687  NRY--MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            NR   +EDSG  + RLPYQ+WNVNK G+CVDA + GVMPPPL+E Q
Sbjct  179  NRKGDVEDSGSLYQRLPYQIWNVNKNGVCVDATVTGVMPPPLLELQ  224



>gb|KFK38841.1| hypothetical protein AALP_AA3G167200 [Arabis alpina]
Length=455

 Score =   347 bits (889),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 182/263 (69%), Positives = 206/263 (78%), Gaps = 6/263 (2%)
 Frame = +2

Query  752   QIWVVCRCCHHWC-DAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRSI  928
             QIW V +  +  C DA  +       +  QSSQRYYCAVT+G+DAVISAYRLS D+ RS+
Sbjct  197   QIWNVNK--NGVCVDATVTGIMPPPLLEHQSSQRYYCAVTIGEDAVISAYRLSEDRGRSL  254

Query  929   VGAILSKVVPATFSTISSISKMLWRSeptpttkpep-kpQPFAKASPLTCLKDYPRKGEK  1105
             VGAILSKVVPA  STI+S SK++WRS      +    K Q FA+AS LTC+KDYPRKGEK
Sbjct  255   VGAILSKVVPAAASTIASFSKLIWRSNDQSPKRKPEPKTQSFARASSLTCIKDYPRKGEK  314

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC+FMEML  KD         
Sbjct  315   LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLAKKDKGK-SVMQT  373

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
             E +KSDYCLCLAIHAPRKGI+E+WQMRTGPRL TI C KGSK+LQP YRF S+ +S S Y
Sbjct  374   EPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKLLQPAYRFGSNSSS-SPY  432

Query  1466  IPLEVFFLNGDSGQLSVLNRSLN  1534
             IPLEVF LNGDSGQ+S+LNRSL+
Sbjct  433   IPLEVFLLNGDSGQVSMLNRSLS  455


 Score =   316 bits (810),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R  H TELGCIAC++LS+LGAGKEGWLV NPNLL ALD+ SLALA+R +IL++ W D
Sbjct  1    MAKRI-HLTELGCIACEELSELGAGKEGWLVNNPNLLCALDSQSLALANRFLILIVNWGD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
               P  KI P+LSPI+AE ++A+ WLVFDD++V+  GTS GYLL+YS+ GDLIHKQ V+P
Sbjct  60   PDAPRVKIRPDLSPIEAESITAIEWLVFDDVRVVVAGTSCGYLLVYSVSGDLIHKQMVHP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            ++ILKLR+RGTK+D MQ+ S EE+C+V+PG +ARF+GS+IQSML +WFQE+ +  WDQ  
Sbjct  120  SRILKLRIRGTKKDLMQETSSEEICIVLPGIIARFDGSNIQSMLEKWFQEKNTNFWDQKS  179

Query  687  NRY-MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             +   ED+G S+ RLPYQ+WNVNK G+CVDA + G+MPPPL+EHQ
Sbjct  180  RKGDQEDTGSSYERLPYQIWNVNKNGVCVDATVTGIMPPPLLEHQ  224



>ref|NP_001140784.1| hypothetical protein [Zea mays]
 gb|ACF84614.1| unknown [Zea mays]
 tpg|DAA61015.1| TPA: hypothetical protein ZEAMMB73_415761 [Zea mays]
Length=240

 Score =   338 bits (866),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/233 (76%), Positives = 202/233 (87%), Gaps = 1/233 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQR+YCA+TVG+DAV+SAYRLS D++RSIVGAILS+ V ATFSTISS+SK+LWRSEP+
Sbjct  9     QSSQRHYCAITVGEDAVVSAYRLSEDRTRSIVGAILSRGVAATFSTISSLSKILWRSEPS  68

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P  K  PKPQ FAK SPLTCLKD PRKGE+LTLSPSGTLAAITDSLGRILLLDT ALV V
Sbjct  69    PPKKSRPKPQSFAKTSPLTCLKDSPRKGERLTLSPSGTLAAITDSLGRILLLDTHALVAV  128

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             RLWKGYRDASCLF+EML+NKD ++  S H E+ KSDYCLCLAIHAPRKGI+E+W+MRTG 
Sbjct  129   RLWKGYRDASCLFVEMLLNKDKASSGSMHIEYTKSDYCLCLAIHAPRKGIIEVWKMRTGS  188

Query  1376  RLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             RL TIPCPKGS+ILQP+ R S+S  S  SY PLEV+  NGDSGQLSVLNR + 
Sbjct  189   RLLTIPCPKGSRILQPSARLSTSSFS-PSYSPLEVYLFNGDSGQLSVLNRHIG  240



>gb|EMT29662.1| Rab3 GTPase-activating protein non-catalytic subunit [Aegilops 
tauschii]
Length=422

 Score =   343 bits (881),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 182/248 (73%), Positives = 209/248 (84%), Gaps = 1/248 (0%)
 Frame = +2

Query  791   DAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFS  970
             D  +S+       +  SSQR+YCA+TVG+DAV+SAYRLS D+SRS+VGAILS+ V ATFS
Sbjct  176   DEDTSSFEKIPLQIWNSSQRHYCAITVGEDAVVSAYRLSEDRSRSLVGAILSRGVAATFS  235

Query  971   TISSISKMLWRSeptpttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDS  1150
             TISS+SK+LWRSEP+PT K  PKPQ FAK SPLTCLKD PRKGE+LTLSPSGTLAAITDS
Sbjct  236   TISSLSKILWRSEPSPTKKSRPKPQAFAKTSPLTCLKDSPRKGERLTLSPSGTLAAITDS  295

Query  1151  LGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHA  1330
             LGRILLLDT+ALV VRLWKGYRDASCLF+EML NKD S+  S H ++ KSDYCLCLAIHA
Sbjct  296   LGRILLLDTRALVAVRLWKGYRDASCLFVEMLRNKDKSSSSSMHLDYTKSDYCLCLAIHA  355

Query  1331  PRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQL  1510
             PRKGI+E+WQMRTGPRL TIPCPKGS+ILQP+ R  SS ++ SSY PLEV+  NGDSGQL
Sbjct  356   PRKGIIEVWQMRTGPRLLTIPCPKGSRILQPSTR-FSSSSAFSSYTPLEVYLFNGDSGQL  414

Query  1511  SVLNRSLN  1534
             SVLNR + 
Sbjct  415   SVLNRHIG  422


 Score =   111 bits (277),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 107/190 (56%), Gaps = 15/190 (8%)
 Frame = +3

Query  231  WLVENPNLLTALDTHS----LALASRSIILVLQWTDAGDPPAKIIPELSPIQAEYLSALA  398
            WL ++P +L +L   +    +A A+RS++ ++     G    K  P L P     +SA+ 
Sbjct  13   WL-DDPAVLLSLGPRARDLAVASAARSVLGIVPVAGGGGVTVK--PALGPDDGR-ISAVE  68

Query  399  WLVFD-------DIKVLAVGTSSGYLLIYSLRGDLIHKQFVNPAKILKLRVRGTKRDQMQ  557
            W+  D       +   L VGT +G+LL YSL GDL+HKQ + PAKILKL     K +  +
Sbjct  69   WVPLDAEGAQGEEGMALVVGTDAGWLLFYSLAGDLLHKQSIYPAKILKLNFSERKENAWE  128

Query  558  DASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPVNRYMEDSGDSFGRLPYQ  737
            D+  +E+ VV PG +AR +G+D+Q ML++ FQE  S++W     +  ++   SF ++P Q
Sbjct  129  DSGSDELSVVFPGVIARCDGADLQIMLQKSFQEVKSRMWKDKFEQEDDEDTSSFEKIPLQ  188

Query  738  LWNVNKYGLC  767
            +WN ++   C
Sbjct  189  IWNSSQRHYC  198



>ref|XP_008345136.1| PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-activating protein 
non-catalytic subunit-like [Malus domestica]
Length=364

 Score =   332 bits (850),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 187/214 (87%), Gaps = 2/214 (1%)
 Frame = +2

Query  890   SAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPL  1069
             SA+RLS DK+RS+VGAILS+VVPATFSTI+S+SKM+WRS+     K E KPQPFA+ASPL
Sbjct  153   SAFRLSEDKNRSLVGAILSRVVPATFSTIASLSKMIWRSDQGSPKKSEEKPQPFARASPL  212

Query  1070  TCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLV  1249
             TCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALV+VRLWKGYRDASCLFMEMLV
Sbjct  213   TCLKDFPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVIVRLWKGYRDASCLFMEMLV  272

Query  1250  NKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTY  1429
              KD++   S ++E  KSDYCLCLAIHAPRKGIVEIWQMRTGPRL+   C KG +ILQPTY
Sbjct  273   KKDTAASSSRYYEPTKSDYCLCLAIHAPRKGIVEIWQMRTGPRLRAFQCAKGXQILQPTY  332

Query  1430  RFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSL  1531
             RF SS A  S Y+PLEV  LNGDSGQ+SVLNR+L
Sbjct  333   RFGSSLA--SPYVPLEVXLLNGDSGQISVLNRTL  364



>gb|KDO47009.1| hypothetical protein CISIN_1g012917mg [Citrus sinensis]
Length=300

 Score =   300 bits (768),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 178/225 (79%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M++R+ HTTE+G IAC DLSDLGAGKEGWLV +PNLL ALD H++ALA+R   +++ W D
Sbjct  1    MSKRT-HTTEVGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWAD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
                 AKI PELSPI +EY++A+ WLVF++++ LAVGTS GY L+Y L+GDL+H+Q ++P
Sbjct  60   PEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ-P  683
             +ILKLRVRG++RD  QD + EEVCVVMPG +ARF+GS+IQ ML+RWFQ+  S  WDQ P
Sbjct  120  GRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKP  179

Query  684  VNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
              R  ED  +S+ RLP+QLWNV+KYG C DAAI G+MPPPLME Q
Sbjct  180  KQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQ  224


 Score =   100 bits (249),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRS  1006
             QSSQRY+CAVT+G+D+VISA+RLS D+SRS+VGAILSKVVPATFSTISS+SKM+WRS
Sbjct  224   QSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRS  280



>gb|KDO47007.1| hypothetical protein CISIN_1g012917mg [Citrus sinensis]
 gb|KDO47008.1| hypothetical protein CISIN_1g012917mg [Citrus sinensis]
Length=317

 Score =   300 bits (767),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 178/225 (79%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            M++R+ HTTE+G IAC DLSDLGAGKEGWLV +PNLL ALD H++ALA+R   +++ W D
Sbjct  1    MSKRT-HTTEVGSIACTDLSDLGAGKEGWLVNDPNLLCALDMHTIALANRYQTVIINWAD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
                 AKI PELSPI +EY++A+ WLVF++++ LAVGTS GY L+Y L+GDL+H+Q ++P
Sbjct  60   PEGLVAKIRPELSPIASEYITAIEWLVFEEMRALAVGTSRGYFLVYDLKGDLVHRQLIHP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQ-P  683
             +ILKLRVRG++RD  QD + EEVCVVMPG +ARF+GS+IQ ML+RWFQ+  S  WDQ P
Sbjct  120  GRILKLRVRGSRRDLTQDTAEEEVCVVMPGVLARFDGSEIQKMLQRWFQDSNSNFWDQKP  179

Query  684  VNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
              R  ED  +S+ RLP+QLWNV+KYG C DAAI G+MPPPLME Q
Sbjct  180  KQRDSEDLENSYERLPHQLWNVSKYGPCADAAITGLMPPPLMEVQ  224


 Score =   100 bits (249),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRS  1006
             QSSQRY+CAVT+G+D+VISA+RLS D+SRS+VGAILSKVVPATFSTISS+SKM+WRS
Sbjct  224   QSSQRYFCAVTIGEDSVISAFRLSEDRSRSLVGAILSKVVPATFSTISSLSKMIWRS  280



>emb|CDX97617.1| BnaA05g24620D [Brassica napus]
Length=937

 Score =   341 bits (874),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 180/260 (69%), Positives = 202/260 (78%), Gaps = 10/260 (4%)
 Frame = +2

Query  752   QIWVVCR--CCHHWCDAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRS  925
             QIW V +   C    DA  +       +  QSSQRYYC VT+G+DAVISAYRLS D+ RS
Sbjct  197   QIWNVNKNGVC---VDATITGIMPPPLLEHQSSQRYYCVVTIGEDAVISAYRLSEDRGRS  253

Query  926   IVGAILSKVVPATFSTISSISKMLWRSeptpttkp-epkpQPFAKASPLTCLKDYPRKGE  1102
             +VGAILSKVVPA  STI+S SK++WRS      +  E K Q FA+AS LTC+KDYPRKGE
Sbjct  254   LVGAILSKVVPAAASTIASFSKLIWRSNDQSPKRKPEAKTQSFARASSLTCIKDYPRKGE  313

Query  1103  KLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH  1282
             KLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC+FMEML  KD    KS +
Sbjct  314   KLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCVFMEMLAKKDKG--KSVY  371

Query  1283  H-EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLS  1459
             H E +KSDYCLCLAIHAPRKGI+E+WQMRTGPRL TI C KGSK+LQP YRF S+ +S S
Sbjct  372   HTEPVKSDYCLCLAIHAPRKGIIEVWQMRTGPRLLTIQCAKGSKLLQPAYRFGSNSSS-S  430

Query  1460  SYIPLEVFFLNGDSGQLSVL  1519
              YIPLEVF LNGDSGQ+  L
Sbjct  431   PYIPLEVFLLNGDSGQMKTL  450


 Score =   307 bits (787),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 182/225 (81%), Gaps = 2/225 (1%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTD  326
            MA+R  H TELGCIAC++L++LGAGKEGWLV NPNL++ALD+HS+ALA R +IL++ W D
Sbjct  1    MAKRI-HLTELGCIACEELTELGAGKEGWLVNNPNLISALDSHSIALAHRFLILIVNWAD  59

Query  327  AGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNP  506
                  KI P+LSPI+AE ++A+ WLVFDD++VL  GTS GYLL+YS+ GDLIHKQ V+P
Sbjct  60   PDSLRVKIRPDLSPIEAESITAIEWLVFDDVRVLLAGTSCGYLLVYSIAGDLIHKQLVHP  119

Query  507  AKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPV  686
            ++ILKLRVRGTK+D MQ+ S EE+ +V+PG +ARF+GS+IQSML++WFQE+ S  WDQ  
Sbjct  120  SRILKLRVRGTKKDLMQETSSEEISIVLPGIIARFDGSNIQSMLQKWFQEKNSNFWDQKS  179

Query  687  NRY-MEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             +   ED+G    RLPYQ+WNVNK G+CVDA I G+MPPPL+EHQ
Sbjct  180  KKGDPEDTGSLHQRLPYQIWNVNKNGVCVDATITGIMPPPLLEHQ  224



>gb|EPS61151.1| hypothetical protein M569_13648, partial [Genlisea aurea]
Length=459

 Score =   321 bits (822),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 174/268 (65%), Positives = 204/268 (76%), Gaps = 14/268 (5%)
 Frame = +2

Query  752   QIWVVCRCCHHWCDAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRSIV  931
             QIW V +  +  C   +  G     ++   S RYYCAVT+GDDAVI+AYRLSVDKSRSIV
Sbjct  197   QIWNVNK--YGICADAAITGDMPPPLMEIQSSRYYCAVTIGDDAVIAAYRLSVDKSRSIV  254

Query  932   GAILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTCLKDYPRKGEKLT  1111
             GAILSKVVPATFSTI+S SK++WRSE     K E   QP   AS +TC+KD+PRKGEKLT
Sbjct  255   GAILSKVVPATFSTIASFSKLIWRSEMNQKRKQESVSQPSRAASTVTCIKDHPRKGEKLT  314

Query  1112  LSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEH  1291
             +SP+GTL A+TDSLGRILLLDT+ALVVVRLWKGYR+ASCLF+EML  KD    KS  HE+
Sbjct  315   VSPTGTLMAVTDSLGRILLLDTRALVVVRLWKGYREASCLFVEMLGIKD----KSGLHEY  370

Query  1292  IKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSYI-  1468
              KSD+ LCLAIHAPRKGIVE+W+MRTGPRL  IPCPKG ++LQP YRFSSS    SS   
Sbjct  371   RKSDHFLCLAIHAPRKGIVEVWRMRTGPRLLIIPCPKGCRMLQPAYRFSSSATEGSSSSS  430

Query  1469  -------PLEVFFLNGDSGQLSVLNRSL  1531
                    PL++FFLNGDSG++SVLN+ L
Sbjct  431   SSSSSSDPLQLFFLNGDSGEVSVLNQKL  458


 Score =   271 bits (692),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 173/228 (76%), Gaps = 13/228 (6%)
 Frame = +3

Query  156  RSSHTTELGCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTDAGD  335
            R  HTTE+GCIA + L+D GAGKEGWLV+NPNLL +L + SLA+A RS+IL+L     G 
Sbjct  3    RRLHTTEIGCIAGEYLTDFGAGKEGWLVDNPNLLVSLGSDSLAIADRSLILLLSLPVDGR  62

Query  336  PPA------KIIPELSPIQAEYLSALAWLVFD-DIKVLAVGTSSGYLLIYSLRGDLIHKQ  494
            P +      KIIPELSPI+AEYLSA+ WLVFD +I+VLAVGTSSGYLL++S+ G L+H+Q
Sbjct  63   PDSGNSKAVKIIPELSPIEAEYLSAIEWLVFDGEIRVLAVGTSSGYLLLFSIHGSLLHRQ  122

Query  495  FVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLW  674
            FV+P KILKLRV G K+D  Q AS + VC+VMPG +A FEGSDI+++L++ FQE  S  W
Sbjct  123  FVSPLKILKLRVCGDKQDPTQVASSQGVCIVMPGVIAYFEGSDIKNLLQQKFQETTSLYW  182

Query  675  DQPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            D   N Y ++SG     LPYQ+WNVNKYG+C DAAI G MPPPLME Q
Sbjct  183  DHEFNDY-KNSG-----LPYQIWNVNKYGICADAAITGDMPPPLMEIQ  224



>ref|XP_007099619.1| Rab3 GTPase-activating protein non-catalytic subunit isoform 
1 [Theobroma cacao]
 gb|EOY20420.1| Rab3 GTPase-activating protein non-catalytic subunit isoform 
1 [Theobroma cacao]
Length=236

 Score =   276 bits (705),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QS+QRYYCAVT+GDDAVISA+RLS D++RS+VGAILSKVVPATFSTI+S SKM+WRSE T
Sbjct  62    QSNQRYYCAVTIGDDAVISAFRLSEDRNRSLVGAILSKVVPATFSTIASFSKMIWRSEQT  121

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P  K E KPQ FA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV
Sbjct  122   PKRKSEEKPQSFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  181

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVE  1351
             RLWKGYRDASC FMEMLVNK++    S+++E  KSDYCLCLAIHAPRKGIVE
Sbjct  182   RLWKGYRDASCFFMEMLVNKEAIGSGSSYYEPGKSDYCLCLAIHAPRKGIVE  233


 Score =   103 bits (258),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  633  MLRRWFQERYSQLWDQPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLME  812
            ML+RWFQE +S+ WDQ   +  ED G+S+GRLPYQLWNVNKYG CVDAAI G+MPPPLME
Sbjct  1    MLQRWFQETHSRFWDQKPKKDSEDIGNSYGRLPYQLWNVNKYGTCVDAAITGIMPPPLME  60

