BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17685_g2_i1 len=1030 path=[3190:0-1029]

Length=1030
                                                                      Score     E

ref|XP_006352380.1|  PREDICTED: EH domain-containing protein 1-like     397   4e-131   
ref|XP_004250246.1|  PREDICTED: EH domain-containing protein 1-like     394   1e-129   
ref|XP_009769722.1|  PREDICTED: EH domain-containing protein 1-like     392   4e-129   
ref|XP_009626939.1|  PREDICTED: EH domain-containing protein 1-like     391   9e-129   
ref|XP_011096032.1|  PREDICTED: EH domain-containing protein 1-like     386   1e-126   
ref|XP_007026229.1|  EPS15 domain 2 isoform 5                           378   4e-124   
ref|XP_007026225.1|  EPS15 domain 2 isoform 1                           378   2e-123   
ref|XP_007026227.1|  EPS15 domain 2 isoform 3                           378   3e-123   
ref|XP_007026226.1|  EPS15 domain 2 isoform 2                           377   4e-123   
gb|KDP20684.1|  hypothetical protein JCGZ_21155                         374   6e-122   
ref|XP_007026228.1|  EPS15 domain 2 isoform 4                           373   1e-121   
ref|XP_006829517.1|  hypothetical protein AMTR_s00074p00139810          372   3e-121   
ref|XP_010665753.1|  PREDICTED: EH domain-containing protein 1-like     370   2e-120   
ref|XP_002264320.1|  PREDICTED: EH domain-containing protein 3-like     369   4e-120   Vitis vinifera
ref|XP_010052900.1|  PREDICTED: EH domain-containing protein 1-li...    365   6e-120   
ref|XP_010913401.1|  PREDICTED: EH domain-containing protein 1-like     367   2e-119   
ref|XP_006449830.1|  hypothetical protein CICLE_v10014814mg             366   5e-119   
ref|XP_006467361.1|  PREDICTED: EH domain-containing protein 1-like     366   6e-119   
gb|KDO78396.1|  hypothetical protein CISIN_1g008954mg                   366   6e-119   
ref|XP_010052899.1|  PREDICTED: EH domain-containing protein 1-li...    366   7e-119   
ref|XP_002277794.1|  PREDICTED: EH domain-containing protein 1          365   1e-118   Vitis vinifera
gb|KCW70228.1|  hypothetical protein EUGRSUZ_F03500                     362   1e-118   
ref|XP_010270065.1|  PREDICTED: EH domain-containing protein 1          365   2e-118   
ref|XP_002518408.1|  EH-domain-containing protein, putative             364   3e-118   Ricinus communis
ref|XP_008805595.1|  PREDICTED: EH domain-containing protein 1-li...    364   3e-118   
ref|XP_008458980.1|  PREDICTED: EH domain-containing protein 1          363   1e-117   
ref|XP_010928404.1|  PREDICTED: EH domain-containing protein 1-like     362   3e-117   
ref|XP_004145425.1|  PREDICTED: EH domain-containing protein 1-like     361   6e-117   
ref|XP_008805597.1|  PREDICTED: EH domain-containing protein 1-li...    361   6e-117   
ref|XP_010063047.1|  PREDICTED: EH domain-containing protein 1          360   8e-117   
ref|XP_004157728.1|  PREDICTED: EH domain-containing protein 1-like     360   1e-116   
ref|XP_010544277.1|  PREDICTED: EH domain-containing protein 1          360   1e-116   
ref|XP_008226997.1|  PREDICTED: EH domain-containing protein 1          360   1e-116   
emb|CBI35707.3|  unnamed protein product                                361   2e-116   
gb|KCW70227.1|  hypothetical protein EUGRSUZ_F03500                     362   2e-116   
ref|XP_004293342.1|  PREDICTED: EH domain-containing protein 1-like     359   2e-116   
ref|XP_009348303.1|  PREDICTED: EH domain-containing protein 1-like     359   4e-116   
ref|XP_007213895.1|  hypothetical protein PRUPE_ppa003834mg             359   4e-116   
emb|CDP04464.1|  unnamed protein product                                360   5e-116   
gb|KHG30640.1|  EH domain-containing 1                                  358   6e-116   
ref|XP_007153999.1|  hypothetical protein PHAVU_003G082600g             353   7e-116   
ref|XP_008799457.1|  PREDICTED: EH domain-containing protein 1-like     358   9e-116   
ref|XP_007154001.1|  hypothetical protein PHAVU_003G082600g             353   1e-115   
gb|EMT01492.1|  EH domain-containing protein 1                          358   1e-115   
ref|XP_008805596.1|  PREDICTED: EH domain-containing protein 1-li...    357   2e-115   
ref|XP_009334157.1|  PREDICTED: EH domain-containing protein 1-like     357   2e-115   
ref|XP_003574764.1|  PREDICTED: EH domain-containing protein 1-like     357   2e-115   
ref|XP_002298819.2|  hypothetical protein POPTR_0001s36630g             355   3e-115   Populus trichocarpa [western balsam poplar]
gb|KDP39189.1|  hypothetical protein JCGZ_00946                         356   4e-115   
ref|XP_003529656.1|  PREDICTED: EH domain-containing protein 1-like     356   5e-115   
ref|XP_008359253.1|  PREDICTED: EH domain-containing protein 1-like     356   5e-115   
ref|XP_011046717.1|  PREDICTED: EH domain-containing protein 3          355   1e-114   
ref|XP_009361045.1|  PREDICTED: EH domain-containing protein 1-like     355   2e-114   
gb|KEH28435.1|  calcium-binding EF hand protein                         350   2e-114   
ref|XP_011000650.1|  PREDICTED: EH domain-containing protein 1-like     354   2e-114   
ref|XP_003550477.1|  PREDICTED: EH domain-containing protein 1-like     354   3e-114   
gb|ACJ85603.1|  unknown                                                 350   4e-114   Medicago truncatula
gb|KHN03510.1|  EH domain-containing protein 1                          353   4e-114   
ref|XP_007154000.1|  hypothetical protein PHAVU_003G082600g             353   8e-114   
ref|XP_010090952.1|  EH domain-containing protein 1                     351   1e-113   
ref|XP_004294399.1|  PREDICTED: EH domain-containing protein 1-like     352   1e-113   
ref|XP_009357509.1|  PREDICTED: EH domain-containing protein 1-li...    352   1e-113   
ref|XP_007211540.1|  hypothetical protein PRUPE_ppa003972mg             352   2e-113   
ref|XP_006586764.1|  PREDICTED: EH domain-containing protein 1-like     352   2e-113   
gb|EAZ02155.1|  hypothetical protein OsI_24244                          351   4e-113   Oryza sativa Indica Group [Indian rice]
ref|NP_001058410.1|  Os06g0687800                                       351   4e-113   Oryza sativa Japonica Group [Japonica rice]
gb|KHN40844.1|  EH domain-containing protein 1                          351   5e-113   
ref|XP_008384122.1|  PREDICTED: EH domain-containing protein 1-like     351   5e-113   
gb|AFK42442.1|  unknown                                                 350   8e-113   
ref|XP_010675784.1|  PREDICTED: EH domain-containing protein 1-like     350   8e-113   
emb|CDO98110.1|  unnamed protein product                                350   8e-113   
ref|NP_001045954.1|  Os02g0158100                                       350   9e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003617631.1|  EH-domain-containing protein                       350   1e-112   
emb|CAN67909.1|  hypothetical protein VITISV_034695                     350   1e-112   Vitis vinifera
ref|XP_004951833.1|  PREDICTED: EH domain-containing protein 1-like     351   1e-112   
ref|XP_011095452.1|  PREDICTED: EH domain-containing protein 1-like     350   1e-112   
ref|XP_002531194.1|  EH-domain-containing protein, putative             350   2e-112   Ricinus communis
ref|XP_003594167.1|  EH-domain-containing protein                       349   2e-112   
ref|XP_002453335.1|  hypothetical protein SORBIDRAFT_04g004020          349   2e-112   Sorghum bicolor [broomcorn]