Query  813  HQ  818
             Q
Sbjct  61   LQ  62



>gb|ADE77036.1| unknown [Picea sitchensis]
Length=343

 Score =   297 bits (760),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/257 (57%), Positives = 194/257 (75%), Gaps = 1/257 (0%)
 Frame = +2

Query  752   QIWVVCRCCHHWCDAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRSIV  931
             Q+W V +C     DA  +   +   +  QS Q+YYCA+TVG +A  +A+RLS DK+RS+V
Sbjct  82    QLWNVSKC-GPCSDAAITGIMAPPLMEDQSRQQYYCAITVGSNATFAAFRLSEDKNRSLV  140

Query  932   GAILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTCLKDYPRKGEKLT  1111
             GAILSKV+PAT STISS++KM WR++ +     E KPQ FA+AS LTCLKD PRKGE+L+
Sbjct  141   GAILSKVMPATVSTISSLAKMFWRNDQSEARPAEVKPQAFARASLLTCLKDDPRKGERLS  200

Query  1112  LSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEH  1291
             LSPSG LAA+TDSLGRILL+DTQALVVVRLWKGYRDASC F+E+ +N +  ++    +  
Sbjct  201   LSPSGCLAAVTDSLGRILLIDTQALVVVRLWKGYRDASCFFLEVPLNGEMPSVDGIGYGK  260

Query  1292  IKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIP  1471
              K D+CLCLAIHAPR+G+VE+W+MRTGPR+  + C KG ++LQ + +F+S  +    YIP
Sbjct  261   SKHDFCLCLAIHAPRRGVVEVWKMRTGPRIMMLKCAKGCQLLQSSCKFTSLSSDTYDYIP  320

Query  1472  LEVFFLNGDSGQLSVLN  1522
              +V+ LNGDSGQ+++LN
Sbjct  321   AQVYLLNGDSGQIAILN  337


 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 71/109 (65%), Gaps = 1/109 (1%)
 Frame = +3

Query  495  FVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQER-YSQL  671
             ++P  I +LRVRG+    +++A+ +E+CVV P A+ R + SD+QS+L+R  +ER Y   
Sbjct  1    MLHPCPITRLRVRGSSSGSVENAASDELCVVFPAAILRIDASDLQSLLKRCLEERSYDAR  60

Query  672  WDQPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            +     +  +   D +G+L YQLWNV+K G C DAAI G+M PPLME Q
Sbjct  61   FPISAKKDTQGLDDVYGKLKYQLWNVSKCGPCSDAAITGIMAPPLMEDQ  109



>ref|XP_011069445.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like, 
partial [Sesamum indicum]
Length=177

 Score =   278 bits (710),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = +2

Query  983   ISKMLWRSeptpttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRI  1162
              SK++WRSE  PT KPE K QPFA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRI
Sbjct  1     FSKLIWRSEEKPTKKPEAKSQPFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRI  60

Query  1163  LLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTL-KSAHHEHIKSDYCLCLAIHAPRK  1339
             LLLDTQALVVVRLWKGYR+ASCLF+EML  KD +   + A+ EH KSDYCLCLAIHAPRK
Sbjct  61    LLLDTQALVVVRLWKGYREASCLFVEMLARKDKAAASRWAYDEHSKSDYCLCLAIHAPRK  120

Query  1340  GIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQL  1510
             GIVE+WQMRTGPRL TIPCPKGSKILQPTYRFSS+ AS SSY+PL+VFFLNGDSGQ+
Sbjct  121   GIVEVWQMRTGPRLLTIPCPKGSKILQPTYRFSSATASSSSYVPLQVFFLNGDSGQI  177



>dbj|BAJ98280.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score =   185 bits (469),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQR+YCA+TVG+DAV+SAYRLS D+SRS+VGAILS+ V ATFSTISS+SK+LWRSEP+
Sbjct  234   QSSQRHYCAITVGEDAVVSAYRLSEDRSRSLVGAILSRGVAATFSTISSLSKILWRSEPS  293

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             PT KP PKPQ FAK SPLTCLKD PRKGE+LTLSPSGTLAAITDSLGRILLLDT+ALV V
Sbjct  294   PTKKPRPKPQAFAKTSPLTCLKDSPRKGERLTLSPSGTLAAITDSLGRILLLDTRALVAV  353

Query  1196  RLWK  1207
             RLWK
Sbjct  354   RLWK  357


 Score =   153 bits (387),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 141/238 (59%), Gaps = 18/238 (8%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAG---KEGWLVENPNLLTALDTHS----LALASRSII  305
            MARR  H TE+  +A    S   AG   +EGWL ++P +L +L   +    +A A+RS++
Sbjct  1    MARRGHHLTEVALLASASGSLAAAGAGEREGWL-DDPAVLLSLGPRARDLAVASAARSVL  59

Query  306  LVLQWTDAGDPPAKIIPELSPIQAEYLSALAWLVFD-------DIKVLAVGTSSGYLLIY  464
             ++     G    K  P L P     +SA+ W+  D       +   + VGT +G+LL Y
Sbjct  60   GIVPVAGGGGVTVK--PALGPDDGR-ISAVEWVPLDAEGSQGEEGMTVVVGTDAGWLLFY  116

Query  465  SLRGDLIHKQFVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRR  644
            SL GDL+HKQ + PAKILKL     K +  +D+  +E+ VV PG +AR +G+D+Q ML++
Sbjct  117  SLAGDLLHKQSIYPAKILKLNFNERKENAWEDSGSDELSVVFPGVIARCDGADLQIMLQK  176

Query  645  WFQERYSQLWDQPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
             FQE  S++W     +  ++   SF + P Q+WNV+K+G CVDAAI+G+MPPPL+E Q
Sbjct  177  SFQEVKSRMWKDKFEQEDDEDTSSFEKTPLQIWNVSKFGSCVDAAIVGLMPPPLLELQ  234



>ref|XP_001763313.1| predicted protein [Physcomitrella patens]
 gb|EDQ71843.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   186 bits (472),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 157/239 (66%), Gaps = 12/239 (5%)
 Frame = +2

Query  842   SQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSeptpt  1021
              +R+YCA+TVG D  ++A+R+S +K  S+V AI+ KV+PA+ + IS+++K  W+ + +  
Sbjct  232   GKRHYCALTVGPDCTLAAFRVSGEKQGSLVSAIIDKVMPASVTKISNLAKRFWQKDESSE  291

Query  1022  tkpepkpQP--FAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             +    +  P  F++AS +T LKD  RKGE+L ++P G+LAAI DSLGR+LL+D  A+VVV
Sbjct  292   SNRPLEVSPQTFSRASVITSLKDNMRKGERLAVAPGGSLAAIADSLGRVLLVDVNAVVVV  351

Query  1196  RLWKGYRDASCLFMEMLVN--KDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVE-IWQMR  1366
             RLWKGYRDA CLF+E  V+   D +  +  H    +  Y LCLAIHAPR+G++E IWQMR
Sbjct  352   RLWKGYRDAHCLFLEAPVDGSADYADPQKKHLSLRRQQYRLCLAIHAPRRGVIEVIWQMR  411

Query  1367  TGPRLQTIPCPKGSKILQPTYRFSSSEASL-------SSYIPLEVFFLNGDSGQLSVLN  1522
              G R+  I   +  ++LQP  +  S    L        ++ P  V+FL+GDSG LS++N
Sbjct  412   HGGRVAVIRDGESCRLLQPACQLRSVALELDTKDDEDETFEPARVYFLHGDSGSLSLIN  470


 Score =   134 bits (337),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 123/220 (56%), Gaps = 10/220 (5%)
 Frame = +3

Query  180  GCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALAS-RSIILVLQWTDAGDPPA---K  347
            GCI  D+L  +GAGK  WL +NP +L A+    LA+A+ + II+ L W    +      K
Sbjct  15   GCIVTDELEAVGAGKTRWL-DNPVILVAMTQEHLAIATDQVIIMQLTWKQQVNTKPFVRK  73

Query  348  IIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNPAKILKLR  527
            +   L P   E ++A+ W+VFD   +LAVGTS G LL++S +G L+ KQ+ +   +LKLR
Sbjct  74   VGSCLEP--EEKMTAMEWVVFDGASLLAVGTSFGALLLFSQKGTLLIKQYFHSDPVLKLR  131

Query  528  VRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQERYSQLWDQPVNRYMEDS  707
            VR      + + S E++C++ P A+AR +  D++  L +  +     L    V    +D 
Sbjct  132  VRSEPLGSLGNDSSEDLCLIYPKAIARIDAIDLKVGLPKRLRMEGEGLLGWKVGGDTQDG  191

Query  708  GDSFGRLPYQLWNVNKYG---LCVDAAIIGVMPPPLMEHQ  818
                 RLP+ +WN+N+      C D A+ G+MPPPL+E Q
Sbjct  192  EAPINRLPFLMWNINRTAGALACSDGALAGIMPPPLLELQ  231



>ref|XP_008793038.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X3 [Phoenix dactylifera]
Length=412

 Score =   264 bits (675),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 140/159 (88%), Gaps = 4/159 (3%)
 Frame = +2

Query  1058  ASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM  1237
             ASPLTCLKD PRKGEKLTLSP GTLAAITDSLGRILLLDTQALVVVRLWKGYRDA CLF+
Sbjct  258   ASPLTCLKDPPRKGEKLTLSPGGTLAAITDSLGRILLLDTQALVVVRLWKGYRDACCLFI  317

Query  1238  EMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKIL  1417
             EMLVN+D ++  SA++EH K DYCLCLAIHAPRKGI+EIW+MRTGPR+ TI CPKGSKIL
Sbjct  318   EMLVNRDKAS-SSAYYEHTKGDYCLCLAIHAPRKGIIEIWKMRTGPRVLTIQCPKGSKIL  376

Query  1418  QPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNRSLN  1534
             QP+ RF SS    SSYIPLEVF LNGDSGQLSVLNRS  
Sbjct  377   QPSTRFVSST---SSYIPLEVFLLNGDSGQLSVLNRSFG  412


 Score =   223 bits (568),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 137/259 (53%), Positives = 183/259 (71%), Gaps = 12/259 (5%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAG-KEGWLVENPNLLTALDTHSLALA--SRSIILVLQ  317
            MARRS H T +GCIACD++ +LGAG +EGWL ++P LL AL  H+LALA  +RS++LVL 
Sbjct  1    MARRS-HLTHVGCIACDEMEELGAGEREGWL-DDPGLLAALHPHALALAHSARSLVLVLG  58

Query  318  WTDAGDP-----PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDL  482
            W    DP     P KI P L+  +  ++SA+ WL F D+  LA+ TS+G+L +YSL GDL
Sbjct  59   WDRDPDPSSPRQPLKIRPSLAADEG-HISAIEWLPFGDLLALALATSAGHLFVYSLTGDL  117

Query  483  IHKQFVNPAKILKLRVRGTKRDQMQDASLE-EVCVVMPGAVARFEGSDIQSMLRRWFQER  659
            IHKQ ++  ++L+LR R TK    QD+    E+CVV+PG +ARF+GSDIQS+L+RWFQE 
Sbjct  118  IHKQIIHSGRVLRLRFRETKVGSSQDSVASMELCVVLPGVIARFDGSDIQSLLQRWFQEE  177

Query  660  YSQLWDQPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQlllllGS  839
             S++++           +S+GR+P+QLWNV+K+G C DAAI G+MPPPL+E QLLLLLGS
Sbjct  178  RSRIFENRFQNRNTVDENSYGRIPFQLWNVSKFGSCADAAITGLMPPPLLELQLLLLLGS  237

Query  840  QASVIIVQSLLEMML*FLH  896
            Q S I VQ  LE ML + H
Sbjct  238  QVSAITVQLRLERMLRYQH  256



>ref|XP_007099609.1| Rab3 GTPase-activating protein non-catalytic subunit isoform 
3 [Theobroma cacao]
 gb|EOY20410.1| Rab3 GTPase-activating protein non-catalytic subunit isoform 
3 [Theobroma cacao]
Length=284

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 151/184 (82%), Gaps = 10/184 (5%)
 Frame = +2

Query  809   GTSAAFIV----------GQSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVP  958
             GTS  FI+           QSSQRYYCAVT+GDDAVISA+RLS D++RS++GAILSKVVP
Sbjct  100   GTSRGFILVYSVRADLIHRQSSQRYYCAVTIGDDAVISAFRLSEDRTRSLIGAILSKVVP  159

Query  959   ATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAA  1138
             ATFS I+S SKM+WRSE  P  K E KPQ FA+ASPLTCLKD+PRKGEKLTLSPSGTLAA
Sbjct  160   ATFSRIASFSKMIWRSEQMPKRKSEEKPQSFARASPLTCLKDHPRKGEKLTLSPSGTLAA  219

Query  1139  ITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCL  1318
             ITDSLGRILLLDTQ LVVVRLWKGY DASC FMEMLVNK++     +++E  KSDYCLCL
Sbjct  220   ITDSLGRILLLDTQTLVVVRLWKGYCDASCFFMEMLVNKEAIGSGCSYYEPGKSDYCLCL  279

Query  1319  AIHA  1330
             AIHA
Sbjct  280   AIHA  283


 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 99/119 (83%), Gaps = 3/119 (3%)
 Frame = +3

Query  147  MARRSSHT-TELGCIACDDLSDLGAGKEGWLVENPN--LLTALDTHSLALASRSIILVLQ  317
            M++RS+H  T+LGCIA +DLS+ GAG+EGWL  + +  LL ALD HSLA+A+RS+IL+L 
Sbjct  1    MSKRSNHHLTDLGCIAGEDLSEFGAGEEGWLAPDASTTLLCALDAHSLAIANRSLILILG  60

Query  318  WTDAGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQ  494
            W+D  +P  +I PELSPI+AE+++A+ WLVFD+IKV+AVGTS G++L+YS+R DLIH+Q
Sbjct  61   WSDPDEPRVQIRPELSPIEAEHITAIEWLVFDEIKVIAVGTSRGFILVYSVRADLIHRQ  119



>ref|XP_007099608.1| Rab3 GTPase-activating protein non-catalytic subunit isoform 
2 [Theobroma cacao]
 gb|EOY20409.1| Rab3 GTPase-activating protein non-catalytic subunit isoform 
2 [Theobroma cacao]
Length=284

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 151/184 (82%), Gaps = 10/184 (5%)
 Frame = +2

Query  809   GTSAAFIV----------GQSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVP  958
             GTS  FI+           QSSQRYYCAVT+GDDAVISA+RLS D++RS++GAILSKVVP
Sbjct  100   GTSRGFILVYSLRGDLIHRQSSQRYYCAVTIGDDAVISAFRLSEDRTRSLIGAILSKVVP  159

Query  959   ATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAA  1138
             ATFS I+S SKM+WRSE  P  K E KPQ FA+ASPLTCLKD+PRKGEKLTLSPSGTLAA
Sbjct  160   ATFSRIASFSKMIWRSEQMPKRKSEEKPQSFARASPLTCLKDHPRKGEKLTLSPSGTLAA  219

Query  1139  ITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCL  1318
             ITDSLGRILLLDTQ LVVVRLWKGY DASC FMEMLVNK++     +++E  KSDYCLCL
Sbjct  220   ITDSLGRILLLDTQTLVVVRLWKGYCDASCFFMEMLVNKEAIGSGCSYYEPGKSDYCLCL  279

Query  1319  AIHA  1330
             AIHA
Sbjct  280   AIHA  283


 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 99/119 (83%), Gaps = 3/119 (3%)
 Frame = +3

Query  147  MARRSSHT-TELGCIACDDLSDLGAGKEGWLVENPN--LLTALDTHSLALASRSIILVLQ  317
            M++RS+H  T+LGCIA +DLS+ GAG+EGWL  + +  LL ALD HSLA+A+RS+IL+L 
Sbjct  1    MSKRSNHHLTDLGCIAGEDLSEFGAGEEGWLAPDASTTLLCALDAHSLAIANRSLILILG  60

Query  318  WTDAGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQ  494
            W+D  +P  +I PELSP +AE+++A+ WLVFD+IKV+AVGTS G++L+YSLRGDLIH+Q
Sbjct  61   WSDPDEPRVQIRPELSPFEAEHITAIEWLVFDEIKVIAVGTSRGFILVYSLRGDLIHRQ  119



>ref|XP_007099607.1| Rab3 GTPase-activating protein non-catalytic subunit isoform 
1 [Theobroma cacao]
 gb|EOY20408.1| Rab3 GTPase-activating protein non-catalytic subunit isoform 
1 [Theobroma cacao]
Length=329

 Score =   251 bits (640),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  836   QSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKMLWRSept  1015
             QSSQRYYCAVT+GDDAVISA+RLS D++RS++GAILSKVVPATFS I+S SKM+WRSE  
Sbjct  164   QSSQRYYCAVTIGDDAVISAFRLSEDRTRSLIGAILSKVVPATFSRIASFSKMIWRSEQM  223

Query  1016  pttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             P  K E KPQ FA+ASPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQ LVVV
Sbjct  224   PKRKSEEKPQSFARASPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQTLVVV  283

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHA  1330
             RLWKGY DASC FMEMLVNK++     +++E  KSDYCLCLAIHA
Sbjct  284   RLWKGYCDASCFFMEMLVNKEAIGSGCSYYEPGKSDYCLCLAIHA  328


 Score =   218 bits (556),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 139/170 (82%), Gaps = 3/170 (2%)
 Frame = +3

Query  147  MARRSSHT-TELGCIACDDLSDLGAGKEGWLVENPN--LLTALDTHSLALASRSIILVLQ  317
            M++RS+H  T+LGCIA +DLS+ GAG+EGWL  + +  LL ALD HSLA+A+RS+IL+L 
Sbjct  1    MSKRSNHHLTDLGCIAGEDLSEFGAGEEGWLAPDASTTLLCALDAHSLAIANRSLILILG  60

Query  318  WTDAGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQF  497
            W+D  +P  +I PELSP +AE+++A+ WLVFD+IKV+AVGTS G++L+YSLRGDLIH+Q 
Sbjct  61   WSDPDEPRVQIRPELSPFEAEHITAIEWLVFDEIKVIAVGTSRGFILVYSLRGDLIHRQM  120

Query  498  VNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRW  647
            V P +I+KLRVRGTK+D  QD S EEVCVV+PG +ARF+GSDIQS  R +
Sbjct  121  VYPGRIVKLRVRGTKKDLTQDISSEEVCVVIPGVIARFDGSDIQSSQRYY  170



>ref|XP_007021776.1| Uncharacterized protein TCM_031843 [Theobroma cacao]
 gb|EOY13301.1| Uncharacterized protein TCM_031843 [Theobroma cacao]
Length=343

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 158/260 (61%), Gaps = 72/260 (28%)
 Frame = +2

Query  809   GTSAAFIV----------GQSSQRYYCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVP  958
             GTS  FI+           QS+QRYYCAVT+GDDAVISA+RLS D++RS+          
Sbjct  138   GTSRGFILVYSLRGDLIHRQSNQRYYCAVTIGDDAVISAFRLSEDRNRSL----------  187

Query  959   ATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAA  1138
                                                      D+PRKGEKLTLSPS TLAA
Sbjct  188   -----------------------------------------DHPRKGEKLTLSPSCTLAA  206