ref|XP_010096102.1|  EH domain-containing protein 1                     349   3e-112   
ref|XP_009398680.1|  PREDICTED: EH domain-containing protein 1-like     348   3e-112   
gb|KDO62120.1|  hypothetical protein CISIN_1g009050mg                   343   4e-112   
ref|XP_009334827.1|  PREDICTED: EH domain-containing protein 1-li...    348   5e-112   
ref|XP_008224739.1|  PREDICTED: EH domain-containing protein 1-like     348   6e-112   
gb|EMT05303.1|  EH domain-containing protein 1                          348   7e-112   
dbj|BAJ95881.1|  predicted protein                                      348   9e-112   
ref|XP_003547274.1|  PREDICTED: EH domain-containing protein 1-like     347   1e-111   
ref|XP_009352442.1|  PREDICTED: EH domain-containing protein 1-like     348   1e-111   
ref|XP_010252585.1|  PREDICTED: EH domain-containing protein 1-li...    347   1e-111   
ref|XP_006657273.1|  PREDICTED: EH domain-containing protein 1-like     347   1e-111   
gb|EMS68080.1|  EH domain-containing protein 1                          347   2e-111   
dbj|BAJ86819.1|  predicted protein                                      347   2e-111   
ref|XP_009598339.1|  PREDICTED: EH domain-containing protein 1-li...    346   3e-111   
ref|XP_002437485.1|  hypothetical protein SORBIDRAFT_10g027960          346   3e-111   Sorghum bicolor [broomcorn]
ref|XP_009598337.1|  PREDICTED: EH domain-containing protein 1-li...    346   3e-111   
ref|XP_009393691.1|  PREDICTED: EH domain-containing protein 1-like     346   3e-111   
ref|XP_009598338.1|  PREDICTED: EH domain-containing protein 1-li...    346   4e-111   
ref|XP_002316591.2|  calcium-binding EF hand family protein             345   4e-111   Populus trichocarpa [western balsam poplar]
gb|KHN28769.1|  EH domain-containing protein 1                          353   5e-111   
ref|NP_974517.1|  EPS15 homology domain 2 protein                       345   6e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006646902.1|  PREDICTED: EH domain-containing protein 1-like     345   6e-111   
ref|XP_009776639.1|  PREDICTED: EH domain-containing protein 1 is...    345   7e-111   
ref|XP_009776640.1|  PREDICTED: EH domain-containing protein 1 is...    345   7e-111   
ref|XP_009776638.1|  PREDICTED: EH domain-containing protein 1 is...    345   7e-111   
ref|XP_004486203.1|  PREDICTED: EH domain-containing protein 1-like     345   1e-110   
ref|XP_004507655.1|  PREDICTED: EH domain-containing protein 1-li...    344   1e-110   
ref|NP_001266688.1|  EH-domain-containing protein 1                     344   2e-110   
ref|NP_001140588.1|  uncharacterized protein LOC100272658               344   2e-110   Zea mays [maize]
ref|XP_004507654.1|  PREDICTED: EH domain-containing protein 1-li...    345   3e-110   
ref|XP_003563453.1|  PREDICTED: EH domain-containing protein 1-like     344   3e-110   
ref|XP_008644157.1|  PREDICTED: uncharacterized protein LOC100384...    343   3e-110   
ref|XP_009589162.1|  PREDICTED: EH domain-containing protein 1-li...    343   5e-110   
ref|XP_002874791.1|  calcium-binding EF hand family protein             343   5e-110   
gb|KFK32206.1|  hypothetical protein AALP_AA6G211000                    343   7e-110   
ref|XP_006475006.1|  PREDICTED: EH domain-containing protein 3-like     343   7e-110   
gb|KDO62119.1|  hypothetical protein CISIN_1g009050mg                   342   8e-110   
ref|XP_004966283.1|  PREDICTED: EH domain-containing protein 1-like     342   8e-110   
ref|XP_010455720.1|  PREDICTED: EH domain-containing protein 1-li...    342   9e-110   
ref|XP_006452452.1|  hypothetical protein CICLE_v10007883mg             343   1e-109   
ref|XP_008449138.1|  PREDICTED: EH domain-containing protein 1          342   1e-109   
ref|XP_006396726.1|  hypothetical protein EUTSA_v10028561mg             342   2e-109   
ref|XP_007020711.1|  EPS15 domain 1                                     342   2e-109   
ref|XP_004491428.1|  PREDICTED: EH domain-containing protein 3-like     342   2e-109   
ref|NP_567299.2|  EPS15 homology domain 2 protein                       342   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009334825.1|  PREDICTED: EH domain-containing protein 1-li...    342   4e-109   
ref|XP_009114593.1|  PREDICTED: EH domain-containing protein 1 is...    340   6e-109   
ref|XP_009334826.1|  PREDICTED: EH domain-containing protein 1-li...    342   7e-109   
ref|XP_004149345.1|  PREDICTED: EH domain-containing protein 1-like     340   7e-109   
ref|XP_010433120.1|  PREDICTED: EH domain-containing protein 1-li...    340   8e-109   
gb|KGN56098.1|  hypothetical protein Csa_3G073890                       340   1e-108   
ref|XP_006602183.1|  PREDICTED: EH domain-containing protein 1-like     340   1e-108   
ref|XP_004500109.1|  PREDICTED: EH domain-containing protein 1-like     339   2e-108   
ref|XP_006287437.1|  hypothetical protein CARUB_v10000641mg             338   4e-108   
ref|XP_010466211.1|  PREDICTED: EH domain-containing protein 1-like     338   4e-108   
ref|XP_003519595.1|  PREDICTED: EH domain-containing protein 1-like     338   4e-108   
ref|XP_010455719.1|  PREDICTED: EH domain-containing protein 1-li...    338   4e-108   
gb|EPS68571.1|  hypothetical protein M569_06192                         338   4e-108   
emb|CDX94536.1|  BnaC09g23000D                                          338   7e-108   
ref|XP_010487999.1|  PREDICTED: EH domain-containing protein 1-like     337   8e-108   
ref|XP_010508763.1|  PREDICTED: EH domain-containing protein 1-like     337   2e-107   
ref|XP_006346193.1|  PREDICTED: EH domain-containing protein 1-like     336   2e-107   
emb|CDY16689.1|  BnaA09g20670D                                          336   3e-107   
ref|XP_009114592.1|  PREDICTED: EH domain-containing protein 1 is...    336   3e-107   
ref|XP_006406401.1|  hypothetical protein EUTSA_v10020459mg             336   3e-107   
ref|XP_010433113.1|  PREDICTED: EH domain-containing protein 1-li...    336   4e-107   
emb|CDP13787.1|  unnamed protein product                                335   5e-107   
ref|NP_566657.1|  EPS15 homology domain 1 protein                       335   5e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010324305.1|  PREDICTED: EH domain-containing protein 1-li...    335   9e-107   
ref|XP_006296699.1|  hypothetical protein CARUB_v10013398mg             334   2e-106   
gb|EYU27376.1|  hypothetical protein MIMGU_mgv1a004087mg                334   2e-106   
ref|XP_010538744.1|  PREDICTED: EH domain-containing protein 1 is...    333   2e-106   
ref|XP_010538746.1|  PREDICTED: EH domain-containing protein 1 is...    333   3e-106   
ref|XP_007142331.1|  hypothetical protein PHAVU_008G271300g             333   3e-106   
ref|XP_009390978.1|  PREDICTED: EH domain-containing protein 1-li...    333   3e-106   
ref|XP_009390977.1|  PREDICTED: EH domain-containing protein 1-li...    333   4e-106   
ref|XP_009111201.1|  PREDICTED: EH domain-containing protein 1-li...    333   5e-106   
ref|XP_007147670.1|  hypothetical protein PHAVU_006G144500g             332   9e-106   
ref|XP_010324304.1|  PREDICTED: EH domain-containing protein 1-li...    332   1e-105   
ref|XP_003610495.1|  EH-domain-containing protein                       332   1e-105   
ref|XP_007145728.1|  hypothetical protein PHAVU_007G262900g             331   2e-105   
ref|XP_002885363.1|  calcium-binding EF hand family protein             331   2e-105   
ref|XP_009145649.1|  PREDICTED: EH domain-containing protein 1 is...    330   4e-105   
gb|EPS69769.1|  hypothetical protein M569_04997                         326   4e-105   
ref|XP_009145651.1|  PREDICTED: EH domain-containing protein 1 is...    330   5e-105   
ref|XP_009390979.1|  PREDICTED: EH domain-containing protein 1-li...    329   1e-104   
ref|XP_009401415.1|  PREDICTED: EH domain-containing protein 1-like     329   1e-104   
gb|KEH33921.1|  EPS15-like domain protein                               327   1e-103   
dbj|BAB02809.1|  unnamed protein product                                326   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011097835.1|  PREDICTED: EH domain-containing protein 1-li...    326   2e-103   
ref|XP_011097837.1|  PREDICTED: EH domain-containing protein 1-li...    326   2e-103   
ref|XP_009145648.1|  PREDICTED: EH domain-containing protein 1 is...    326   2e-103   
ref|XP_009145650.1|  PREDICTED: EH domain-containing protein 1 is...    325   4e-103   
gb|KFK39351.1|  hypothetical protein AALP_AA3G233100                    325   6e-103   
ref|XP_006652990.1|  PREDICTED: EH domain-containing protein 1-like     323   2e-102   
gb|KHN38249.1|  EH domain-containing protein 1                          323   3e-102   
ref|NP_001054202.1|  Os04g0669300                                       321   2e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447292.1|  hypothetical protein SORBIDRAFT_06g032210          320   3e-101   Sorghum bicolor [broomcorn]
gb|AEV41109.1|  putative EH-domain-containing protein 1                 320   3e-101   
gb|AEV41063.1|  putative EH-domain-containing protein 1                 320   4e-101   
gb|AEV40966.1|  putative EH-domain-containing protein 1                 320   5e-101   
ref|XP_003579456.1|  PREDICTED: EH domain-containing protein 1-like     319   1e-100   
ref|NP_001167939.1|  uncharacterized protein LOC100381653               318   2e-100   Zea mays [maize]
tpg|DAA35457.1|  TPA: hypothetical protein ZEAMMB73_021494              318   2e-100   
gb|AEV41016.1|  putative EH-domain-containing protein 1                 317   6e-100   
ref|XP_010313928.1|  PREDICTED: EH domain-containing protein 3-like     311   8e-98    
gb|EYU33672.1|  hypothetical protein MIMGU_mgv1a004199mg                307   3e-96    
ref|XP_009770782.1|  PREDICTED: EH domain-containing protein 1-li...    307   5e-96    
ref|XP_001772546.1|  predicted protein                                  307   5e-96    
ref|XP_009770776.1|  PREDICTED: EH domain-containing protein 1-li...    307   6e-96    
ref|XP_006352527.1|  PREDICTED: EH domain-containing protein 1-li...    306   8e-96    
ref|XP_006344871.1|  PREDICTED: EH domain-containing protein 1-like     306   9e-96    
ref|XP_002970092.1|  hypothetical protein SELMODRAFT_92582              305   2e-95    
gb|AAD48968.1|AF147263_10  contains similarity to Pfam family PF0...    304   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009779278.1|  PREDICTED: EH domain-containing protein 1-li...    305   3e-95    
gb|EYU27374.1|  hypothetical protein MIMGU_mgv1a026674mg                299   2e-94    
ref|XP_009603507.1|  PREDICTED: EH domain-containing protein 1-li...    302   3e-94    
ref|XP_006352528.1|  PREDICTED: EH domain-containing protein 1-li...    302   4e-94    
ref|XP_007145730.1|  hypothetical protein PHAVU_007G263100g             299   5e-93    
ref|XP_002985283.1|  hypothetical protein SELMODRAFT_121714             298   2e-92    
ref|XP_002974220.1|  hypothetical protein SELMODRAFT_414547             295   3e-91    
ref|XP_010327191.1|  PREDICTED: EH domain-containing protein 1-like     290   2e-89    
ref|XP_008363998.1|  PREDICTED: EH domain-containing protein 1-like     273   5e-86    
emb|CDY50093.1|  BnaC01g32680D                                          278   5e-85    
emb|CDY29816.1|  BnaC05g31740D                                          273   5e-83    
ref|XP_001784382.1|  predicted protein                                  272   7e-83    
emb|CDY25408.1|  BnaA05g18760D                                          270   4e-82    
emb|CDY50090.1|  BnaC01g32650D                                          260   8e-78    
emb|CAJ86083.1|  H0818H01.5                                             246   1e-72    Oryza sativa [red rice]
gb|EMT24958.1|  EH domain-containing protein 1                          239   1e-70    
gb|EYU27756.1|  hypothetical protein MIMGU_mgv1a004743mg                239   4e-70    
ref|XP_009589164.1|  PREDICTED: EH domain-containing protein 1-li...    236   9e-70    
ref|XP_009357511.1|  PREDICTED: EH domain-containing protein 1-li...    237   1e-69    
ref|XP_005851211.1|  hypothetical protein CHLNCDRAFT_33853              239   1e-69    
ref|XP_009598340.1|  PREDICTED: EH domain-containing protein 1-li...    232   7e-68    
ref|XP_008370549.1|  PREDICTED: EH domain-containing protein 1-like     231   1e-67    
ref|XP_009776641.1|  PREDICTED: EH domain-containing protein 1 is...    231   2e-67    
ref|XP_007515068.1|  unnamed protein product                            230   1e-66    
ref|XP_009111206.1|  PREDICTED: EH domain-containing protein 1-li...    228   3e-66    
ref|XP_010422242.1|  PREDICTED: EH domain-containing protein 1-like     224   2e-65    
ref|XP_006406402.1|  hypothetical protein EUTSA_v10020459mg             223   5e-65    
gb|KFM29283.1|  EH domain-containing protein 1                          225   3e-64    
ref|XP_006452453.1|  hypothetical protein CICLE_v10007883mg             221   5e-64    
ref|XP_010252586.1|  PREDICTED: EH domain-containing protein 1-li...    219   3e-63    
ref|XP_008371039.1|  PREDICTED: EH domain-containing protein 3-li...    209   9e-63    
gb|KCW77036.1|  hypothetical protein EUGRSUZ_D01382                     218   1e-62    
ref|XP_010054613.1|  PREDICTED: EH domain-containing protein 1-like     218   5e-62    
gb|AIE88276.1|  hypothetical protein OG_BBa0063K01.7                    216   9e-62    
ref|XP_005643284.1|  hypothetical protein COCSUDRAFT_38543              216   3e-61    
gb|KEH33927.1|  calcium-binding EF hand protein                         213   3e-61    
ref|XP_010042270.1|  PREDICTED: EH domain-containing protein 1-like     209   3e-60    
ref|XP_010042271.1|  PREDICTED: EH domain-containing protein 1-like     205   2e-59    
ref|XP_010675794.1|  PREDICTED: EH domain-containing protein 1-like     203   2e-57    
ref|XP_002985697.1|  hypothetical protein SELMODRAFT_122705             205   5e-57    
ref|XP_009402015.1|  PREDICTED: EH domain-containing protein 1-like     199   4e-55    
ref|XP_009603511.1|  PREDICTED: EH domain-containing protein 1-li...    197   7e-55    
ref|XP_009779284.1|  PREDICTED: EH domain-containing protein 1-li...    197   7e-55    
ref|XP_009770779.1|  PREDICTED: EH domain-containing protein 1-li...    197   9e-55    
ref|XP_009770780.1|  PREDICTED: EH domain-containing protein 1-li...    192   2e-53    
ref|XP_009779286.1|  PREDICTED: EH domain-containing protein 1-li...    192   5e-53    
ref|XP_010513695.1|  PREDICTED: EH domain-containing protein 1-like     179   2e-49    
ref|XP_002966377.1|  hypothetical protein SELMODRAFT_85478              176   1e-47    
ref|XP_002978188.1|  hypothetical protein SELMODRAFT_108442             176   1e-47    
gb|KHG01502.1|  EH domain-containing 1                                  177   3e-47    
ref|XP_005792863.1|  RME1A, RME-1/EHD family protein                    168   4e-47    
gb|ABI13180.1|  hypothetical protein                                    169   7e-45    Emiliania huxleyi