Query  1139  ITDSLGRILLLDTQALVVVRLWKGYRDASCLF--------MEMLVNKDSSTLKSAHHEHI  1294
             ITDSLGRILLLDTQALVVVRLW+    AS +F          + VN ++    S+++E  
Sbjct  207   ITDSLGRILLLDTQALVVVRLWR-VSSASMVFNFLKSNRSFILFVNTEAIGSGSSYYEPG  265

Query  1295  KSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPL  1474
             KSDYCLCLAIHAPRKGIVE+WQMRTGPRL TI C KG ++LQPTYRF SS    S Y+PL
Sbjct  266   KSDYCLCLAIHAPRKGIVEVWQMRTGPRLLTIQCAKGCRLLQPTYRFGSSLD--SPYVPL  323

Query  1475  EVFFLNGDSGQLSVLNRSLN  1534
             +VF LNGDSGQLSVLNR  N
Sbjct  324   DVFLLNGDSGQLSVLNRVFN  343


 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 60/102 (59%), Gaps = 29/102 (28%)
 Frame = +3

Query  195  DDLSDLGAGKEGWLVENPN--LLTALDTHSLALASRSIILVLQWTDAGDPPAKIIPELSP  368
            +DLS+ G GKEGWL  + +  LL ALD HSLA+A+RS+IL+L W+D  +P  +I+     
Sbjct  83   EDLSEFGVGKEGWLAPDASTTLLCALDAHSLAIANRSLILILGWSDPDEPRVQIL-----  137

Query  369  IQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQ  494
                                  GTS G++L+YSLRGDLIH+Q
Sbjct  138  ----------------------GTSRGFILVYSLRGDLIHRQ  157



>ref|XP_002960118.1| hypothetical protein SELMODRAFT_402130 [Selaginella moellendorffii]
 gb|EFJ37657.1| hypothetical protein SELMODRAFT_402130 [Selaginella moellendorffii]
Length=459

 Score =   228 bits (581),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 167/265 (63%), Gaps = 12/265 (5%)
 Frame = +2

Query  752   QIWVVCRCCHHWC-DAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRSI  928
             Q+W V       C DA  +     A    QS +RY+CAVT+G D+ ++A+RLS D+ +S+
Sbjct  194   QVWSVKSSGSSICVDAAITGVLPPALFEQQSRERYFCAVTIGSDSTLAAFRLSEDRRKSL  253

Query  929   VGAILSKVVPATFSTISSISKMLWRSeptpttk--pepkpQPFAKASPLTCLKDYPRKGE  1102
                + +KVVPAT S I+S +K   R+          E K Q F++AS +T LKD PRKGE
Sbjct  254   TELLFNKVVPATVSRITSFAKAFRRNSEPVQEARPAEVKAQEFSRASLITALKDSPRKGE  313

Query  1103  KLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH  1282
              L LSP+ +LAA+TDSLGR+LL+D  ALVVVRLWKGYRDA C F+E  +N  S       
Sbjct  314   SLALSPTCSLAAVTDSLGRVLLVDVHALVVVRLWKGYRDAHCKFLEAPLNGSSGL----Q  369

Query  1283  HEH--IKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEAS-  1453
             H    +K D+ LCLAIHAPR+ +VE+WQ+R GPRL  I C +  ++LQP  +F SS+ + 
Sbjct  370   HRSSCVKEDFSLCLAIHAPRRAVVEVWQLRNGPRLSVIHCSESCRLLQPPSQFWSSDRND  429

Query  1454  --LSSYIPLEVFFLNGDSGQLSVLN  1522
                 SY P  VF L GDSG LS++N
Sbjct  430   HEEESYSPKLVFLLKGDSGLLSLIN  454


 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 115/225 (51%), Gaps = 24/225 (11%)
 Frame = +3

Query  180  GCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTDAGDPPAKI---  350
            GC+   +L  +GAGK GWL ++  L+ A+    +A+A +  ++V  W+ A     +    
Sbjct  11   GCLV-SELGAVGAGKPGWL-DDAALVAAMGRDLVAIARQRSLVVTPWSGAHSSAPRASGF  68

Query  351  ----IPELSPIQAEY-LSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNPAKI  515
                IP  +     Y ++AL WL ++   VLAVGTS G L  YS  GDL+ KQ  N   I
Sbjct  69   SIDSIPAATGADPSYRITALEWLFWEGWSVLAVGTSLGILCFYSEIGDLLIKQSFNVGSI  128

Query  516  LKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQE--RYSQLWDQPVN  689
              L VR    +Q +  + EE+ V    ++AR +  D+QS LRR   E  R S L  Q + 
Sbjct  129  CNLHVRC---NQNKRVTAEELSVAFQSSIARIDALDLQSQLRRRLLEVARNSTLERQLI-  184

Query  690  RYMEDSGDSFGRLPYQLWNVNKYG--LCVDAAIIGVMPPPLMEHQ  818
                       +L YQ+W+V   G  +CVDAAI GV+PP L E Q
Sbjct  185  ------AAESTKLSYQVWSVKSSGSSICVDAAITGVLPPALFEQQ  223



>ref|XP_002984023.1| hypothetical protein SELMODRAFT_119185 [Selaginella moellendorffii]
 gb|EFJ15035.1| hypothetical protein SELMODRAFT_119185 [Selaginella moellendorffii]
Length=459

 Score =   228 bits (581),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/265 (48%), Positives = 167/265 (63%), Gaps = 12/265 (5%)
 Frame = +2

Query  752   QIWVVCRCCHHWC-DAPSSNGTSAAFIVGQSSQRYYCAVTVGDDAVISAYRLSVDKSRSI  928
             Q+W V       C DA  +     A    QS +RY+CAVT+G D+ ++A+RLS D+ +S+
Sbjct  194   QVWSVKSSGSSICVDAAITGVLPPALFEQQSRERYFCAVTIGSDSTLAAFRLSEDRRKSL  253

Query  929   VGAILSKVVPATFSTISSISKMLWRSeptpttk--pepkpQPFAKASPLTCLKDYPRKGE  1102
                + +KVVPAT S I+S +K   R+          E K Q F++AS +T LKD PRKGE
Sbjct  254   TELLFNKVVPATVSRITSFAKAFRRNSEPVQEARPAEVKAQEFSRASLITALKDSPRKGE  313

Query  1103  KLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH  1282
              L LSP+ +LAA+TDSLGR+LL+D  ALVVVRLWKGYRDA C F+E  +N  S       
Sbjct  314   SLALSPTCSLAAVTDSLGRVLLVDVHALVVVRLWKGYRDAHCKFLEAPLNGSSGL----Q  369

Query  1283  HEH--IKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEAS-  1453
             H    +K D+ LCLAIHAPR+ +VE+WQ+R GPRL  I C +  ++LQP  +F SS+ + 
Sbjct  370   HRSSCVKEDFSLCLAIHAPRRAVVEVWQLRNGPRLSVIHCSESCRLLQPPSQFWSSDRND  429

Query  1454  --LSSYIPLEVFFLNGDSGQLSVLN  1522
                 SY P  VF L GDSG LS++N
Sbjct  430   HEEESYSPKLVFLLKGDSGLLSLIN  454


 Score =   109 bits (272),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 115/225 (51%), Gaps = 24/225 (11%)
 Frame = +3

Query  180  GCIACDDLSDLGAGKEGWLVENPNLLTALDTHSLALASRSIILVLQWTDAGDPPAKI---  350
            GC+   +L  +GAGK GWL ++  L+ A+    +A+A +  ++V  W+ A     +    
Sbjct  11   GCLV-SELGAVGAGKPGWL-DDAALVAAMGRDLVAIARQRSLVVTPWSGAHSSAPRASGF  68

Query  351  ----IPELSPIQAEY-LSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQFVNPAKI  515
                IP  +     Y ++AL WL ++   VLAVGTS G L  YS  GDL+ KQ  N   I
Sbjct  69   SIDSIPAATGADPSYRITALEWLFWEGWSVLAVGTSLGILCFYSEIGDLLIKQSFNVGSI  128

Query  516  LKLRVRGTKRDQMQDASLEEVCVVMPGAVARFEGSDIQSMLRRWFQE--RYSQLWDQPVN  689
              L VR    +Q +  + EE+ V    ++AR +  D+QS LRR   E  R S L  Q + 
Sbjct  129  CNLHVRC---NQNKRDTAEELSVAFQSSIARIDALDLQSQLRRRLLEVARNSTLERQLI-  184

Query  690  RYMEDSGDSFGRLPYQLWNVNKYG--LCVDAAIIGVMPPPLMEHQ  818
                       +L YQ+W+V   G  +CVDAAI GV+PP L E Q
Sbjct  185  ------AAESTKLSYQVWSVKSSGSSICVDAAITGVLPPALFEQQ  223



>ref|XP_008793037.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X2 [Phoenix dactylifera]
Length=432

 Score =   223 bits (568),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 137/259 (53%), Positives = 183/259 (71%), Gaps = 12/259 (5%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAG-KEGWLVENPNLLTALDTHSLALA--SRSIILVLQ  317
            MARRS H T +GCIACD++ +LGAG +EGWL ++P LL AL  H+LALA  +RS++LVL 
Sbjct  1    MARRS-HLTHVGCIACDEMEELGAGEREGWL-DDPGLLAALHPHALALAHSARSLVLVLG  58

Query  318  WTDAGDP-----PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDL  482
            W    DP     P KI P L+  +  ++SA+ WL F D+  LA+ TS+G+L +YSL GDL
Sbjct  59   WDRDPDPSSPRQPLKIRPSLAADEG-HISAIEWLPFGDLLALALATSAGHLFVYSLTGDL  117

Query  483  IHKQFVNPAKILKLRVRGTKRDQMQDASLE-EVCVVMPGAVARFEGSDIQSMLRRWFQER  659
            IHKQ ++  ++L+LR R TK    QD+    E+CVV+PG +ARF+GSDIQS+L+RWFQE 
Sbjct  118  IHKQIIHSGRVLRLRFRETKVGSSQDSVASMELCVVLPGVIARFDGSDIQSLLQRWFQEE  177

Query  660  YSQLWDQPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQlllllGS  839
             S++++           +S+GR+P+QLWNV+K+G C DAAI G+MPPPL+E QLLLLLGS
Sbjct  178  RSRIFENRFQNRNTVDENSYGRIPFQLWNVSKFGSCADAAITGLMPPPLLELQLLLLLGS  237

Query  840  QASVIIVQSLLEMML*FLH  896
            Q S I VQ  LE ML + H
Sbjct  238  QVSAITVQLRLERMLRYQH  256


 Score =   174 bits (440),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 95/111 (86%), Gaps = 7/111 (6%)
 Frame = +2

Query  1058  ASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM  1237
             ASPLTCLKD PRKGEKLTLSP GTLAAITDSLGRILLLDTQALVVVRLWKGYRDA CLF+
Sbjct  258   ASPLTCLKDPPRKGEKLTLSPGGTLAAITDSLGRILLLDTQALVVVRLWKGYRDACCLFI  317

Query  1238  EMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTI  1390
             EMLVN+D ++  SA++EH K DYCLCLAIHAPRKGI+E      GP L+ +
Sbjct  318   EMLVNRDKAS-SSAYYEHTKGDYCLCLAIHAPRKGIIE------GPSLEFV  361



>ref|XP_008793036.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X1 [Phoenix dactylifera]
Length=454

 Score =   223 bits (567),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 137/259 (53%), Positives = 183/259 (71%), Gaps = 12/259 (5%)
 Frame = +3

Query  147  MARRSSHTTELGCIACDDLSDLGAG-KEGWLVENPNLLTALDTHSLALA--SRSIILVLQ  317
            MARRS H T +GCIACD++ +LGAG +EGWL ++P LL AL  H+LALA  +RS++LVL 
Sbjct  1    MARRS-HLTHVGCIACDEMEELGAGEREGWL-DDPGLLAALHPHALALAHSARSLVLVLG  58

Query  318  WTDAGDP-----PAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDL  482
            W    DP     P KI P L+  +  ++SA+ WL F D+  LA+ TS+G+L +YSL GDL
Sbjct  59   WDRDPDPSSPRQPLKIRPSLAADEG-HISAIEWLPFGDLLALALATSAGHLFVYSLTGDL  117

Query  483  IHKQFVNPAKILKLRVRGTKRDQMQDASLE-EVCVVMPGAVARFEGSDIQSMLRRWFQER  659
            IHKQ ++  ++L+LR R TK    QD+    E+CVV+PG +ARF+GSDIQS+L+RWFQE 
Sbjct  118  IHKQIIHSGRVLRLRFRETKVGSSQDSVASMELCVVLPGVIARFDGSDIQSLLQRWFQEE  177

Query  660  YSQLWDQPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQlllllGS  839
             S++++           +S+GR+P+QLWNV+K+G C DAAI G+MPPPL+E QLLLLLGS
Sbjct  178  RSRIFENRFQNRNTVDENSYGRIPFQLWNVSKFGSCADAAITGLMPPPLLELQLLLLLGS  237

Query  840  QASVIIVQSLLEMML*FLH  896
            Q S I VQ  LE ML + H
Sbjct  238  QVSAITVQLRLERMLRYQH  256


 Score =   174 bits (440),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 95/111 (86%), Gaps = 7/111 (6%)
 Frame = +2

Query  1058  ASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM  1237
             ASPLTCLKD PRKGEKLTLSP GTLAAITDSLGRILLLDTQALVVVRLWKGYRDA CLF+
Sbjct  258   ASPLTCLKDPPRKGEKLTLSPGGTLAAITDSLGRILLLDTQALVVVRLWKGYRDACCLFI  317

Query  1238  EMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTI  1390
             EMLVN+D ++  SA++EH K DYCLCLAIHAPRKGI+E      GP L+ +
Sbjct  318   EMLVNRDKAS-SSAYYEHTKGDYCLCLAIHAPRKGIIE------GPSLEFV  361



>ref|XP_007099613.1| Receptor like protein 33 [Theobroma cacao]
 gb|EOY20414.1| Receptor like protein 33 [Theobroma cacao]
Length=991

 Score =   209 bits (532),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 131/189 (69%), Gaps = 24/189 (13%)
 Frame = +3

Query  252  LLTALDTHSLALASRSIILVLQWTDAGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLA  431
            LL A+D HSLA+A+RS+IL L W+D  +    + P++SPI+AE+++A+ WLVF +IK+  
Sbjct  812  LLCAVDAHSLAIANRSLILTLGWSDPDELRVNMRPDISPIEAEHITAIEWLVFYEIKM--  869

Query  432  VGTSSGYLLIYSLRGDLIHKQFVNPAKILKLRVRGTKRDQMQDASLEEVCVVMPGAVARF  611
                                  V P +I+KLRVRGTK+D  QD S EEVCVV+PG +ARF
Sbjct  870  ----------------------VYPGRIVKLRVRGTKKDLTQDISSEEVCVVIPGVIARF  907

Query  612  EGSDIQSMLRRWFQERYSQLWDQPVNRYMEDSGDSFGRLPYQLWNVNKYGLCVDAAIIGV  791
            +GSDIQSML+RWFQE +S  WDQ   +  ED G+S+GRLPYQLWNVNKYG CVDAAI G+
Sbjct  908  DGSDIQSMLQRWFQETHSLFWDQKPKKDSEDIGNSYGRLPYQLWNVNKYGTCVDAAITGI  967

Query  792  MPPPLMEHQ  818
            MP  LME Q
Sbjct  968  MPLLLMELQ  976



>ref|XP_007099618.1| Uncharacterized protein TCM_046018 [Theobroma cacao]
 gb|EOY20419.1| Uncharacterized protein TCM_046018 [Theobroma cacao]
Length=309

 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = +2

Query  1055  KASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLF  1234
             + SPLTCLKD+PRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC F
Sbjct  201   QPSPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCFF  260

Query  1235  MEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRT  1369
             MEMLVNK++    S+++E  KSDYCLCLAIHAP+KGIVE+WQMRT
Sbjct  261   MEMLVNKEAIGSGSSYYEPGKSDYCLCLAIHAPQKGIVEVWQMRT  305


 Score =   153 bits (386),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 98/119 (82%), Gaps = 3/119 (3%)
 Frame = +3

Query  147  MARRS-SHTTELGCIACDDLSDLGAGKEGWLVEN--PNLLTALDTHSLALASRSIILVLQ  317
            M++RS  H T+LGCIA +DLS+ GAGKEGWL  +  P  L ALD HSLA+A+RS+IL+L 
Sbjct  1    MSKRSYHHLTDLGCIAGEDLSEFGAGKEGWLAPDASPTHLCALDAHSLAIANRSLILILG  60

Query  318  WTDAGDPPAKIIPELSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGDLIHKQ  494
            W+D  +P  +I PELSPI+AE+++A+ WLVFD+IKV+AVGTS G++L+YS+RGDLIH+Q
Sbjct  61   WSDTDEPRVQIRPELSPIEAEHITAIEWLVFDEIKVIAVGTSRGFILVYSVRGDLIHRQ  119


 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  699  EDSGDSFGRLPYQLWNVNKYGLCVDAAIIGVMPPPLMEHQ  818
            ED G+S+GRLPYQ+WNVNKYG CVDAAI G+MPPPLME Q
Sbjct  126  EDKGNSYGRLPYQVWNVNKYGTCVDAAITGIMPPPLMELQ  165



>ref|XP_010113082.1| hypothetical protein L484_000038 [Morus notabilis]
 gb|EXC62906.1| hypothetical protein L484_000038 [Morus notabilis]
Length=61

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 2/63 (3%)
 Frame = +2

Query  1346  VEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPLEVFFLNGDSGQLSVLNR  1525
             ++IWQMRTGPRL+TI C KGSKI+Q TYRF SS A  S Y+PLEVF LNGDSGQ+SVLNR
Sbjct  1     MQIWQMRTGPRLRTIQCAKGSKIIQATYRFGSSVA--SPYVPLEVFLLNGDSGQISVLNR  58

Query  1526  SLN  1534
             +L+
Sbjct  59    TLS  61



>gb|ELU04193.1| hypothetical protein CAPTEDRAFT_19824 [Capitella teleta]
Length=1405

 Score =   105 bits (262),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 96/175 (55%), Gaps = 12/175 (7%)
 Frame = +2

Query  923   SIVGAILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTCLK------D  1084
              +  A+ SK+  A FS IS+ S  L     +     + + +P  K  P T L       D
Sbjct  316   DVAHAVASKLKSALFSQISAASGWLGLGGTSGAESTQREKKP--KIEPATALPLRFGLYD  373

Query  1085  YPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSS  1264
               R+GEKL LSP+G L A TDS GR++L+D    V VR+WKGYRDA   F+ M   +D  
Sbjct  374   KRRQGEKLCLSPNGLLLATTDSFGRVILVDVTRGVAVRMWKGYRDAQLAFVAM--TEDQL  431

Query  1265  TLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTY  1429
             T +++  + ++    L L I+APR+GI+E+W  + GPR+      K S++L P Y
Sbjct  432   TERASRSQPLRR--ALFLVIYAPRRGILEVWTAQQGPRVAAFNVSKWSQLLCPGY  484



>ref|XP_007574971.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Poecilia formosa]
Length=1375

 Score = 90.1 bits (222),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 92/198 (46%), Gaps = 11/198 (6%)
 Frame = +2

Query  863   VTVGDDAVISAYRLSVDKSRSIVG----AILSKVVPATFSTISSISKMLWRSeptpttkp  1030
             VTVG       Y      S+ ++     A+ SK+  A F+  S    + W          
Sbjct  310   VTVGTGPYAGFYYAVEGNSQPLLSHVALAVASKLTSALFNAASGW--LGWNKNKNEEEAA  367

Query  1031  epkpQPFAKASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRL  1201
             + +      A+PL     L D  R GE + LSP  TLA +TD  GR+ LLD      +R+
Sbjct  368   QKQKPKVEPATPLGIRFGLPDSRRHGESICLSPCNTLAGVTDDFGRVTLLDLARGAAIRM  427

Query  1202  WKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRL  1381
             WKGYRDA   +++  V ++    + +    +   + L L I+APR+GI+E+W M+ GPR+
Sbjct  428   WKGYRDAQLGWLQ--VQEERGDREFSPSASLPRRHALFLIIYAPRRGILEVWAMQRGPRV  485

Query  1382  QTIPCPKGSKILQPTYRF  1435
                   K  ++L   Y  
Sbjct  486   GAFTVGKHCRLLYAGYHL  503


 Score = 37.4 bits (85),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 34/131 (26%), Positives = 52/131 (40%), Gaps = 13/131 (10%)
 Frame = +3

Query  414  DIKVLAVGTSSGYLLIYSLRGDLIHKQF--VNPAKILKLRVRGTKRDQMQDASLEEVCVV  587
            D   + VG +SGY+  Y+  G L+  Q   V+P   LK R     R        EE+ ++
Sbjct  157  DWTCIVVGFTSGYVRFYTESGVLLLAQLLHVDPVLRLKCRTYEIPRHPGVTEQHEELSIL  216

Query  588  MPGAVARFEGSDIQSMLRRWFQERYSQLWDQPVNRYMEDSGDSFGRLP--YQLWNVNKYG  761
             P A+   +G  +   LR    +         V R      D     P  Y+ W + +  
Sbjct  217  YPAALVTIDGFSLFQSLRACRNQ---------VARAAAAGSDVVPPPPLAYKKWGLQEMD  267

Query  762  LCVDAAIIGVM  794
              VD + +GVM
Sbjct  268  TIVDHSSVGVM  278



>ref|XP_007021773.1| Uncharacterized protein TCM_031840 [Theobroma cacao]
 gb|EOY13298.1| Uncharacterized protein TCM_031840 [Theobroma cacao]
Length=116

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%), Gaps = 3/100 (3%)
 Frame = +3

Query  186  IACDDLSDLGAGKEGWLVENPN--LLTALDTHSLALASRSIILVLQWTDAGDPPAKIIPE  359
            IA +DLS+ G GK GWL  + +   L ALD HSLA+A+RSIIL+L W+D  +P ++ +P 
Sbjct  18   IAGEDLSEFGPGKVGWLAPDASTTFLCALDAHSLAIANRSIILILGWSDPDEPWSRSVPN  77

Query  360  LSPIQAEYLSALAWLVFDDIKVLAVGTSSGYLLIYSLRGD  479
               +    + A+ WLVFD+IK +AVGTS  ++L+YSLRGD
Sbjct  78   CH-LSRPSIMAIEWLVFDEIKAIAVGTSRWFILVYSLRGD  116



>ref|NP_001120595.1| rab3 GTPase-activating protein, non-catalytic subunit [Xenopus 
(Silurana) tropicalis]
 gb|AAI61630.1| LOC100145752 protein [Xenopus (Silurana) tropicalis]
Length=1408

 Score =   102 bits (253),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 98/174 (56%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+     + + KP+    A+PL     L D  R GE+
Sbjct  355   AVASKLTSALFSAASGW--LGWKSKHEEEPQQKQKPK-VEPANPLAVRFGLPDSRRHGER  411

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             ++LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +M+++ +      +  HH
Sbjct  412   VSLSPCNTLAAVTDDFGRVILLDVGRGIAIRMWKGYRDAQVGWMQIVEDLHERESERGHH  471

Query  1286  ---EHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                +++K  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  472   SPFQNVKGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  525



>ref|XP_010640976.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Fukomys damarensis]
Length=1386

 Score = 99.8 bits (247),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 96/178 (54%), Gaps = 17/178 (10%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+         KP+    A+PL     L D  R GE 
Sbjct  307   AVASKLTSALFNAASGW--LGWKSKHEEEAVQRQKPK-VEPATPLAVRFGLPDSRRHGES  363

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN--------KDS  1261
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   +++++ +        +DS
Sbjct  364   ICLSPCNTLAAVTDDFGRVILLDVARGIAVRMWKGYRDAQAGWVQVVEDLQERAPGREDS  423

Query  1262  STLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             S  +S+      + +   L I+APR+GI+E+W MR GPR+      K  ++L P Y+ 
Sbjct  424   SPFRSSQGPSRVAQF---LVIYAPRRGILEVWAMRQGPRVGAFNVGKHCRLLYPGYKI  478



>ref|XP_010766356.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Notothenia coriiceps]
Length=1372

 Score = 98.6 bits (244),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 76/233 (33%), Positives = 108/233 (46%), Gaps = 20/233 (9%)
 Frame = +2

Query  863   VTVGDDAVISAYRLSVDKSRSIVG----AILSKVVPATFSTISSISKMLWRSeptpttkp  1030
             VTVG       Y      S+ ++     A+ SK+  A FS  S    + W          
Sbjct  309   VTVGGGPYTGFYYAVEGSSQPLLSHVALAVASKLTSALFSAASGW--LGWNKHKNEEEAV  366

Query  1031  epkpQPFAKASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRL  1201
             + +      A+PLT    L D  R GE + LSP  TLA +TD  GR+ LLD    V +R+
Sbjct  367   QKQKPKVEPATPLTIRFGLPDSRRHGESICLSPCNTLAGVTDDFGRVSLLDLARGVAIRM  426

Query  1202  WKGYRDASCLFM---EMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             WKGYRDA   ++   E  V+++SS   S    H      L L I+APR+GI+E+W M+ G
Sbjct  427   WKGYRDAQLGWLQVPEERVDRESSPSASHPRRH-----ALFLVIYAPRRGILEVWGMQHG  481

Query  1373  PRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPL---EVFFLNGDSGQLSVLN  1522
             PR+      K  ++L   YR     +  S    L   +V  L+  +G L  +N
Sbjct  482   PRVGAFTVGKHCRLLYAGYRLMGVNSVTSKGWQLHTQQVCLLDPITGALRTVN  534



>ref|XP_010766353.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Notothenia coriiceps]
 ref|XP_010766354.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Notothenia coriiceps]
Length=1390

 Score = 98.6 bits (244),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 76/233 (33%), Positives = 108/233 (46%), Gaps = 20/233 (9%)
 Frame = +2

Query  863   VTVGDDAVISAYRLSVDKSRSIVG----AILSKVVPATFSTISSISKMLWRSeptpttkp  1030
             VTVG       Y      S+ ++     A+ SK+  A FS  S    + W          
Sbjct  309   VTVGGGPYTGFYYAVEGSSQPLLSHVALAVASKLTSALFSAASGW--LGWNKHKNEEEAV  366

Query  1031  epkpQPFAKASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRL  1201
             + +      A+PLT    L D  R GE + LSP  TLA +TD  GR+ LLD    V +R+
Sbjct  367   QKQKPKVEPATPLTIRFGLPDSRRHGESICLSPCNTLAGVTDDFGRVSLLDLARGVAIRM  426

Query  1202  WKGYRDASCLFM---EMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             WKGYRDA   ++   E  V+++SS   S    H      L L I+APR+GI+E+W M+ G
Sbjct  427   WKGYRDAQLGWLQVPEERVDRESSPSASHPRRH-----ALFLVIYAPRRGILEVWGMQHG  481

Query  1373  PRLQTIPCPKGSKILQPTYRFSSSEASLSSYIPL---EVFFLNGDSGQLSVLN  1522
             PR+      K  ++L   YR     +  S    L   +V  L+  +G L  +N
Sbjct  482   PRVGAFTVGKHCRLLYAGYRLMGVNSVTSKGWQLHTQQVCLLDPITGALRTVN  534



>gb|EZA61233.1| Rab3 GTPase-activating protein non-catalytic subunit [Cerapachys 
biroi]
Length=1176

 Score = 98.6 bits (244),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 84/138 (61%), Gaps = 7/138 (5%)
 Frame = +2

Query  1067  LTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM  1237
             +TC   L D  R+G+ +  SP+ TL+ I+D++GR++L++ +  + VR+WKGYRDA C ++
Sbjct  93    MTCRFGLSDIMREGDCIVCSPNKTLSVISDAMGRVILVNNRRGIAVRMWKGYRDAQCGWI  152

Query  1238  EMLVNKDSSTLKSAHHEHIKS--DYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSK  1411
             E+   +D    KS      KS     L L I+AP+KG+++IW ++ GP++ T    K  +
Sbjct  153   EVTEERDRGIHKSVGKSARKSLLRTALFLVIYAPKKGVIDIWNIQQGPKITTFTASKNGR  212

Query  1412  ILQPTYRF--SSSEASLS  1459
             +L   Y +  ++  ASLS
Sbjct  213   LLYINYGYLGANDNASLS  230



>ref|XP_004613073.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Sorex araneus]
Length=1385

 Score = 98.6 bits (244),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 93/174 (53%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R+GE 
Sbjct  332   AVASKLTSALFNAASGW--LGWKSKHEEEAFQKQKPK-VEPATPLAVRFGLPDSRRRGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      D + L
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVSRGIAIRMWKGYRDAQVGWIQIVEDLHERVPDRADL  448

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 H    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  449   SPFGHNQGPSRVAQFLVIYAPRRGILEVWNTQQGPRVGAFNVGKHCRLLYPGYK  502



>gb|KFO25393.1| Rab3 GTPase-activating protein non-catalytic subunit [Fukomys 
damarensis]
Length=1476

 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 75/128 (59%), Gaps = 11/128 (9%)
 Frame = +2

Query  1076  LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-  1252
             L D  R GE + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   +++++ + 
Sbjct  494   LPDSRRHGESICLSPCNTLAAVTDDFGRVILLDVARGIAVRMWKGYRDAQAGWVQVVEDL  553

Query  1253  -------KDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSK  1411
                    +DSS  +S+      + +   L I+APR+GI+E+W MR GPR+      K  +
Sbjct  554   QERAPGREDSSPFRSSQGPSRVAQF---LVIYAPRRGILEVWAMRQGPRVGAFNVGKHCR  610

Query  1412  ILQPTYRF  1435
             +L P Y+ 
Sbjct  611   LLYPGYKI  618



>gb|EFN79470.1| Rab3 GTPase-activating protein non-catalytic subunit [Harpegnathos 
saltator]
Length=1236

 Score = 96.7 bits (239),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 79/128 (62%), Gaps = 5/128 (4%)
 Frame = +2

Query  1067  LTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM  1237
             +TC   L D  R+G+ +T SP+  L+ I+D++GR++L++ +  + VR+WKGYRDA C ++
Sbjct  297   MTCRFGLSDIMREGDCITCSPNKVLSVISDAMGRVILINNKKGIAVRMWKGYRDAQCGWI  356

Query  1238  EMLVNKDSSTLKSAHHEHIKS--DYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSK  1411
             E+   KD    K+ +    K+     + L I+AP+KG+++IW ++ GP++ T    K  +
Sbjct  357   EVNEEKDRGIHKNINRPMQKTLLRTTMFLVIYAPKKGVIDIWSIQQGPKITTFTASKNGR  416

Query  1412  ILQPTYRF  1435
             +L   Y F
Sbjct  417   LLYINYGF  424



>ref|XP_008307451.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit, 
partial [Cynoglossus semilaevis]
Length=1357

 Score = 96.7 bits (239),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 96/202 (48%), Gaps = 10/202 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W          +        A+PL     L D  R GE 
Sbjct  340   AVASKLTSALFSAASGW--LGWNKNKHEEESVQKHKPKVEAATPLGIRFGLPDSRRHGES  397

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR+ LLD    V VR+WKGYRDA   +++  ++++      +  
Sbjct  398   ICLSPCNTLAGVTDDFGRVTLLDLSRGVAVRMWKGYRDAQLGWLQ--ISEERGDRDFSPS  455

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
               +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   YR     +  S  
Sbjct  456   ASLPRRHALFLVIYAPRRGILEVWAMQQGPRVGAFTVGKHCRLLYAGYRLMGVNSVTSQG  515

Query  1466  IPL---EVFFLNGDSGQLSVLN  1522
               L   +V  L+  SG L  +N
Sbjct  516   WQLHTQQVCLLDPGSGALRTVN  537



>gb|EFN66870.1| Rab3 GTPase-activating protein non-catalytic subunit [Camponotus 
floridanus]
Length=1018

 Score = 96.3 bits (238),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 79/132 (60%), Gaps = 4/132 (3%)
 Frame = +2

Query  1076  LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNK  1255
             L D  R+G+ +  SP+  L+ I+D++GR+LL++ +  V VRLWKGYRDA C ++E    K
Sbjct  340   LSDIMREGDCIVCSPNKMLSVISDAMGRVLLINNKRGVAVRLWKGYRDAQCGWIEATEEK  399

Query  1256  DSSTLKSAHH--EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTY  1429
             D    ++ +     I     L L I+AP+KG+++IW ++ GP++ T    K  ++L   Y
Sbjct  400   DRGIHRNINKSGRKILLRTALFLVIYAPKKGVIDIWSIQQGPKITTFTASKNGRLLYINY  459

Query  1430  RF--SSSEASLS  1459
              F  ++  A+LS
Sbjct  460   GFLGANDNATLS  471



>ref|XP_001627803.1| predicted protein [Nematostella vectensis]
 gb|EDO35703.1| predicted protein [Nematostella vectensis]
Length=575

 Score = 95.1 bits (235),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 101/194 (52%), Gaps = 19/194 (10%)
 Frame = +2

Query  854   YCAVTVGDDAVISAYRLSVDKSRSIVGAILSKVVPATFSTISSISKML-WRSeptpttkp  1030
             YCA+      +IS           +  A+ SK+  A  S +S+ S  L W S+P      
Sbjct  254   YCAIEGSGPPLIS----------DVAMAVASKLTSAVLSRLSAASGWLGWGSKPAAQPAE  303

Query  1031  epk-----pQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVV  1195
             + K      +  AK +    L D+PR+G  +TL+P+G +A  TD  GR++LLD +  + +
Sbjct  304   QTKPPKPKVEKGAKLAARFGLPDFPRRGTNITLAPNGKVAVTTDEFGRVMLLDVKKGIAI  363

Query  1196  RLWKGYRDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGP  1375
             R+WKGYR+A C ++ +  +  +S   S + +H  +   L L I+A ++GI+EIW+   GP
Sbjct  364   RMWKGYREAECGWIMVDEDDFTSHEPSTNEQHRTA---LFLVIYAAKRGILEIWRAEQGP  420

Query  1376  RLQTIPCPKGSKIL  1417
             R+      K  ++L
Sbjct  421   RVAAFNIGKDCRLL  434



>gb|KFM80974.1| Rab3 GTPase-activating protein non-catalytic subunit, partial 
[Stegodyphus mimosarum]
Length=751

 Score = 95.1 bits (235),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 79/143 (55%), Gaps = 6/143 (4%)
 Frame = +2

Query  1076  LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNK  1255
             L D  R+G  ++LSP+  LAA+TD+ GR++L D    V VR+WKGYRDA C ++E+    
Sbjct  372   LYDKRRQGISISLSPNKCLAAVTDAFGRVILFDIFKGVAVRMWKGYRDAQCGWVEV----  427

Query  1256  DSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             + S +K       ++     L I+APR+GI+E+W ++ GPR+      K  ++  P Y  
Sbjct  428   EDSIMKDKKENSKRNRRVFFLVIYAPRRGILEVWCIQQGPRVAAFNVGKTGRLFCPGYAM  487

Query  1436  --SSSEASLSSYIPLEVFFLNGD  1498
                S   SLS       +FL+ D
Sbjct  488   VGGSFSTSLSKDHLCSCYFLDID  510



>ref|XP_005929682.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Haplochromis burtoni]
Length=1368

 Score = 95.1 bits (235),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 87/173 (50%), Gaps = 7/173 (4%)
 Frame = +2

Query  926   IVGAILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRK  1096
             +  A+ SK+  A FS  S    + W         P+ +      A+PL+    L D  R 
Sbjct  335   VAMAVASKLTSALFSAASGW--LGWNKNKNEEEAPQKQKPKVEPATPLSIRFGLPDSRRH  392

Query  1097  GEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKS  1276
             GE + LSP  TLA +TD  GR+ LLD    + VR+WKGYRDA   ++++   +    L  
Sbjct  393   GESICLSPCNTLAGVTDDFGRVTLLDLARGIAVRMWKGYRDAQLGWLQVPEERSERDLSP  452

Query  1277  AHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +    +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   YR 
Sbjct  453   S--ASLPRRHALFLVIYAPRRGILEVWAMQQGPRVGAFTVGKHCRLLYAGYRL  503



>ref|XP_009579941.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like, 
partial [Fulmarus glacialis]
Length=562

 Score = 94.4 bits (233),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 94/177 (53%), Gaps = 17/177 (10%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  352   AVASKLTSALFNAASGW--LGWKSKHEEEPAQKQKPK-VEPATPLAVRFGLPDSRRHGER  408

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN--------KDS  1261
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   +++ + +         D 
Sbjct  409   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDF  468

Query  1262  STLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
             S   +AH     + +   L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  469   SPFGNAHGPSRVAQF---LVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYK  522



>ref|XP_006786359.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Neolamprologus brichardi]
Length=1335

 Score = 95.1 bits (235),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 88/173 (51%), Gaps = 7/173 (4%)
 Frame = +2

Query  926   IVGAILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRK  1096
             +  A+ SK+  A FS  S    + W         P+ +      A+PL+    L D  R 
Sbjct  302   VAMAVASKLTSALFSAASGW--LGWNKNKNEEEAPQKQKPKVEPATPLSIRFGLPDSRRH  359

Query  1097  GEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKS  1276
             GE + LSP  TLA +TD  GR+ LLD    + +R+WKGYRDA   +++  V ++ S    
Sbjct  360   GESICLSPCNTLAGVTDDFGRVTLLDLARGIAIRMWKGYRDAQLGWLQ--VPEERSERDF  417

Query  1277  AHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +    +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   YR 
Sbjct  418   SPSASLPRRHALFLVIYAPRRGILEVWAMQQGPRVGAFTVGKHCRLLYAGYRL  470



>ref|XP_003447880.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Oreochromis niloticus]
Length=1368

 Score = 94.7 bits (234),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 99/205 (48%), Gaps = 10/205 (5%)
 Frame = +2

Query  926   IVGAILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRK  1096
             +  A+ SK+  A FS  S    + W         P+ +      A+PL+    L D  R 
Sbjct  335   VAMAVASKLTSALFSAASGW--LGWNKNKNEEEAPQKQKPKVEPATPLSIRFGLPDSRRH  392

Query  1097  GEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKS  1276
             GE + LSP  TLA +TD  GR+ LLD    + +R+WKGYRDA   ++++   +    L  
Sbjct  393   GESICLSPCNTLAGVTDDFGRVTLLDLARGIAIRMWKGYRDAQLGWLQVPEERSERDLSP  452

Query  1277  AHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASL  1456
             +    +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   YR     +  
Sbjct  453   S--ASLPRRHALFLIIYAPRRGILEVWAMQQGPRVGAFTVGKHCRLLYAGYRLMGVNSVT  510