ref|XP_002946165.1|  hypothetical protein VOLCADRAFT_55400              171   7e-45    
emb|CEG84957.1|  hypothetical protein RMATCC62417_18698                 164   1e-44    
ref|XP_005780580.1|  RME1A, RME-1/EHD family protein                    169   9e-44    
ref|XP_008859898.1|  receptor mediated endocytosis protein, putative    159   1e-43    
emb|CEJ02933.1|  hypothetical protein RMCBS344292_16925                 158   2e-43    
gb|EMD49223.1|  EH domain containing protein                            160   2e-43    
emb|CEG64412.1|  hypothetical protein RMATCC62417_01389                 164   3e-43    
emb|CCA22188.1|  conserved hypothetical protein                         160   4e-43    
gb|EMD46131.1|  receptor -mediated endocytosis protein, putative        160   5e-43    
gb|EIE86499.1|  hypothetical protein RO3G_11210                         166   1e-42    
ref|XP_003055188.1|  predicted protein                                  165   1e-42    
ref|XP_004365433.1|  past-1                                             165   2e-42    
ref|XP_008225167.1|  PREDICTED: EH domain-containing protein 1-like     158   2e-42    
emb|CDS06358.1|  hypothetical protein LRAMOSA08886                      164   3e-42    
emb|CDH57890.1|  past-1                                                 164   4e-42    
ref|XP_002499973.1|  predicted protein                                  162   4e-42    Micromonas commoda
emb|CEG64411.1|  hypothetical protein RMATCC62417_01389                 163   6e-42    
emb|CEI99343.1|  hypothetical protein RMCBS344292_13433                 164   8e-42    
dbj|GAM18969.1|  hypothetical protein SAMD00019534_021440               163   9e-42    
gb|ELW65085.1|  EH domain-containing protein 1                          156   9e-42    
emb|CEG72115.1|  hypothetical protein RMATCC62417_07727                 162   2e-41    
gb|EPB81232.1|  hypothetical protein HMPREF1544_12055                   162   2e-41    
ref|XP_010819470.1|  PREDICTED: EH domain-containing protein 1          154   2e-41    
emb|CEJ00342.1|  hypothetical protein RMCBS344292_14400                 162   2e-41    
ref|XP_001734264.1|  EH domain-containing protein                       161   3e-41    Entamoeba dispar SAW760
ref|XP_001913783.1|  ENTH domain protein                                161   3e-41    Entamoeba histolytica HM-1:IMSS
ref|XP_653938.1|  Receptor mediated endocytosis protein                 161   3e-41    Entamoeba histolytica HM-1:IMSS
ref|XP_001735333.1|  EH domain-containing protein                       161   3e-41    Entamoeba dispar SAW760
tpg|DAA13661.1|  TPA: EH-domain containing 1-like                       153   3e-41    
ref|XP_008047905.1|  PREDICTED: EH domain-containing protein 1-like     154   3e-41    
gb|KHN85977.1|  EH domain-containing protein 1                          153   8e-41    
emb|CCI42136.1|  unnamed protein product                                160   9e-41    
gb|EMH72886.1|  receptor mediated endocytosis protein, putative         150   1e-40    
ref|XP_004596919.1|  PREDICTED: EH domain-containing protein 1          156   1e-40    
gb|EPB88290.1|  hypothetical protein HMPREF1544_04874                   159   1e-40    
gb|EFA79769.1|  hypothetical protein PPL_06588                          159   2e-40    
gb|KFH65415.1|  hypothetical protein MVEG_08893                         160   2e-40    
ref|XP_001508007.3|  PREDICTED: EH domain-containing protein 1          150   2e-40    
tpg|DAA13730.1|  TPA: EH domain-containing protein 1                    156   2e-40    
ref|XP_005660782.1|  PREDICTED: EH domain-containing protein 1 is...    159   3e-40    
gb|ESA13801.1|  hypothetical protein GLOINDRAFT_175493                  159   3e-40    
emb|CAJ82518.1|  EH-domain containing 1                                 155   3e-40    
ref|XP_002899341.1|  conserved hypothetical protein                     159   3e-40    
gb|KHG22957.1|  EH domain-containing 1                                  157   5e-40    
dbj|BAG64091.1|  unnamed protein product                                157   5e-40    
gb|ACC64578.1|  EH-domain containing 1 (predicted)                      156   6e-40    
ref|XP_006861018.1|  PREDICTED: EH domain-containing protein 1 is...    158   6e-40    
gb|AAH84135.1|  LOC495040 protein                                       154   6e-40    
ref|XP_003122601.2|  PREDICTED: EH domain-containing protein 1 is...    158   6e-40    
ref|XP_006861019.1|  PREDICTED: EH domain-containing protein 1 is...    157   6e-40    
dbj|BAE01936.1|  unnamed protein product                                156   7e-40    
ref|XP_008302461.1|  PREDICTED: EH domain-containing protein 3-like     149   8e-40    
ref|XP_004683416.1|  PREDICTED: EH domain-containing protein 1          157   9e-40    
ref|XP_004383816.1|  PREDICTED: EH domain-containing protein 1          157   1e-39    
ref|XP_006149915.1|  PREDICTED: EH domain-containing protein 1 is...    157   1e-39    
ref|XP_008157310.1|  PREDICTED: EH domain-containing protein 1          157   1e-39    
ref|XP_004261439.1|  EH domain containing protein, putative             157   1e-39    
gb|EJD74139.1|  receptor mediated endocytosis protein 1                 157   1e-39    
ref|XP_003798673.1|  PREDICTED: EH domain-containing protein 1          157   1e-39    
ref|XP_010634333.1|  PREDICTED: EH domain-containing protein 1 is...    157   1e-39    
ref|XP_009537814.1|  hypothetical protein PHYSODRAFT_529936             157   1e-39    
ref|XP_007518643.1|  PREDICTED: EH domain-containing protein 1          157   1e-39    
ref|XP_010634332.1|  PREDICTED: EH domain-containing protein 1 is...    157   1e-39    
ref|XP_008251915.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    157   2e-39    
ref|XP_006642819.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    156   2e-39    
ref|XP_008578193.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
ref|XP_004618455.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
dbj|BAE40477.1|  unnamed protein product                                156   2e-39    
ref|XP_010955402.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
ref|NP_034249.1|  EH domain-containing protein 1                        156   2e-39    
ref|XP_006745613.1|  PREDICTED: EH domain-containing protein 1 is...    156   2e-39    
ref|XP_009006688.1|  PREDICTED: EH domain-containing protein 1 is...    156   2e-39    
ref|XP_004643795.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
ref|XP_006216738.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
ref|NP_001267146.1|  EH domain-containing protein 1                     156   2e-39    
ref|XP_007942988.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
ref|XP_010346582.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
ref|XP_007110081.1|  PREDICTED: EH domain-containing protein 1 is...    156   2e-39    
ref|XP_005064005.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
ref|XP_004437632.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
gb|ACQ62995.1|  EH-domain containing 1 (predicted)                      156   2e-39    
ref|XP_007462100.1|  PREDICTED: EH domain-containing protein 1 is...    156   2e-39    
ref|XP_006901528.1|  PREDICTED: EH domain-containing protein 1 is...    156   2e-39    
ref|XP_004264369.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
ref|NP_006786.2|  EH domain-containing protein 1 isoform 1              156   2e-39    
ref|XP_004478690.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
gb|ACA64879.1|  EH-domain containing 1 (predicted)                      156   2e-39    
ref|XP_004823289.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
ref|XP_007174350.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
ref|XP_005384609.1|  PREDICTED: EH domain-containing protein 1 is...    156   2e-39    
gb|AAI60908.1|  Ehd1 protein                                            156   2e-39    
ref|XP_004770175.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
ref|XP_004394030.1|  PREDICTED: EH domain-containing protein 1 is...    156   2e-39    
dbj|BAK63307.1|  EH-domain-containing protein 1                         156   2e-39    
ref|XP_006745612.1|  PREDICTED: EH domain-containing protein 1 is...    156   2e-39    
dbj|BAE39763.1|  unnamed protein product                                156   2e-39    
ref|XP_003468257.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
ref|NP_001269374.1|  EH domain-containing protein 1 isoform 2           156   2e-39    
ref|XP_006911196.1|  PREDICTED: EH domain-containing protein 1          156   2e-39    
ref|XP_004394029.1|  PREDICTED: EH domain-containing protein 1 is...    156   2e-39    
gb|AAG02009.1|  similar to Homo sapiens Hpast (HPAST) mRNA with G...    156   2e-39    
ref|XP_003432468.2|  PREDICTED: EH domain-containing protein 1 is...    156   2e-39    
gb|AAH37094.1|  EH-domain containing 1                                  156   2e-39    
ref|XP_006179621.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    156   2e-39    
dbj|BAE43123.1|  unnamed protein product                                156   2e-39    
ref|XP_007462099.1|  PREDICTED: EH domain-containing protein 1 is...    156   2e-39    
ref|XP_002755558.3|  PREDICTED: EH domain-containing protein 1 is...    156   3e-39    
ref|XP_005631565.1|  PREDICTED: EH domain-containing protein 1 is...    156   3e-39    
ref|XP_009183961.1|  PREDICTED: EH domain-containing protein 1 is...    156   3e-39    
ref|XP_007246435.1|  PREDICTED: EH domain-containing protein 1-like     156   3e-39    
ref|XP_008618010.1|  hypothetical protein SDRG_13692                    156   3e-39    
gb|AAD45866.1|AF099011_1  EH-domain containing protein testilin         156   3e-39    
ref|NP_001015578.1|  EH domain-containing protein 1                     156   3e-39    
ref|XP_003993621.1|  PREDICTED: EH domain-containing protein 1          156   3e-39    
ref|XP_009183962.1|  PREDICTED: EH domain-containing protein 1 is...    156   3e-39    
emb|CDS09414.1|  hypothetical protein LRAMOSA10774                      155   3e-39    
ref|XP_010994338.1|  PREDICTED: EH domain-containing protein 1          156   3e-39    
ref|XP_005988942.1|  PREDICTED: EH domain-containing protein 1-like     155   3e-39    
ref|NP_001006734.1|  EH-domain containing 1                             155   4e-39    
dbj|BAN40829.1|  EH domain-containing protein, putative                 155   4e-39    
dbj|BAN40368.1|  EH domain-containing protein, putative                 155   4e-39    
emb|CBJ27036.1|  RME1, RME-1/EHD family ATPase with a C-terminal ...    155   4e-39    
ref|XP_009006687.1|  PREDICTED: EH domain-containing protein 1 is...    155   4e-39    
ref|NP_001004578.1|  EH domain-containing protein 1                     155   5e-39    
gb|KDO25885.1|  hypothetical protein SPRG_08827                         155   5e-39    
gb|EQB77753.1|  EH domain-containing protein 1                          155   5e-39    
ref|XP_005351853.1|  PREDICTED: EH domain-containing protein 1          155   6e-39    
emb|CDQ05699.1|  Protein Bm6218, isoform c                              155   6e-39    
gb|ABG66989.1|  EH-domain containing 1                                  155   6e-39    
gb|AAH97601.1|  LOC495040 protein                                       154   7e-39    
ref|NP_998039.1|  EH-domain containing 1a                               155   7e-39    
gb|KFM72425.1|  EH domain-containing protein 1                          147   7e-39    
ref|XP_001733332.1|  EH domain-containing protein                       155   7e-39    
ref|XP_006056578.1|  PREDICTED: EH domain-containing protein 1          155   7e-39    
ref|XP_008916119.1|  hypothetical protein PPTG_19423                    155   7e-39    
gb|ETM53605.1|  hypothetical protein L914_02911                         155   7e-39    
gb|ETM00403.1|  hypothetical protein L917_02847                         155   7e-39    
emb|CDI81692.1|  EH protein, putative                                   150   7e-39    
gb|ELT99462.1|  hypothetical protein CAPTEDRAFT_108382                  154   8e-39    
gb|EJW78181.1|  receptor mediated endocytosis protein 1                 153   8e-39    
ref|NP_001088212.1|  EH-domain containing 1                             154   9e-39    
ref|XP_006781385.1|  PREDICTED: EH domain-containing protein 1-like     154   1e-38    
ref|XP_010836316.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    154   1e-38    
gb|EHH56113.1|  Testilin                                                154   1e-38    
ref|XP_001748021.1|  hypothetical protein                               154   1e-38    
ref|XP_004051595.1|  PREDICTED: EH domain-containing protein 1          154   2e-38    
ref|XP_003382701.1|  PREDICTED: EH domain-containing protein 1-like     154   2e-38    
ref|NP_001024195.1|  Protein RME-1, isoform d                           154   2e-38    
gb|AAB81204.1|  Hpast                                                   154   2e-38    
emb|CDJ45733.1|  EH protein, putative                                   150   2e-38    
ref|NP_001024197.1|  Protein RME-1, isoform f                           154   2e-38    
ref|XP_009064815.1|  hypothetical protein LOTGIDRAFT_196647             153   2e-38    
ref|XP_004656697.1|  PREDICTED: EH domain-containing protein 1          153   2e-38    
ref|NP_001024196.1|  Protein RME-1, isoform e                           154   2e-38    
ref|NP_001024194.1|  Protein RME-1, isoform c                           154   2e-38    
gb|EGT40046.1|  hypothetical protein CAEBREN_17914                      153   2e-38    
ref|XP_004261078.1|  EH domain containing protein, putative             153   2e-38    
ref|XP_001951167.1|  PREDICTED: EH domain-containing protein 1          153   3e-38    
ref|XP_008325062.1|  PREDICTED: EH domain-containing protein 1-like     153   3e-38    
ref|XP_003444774.1|  PREDICTED: EH domain-containing protein 1          153   3e-38    
dbj|BAE35852.1|  unnamed protein product                                153   3e-38    
ref|NP_001024192.1|  Protein RME-1, isoform a                           155   3e-38    
ref|XP_003286160.1|  hypothetical protein DICPUDRAFT_30504              153   3e-38    
ref|XP_004887841.1|  PREDICTED: EH domain-containing protein 1          153   3e-38    
ref|XP_009011174.1|  hypothetical protein HELRODRAFT_109211             153   4e-38    
emb|CDQ05701.1|  Protein Bm6218, isoform a                              153   4e-38    
gb|ERG83767.1|  eh domain-containing protein 3                          153   4e-38    
ref|XP_003970287.1|  PREDICTED: EH domain-containing protein 1-like     152   4e-38    
emb|CDQ05702.1|  Protein Bm6218, isoform d                              153   4e-38    
emb|CDQ05700.1|  Protein Bm6218, isoform b                              153   4e-38    