Query  1457  SSYIPL---EVFFLNGDSGQLSVLN  1522
             S    L   +V  L+  +G L  +N
Sbjct  511   SQGWQLHTQQVCLLDPITGALRTVN  535



>ref|XP_009074027.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit, 
partial [Acanthisitta chloris]
Length=820

 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  294   AVASKLTSALFNAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGER  350

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  + S
Sbjct  351   ICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLQERETEKMDS  410

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  411   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  465



>ref|XP_008934340.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit, 
partial [Merops nubicus]
Length=1347

 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 97/175 (55%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+    + P+ KP+    A+PL     L D  R GE+
Sbjct  295   AVASKLTSALFNAASGW--LGWKSKHEEESAPKQKPK-VEPATPLAVRFGLPDSRRHGER  351

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   +M   E L  +++  + S
Sbjct  352   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEVGWMQTVEDLHERETEKMDS  411

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  412   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  466



>gb|KFQ25872.1| Rab3 GTPase-activating protein non-catalytic subunit, partial 
[Merops nubicus]
Length=1347

 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 97/175 (55%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+    + P+ KP+    A+PL     L D  R GE+
Sbjct  297   AVASKLTSALFNAASGW--LGWKSKHEEESAPKQKPK-VEPATPLAVRFGLPDSRRHGER  353

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   +M   E L  +++  + S
Sbjct  354   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEVGWMQTVEDLHERETEKMDS  413

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  414   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  468



>ref|XP_008300512.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Stegastes partitus]
Length=1381

 Score = 94.0 bits (232),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 98/202 (49%), Gaps = 10/202 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W    T     + +      A+PL     L D  R GE 
Sbjct  346   AVASKLTSALFSAASGW--LGWNKNKTEEEVVQKQKPKVEPATPLGIRFGLPDSRRHGES  403

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR+ LLD    + +R+WKGYRDA   +++  V ++    + +  
Sbjct  404   ICLSPCNTLAGVTDDFGRVTLLDLARGIAIRMWKGYRDAQLGWLQ--VPEERGDREFSPS  461

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
               +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   YR     +  S  
Sbjct  462   ASLPRRHALFLVIYAPRRGILEVWAMQQGPRVGAFTVGKHCRLLYAGYRLMGVNSVTSQG  521

Query  1466  IPL---EVFFLNGDSGQLSVLN  1522
               L   +V  ++  +G L  +N
Sbjct  522   WQLHTQQVCLMDPSTGALRTVN  543



>gb|KFP81071.1| Rab3 GTPase-activating protein non-catalytic subunit, partial 
[Acanthisitta chloris]
Length=834

 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 77/134 (57%), Gaps = 8/134 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA  
Sbjct  346   ATPLAVRFGLPDSRRHGERICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEV  405

Query  1229  LFM---EMLVNKDSSTLKSAHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              ++   E L  +++  + S+   + +  S     L I+APR+GI+E+W  + GPR+    
Sbjct  406   GWIQTVEDLQERETEKMDSSPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  465

Query  1394  CPKGSKILQPTYRF  1435
               K  ++L P Y+ 
Sbjct  466   VGKHCRLLYPGYKI  479



>ref|XP_006608455.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Apis dorsata]
Length=1364

 Score = 94.0 bits (232),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 46/127 (36%), Positives = 73/127 (57%), Gaps = 5/127 (4%)
 Frame = +2

Query  1064  PLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLF  1234
             P+TC   L D  R+G  +  SP+  L+ I D++GR+LL+D +  + +R+WKGYRDA C +
Sbjct  339   PMTCRFGLSDVTREGYSIISSPNKALSVILDAMGRVLLIDNKCCIAIRMWKGYRDAQCGW  398

Query  1235  MEMLVNKDSSTLK--SAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGS  1408
             +E+   K S   K  S   +  +      L I+AP+KGI++IW  + GP++ T    K  
Sbjct  399   IEVEEEKHSGMHKAFSKFKQTPQLRSAFFLVIYAPKKGIIDIWSTQQGPKITTFTASKHG  458

Query  1409  KILQPTY  1429
             ++L   Y
Sbjct  459   RLLYINY  465



>gb|KFW78517.1| Rab3 GTPase-activating protein non-catalytic subunit, partial 
[Manacus vitellinus]
Length=1345

 Score = 94.0 bits (232),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 77/134 (57%), Gaps = 8/134 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA  
Sbjct  334   ATPLAVRFGLPDSRRHGERICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEV  393

Query  1229  LFM---EMLVNKDSSTLKSAHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              ++   E L  ++S  + S+   + +  S     L I+APR+GI+E+W  + GPR+    
Sbjct  394   GWIQTVEDLQERESEKMDSSPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  453

Query  1394  CPKGSKILQPTYRF  1435
               K  ++L P Y+ 
Sbjct  454   VGKYCRLLYPGYKI  467



>ref|XP_008919240.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Manacus vitellinus]
Length=1390

 Score = 94.0 bits (232),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 77/134 (57%), Gaps = 8/134 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA  
Sbjct  376   ATPLAVRFGLPDSRRHGERICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEV  435

Query  1229  LFM---EMLVNKDSSTLKSAHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              ++   E L  ++S  + S+   + +  S     L I+APR+GI+E+W  + GPR+    
Sbjct  436   GWIQTVEDLQERESEKMDSSPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  495

Query  1394  CPKGSKILQPTYRF  1435
               K  ++L P Y+ 
Sbjct  496   VGKYCRLLYPGYKI  509



>ref|XP_003697293.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform 2 [Apis florea]
Length=1365

 Score = 94.0 bits (232),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 46/129 (36%), Positives = 75/129 (58%), Gaps = 9/129 (7%)
 Frame = +2

Query  1064  PLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLF  1234
             P+TC   L D  R+G  +  SP+  L+ I D++GR+LL+D +  + +R+WKGYRDA C +
Sbjct  339   PMTCRFGLSDVTREGYSIISSPNKALSVILDAMGRVLLIDNKCCIAIRMWKGYRDAQCGW  398

Query  1235  MEMLVNKDSST----LKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPK  1402
             +E+   K S      +K      ++S +   L I+AP+KGI++IW  + GP++ T    K
Sbjct  399   IEVEEEKHSGMHKAFIKFKQTPQLRSAF--FLVIYAPKKGIIDIWSTQQGPKITTFTASK  456

Query  1403  GSKILQPTY  1429
               ++L   Y
Sbjct  457   HGRLLYINY  465



>ref|XP_006571194.1| PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-activating protein 
non-catalytic subunit-like [Apis mellifera]
Length=1388

 Score = 93.6 bits (231),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 46/129 (36%), Positives = 75/129 (58%), Gaps = 9/129 (7%)
 Frame = +2

Query  1064  PLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLF  1234
             P+TC   L D  R+G  +  SP+  L+ I D++GR+LL+D +  + +R+WKGYRDA C +
Sbjct  339   PMTCRFGLSDVTREGYSIISSPNKALSVILDAMGRVLLIDNKCCIAIRMWKGYRDAQCGW  398

Query  1235  MEMLVNKDSSTLKS----AHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPK  1402
             +E+   K S   K+         ++S +   L I+AP+KGI++IW  + GP++ T    K
Sbjct  399   IEVEEEKHSGMHKAFTKFKQTPQLRSAF--FLVIYAPKKGIIDIWSTQQGPKITTFTASK  456

Query  1403  GSKILQPTY  1429
               ++L   Y
Sbjct  457   HGRLLYINY  465



>ref|XP_010734699.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Larimichthys crocea]
Length=1374

 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 98/202 (49%), Gaps = 10/202 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W    +     + +      A+PL     L D  R GE 
Sbjct  337   AVASKLTSALFSAASGW--LGWNKNKSEEEAVQKQKPKVEAATPLGIRFGLPDSRRHGES  394

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR+ LLD    + +R+WKGYRDA   +++  V ++    + +  
Sbjct  395   ICLSPCNTLAGVTDDFGRVTLLDLARGIAIRMWKGYRDAQLGWLQ--VPEERGDREFSPS  452

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
               +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   YR     +  S  
Sbjct  453   ASLPRRHALFLVIYAPRRGILEVWAMQHGPRVGAFTVGKHCRLLYAGYRLMGVNSVTSQG  512

Query  1466  IPL---EVFFLNGDSGQLSVLN  1522
               L   +V  L+  +G L  +N
Sbjct  513   WQLHTQQVCLLDPITGALRTVN  534



>ref|XP_004082764.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Oryzias latipes]
Length=1343

 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 97/208 (47%), Gaps = 16/208 (8%)
 Frame = +2

Query  926   IVGAILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRK  1096
             +  A+ SK+  A FS  S    + W    T       +      A+PL     L D  R 
Sbjct  398   VAMAVASKLTSALFSAASGW--LGWNKSKTEEDSTPKQRPKVEPATPLGIRFGLPDSRRH  455

Query  1097  GEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSST  1267
             GE + LSP  TLA +TD  GR+ LLD    + +R+WKGYRDA   ++   E   ++D S 
Sbjct  456   GESICLSPCNTLAGVTDDFGRVTLLDLARGISIRMWKGYRDAQLGWLQVREERGDRDFSP  515

Query  1268  LKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSE  1447
               S    H      L L I+APR+GI+E+W M+ GPR+      K  ++L   YR     
Sbjct  516   TGSMPRRH-----ALFLIIYAPRRGILEVWAMQRGPRVGAFTVGKHCRLLYAGYRLMGVN  570

Query  1448  ASLSSYIPL---EVFFLNGDSGQLSVLN  1522
             +  S    L   +V  L+  SG L  +N
Sbjct  571   SVTSQGWQLHTQQVCLLDPSSGVLRTVN  598



>ref|XP_010734698.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Larimichthys crocea]
Length=1375

 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 98/202 (49%), Gaps = 10/202 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W    +     + +      A+PL     L D  R GE 
Sbjct  337   AVASKLTSALFSAASGW--LGWNKNKSEEEAVQKQKPKVEAATPLGIRFGLPDSRRHGES  394

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR+ LLD    + +R+WKGYRDA   +++  V ++    + +  
Sbjct  395   ICLSPCNTLAGVTDDFGRVTLLDLARGIAIRMWKGYRDAQLGWLQ--VPEERGDREFSPS  452

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
               +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   YR     +  S  
Sbjct  453   ASLPRRHALFLVIYAPRRGILEVWAMQHGPRVGAFTVGKHCRLLYAGYRLMGVNSVTSQG  512

Query  1466  IPL---EVFFLNGDSGQLSVLN  1522
               L   +V  L+  +G L  +N
Sbjct  513   WQLHTQQVCLLDPITGALRTVN  534



>ref|XP_003697292.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform 1 [Apis florea]
Length=1416

 Score = 93.6 bits (231),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 46/129 (36%), Positives = 75/129 (58%), Gaps = 9/129 (7%)
 Frame = +2

Query  1064  PLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLF  1234
             P+TC   L D  R+G  +  SP+  L+ I D++GR+LL+D +  + +R+WKGYRDA C +
Sbjct  339   PMTCRFGLSDVTREGYSIISSPNKALSVILDAMGRVLLIDNKCCIAIRMWKGYRDAQCGW  398

Query  1235  MEMLVNKDSST----LKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPK  1402
             +E+   K S      +K      ++S +   L I+AP+KGI++IW  + GP++ T    K
Sbjct  399   IEVEEEKHSGMHKAFIKFKQTPQLRSAF--FLVIYAPKKGIIDIWSTQQGPKITTFTASK  456

Query  1403  GSKILQPTY  1429
               ++L   Y
Sbjct  457   HGRLLYINY  465



>gb|KFO84451.1| Rab3 GTPase-activating protein non-catalytic subunit, partial 
[Buceros rhinoceros silvestris]
Length=1343

 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 92/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  297   AVASKLTSALFNAASGW--LGWKSKHEEELAQKQKPK-VEPATPLAVRFGLPDSRRHGER  353

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   +++ + +      +   L
Sbjct  354   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDL  413

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 + H  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  414   SPFGNAHGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  468



>ref|XP_008397867.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X4 [Poecilia reticulata]
Length=1374

 Score = 93.6 bits (231),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 96/202 (48%), Gaps = 10/202 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W          + +      A+PL     L D  R GE 
Sbjct  338   AVASKLTSALFNAASGW--LGWNKNKNEEEAAQKQKPKVEPATPLAIRFGLPDSRRHGES  395

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR+ LLD    V +R+WKGYRDA   +++  V ++    + +  
Sbjct  396   ICLSPCNTLAGVTDDFGRVTLLDLARGVTIRMWKGYRDAQLGWLQ--VQEERGDREFSPS  453

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
               +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   Y      +  S  
Sbjct  454   ASLPRRHALFLIIYAPRRGILEVWAMQRGPRVGAFTVGKHCRLLYAGYHLMGVNSVTSQG  513

Query  1466  IPL---EVFFLNGDSGQLSVLN  1522
               L   +V  L+  +G L  +N
Sbjct  514   WQLHTQQVCLLDPTTGALRTIN  535



>ref|XP_010130123.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit, 
partial [Buceros rhinoceros silvestris]
Length=1345

 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 92/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  294   AVASKLTSALFNAASGW--LGWKSKHEEELAQKQKPK-VEPATPLAVRFGLPDSRRHGER  350

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   +++ + +      +   L
Sbjct  351   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDL  410

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 + H  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  411   SPFGNAHGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  465



>ref|XP_008397865.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Poecilia reticulata]
Length=1391

 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 96/202 (48%), Gaps = 10/202 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W          + +      A+PL     L D  R GE 
Sbjct  337   AVASKLTSALFNAASGW--LGWNKNKNEEEAAQKQKPKVEPATPLAIRFGLPDSRRHGES  394

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR+ LLD    V +R+WKGYRDA   +++  V ++    + +  
Sbjct  395   ICLSPCNTLAGVTDDFGRVTLLDLARGVTIRMWKGYRDAQLGWLQ--VQEERGDREFSPS  452

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
               +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   Y      +  S  
Sbjct  453   ASLPRRHALFLIIYAPRRGILEVWAMQRGPRVGAFTVGKHCRLLYAGYHLMGVNSVTSQG  512

Query  1466  IPL---EVFFLNGDSGQLSVLN  1522
               L   +V  L+  +G L  +N
Sbjct  513   WQLHTQQVCLLDPTTGALRTIN  534



>ref|XP_008397866.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X3 [Poecilia reticulata]
Length=1379

 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 96/202 (48%), Gaps = 10/202 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W          + +      A+PL     L D  R GE 
Sbjct  338   AVASKLTSALFNAASGW--LGWNKNKNEEEAAQKQKPKVEPATPLAIRFGLPDSRRHGES  395

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR+ LLD    V +R+WKGYRDA   +++  V ++    + +  
Sbjct  396   ICLSPCNTLAGVTDDFGRVTLLDLARGVTIRMWKGYRDAQLGWLQ--VQEERGDREFSPS  453

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
               +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   Y      +  S  
Sbjct  454   ASLPRRHALFLIIYAPRRGILEVWAMQRGPRVGAFTVGKHCRLLYAGYHLMGVNSVTSQG  513

Query  1466  IPL---EVFFLNGDSGQLSVLN  1522
               L   +V  L+  +G L  +N
Sbjct  514   WQLHTQQVCLLDPTTGALRTIN  535



>ref|XP_790581.3| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Strongylocentrotus purpuratus]
Length=1531

 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 73/126 (58%), Gaps = 8/126 (6%)
 Frame = +2

Query  1076  LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEML--V  1249
             L D  R G+ + L+P   LAA TDS GR+ L+D    V VR+WKGYRDA C +++++  +
Sbjct  392   LPDVRRHGDTIVLAPGMRLAASTDSFGRVSLIDVTRGVAVRMWKGYRDAQCGWIQVIEDI  451

Query  1250  NKDSSTLKSAHHEHIKSD------YCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSK  1411
             +++ ++   +      +D        L L I+APR+GI+E+W  + GPR+     PK  +
Sbjct  452   HRERTSEHGSKRPRHSTDSKHGPRVALFLVIYAPRRGIIEVWNTQQGPRVAAFNVPKSCR  511

Query  1412  ILQPTY  1429
             +L P Y
Sbjct  512   LLYPGY  517



>ref|XP_008397864.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Poecilia reticulata]
Length=1392

 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 96/202 (48%), Gaps = 10/202 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W          + +      A+PL     L D  R GE 
Sbjct  338   AVASKLTSALFNAASGW--LGWNKNKNEEEAAQKQKPKVEPATPLAIRFGLPDSRRHGES  395

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR+ LLD    V +R+WKGYRDA   +++  V ++    + +  
Sbjct  396   ICLSPCNTLAGVTDDFGRVTLLDLARGVTIRMWKGYRDAQLGWLQ--VQEERGDREFSPS  453

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
               +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   Y      +  S  
Sbjct  454   ASLPRRHALFLIIYAPRRGILEVWAMQRGPRVGAFTVGKHCRLLYAGYHLMGVNSVTSQG  513

Query  1466  IPL---EVFFLNGDSGQLSVLN  1522
               L   +V  L+  +G L  +N
Sbjct  514   WQLHTQQVCLLDPTTGALRTIN  535



>ref|XP_007636782.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X3 [Cricetulus griseus]
Length=1372

 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 92/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  315   AVASKLTSALFSAASGW--LGWKSKHEEETIQKQKPK-MEPATPLAVRFGLPDSRRHGES  371

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +   L
Sbjct  372   ICLSPCNTLAAVTDDFGRVILLDVSRGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKGDL  431

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  432   SPFGNTQGPSRVAQFLVIYAPRRGILEVWNTQQGPRVGAFNVGKHCRLLYPGYKI  486



>ref|XP_010704992.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Meleagris gallopavo]
Length=1360

 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 74/133 (56%), Gaps = 8/133 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     + D  R GEK+ LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA  
Sbjct  347   ATPLAVRFGIPDSRRHGEKICLSPCNTLAAVTDDFGRVILLDVTRGLAIRMWKGYRDAEV  406

Query  1229  LFMEMLVNKDSSTLKSAHHEHIKSDYC-----LCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              +++ + +      +   +    + +C       L I+APR+GI+E+W  + GPR+    
Sbjct  407   GWIQTVEDLHERETEKIDYSPFGNAHCPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  466

Query  1394  CPKGSKILQPTYR  1432
               K  ++L P Y+
Sbjct  467   VGKHCRLLYPGYK  479



>gb|KFV78308.1| Rab3 GTPase-activating protein non-catalytic subunit, partial 
[Struthio camelus australis]
Length=1346

 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 95/174 (55%), Gaps = 10/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC--LKDYPRKGEKL  1108
             A+ SK+  A F+  S    + W+S+    T  + KP+    A+PL    L D  R GE++
Sbjct  297   AVASKLTSALFNAASGW--LGWKSKHEEETAQKQKPK-VEPATPLAVFGLPDSRRHGERI  353

Query  1109  TLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKSA  1279
              LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  +
Sbjct  354   CLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEIGWIQTVEDLHERETEKMDFS  413

Query  1280  HHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                H +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  414   PFGHAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  467



>gb|KGL79713.1| Rab3 GTPase-activating protein non-catalytic subunit, partial 
[Tinamus guttatus]
Length=1383

 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 94/173 (54%), Gaps = 10/173 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC--LKDYPRKGEKL  1108
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL    L D  R GE++
Sbjct  331   AVASKLTSALFNAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVFGLPDSRRHGERI  387

Query  1109  TLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKSA  1279
              LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  +
Sbjct  388   CLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEIGWIQTVEDLNERETEKMDFS  447

Query  1280  HHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                H +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  448   PFGHAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKCCRLLYPGYK  500



>ref|XP_003999573.2| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Felis catus]
Length=782

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 92/174 (53%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+      P+ KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEVVPKQKPK-VEPAAPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +M+++ +      + A  
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWMQIVEDLHERVPEKADF  449

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  450   SPFGNTQGPSRVAQFLVIYAPRRGILEVWGTQQGPRVGAFNVGKHCRLLYPGYK  503



>ref|XP_005483178.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Zonotrichia albicollis]
Length=1412

 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  370   AVASKLTSALFNAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGER  426

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  + S
Sbjct  427   ICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLQERETEKMDS  486

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  487   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  541



>ref|XP_009667378.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Struthio camelus australis]
Length=1383

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+    T  + KP+    A+PL     L D  R GE+
Sbjct  327   AVASKLTSALFNAASGW--LGWKSKHEEETAQKQKPK-VEPATPLAVRFGLPDSRRHGER  383

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  
Sbjct  384   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEIGWIQTVEDLHERETEKMDF  443

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   H +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  444   SPFGHAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  498



>ref|XP_010216511.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Tinamus guttatus]
Length=1386

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 94/174 (54%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  331   AVASKLTSALFNAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGER  387

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  
Sbjct  388   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEIGWIQTVEDLNERETEKMDF  447

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
             +   H +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  448   SPFGHAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKCCRLLYPGYK  501



>ref|XP_003495044.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Cricetulus griseus]
Length=1372

 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 92/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  315   AVASKLTSALFSAASGW--LGWKSKHEEETIQKQKPK-MEPATPLAVRFGLPDSRRHGES  371

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +   L
Sbjct  372   ICLSPCNTLAAVTDDFGRVILLDVSRGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKGDL  431

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  432   SPFGNTQGPSRVAQFLVIYAPRRGILEVWNTQQGPRVGAFNVGKHCRLLYPGYKI  486



>ref|XP_005416340.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Geospiza fortis]
Length=1391

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  340   AVASKLTSALFNAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGER  396

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  + S
Sbjct  397   ICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLQERETEKMDS  456

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  457   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  511



>gb|KFQ61339.1| Rab3 GTPase-activating protein non-catalytic subunit, partial 
[Pelecanus crispus]
Length=1339

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 77/133 (58%), Gaps = 8/133 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA  
Sbjct  330   ATPLAVRFGLPDSRRHGERICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEV  389

Query  1229  LFM---EMLVNKDSSTLKSAHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              ++   E L  +++  +  +   + +  S     L I+APR+GI+E+W M+ GPR+    
Sbjct  390   GWIQTVEDLHERETEKMDFSPFGNAQGPSRVAQFLVIYAPRRGILEVWSMQQGPRVGAFN  449

Query  1394  CPKGSKILQPTYR  1432
               K  ++L P Y+
Sbjct  450   VGKYCRLLYPGYK  462



>ref|XP_009094633.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Serinus canaria]
Length=1384

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  332   AVASKLTSALFNAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGER  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  + S
Sbjct  389   ICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLQERETEKMDS  448

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  449   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVAAFNVGKYCRLLYPGYKI  503



>ref|XP_009481302.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Pelecanus crispus]
Length=1370

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 95/174 (55%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  321   AVASKLTSALFNAASGW--LGWKSKHEEEPAQKQKPK-VEPATPLAVRFGLPDSRRHGER  377

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  
Sbjct  378   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDF  437

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
             +   + +  S     L I+APR+GI+E+W M+ GPR+      K  ++L P Y+
Sbjct  438   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSMQQGPRVGAFNVGKYCRLLYPGYK  491



>ref|XP_007640777.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Cricetulus griseus]
Length=1352

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 92/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  315   AVASKLTSALFSAASGW--LGWKSKHEEETIQKQKPK-MEPATPLAVRFGLPDSRRHGES  371

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +   L
Sbjct  372   ICLSPCNTLAAVTDDFGRVILLDVSRGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKGDL  431

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  432   SPFGNTQGPSRVAQFLVIYAPRRGILEVWNTQQGPRVGAFNVGKHCRLLYPGYKI  486



>ref|XP_005799228.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Xiphophorus maculatus]
Length=1373

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 96/202 (48%), Gaps = 10/202 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W          + +      A+PL     L D  R GE 
Sbjct  337   AVASKLTSALFNAASGW--LGWNKSKNEEEAAQKQKPKVEPATPLGIRFGLPDSRRHGES  394

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR+ LLD    V +R+WKGYRDA   +++  V ++    + +  
Sbjct  395   ICLSPCNTLAGVTDDFGRVTLLDLARGVAIRMWKGYRDAQLGWLQ--VQEERGDREFSPS  452

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
               +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   Y      +  S  
Sbjct  453   ASLPRRHALFLIIYAPRRGILEVWAMQRGPRVGAFTVGKHCRLLYAGYHLMGVNSVTSQG  512

Query  1466  IPL---EVFFLNGDSGQLSVLN  1522
               L   +V  L+  +G L  +N
Sbjct  513   WQLHTQQVCLLDPTTGALRTIN  534



>ref|NP_001157271.1| rab3 GTPase-activating protein non-catalytic subunit [Taeniopygia 
guttata]
Length=1383

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 77/134 (57%), Gaps = 8/134 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA  
Sbjct  369   ATPLAVRFGLPDSRRHGERICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEV  428

Query  1229  LFM---EMLVNKDSSTLKSAHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              ++   E L  +++  + S+   + +  S     L I+APR+GI+E+W  + GPR+    
Sbjct  429   GWIQTVEDLQERETEKMDSSPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  488

Query  1394  CPKGSKILQPTYRF  1435
               K  ++L P Y+ 
Sbjct  489   VGKYCRLLYPGYKI  502



>gb|EGV92537.1| Rab3 GTPase-activating protein non-catalytic subunit [Cricetulus 
griseus]
Length=1302

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 92/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  245   AVASKLTSALFSAASGW--LGWKSKHEEETIQKQKPK-MEPATPLAVRFGLPDSRRHGES  301

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +   L
Sbjct  302   ICLSPCNTLAAVTDDFGRVILLDVSRGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKGDL  361

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  362   SPFGNTQGPSRVAQFLVIYAPRRGILEVWNTQQGPRVGAFNVGKHCRLLYPGYKI  416



>ref|XP_009094632.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Serinus canaria]
Length=1387

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 77/134 (57%), Gaps = 8/134 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA  
Sbjct  373   ATPLAVRFGLPDSRRHGERICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEV  432

Query  1229  LFM---EMLVNKDSSTLKSAHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              ++   E L  +++  + S+   + +  S     L I+APR+GI+E+W  + GPR+    
Sbjct  433   GWIQTVEDLQERETEKMDSSPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVAAFN  492

Query  1394  CPKGSKILQPTYRF  1435
               K  ++L P Y+ 
Sbjct  493   VGKYCRLLYPGYKI  506



>ref|XP_004554870.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X1 [Maylandia zebra]
Length=1373

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 86/173 (50%), Gaps = 7/173 (4%)
 Frame = +2

Query  926   IVGAILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRK  1096
             +  A+ SK+  A FS  S    + W         P+ +      A+PL+    L D  R 
Sbjct  335   VAMAVASKLTSALFSAASGW--LGWNKNKNEEEAPQKQKPKVEPATPLSIRFGLPDSRRH  392

Query  1097  GEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKS  1276
             GE + LSP   LA +TD  GR+ LLD    + +R+WKGYRDA   ++++   +    L  
Sbjct  393   GESICLSPCNMLAGVTDDFGRVTLLDLARGIAIRMWKGYRDAQLGWLQVPEERSERDLSP  452

Query  1277  AHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +    +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   YR 
Sbjct  453   S--ASLPRRHALFLVIYAPRRGILEVWAMQQGPRVGAFTVGKHCRLLYAGYRL  503



>ref|XP_005025931.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Anas platyrhynchos]
Length=1348

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (55%), Gaps = 8/133 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA  
Sbjct  334   ATPLAVRFGLPDSRRHGERICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEV  393

Query  1229  LFMEMLVNKDSSTLKSAHHEHIKSDYC-----LCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              +++ + +      +   +    +  C       L I+APR+GI+E+W  + GPR+    
Sbjct  394   GWIQTVEDLHERETEKVDYSPFGNAQCPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  453

Query  1394  CPKGSKILQPTYR  1432
               K  ++L P Y+
Sbjct  454   VGKHCRLLYPGYK  466



>ref|XP_004554871.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X2 [Maylandia zebra]
Length=1372

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 86/173 (50%), Gaps = 7/173 (4%)
 Frame = +2

Query  926   IVGAILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRK  1096
             +  A+ SK+  A FS  S    + W         P+ +      A+PL+    L D  R 
Sbjct  334   VAMAVASKLTSALFSAASGW--LGWNKNKNEEEAPQKQKPKVEPATPLSIRFGLPDSRRH  391

Query  1097  GEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKS  1276
             GE + LSP   LA +TD  GR+ LLD    + +R+WKGYRDA   ++++   +    L  
Sbjct  392   GESICLSPCNMLAGVTDDFGRVTLLDLARGIAIRMWKGYRDAQLGWLQVPEERSERDLSP  451

Query  1277  AHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +    +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   YR 
Sbjct  452   S--ASLPRRHALFLVIYAPRRGILEVWAMQQGPRVGAFTVGKHCRLLYAGYRL  502



>ref|XP_010391879.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X3 [Corvus cornix cornix]
Length=1374

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  322   AVASKLTSALFNAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGER  378

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  + S
Sbjct  379   ICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLQERETEKMDS  438

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  439   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  493



>ref|XP_010391876.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Corvus cornix cornix]
Length=1377

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  322   AVASKLTSALFNAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGER  378

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  + S
Sbjct  379   ICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLQERETEKMDS  438

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  439   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  493



>ref|XP_010391878.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Corvus cornix cornix]
Length=1375

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  320   AVASKLTSALFNAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGER  376

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  + S
Sbjct  377   ICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLQERETEKMDS  436

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  437   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  491



>ref|XP_008628754.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Corvus brachyrhynchos]
Length=1349

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  297   AVASKLTSALFNAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGER  353

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  + S
Sbjct  354   ICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLQERETEKMDS  413

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  414   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  468



>ref|XP_004554872.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X3 [Maylandia zebra]
Length=1368

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 86/173 (50%), Gaps = 7/173 (4%)
 Frame = +2

Query  926   IVGAILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRK  1096
             +  A+ SK+  A FS  S    + W         P+ +      A+PL+    L D  R 
Sbjct  335   VAMAVASKLTSALFSAASGW--LGWNKNKNEEEAPQKQKPKVEPATPLSIRFGLPDSRRH  392

Query  1097  GEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKS  1276
             GE + LSP   LA +TD  GR+ LLD    + +R+WKGYRDA   ++++   +    L  
Sbjct  393   GESICLSPCNMLAGVTDDFGRVTLLDLARGIAIRMWKGYRDAQLGWLQVPEERSERDLSP  452

Query  1277  AHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +    +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   YR 
Sbjct  453   S--ASLPRRHALFLVIYAPRRGILEVWAMQQGPRVGAFTVGKHCRLLYAGYRL  503



>ref|XP_005523374.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Pseudopodoces humilis]
Length=1384

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  332   AVASKLTSALFNAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGER  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  + S
Sbjct  389   ICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEIGWIQTVEDLQERETEKMDS  448

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  449   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  503



>ref|XP_004699965.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Echinops telfairi]
Length=1392

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/207 (32%), Positives = 105/207 (51%), Gaps = 14/207 (7%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA TD  GR++LLD    + VR+WKGYRDA   +++++ +      +   L
Sbjct  390   ICLSPCNTLAAATDDFGRVILLDVARGIAVRMWKGYRDAQIGWIQIVEDLHERVPEKVDL  449

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSS-SE  1447
                 + H  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+    + 
Sbjct  450   SPFGNTHGPSRVAQFLVIYAPRRGILEVWGTQQGPRVGAFNVGKHCRLLYPGYKIMGLNN  509

Query  1448  ASLSSYIP--LEVFFLNGDSGQLSVLN  1522
              +  S+ P   ++  ++  SG +  LN
Sbjct  510   VTSQSWQPQTYQICLVDPVSGSMKTLN  536



>ref|XP_005998474.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Latimeria chalumnae]
Length=1387

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 89/175 (51%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  332   AVASKLTSALFNAASGW--LGWKSKHEEEQVQKQKPK-VEPATPLAVRFGLPDSRRHGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLAA+TD  GR++LLD    V VR+WKGYRDA   +++M+ +           
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVARGVAVRMWKGYRDAQVGWIQMVEDIHEREADKGTF  448

Query  1286  EHIKSDYCLC-----LAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 S    C     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  449   SPFGSLQGPCRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  503



>gb|KFO56652.1| Rab3 GTPase-activating protein non-catalytic subunit, partial 
[Corvus brachyrhynchos]
Length=1346

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 77/134 (57%), Gaps = 8/134 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA  
Sbjct  335   ATPLAVRFGLPDSRRHGERICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEV  394

Query  1229  LFM---EMLVNKDSSTLKSAHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              ++   E L  +++  + S+   + +  S     L I+APR+GI+E+W  + GPR+    
Sbjct  395   GWIQTVEDLQERETEKMDSSPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  454

Query  1394  CPKGSKILQPTYRF  1435
               K  ++L P Y+ 
Sbjct  455   VGKYCRLLYPGYKI  468



>ref|XP_005523373.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Pseudopodoces humilis]
Length=1383

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  331   AVASKLTSALFNAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGER  387

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  + S
Sbjct  388   ICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEIGWIQTVEDLQERETEKMDS  447

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  448   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  502



>ref|XP_005043115.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Ficedula albicollis]
Length=1384

 Score = 92.8 bits (229),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 77/134 (57%), Gaps = 8/134 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA  
Sbjct  370   ATPLAVRFGLPDSRRHGERICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEI  429

Query  1229  LFM---EMLVNKDSSTLKSAHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              ++   E L  +++  + S+   + +  S     L I+APR+GI+E+W  + GPR+    
Sbjct  430   GWIQTVEDLQERETEKMDSSPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  489

Query  1394  CPKGSKILQPTYRF  1435
               K  ++L P Y+ 
Sbjct  490   VGKYCRLLYPGYKI  503



>ref|XP_005043116.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Ficedula albicollis]
Length=1383

 Score = 92.4 bits (228),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 77/134 (57%), Gaps = 8/134 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA  
Sbjct  369   ATPLAVRFGLPDSRRHGERICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEI  428

Query  1229  LFM---EMLVNKDSSTLKSAHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              ++   E L  +++  + S+   + +  S     L I+APR+GI+E+W  + GPR+    
Sbjct  429   GWIQTVEDLQERETEKMDSSPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  488

Query  1394  CPKGSKILQPTYRF  1435
               K  ++L P Y+ 
Sbjct  489   VGKYCRLLYPGYKI  502



>ref|XP_003976453.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Takifugu rubripes]
Length=1280

 Score = 92.4 bits (228),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 96/201 (48%), Gaps = 20/201 (10%)
 Frame = +2

Query  863   VTVGDDAVISAYRLSVDKSRSIVG----AILSKVVPATFSTISSISKMLWRSeptpttkp  1030
             V+VG    I  Y      S+ ++     A+ SK+  A F+  S    + W    +     
Sbjct  297   VSVGGGPYIGFYYAVEGSSQPLLSHVALAVASKLTSALFNAASGW--LGWNKNRSEEETV  354

Query  1031  epkpQPFAKASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRL  1201
             + +      A+PL     L D  R GE + LSP   LA +TD  GR+ LLD    + +R+
Sbjct  355   QKQKPKVEPATPLGIRFGLPDSRRHGESICLSPCNMLAGVTDDFGRVALLDLARGICIRM  414

Query  1202  WKGYRDASCLFMEMLVNK---DSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTG  1372
             WKGYRDA   ++++   +   DSS+L   H         L L I+APR+GI+E+W M+ G
Sbjct  415   WKGYRDAQLGWLQVQEERGDHDSSSLPKRH--------ALFLVIYAPRRGILEVWAMKQG  466

Query  1373  PRLQTIPCPKGSKILQPTYRF  1435
             PR+      K  ++L   +R 
Sbjct  467   PRVGAFNVGKHCRLLYAGHRL  487



>ref|XP_004878980.1| PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-activating protein 
non-catalytic subunit [Heterocephalus glaber]
Length=1383

 Score = 92.4 bits (228),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 92/178 (52%), Gaps = 17/178 (10%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+         KP+    ASPL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEPVQRQKPK-VEPASPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN--------KDS  1261
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   +++++ +         D 
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAVRMWKGYRDAQAGWVQVVEDLQERVPGRADC  449

Query  1262  STLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             S  +S       + +   L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  450   SPFRSGQGPSRVAQF---LVIYAPRRGILEVWGTQQGPRVGAFNVGKHCRLLYPGYKI  504



>ref|XP_003705059.1| PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-activating protein 
non-catalytic subunit-like [Megachile rotundata]
Length=1380

 Score = 92.4 bits (228),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 46/127 (36%), Positives = 74/127 (58%), Gaps = 5/127 (4%)
 Frame = +2

Query  1064  PLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLF  1234
             P+TC   L D  R+G  +  SP+ TL+ I D++GR++L+D +  + +R+WKGYRDA C +
Sbjct  334   PMTCRFGLSDIMREGYSIISSPNKTLSVIIDAMGRVILIDNRCGIALRMWKGYRDAQCGW  393

Query  1235  MEMLVNKDSSTLKSAHHEHIKSDY--CLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGS  1408
             +E+   K S   K  +     S     L L I+AP+KG+++IW  + GP++ T    K  
Sbjct  394   IEVEEEKHSRMHKEFNKFKQTSQLRSALFLVIYAPKKGVIDIWSTQQGPKITTFTASKHG  453

Query  1409  KILQPTY  1429
             ++L   Y
Sbjct  454   RLLYINY  460



>ref|XP_009471285.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Nipponia nippon]
Length=1483

 Score = 92.4 bits (228),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 94/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  431   AVASKLTSALFNAASGW--LGWKSKHEEEPAQKQKPK-VEPATPLAVRFGLPDSRRHGER  487

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAAITD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  
Sbjct  488   ICLSPCNTLAAITDDFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDF  547

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P YR 
Sbjct  548   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYRI  602



>ref|XP_004867457.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Heterocephalus glaber]
Length=1394

 Score = 92.4 bits (228),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 106/210 (50%), Gaps = 20/210 (10%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+         KP+    ASPL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEPVQRQKPK-VEPASPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN--------KDS  1261
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   +++++ +         D 
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAVRMWKGYRDAQAGWVQVVEDLQERVPGRADC  449

Query  1262  STLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSS  1441
             S  +S       + +   L I+APR+GI+E+W  + GPR+      K  ++L P Y+   
Sbjct  450   SPFRSGQGPSRVAQF---LVIYAPRRGILEVWGTQQGPRVGAFNVGKHCRLLYPGYKIMG  506

Query  1442  -SEASLSSYIP--LEVFFLNGDSGQLSVLN  1522
              +  +  S+ P   ++  ++  SG +  +N
Sbjct  507   LNNVTSQSWQPQTYQICLMDPVSGSVKTVN  536