ref|NP_001024193.1|  Protein RME-1, isoform b                           155   4e-38    
ref|XP_003112313.1|  CRE-RME-1 protein                                  152   4e-38    
ref|XP_004073212.1|  PREDICTED: EH domain-containing protein 1-like     152   4e-38    
ref|XP_002637221.1|  C. briggsae CBR-RME-1 protein                      153   5e-38    
gb|EGT47196.1|  hypothetical protein CAEBREN_20402                      154   5e-38    
ref|XP_010896656.1|  PREDICTED: EH domain-containing protein 1-li...    152   5e-38    
ref|XP_010766243.1|  PREDICTED: EH domain-containing protein 1          152   5e-38    
ref|XP_009492794.1|  hypothetical protein H696_00638                    152   5e-38    
ref|XP_002718009.2|  PREDICTED: EH domain-containing protein 4          152   6e-38    
ref|XP_010896654.1|  PREDICTED: EH domain-containing protein 1-li...    152   6e-38    
ref|XP_008418633.1|  PREDICTED: EH domain-containing protein 1-li...    150   6e-38    
gb|KFH71719.1|  hypothetical protein MVEG_02014                         152   6e-38    
ref|XP_004183208.1|  EH domain containing protein, putative             152   6e-38    
dbj|BAN41932.1|  EH domain-containing protein, putative                 152   6e-38    
gb|ETN74697.1|  dynamin family protein                                  152   7e-38    
ref|XP_010896655.1|  PREDICTED: EH domain-containing protein 1-li...    152   8e-38    
gb|EYC08124.1|  hypothetical protein Y032_0067g13                       152   8e-38    
ref|XP_010747976.1|  PREDICTED: EH domain-containing protein 1-like     152   8e-38    
ref|XP_008278543.1|  PREDICTED: EH domain-containing protein 1-like     152   9e-38    
ref|XP_006265021.1|  PREDICTED: EH domain-containing protein 1          152   9e-38    
ref|XP_005814925.1|  PREDICTED: EH domain-containing protein 1-like     151   1e-37    
ref|XP_006033224.1|  PREDICTED: EH domain-containing protein 1 is...    151   1e-37    
ref|XP_004545608.1|  PREDICTED: EH domain-containing protein 1-like     151   1e-37    
ref|XP_005723146.1|  PREDICTED: EH domain-containing protein 1-like     151   1e-37    
gb|EYC08125.1|  hypothetical protein Y032_0067g13                       152   1e-37    
ref|XP_008870165.1|  hypothetical protein H310_06767                    151   1e-37    
emb|CAG09748.1|  unnamed protein product                                152   1e-37    
gb|KDR15657.1|  EH domain-containing protein 4                          151   1e-37    
gb|KFD48759.1|  hypothetical protein M513_10389                         151   1e-37    
emb|CDJ61725.1|  EH protein, putative                                   142   1e-37    
ref|XP_009009818.1|  hypothetical protein HELRODRAFT_62236              151   1e-37    
gb|KDD73486.1|  hypothetical protein H632_c2126p0                       149   2e-37    
ref|XP_010868930.1|  PREDICTED: EH domain-containing protein 1-like     150   2e-37    
emb|CDQ63557.1|  unnamed protein product                                150   2e-37    
ref|XP_005107738.1|  PREDICTED: EH domain-containing protein 3-like     151   2e-37    
ref|XP_655680.1|  EH-domain containing protein                          150   2e-37    
ref|XP_007440405.1|  PREDICTED: EH domain-containing protein 4-like     148   2e-37    
ref|XP_003744873.1|  PREDICTED: EH domain-containing protein 4-like     150   2e-37    
emb|CDW56868.1|  protein rme isoform c; protein rme isoform b; pr...    150   2e-37    
gb|ETI54061.1|  hypothetical protein F443_03079                         150   2e-37    
gb|EHJ75206.1|  past-1                                                  149   2e-37    
ref|XP_008860576.1|  ENTH domain containing protein, putative           150   2e-37    
gb|KHJ46049.1|  putative ribosomal protein S23                          151   3e-37    
ref|XP_004327382.1|  PREDICTED: EH domain-containing protein 3-like     148   3e-37    
ref|XP_009822927.1|  hypothetical protein H257_01428                    150   3e-37    
gb|KFM71674.1|  EH domain-containing protein 1                          150   3e-37    
gb|AAH84280.1|  LOC495107 protein                                       150   3e-37    
ref|XP_008418632.1|  PREDICTED: EH domain-containing protein 1-li...    150   3e-37    
ref|XP_006079678.1|  PREDICTED: EH domain-containing protein 3          149   4e-37    
ref|NP_001091473.1|  EH domain-containing protein 3                     149   5e-37    
gb|EFN75788.1|  EH domain-containing protein 1                          149   5e-37    
gb|EFZ22199.1|  hypothetical protein SINV_15529                         149   5e-37    
emb|CDJ88426.1|  Dynamin and EF hand domain containing protein          152   5e-37    
ref|XP_006771666.1|  PREDICTED: EH domain-containing protein 1          149   5e-37    
gb|ELR57915.1|  EH domain-containing protein 3                          149   5e-37    
ref|XP_005307972.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    149   6e-37    
ref|XP_004056087.1|  PREDICTED: EH domain-containing protein 4-like     142   6e-37    
ref|XP_006183228.1|  PREDICTED: EH domain-containing protein 3          149   6e-37    
ref|XP_006197310.1|  PREDICTED: EH domain-containing protein 3          149   6e-37    
ref|XP_004927463.1|  PREDICTED: EH domain-containing protein 1-like     149   7e-37    
ref|XP_003230702.2|  PREDICTED: EH domain-containing protein 1          149   8e-37    
gb|ETE58213.1|  EH domain-containing protein 3                          140   8e-37    
ref|XP_005686903.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    149   8e-37    
ref|XP_004005851.1|  PREDICTED: LOW QUALITY PROTEIN: EH domain-co...    149   8e-37    
ref|XP_005980047.1|  PREDICTED: EH domain-containing protein 3          149   9e-37    
ref|XP_011052393.1|  PREDICTED: EH domain-containing protein 3          149   9e-37    
ref|XP_003379210.1|  EH domain-containing protein                       149   1e-36    
ref|XP_003121623.1|  PREDICTED: EH domain-containing protein 4-like     140   1e-36    
gb|KFG55407.1|  sarcalumenin/eps15 family protein                       143   1e-36    
dbj|BAE37511.1|  unnamed protein product                                145   1e-36    
gb|KFH11100.1|  sarcalumenin/eps15 family protein                       143   1e-36    
ref|XP_007191438.1|  PREDICTED: EH domain-containing protein 3 is...    147   1e-36    
ref|XP_007460261.1|  PREDICTED: EH domain-containing protein 4-like     142   1e-36    
emb|CBY21336.1|  unnamed protein product                                148   1e-36    
ref|XP_004268234.1|  PREDICTED: EH domain-containing protein 3          148   1e-36    
ref|XP_007550413.1|  PREDICTED: EH domain-containing protein 1-like     148   1e-36    
emb|CEF69854.1|  AT21416p                                               148   1e-36    
ref|XP_007470944.1|  PREDICTED: EH domain-containing protein 3          148   2e-36    
emb|CDQ63653.1|  unnamed protein product                                148   2e-36    
ref|XP_007191437.1|  PREDICTED: EH domain-containing protein 3 is...    147   2e-36    
emb|CBJ30463.1|  RME1L1, RME1-like GTPase/ATPase without a C-term...    147   2e-36    
emb|CCD58541.1|  eh domain containing/past-1-related                    148   2e-36    
gb|EFX80375.1|  hypothetical protein DAPPUDRAFT_304007                  147   2e-36    
gb|ENN79547.1|  hypothetical protein YQE_04009                          147   2e-36    
gb|AEE63488.1|  unknown                                                 147   2e-36    



>ref|XP_006352380.1| PREDICTED: EH domain-containing protein 1-like [Solanum tuberosum]
Length=547

 Score =   397 bits (1021),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 209/306 (68%), Positives = 237/306 (77%), Gaps = 33/306 (11%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S P  S +KE +K++Q+WFNFADSDGDGR+TGNDA KLF +S+LSKP+LKQVWA+A
Sbjct  1    MEIVSVPVASFTKEDEKIYQNWFNFADSDGDGRITGNDAIKLFSLSNLSKPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGV-SPPTMKDLDallasang  549
            DSKRQGFLG NEF TAMQLISLAQ+G EL+SDLL  K    + SPP+M+ LDAL +    
Sbjct  61   DSKRQGFLGFNEFVTAMQLISLAQDGSELSSDLLKSKANMELLSPPSMEGLDALFS----  116

Query  548  sspnssgsLTESPPQTNGSK----PDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKV  381
                          +T+GS       TNGT  + P            I MFS R SRKK+
Sbjct  117  --------------KTSGSLMKNLSGTNGTIQVLPPS---------PINMFS-RKSRKKI  152

Query  380  QPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGK  201
            QPSLTAVTSV DGLK+LYN KLKPLE+TYRFNDF SP LT+SDFDAKPM+MLLGQYSTGK
Sbjct  153  QPSLTAVTSVTDGLKKLYNEKLKPLELTYRFNDFASPALTESDFDAKPMVMLLGQYSTGK  212