>ref|XP_007072910.1| PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-activating protein 
non-catalytic subunit [Panthera tigris altaica]
Length=1408

 Score = 92.4 bits (228),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 92/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+      P+ KP+    A+PL     L D  R GE 
Sbjct  341   AVASKLTSALFNAASGW--LGWKSKHEEEVVPKQKPK-VEPAAPLAVRFGLPDSRRHGES  397

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +M+++ +      + A  
Sbjct  398   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWMQIVEDLHERVPEKADF  457

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  458   SPFGNTQGPSRVAQFLVIYAPRRGILEVWGTQQGPRVGAFNVGKHCRLLYPGYKI  512



>ref|XP_005082491.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Mesocricetus auratus]
Length=1389

 Score = 92.4 bits (228),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 92/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  332   AVASKLTSALFSAASGW--LGWKSKHEEETVQKQKPK-MEPATPLAVRFGLPDSRRHGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +   L
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKGDL  448

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  449   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  503



>gb|KFR06154.1| Rab3 GTPase-activating protein non-catalytic subunit, partial 
[Nipponia nippon]
Length=1347

 Score = 92.4 bits (228),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 76/133 (57%), Gaps = 8/133 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE++ LSP  TLAAITD  GR++LLD    + VR+WKGYRDA  
Sbjct  335   ATPLAVRFGLPDSRRHGERICLSPCNTLAAITDDFGRVILLDVTRGLAVRMWKGYRDAEV  394

Query  1229  LFM---EMLVNKDSSTLKSAHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              ++   E L  +++  +  +   + +  S     L I+APR+GI+E+W  + GPR+    
Sbjct  395   GWIQTVEDLHERETEKMDFSPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  454

Query  1394  CPKGSKILQPTYR  1432
               K  ++L P YR
Sbjct  455   VGKYCRLLYPGYR  467



>ref|XP_005082492.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Mesocricetus auratus]
Length=1369

 Score = 92.0 bits (227),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 92/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  332   AVASKLTSALFSAASGW--LGWKSKHEEETVQKQKPK-MEPATPLAVRFGLPDSRRHGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +   L
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKGDL  448

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  449   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  503



>ref|XP_010157566.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit, 
partial [Eurypyga helias]
Length=584

 Score = 91.3 bits (225),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 94/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  294   AVASKLTSALFNAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGER  350

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  
Sbjct  351   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDF  410

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  411   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  465



>ref|XP_002121049.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Ciona intestinalis]
Length=1369

 Score = 92.0 bits (227),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 79/152 (52%), Gaps = 12/152 (8%)
 Frame = +2

Query  1076  LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNK  1255
             L D  R+G  + L+PS  L A TDS GR++LLD      +R+WKGYRDA   F+      
Sbjct  376   LPDLRRQGHSIVLAPSAWLGATTDSFGRVMLLDLNKGYALRIWKGYRDAQIAFVR-----  430

Query  1256  DSSTLKSAHHEHIKS--DYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTY  1429
               S   +  H H  S     L L I+APR+G++EIW    GPR+      K +++L P Y
Sbjct  431   --SHDDTQKHRHSSSPPRSALFLVIYAPRRGLLEIWSCINGPRVGAFNISKNARLLCPGY  488

Query  1430  RFSSSEASLSSYIP--LEVFFLNGDSGQLSVL  1519
             +      S +++ P  LE   L G  G++ V+
Sbjct  489   KMFGMNNSSTTHTPSMLECCVL-GTDGEVQVI  519



>ref|XP_006972166.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Peromyscus maniculatus bairdii]
Length=1390

 Score = 92.0 bits (227),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFSAASGW--LGWKSKHEEETGQKQKPK-MEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +    
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKGDF  449

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  450   SPFGNNQGPSRVAQFLVIYAPRRGILEVWNTQQGPRVGAFNVGKHCRLLYPGYK  503



>ref|XP_009565496.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Cuculus canorus]
Length=1357

 Score = 92.0 bits (227),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 96/174 (55%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  305   AVASKLTSALFNAASGW--LGWKSKHEEEAAQKQKPK-VEPATPLAVRFGLPDSRRHGER  361

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L ++++  +  
Sbjct  362   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHDRETEKVDF  421

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
             + + + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  422   SPYGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYK  475



>ref|XP_004627000.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Octodon degus]
Length=1391

 Score = 92.0 bits (227),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 91/175 (52%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFSAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   +++++ +      ++A  
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAVRMWKGYRDAQVGWVQIVEDLQERAPETADP  449

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                      S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  450   TPFGSSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  504



>ref|XP_003807227.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Pan paniscus]
Length=1393

 Score = 92.0 bits (227),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 92/174 (53%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + +  
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  449

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
              S  +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  450   SSFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  503



>ref|XP_010126855.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like, 
partial [Chlamydotis macqueenii]
Length=585

 Score = 91.3 bits (225),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 94/174 (54%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  295   AVASKLTSALFNAASGW--LGWKSKHEEEPAQKQKPK-VEPATPLAVRFGLPDSRRHGER  351

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  
Sbjct  352   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDF  411

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
             +   + +  S     L I+APR+G++E+W  + GPR+      K  ++L P Y+
Sbjct  412   SPFGNAQGPSRVAQFLVIYAPRRGVLEVWSTQQGPRVGAFNVGKYCRLLYPGYK  465



>gb|KFO80827.1| Rab3 GTPase-activating protein non-catalytic subunit, partial 
[Cuculus canorus]
Length=1348

 Score = 92.0 bits (227),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 96/175 (55%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  297   AVASKLTSALFNAASGW--LGWKSKHEEEAAQKQKPK-VEPATPLAVRFGLPDSRRHGER  353

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L ++++  +  
Sbjct  354   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHDRETEKVDF  413

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             + + + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  414   SPYGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  468



>ref|XP_005097932.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Aplysia californica]
Length=968

 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 69/118 (58%), Gaps = 5/118 (4%)
 Frame = +2

Query  1076  LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNK  1255
             L D  R GE + LSP+   AA TDS GRI+L+D Q  + VR+WKGYRDA   ++E+   K
Sbjct  385   LPDKRRCGEMIILSPNNNFAATTDSFGRIILIDVQRGMAVRMWKGYRDAQLGWIEV---K  441

Query  1256  DSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTY  1429
             + S     +++H +      L I+APR+GI+E+W    GPR+      K  +++ P Y
Sbjct  442   EESVEPGKNNDHYR--LAQFLIIYAPRRGILEVWLAAHGPRVAAFNVSKSCRLVCPCY  497



>ref|XP_006272969.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Alligator mississippiensis]
Length=1382

 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 94/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+       + KP+    A+PL     L D  R+GE 
Sbjct  332   AVASKLTSALFSAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRRGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  L  
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAQIGWIQTVEDLHERETEKLDF  448

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  449   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  503



>ref|NP_001157272.1| rab3 GTPase-activating protein non-catalytic subunit [Gallus 
gallus]
Length=1382

 Score = 91.7 bits (226),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 73/133 (55%), Gaps = 8/133 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     + D  R GEK+ LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA  
Sbjct  369   ATPLAVRFGIPDSRRHGEKICLSPCNTLAAVTDDFGRVILLDVTRGLAIRMWKGYRDAEV  428

Query  1229  LFMEMLVNKDSSTLKSAHHEHIKSDYC-----LCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              +++ + +      +   +    +  C       L I+APR+GI+E+W  + GPR+    
Sbjct  429   GWIQTVEDLHERETEKIDYSPFGNAQCPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  488

Query  1394  CPKGSKILQPTYR  1432
               K  ++L P Y+
Sbjct  489   VGKHCRLLYPGYK  501



>ref|XP_004751513.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Mustela putorius furo]
Length=1393

 Score = 91.7 bits (226),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 92/174 (53%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  332   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + + L
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIIEDLHERVPEKADL  448

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  449   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  502



>ref|XP_008559647.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Microplitis demolitor]
 ref|XP_008559648.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Microplitis demolitor]
 ref|XP_008559649.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Microplitis demolitor]
 gb|EZA45812.1| rab3 GTPase-activating protein non-catalytic subunit-like protein 
[Microplitis demolitor]
Length=1352

 Score = 91.7 bits (226),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 76/127 (60%), Gaps = 10/127 (8%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A  +TC   L D  R+G+ L +SP+ +L+ ITD++GR+ L++ +  + +R+WKGYRDA C
Sbjct  333   AEAMTCRFGLSDVMREGDSLIVSPNKSLSVITDAMGRVTLINNRRGLALRMWKGYRDAQC  392

Query  1229  LFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGS  1408
              ++E+  +K S           K    L L I+AP+KG+++IW ++TG ++ T    K  
Sbjct  393   GWIEVAEDKRSKVTS-------KRRTALFLVIYAPKKGVIDIWGIQTGGKITTFSASKNG  445

Query  1409  KILQPTY  1429
             ++L   Y
Sbjct  446   RLLYINY  452



>ref|XP_005348887.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Microtus ochrogaster]
 ref|XP_005348888.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Microtus ochrogaster]
Length=1389

 Score = 91.7 bits (226),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  332   AVASKLTSALFSAASGW--LGWKSKHEEETVQKQKPK-MEPATPLAVRFGLPDSRRHGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +    
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKGEF  448

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  449   SPFGNTQGPSRVAQFLVIYAPRRGILEVWNTQQGPRVGAFNVGKHCRLLYPGYK  502



>ref|XP_004751512.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Mustela putorius furo]
Length=1397

 Score = 91.7 bits (226),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 92/174 (53%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  336   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  392

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + + L
Sbjct  393   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIIEDLHERVPEKADL  452

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  453   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  506



>ref|XP_005348889.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X3 [Microtus ochrogaster]
Length=1369

 Score = 91.7 bits (226),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  332   AVASKLTSALFSAASGW--LGWKSKHEEETVQKQKPK-MEPATPLAVRFGLPDSRRHGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +    
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKGEF  448

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  449   SPFGNTQGPSRVAQFLVIYAPRRGILEVWNTQQGPRVGAFNVGKHCRLLYPGYK  502



>ref|XP_005728771.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Pundamilia nyererei]
Length=1295

 Score = 91.7 bits (226),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 84/161 (52%), Gaps = 8/161 (5%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL+    L D  R GE + LSP  TLA +TD  GR+ LLD    + +R+WKGYRDA  
Sbjct  304   ATPLSIRFGLPDSRRHGESICLSPCNTLAGVTDDFGRVTLLDLARGIAIRMWKGYRDAQL  363

Query  1229  LFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGS  1408
              ++++   +    L  +    +   + L L I+APR+GI+E+W M+ GPR+      K  
Sbjct  364   GWLQVPEERSERDLSPS--ASLPRRHALFLVIYAPRRGILEVWAMQQGPRVGAFTVGKHC  421

Query  1409  KILQPTYRFSSSEASLSSYIPL---EVFFLNGDSGQLSVLN  1522
             ++L   YR     +  S    L   +V  L+  +G L  +N
Sbjct  422   RLLYAGYRLMGVNSVTSQGWQLHTQQVCLLDPITGVLRTVN  462



>ref|XP_008683902.1| PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-activating protein 
non-catalytic subunit [Ursus maritimus]
Length=1396

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 91/175 (52%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  332   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  448

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  449   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  503



>ref|NP_001157226.1| rab3 GTPase-activating protein non-catalytic subunit [Mus musculus]
Length=1387

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  332   AVASKLTSALFSAASGW--LGWKSKHEEDTVQKQKPK-MEPATPLAVRFGLPDSRRHGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +    
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQVGWIQIVEDLHERVPEKGGF  448

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  449   SPFGNTQGPSRVAQFLVIYAPRRGILEVWNTQQGPRVGAFNVGKHCRLLYPGYK  502



>ref|XP_007575066.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X3 [Poecilia formosa]
Length=1374

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 95/202 (47%), Gaps = 10/202 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W          + +      A+PL     L D  R GE 
Sbjct  338   AVASKLTSALFNAASGW--LGWNKNKNEEEAAQKQKPKVEPATPLGIRFGLPDSRRHGES  395

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR+ LLD      +R+WKGYRDA   +++  V ++    + +  
Sbjct  396   ICLSPCNTLAGVTDDFGRVTLLDLARGAAIRMWKGYRDAQLGWLQ--VQEERGDREFSPS  453

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
               +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   Y      +  S  
Sbjct  454   ASLPRRHALFLIIYAPRRGILEVWAMQRGPRVGAFTVGKHCRLLYAGYHLMGVNSVTSQG  513

Query  1466  IPL---EVFFLNGDSGQLSVLN  1522
               L   +V  L+  +G L  +N
Sbjct  514   WQLHTQQVCLLDPTTGALRTIN  535



>ref|XP_009870073.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit, 
partial [Apaloderma vittatum]
Length=1418

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 8/134 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA  
Sbjct  406   ATPLAVRFGLPDSRRHGERICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEV  465

Query  1229  LFM---EMLVNKDSSTLKSAHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              ++   E L  ++S  +  +   + +  S     L I+APR+GI+E+W  + GPR+    
Sbjct  466   GWIQTVEDLQERESEKMDFSPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  525

Query  1394  CPKGSKILQPTYRF  1435
               K  ++L P Y+ 
Sbjct  526   VGKYCRLLYPGYKI  539



>sp|Q8BMG7.2|RBGPR_MOUSE RecName: Full=Rab3 GTPase-activating protein non-catalytic subunit; 
AltName: Full=Rab3 GTPase-activating protein 150 kDa 
subunit; AltName: Full=Rab3-GAP p150; Short=Rab3-GAP150; AltName: 
Full=Rab3-GAP regulatory subunit [Mus musculus]
Length=1366

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  331   AVASKLTSALFSAASGW--LGWKSKHEEDTVQKQKPK-MEPATPLAVRFGLPDSRRHGES  387

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +    
Sbjct  388   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQVGWIQIVEDLHERVPEKGGF  447

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  448   SPFGNTQGPSRVAQFLVIYAPRRGILEVWNTQQGPRVGAFNVGKHCRLLYPGYK  501



>ref|XP_007575058.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X2 [Poecilia formosa]
Length=1374

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 95/202 (47%), Gaps = 10/202 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W          + +      A+PL     L D  R GE 
Sbjct  337   AVASKLTSALFNAASGW--LGWNKNKNEEEAAQKQKPKVEPATPLGIRFGLPDSRRHGES  394

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR+ LLD      +R+WKGYRDA   +++  V ++    + +  
Sbjct  395   ICLSPCNTLAGVTDDFGRVTLLDLARGAAIRMWKGYRDAQLGWLQ--VQEERGDREFSPS  452

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
               +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   Y      +  S  
Sbjct  453   ASLPRRHALFLIIYAPRRGILEVWAMQRGPRVGAFTVGKHCRLLYAGYHLMGVNSVTSQG  512

Query  1466  IPL---EVFFLNGDSGQLSVLN  1522
               L   +V  L+  +G L  +N
Sbjct  513   WQLHTQQVCLLDPTTGALRTIN  534



>ref|XP_006497279.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Mus musculus]
Length=1367

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  332   AVASKLTSALFSAASGW--LGWKSKHEEDTVQKQKPK-MEPATPLAVRFGLPDSRRHGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +    
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQVGWIQIVEDLHERVPEKGGF  448

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  449   SPFGNTQGPSRVAQFLVIYAPRRGILEVWNTQQGPRVGAFNVGKHCRLLYPGYK  502



>ref|XP_002920055.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
[Ailuropoda melanoleuca]
Length=1393

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 91/175 (52%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  332   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  448

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  449   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  503



>ref|XP_007575050.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit-like 
isoform X1 [Poecilia formosa]
Length=1375

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 95/202 (47%), Gaps = 10/202 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W          + +      A+PL     L D  R GE 
Sbjct  338   AVASKLTSALFNAASGW--LGWNKNKNEEEAAQKQKPKVEPATPLGIRFGLPDSRRHGES  395

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR+ LLD      +R+WKGYRDA   +++  V ++    + +  
Sbjct  396   ICLSPCNTLAGVTDDFGRVTLLDLARGAAIRMWKGYRDAQLGWLQ--VQEERGDREFSPS  453

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRFSSSEASLSSY  1465
               +   + L L I+APR+GI+E+W M+ GPR+      K  ++L   Y      +  S  
Sbjct  454   ASLPRRHALFLIIYAPRRGILEVWAMQRGPRVGAFTVGKHCRLLYAGYHLMGVNSVTSQG  513

Query  1466  IPL---EVFFLNGDSGQLSVLN  1522
               L   +V  L+  +G L  +N
Sbjct  514   WQLHTQQVCLLDPTTGALRTIN  535



>ref|XP_004415199.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Odobenus rosmarus divergens]
Length=1393

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 91/175 (52%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  332   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  448

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  449   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  503



>ref|XP_007670657.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Ornithorhynchus anatinus]
Length=1585

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 92/174 (53%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  525   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  581

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + + L
Sbjct  582   ICLSPCNTLAAVTDDFGRVILLDVARGLAIRMWKGYRDAQIGWVQVIEDLHERESEKTDL  641

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  642   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  695



>ref|XP_536122.2| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Canis lupus familiaris]
Length=1394

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 91/175 (52%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  449

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  450   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  504



>ref|NP_001035244.2| rab3 GTPase-activating protein non-catalytic subunit [Rattus 
norvegicus]
Length=1387

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  332   AVASKLTSALFSAASGW--LGWKSKHEEETVQKQKPK-MEPATPLAVRFGLPDSRRHGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +    
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKGDF  448

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  449   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  502



>sp|Q5U1Z0.2|RBGPR_RAT RecName: Full=Rab3 GTPase-activating protein non-catalytic subunit; 
AltName: Full=Rab3 GTPase-activating protein 150 kDa 
subunit; AltName: Full=Rab3-GAP p150; Short=Rab3-GAP150; AltName: 
Full=Rab3-GAP regulatory subunit [Rattus norvegicus]
Length=1386

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  331   AVASKLTSALFSAASGW--LGWKSKHEEETVQKQKPK-MEPATPLAVRFGLPDSRRHGES  387

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +    
Sbjct  388   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKGDF  447

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  448   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  501



>ref|XP_008610404.1| hypothetical protein SDRG_06403 [Saprolegnia diclina VS20]
 gb|EQC36298.1| hypothetical protein SDRG_06403 [Saprolegnia diclina VS20]
Length=1264

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 97/200 (49%), Gaps = 16/200 (8%)
 Frame = +2

Query  860   AVTVGDDAVISAYRLSVDKSRSI-VGAILSKVVPATFSTISSISKML-WRSeptpttkpe  1033
             A+ VG D +I  Y    D S  + +  I S V       + S++K   W +E TP++  +
Sbjct  183   ALAVGCDPIIGFYHAGNDASSILHIAHIASAVATRAAGAVWSLAKSWGWSAEKTPSSAND  242

Query  1034  pkpQPFAKASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGY  1213
               P P   AS L       +K     LSP G LA + DSLGRILLLDT  +++VRLWKGY
Sbjct  243   VAPTPLDVASELGLPNTLRQKARAAVLSPHGRLALVPDSLGRILLLDTSTMLLVRLWKGY  302

Query  1214  RDASCLFMEMLVNKDSSTLKSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
             RDA   +M M    D   L               +  ++ R+G VE+W+ R GPR+  +P
Sbjct  303   RDAQVGWMTMDAKSDVPGLY--------------MVFYSARRGFVEVWRARHGPRVLCVP  348

Query  1394  CPKGSKILQPTYRFSSSEAS  1453
                 +K+   T   S + AS
Sbjct  349   VGVHAKLQLCTLATSPTHAS  368



>ref|XP_008768058.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Rattus norvegicus]
Length=1280

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  245   AVASKLTSALFSAASGW--LGWKSKHEEETVQKQKPK-MEPATPLAVRFGLPDSRRHGES  301

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +    
Sbjct  302   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKGDF  361

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  362   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  415



>gb|KFO13971.1| Rab3 GTPase-activating protein non-catalytic subunit, partial 
[Balearica regulorum gibbericeps]
Length=1347

 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 94/174 (54%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  297   AVASKLTSALFSAASGW--LGWKSKHEEEPAQKQKPK-VEPATPLAVRFGLPDSRRHGER  353

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  
Sbjct  354   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDF  413

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  414   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYK  467



>ref|XP_010307005.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit, 
partial [Balearica regulorum gibbericeps]
Length=1346

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 94/174 (54%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  294   AVASKLTSALFSAASGW--LGWKSKHEEEPAQKQKPK-VEPATPLAVRFGLPDSRRHGER  350

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  
Sbjct  351   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDF  410

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  411   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYK  464



>ref|XP_007986592.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X3 [Chlorocebus sabaeus]
Length=1363

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  303   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  359

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  360   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  419

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  420   SPFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  473



>gb|KFP77197.1| Rab3 GTPase-activating protein non-catalytic subunit, partial 
[Apaloderma vittatum]
Length=1346

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 9/134 (7%)
 Frame = +2

Query  1058  ASPLTC----LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDAS  1225
             A+PL      L D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA 
Sbjct  335   ATPLAVRQFGLPDSRRHGERICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAE  394

Query  1226  CLFM---EMLVNKDSSTLKSAHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTI  1390
               ++   E L  ++S  +  +   + +  S     L I+APR+GI+E+W  + GPR+   
Sbjct  395   VGWIQTVEDLQERESEKMDFSPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAF  454

Query  1391  PCPKGSKILQPTYR  1432
                K  ++L P Y+
Sbjct  455   NVGKYCRLLYPGYK  468



>ref|XP_006022404.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X3 [Alligator sinensis]
Length=1295

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 93/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  245   AVASKLTSALFSAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGES  301

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  L  
Sbjct  302   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAQIGWIQTVEDLHERETEKLDF  361

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  362   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  416



>ref|XP_001103011.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Macaca mulatta]
Length=1393

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  449

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  450   SPFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  503



>ref|XP_005409324.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Chinchilla lanigera]
Length=1399

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 93/181 (51%), Gaps = 12/181 (7%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE + LSP  TLAA+TD  GR+LLLD    + +R+WKGYRDA  
Sbjct  371   ATPLAVRFGLPDSRRHGESICLSPCNTLAAVTDDFGRVLLLDVARGIAIRMWKGYRDAQV  430

Query  1229  LFMEMLVNKDSSTLKSAHHEHIKSD-----YCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              + +++ +      ++A      S          L I+APR+GI+E+W  + GPR+    
Sbjct  431   GWAQIVEDLQERAPETADPAPFGSSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  490

Query  1394  CPKGSKILQPTYRFSS-SEASLSSYIP--LEVFFLNGDSGQLSVLNRSLN*NAINSLKCT  1564
               K  ++L P Y+    +  +  S+ P   ++  ++  SG +  +N   +  A++  KC 
Sbjct  491   VGKHCRLLYPGYKIMGLNNVTSQSWQPQTYQICLVDPVSGSVKTVNVPFH-LALSDKKCE  549

Query  1565  K  1567
             +
Sbjct  550   R  550



>ref|XP_008768059.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X3 [Rattus norvegicus]
Length=1116

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 94/184 (51%), Gaps = 29/184 (16%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+    T  + KP+    A+PL     L D  R GE 
Sbjct  61    AVASKLTSALFSAASGW--LGWKSKHEEETVQKQKPK-MEPATPLAVRFGLPDSRRHGES  117

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +          H
Sbjct  118   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDL---------H  168

Query  1286  EHI--KSDY------------CLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQP  1423
             E +  K D+               L I+APR+GI+E+W  + GPR+      K  ++L P
Sbjct  169   ERVPEKGDFSPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYP  228

Query  1424  TYRF  1435
              Y+ 
Sbjct  229   GYKI  232



>ref|XP_006022402.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Alligator sinensis]
Length=1382

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 93/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  332   AVASKLTSALFSAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGES  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  L  
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAQIGWIQTVEDLHERETEKLDF  448

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  449   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  503



>ref|XP_007986591.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Chlorocebus sabaeus]
Length=1393

 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  449

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  450   SPFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  503



>ref|XP_005409325.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Chinchilla lanigera]
Length=1396

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 93/181 (51%), Gaps = 12/181 (7%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE + LSP  TLAA+TD  GR+LLLD    + +R+WKGYRDA  
Sbjct  371   ATPLAVRFGLPDSRRHGESICLSPCNTLAAVTDDFGRVLLLDVARGIAIRMWKGYRDAQV  430

Query  1229  LFMEMLVNKDSSTLKSAHHEHIKSD-----YCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              + +++ +      ++A      S          L I+APR+GI+E+W  + GPR+    
Sbjct  431   GWAQIVEDLQERAPETADPAPFGSSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  490

Query  1394  CPKGSKILQPTYRFSS-SEASLSSYIP--LEVFFLNGDSGQLSVLNRSLN*NAINSLKCT  1564
               K  ++L P Y+    +  +  S+ P   ++  ++  SG +  +N   +  A++  KC 
Sbjct  491   VGKHCRLLYPGYKIMGLNNVTSQSWQPQTYQICLVDPVSGSVKTVNVPFH-LALSDKKCE  549

Query  1565  K  1567
             +
Sbjct  550   R  550



>ref|XP_006894655.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Elephantulus edwardii]
Length=1367

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 90/175 (51%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  307   AVASKLTSALFNAASGW--LGWKSKHEEEAAQKQKPK-VEPATPLAVRFGLPDSRRHGES  363

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA TD  GR++LLD    + VR+WKGYRDA   +++++ +      +   L
Sbjct  364   ICLSPCNTLAAATDDFGRVILLDVAKGIAVRMWKGYRDAQIGWIQIVEDLHERVPEKVDL  423

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  424   SPFGNTQCPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  478



>ref|XP_010366384.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Rhinopithecus roxellana]
Length=1305

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 91/175 (52%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  245   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  301

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  302   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  361

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  362   SPFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  416



>ref|XP_010366383.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Rhinopithecus roxellana]
Length=1393

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  449

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  450   SPFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  503



>ref|XP_005409327.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X4 [Chinchilla lanigera]
Length=1392

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 93/181 (51%), Gaps = 12/181 (7%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE + LSP  TLAA+TD  GR+LLLD    + +R+WKGYRDA  
Sbjct  371   ATPLAVRFGLPDSRRHGESICLSPCNTLAAVTDDFGRVLLLDVARGIAIRMWKGYRDAQV  430

Query  1229  LFMEMLVNKDSSTLKSAHHEHIKSD-----YCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              + +++ +      ++A      S          L I+APR+GI+E+W  + GPR+    
Sbjct  431   GWAQIVEDLQERAPETADPAPFGSSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  490

Query  1394  CPKGSKILQPTYRFSS-SEASLSSYIP--LEVFFLNGDSGQLSVLNRSLN*NAINSLKCT  1564
               K  ++L P Y+    +  +  S+ P   ++  ++  SG +  +N   +  A++  KC 
Sbjct  491   VGKHCRLLYPGYKIMGLNNVTSQSWQPQTYQICLVDPVSGSVKTVNVPFH-LALSDKKCE  549

Query  1565  K  1567
             +
Sbjct  550   R  550



>ref|XP_005540945.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Macaca fascicularis]
 gb|EHH50528.1| hypothetical protein EGM_01375 [Macaca fascicularis]
Length=1393

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  449

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  450   SPFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  503



>ref|XP_003265130.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Nomascus leucogenys]
Length=1393

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 91/175 (52%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  449

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  450   SPFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  504



>ref|XP_007986590.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Chlorocebus sabaeus]
Length=1397

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  337   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  393

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  394   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  453

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  454   SPFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  507



>ref|XP_006022403.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Alligator sinensis]
Length=1381

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 93/175 (53%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  331   AVASKLTSALFSAASGW--LGWKSKHEEEPVQKQKPK-VEPATPLAVRFGLPDSRRHGES  387

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  L  
Sbjct  388   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAQIGWIQTVEDLHERETEKLDF  447

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  448   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  502



>ref|XP_005409326.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X3 [Chinchilla lanigera]
Length=1391

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 93/181 (51%), Gaps = 12/181 (7%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE + LSP  TLAA+TD  GR+LLLD    + +R+WKGYRDA  
Sbjct  371   ATPLAVRFGLPDSRRHGESICLSPCNTLAAVTDDFGRVLLLDVARGIAIRMWKGYRDAQV  430

Query  1229  LFMEMLVNKDSSTLKSAHHEHIKSD-----YCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              + +++ +      ++A      S          L I+APR+GI+E+W  + GPR+    
Sbjct  431   GWAQIVEDLQERAPETADPAPFGSSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  490

Query  1394  CPKGSKILQPTYRFSS-SEASLSSYIP--LEVFFLNGDSGQLSVLNRSLN*NAINSLKCT  1564
               K  ++L P Y+    +  +  S+ P   ++  ++  SG +  +N   +  A++  KC 
Sbjct  491   VGKHCRLLYPGYKIMGLNNVTSQSWQPQTYQICLVDPVSGSVKTVNVPFH-LALSDKKCE  549

Query  1565  K  1567
             +
Sbjct  550   R  550



>ref|XP_005500033.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Columba livia]
Length=1383

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  331   AVASKLTSALFNAASGW--LGWKSKHEEEPAQKQKPK-VEPATPLAVRFGLPDSRRHGER  387

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD+ GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  
Sbjct  388   ICLSPCNTLAAVTDAFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDF  447

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  448   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  502



>ref|XP_003474275.2| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Cavia porcellus]
Length=1393

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 90/175 (51%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + +P+    A+PL     L D  R GE 
Sbjct  338   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQRPK-VEPATPLAVRFGLPDSRRHGES  394

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   + +++ +      DS+  
Sbjct  395   ICLSPCNTLAAVTDDFGRVILLDVTRGIAVRMWKGYRDAQVGWAQIVEDLQERAPDSTDG  454

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                      S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  455   APFGSTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  509



>ref|XP_005500034.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Columba livia]
Length=1384

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  332   AVASKLTSALFNAASGW--LGWKSKHEEEPAQKQKPK-VEPATPLAVRFGLPDSRRHGER  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD+ GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  
Sbjct  389   ICLSPCNTLAAVTDAFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDF  448

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  449   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  503



>ref|XP_002809484.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Pongo abelii]
Length=1393

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 91/175 (52%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  449

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  450   SPFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  504



>ref|XP_004578686.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Ochotona princeps]
Length=1305

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 91/175 (52%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  245   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  301

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  302   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  361

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  362   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYKI  416



>ref|XP_010877413.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Esox lucius]
Length=1390

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 90/170 (53%), Gaps = 8/170 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S       +SE   T K  PK +P   A+PL     L D  R GE 
Sbjct  335   AVASKLTSALFSAASGWLGWKKQSEEETTQKQRPKVEP---ATPLAVRFGLPDSRRHGES  391

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR++LLD    + +R+WKGYRDA   +++  V++     +S+  
Sbjct  392   ICLSPCNTLAGVTDDFGRVMLLDVGRGIAIRMWKGYRDAQLGWVQ--VSEGRGERESSPS  449

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
               +   +   L I+APR+GI+E+W  + GPR+      K  ++L   YR 
Sbjct  450   APLPRRHAQFLVIYAPRRGILEVWGTQQGPRVGAFTVGKHCRLLYAGYRL  499



>ref|XP_009898389.1| PREDICTED: LOW QUALITY PROTEIN: rab3 GTPase-activating protein 
non-catalytic subunit [Picoides pubescens]
Length=1386

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 94/174 (54%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  332   AVASKLTSALFNAASGW--LGWKSKHEEEPTQKQKPK-VEPATPLAVRFGLPDSRRHGER  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  
Sbjct  389   ICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLNEREAEKMDF  448

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  449   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYK  502



>ref|XP_010339339.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Saimiri boliviensis boliviensis]
Length=1368

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (55%), Gaps = 8/133 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     L D  R GE + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA  
Sbjct  371   ATPLAVRFGLPDSRRHGESICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQI  430

Query  1229  LFMEMLVNKDSSTLKSAH-----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              +++++ +      + A      +    S     L I+APR+GI+E+W  + GPR+    
Sbjct  431   GWIQIVEDLHERVPEKAEFSPFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  490

Query  1394  CPKGSKILQPTYR  1432
               K  ++L P Y+
Sbjct  491   VGKHCRLLYPGYK  503



>ref|XP_010877414.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Esox lucius]
Length=1366

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 90/170 (53%), Gaps = 8/170 (5%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A FS  S       +SE   T K  PK +P   A+PL     L D  R GE 
Sbjct  335   AVASKLTSALFSAASGWLGWKKQSEEETTQKQRPKVEP---ATPLAVRFGLPDSRRHGES  391

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLA +TD  GR++LLD    + +R+WKGYRDA   +++  V++     +S+  
Sbjct  392   ICLSPCNTLAGVTDDFGRVMLLDVGRGIAIRMWKGYRDAQLGWVQ--VSEGRGERESSPS  449

Query  1286  EHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
               +   +   L I+APR+GI+E+W  + GPR+      K  ++L   YR 
Sbjct  450   APLPRRHAQFLVIYAPRRGILEVWGTQQGPRVGAFTVGKHCRLLYAGYRL  499



>ref|XP_514211.2| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Pan troglodytes]
Length=1393

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  449

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  450   SPFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  503



>ref|XP_004028475.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Gorilla gorilla gorilla]
Length=1417

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 91/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAH-  1282
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      + A  
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDLHERVPEKADF  449

Query  1283  ----HEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  450   SPFGNSQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  503



>gb|EMC80943.1| Rab3 GTPase-activating protein non-catalytic subunit [Columba 
livia]
Length=1382

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 95/175 (54%), Gaps = 11/175 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE+
Sbjct  331   AVASKLTSALFNAASGW--LGWKSKHEEEPAQKQKPK-VEPATPLAVRFGLPDSRRHGER  387

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFM---EMLVNKDSSTLKS  1276
             + LSP  TLAA+TD+ GR++LLD    + VR+WKGYRDA   ++   E L  +++  +  
Sbjct  388   ICLSPCNTLAAVTDAFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDF  447

Query  1277  AHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYRF  1435
             +   + +  S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+ 
Sbjct  448   SPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKYCRLLYPGYKI  502



>ref|XP_010560450.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X1 [Haliaeetus leucocephalus]
Length=1384

 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 90/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     + D  R GE+
Sbjct  332   AVASKLTSALFNAASGW--LGWKSKHEEEPAQKQKPK-VEPATPLAVRFGIPDSRRHGER  388

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   +++ + +      +    
Sbjct  389   ICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDF  448

Query  1286  EHIKSDYC-----LCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +  C       L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  449   SPFGNAQCPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  502



>ref|XP_010560451.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
isoform X2 [Haliaeetus leucocephalus]
Length=1383

 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 90/174 (52%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     + D  R GE+
Sbjct  331   AVASKLTSALFNAASGW--LGWKSKHEEEPAQKQKPK-VEPATPLAVRFGIPDSRRHGER  387

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA   +++ + +      +    
Sbjct  388   ICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEVGWIQTVEDLHERETEKMDF  447

Query  1286  EHIKSDYC-----LCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +  C       L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  448   SPFGNAQCPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  501



>ref|XP_009924710.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit, 
partial [Haliaeetus albicilla]
Length=1390

 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 72/134 (54%), Gaps = 8/134 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL     + D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA  
Sbjct  376   ATPLAVRFGIPDSRRHGERICLSPCNTLAAVTDEFGRVILLDVTRGLAVRMWKGYRDAEV  435

Query  1229  LFMEMLVNKDSSTLKSAHHEHIKSDYC-----LCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              +++ + +      +        +  C       L I+APR+GI+E+W  + GPR+    
Sbjct  436   GWIQTVEDLHERETEKMDFSPFGNAQCPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  495

Query  1394  CPKGSKILQPTYRF  1435
               K  ++L P Y+ 
Sbjct  496   VGKHCRLLYPGYKI  509



>ref|XP_009185364.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Papio anubis]
Length=1390

 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 94/183 (51%), Gaps = 29/183 (16%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R GE 
Sbjct  333   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-VEPATPLAVRFGLPDSRRHGES  389

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVNKDSSTLKSAHH  1285
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +          H
Sbjct  390   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQIGWIQIVEDL---------H  440

Query  1286  EHI--KSDY------------CLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQP  1423
             E I  K+D+               L I+APR+GI+E+W  + GPR+      K  ++L P
Sbjct  441   ERIPEKADFSPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYP  500

Query  1424  TYR  1432
              Y+
Sbjct  501   GYK  503



>ref|XP_004670175.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit 
[Jaculus jaculus]
Length=1396

 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 92/174 (53%), Gaps = 11/174 (6%)
 Frame = +2

Query  935   AILSKVVPATFSTISSISKMLWRSeptpttkpepkpQPFAKASPLTC---LKDYPRKGEK  1105
             A+ SK+  A F+  S    + W+S+       + KP+    A+PL     L D  R+GE 
Sbjct  335   AVASKLTSALFNAASGW--LGWKSKHEEEAVQKQKPK-MEPATPLAVRFGLPDSRRRGES  391

Query  1106  LTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEMLVN-----KDSSTL  1270
             + LSP  TLAA+TD  GR++LLD    + +R+WKGYRDA   +++++ +      +   +
Sbjct  392   ICLSPCNTLAAVTDDFGRVILLDVARGIAIRMWKGYRDAQTGWIQVIEDLHERVPEKVDV  451

Query  1271  KSAHHEHIKSDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIPCPKGSKILQPTYR  1432
                 +    S     L I+APR+GI+E+W  + GPR+      K  ++L P Y+
Sbjct  452   SPFGNTQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFNVGKHCRLLYPGYK  505



>ref|XP_010200725.1| PREDICTED: rab3 GTPase-activating protein non-catalytic subunit, 
partial [Colius striatus]
Length=1346

 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 77/133 (58%), Gaps = 8/133 (6%)
 Frame = +2

Query  1058  ASPLTC---LKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASC  1228
             A+PL+    L D  R GE++ LSP  TLAA+TD  GR++LLD    + VR+WKGYRDA  
Sbjct  332   ATPLSVRFGLPDSRRHGERICLSPCNTLAAVTDDFGRVILLDVTRGLAVRMWKGYRDAEV  391

Query  1229  LFM---EMLVNKDSSTLKSAHHEHIK--SDYCLCLAIHAPRKGIVEIWQMRTGPRLQTIP  1393
              ++   E L  +++  +  +   + +  S     L I+APR+GI+E+W  + GPR+    
Sbjct  392   GWIQAVEDLHERETEKMDFSPFGNAQGPSRVAQFLVIYAPRRGILEVWSTQQGPRVGAFN  451

Query  1394  CPKGSKILQPTYR  1432
               K  ++L P Y+
Sbjct  452   VGKYCRLLYPGYK  464



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5309665725034