Query  200  TTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGA  21
            TTFIKHLLKC+YPGAHIGPEPTTDRFIVVTSGPDERSIPGNT+AVHA+MPFT L+ FGGA
Sbjct  213  TTFIKHLLKCNYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTIAVHAEMPFTDLTKFGGA  272

Query  20   FLSKFE  3
            FLSKFE
Sbjct  273  FLSKFE  278



>ref|XP_004250246.1| PREDICTED: EH domain-containing protein 1-like [Solanum lycopersicum]
Length=547

 Score =   394 bits (1011),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 235/303 (78%), Gaps = 27/303 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME+ S P  S +KE++K++Q+WFNFADSDGDGR+TGNDA KLF +S+LSK +LKQVWA+A
Sbjct  1    MEVVSVPVASFTKEEEKIYQNWFNFADSDGDGRITGNDAIKLFSLSNLSKAELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGV-SPPTMKDLDallasang  549
            DSKRQGFLG NEF TAMQLISLAQ+G EL+ DLL  K    + SPP+M+ LDAL +    
Sbjct  61   DSKRQGFLGFNEFVTAMQLISLAQDGSELSPDLLKSKANMELLSPPSMEGLDALSS----  116

Query  548  sspnssgsLTESPPQTNGS-KPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
                          +TNGS   D +GT     +           I MFS R SRKK+QPS
Sbjct  117  --------------KTNGSLMKDLSGTNGTIQVRPPS------PINMFS-RKSRKKIQPS  155

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            LTAVTSV DGLK+LYN KLKPLE+TYRFN+F SP LT+SDFDAKPM+MLLGQYSTGKTTF
Sbjct  156  LTAVTSVTDGLKKLYNEKLKPLELTYRFNEFSSPALTESDFDAKPMVMLLGQYSTGKTTF  215

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            IKHLLKC+YPGAHIGPEPTTDRFIVVTSGPDERSIPGNT+AVHA+MPFT L+ FGGAFLS
Sbjct  216  IKHLLKCNYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTIAVHAEMPFTDLTKFGGAFLS  275

Query  11   KFE  3
            KFE
Sbjct  276  KFE  278



>ref|XP_009769722.1| PREDICTED: EH domain-containing protein 1-like [Nicotiana sylvestris]
Length=548

 Score =   392 bits (1008),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 213/305 (70%), Positives = 242/305 (79%), Gaps = 30/305 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S   +SCSKE QK++Q+WFNF DSDGDGR+TGNDATKLF +S+LS+P+LKQVWA+A
Sbjct  1    MEIVSSSISSCSKEDQKIYQNWFNFVDSDGDGRITGNDATKLFSLSNLSRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLK-TAAGVSPPTMKDLDallasang  549
            D+KRQGFLG NEF TAMQLISLAQEG EL+SDLL  K     +SPP+M+ LDALL     
Sbjct  61   DTKRQGFLGFNEFVTAMQLISLAQEGRELSSDLLRSKANMEYLSPPSMEGLDALL-----  115

Query  548  sspnssgsLTESPPQTNGS---KPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQ  378
                       S  +T+GS   K +TNGT  L+P+P          I +FS R SRKK+Q
Sbjct  116  -----------SSQKTDGSSMKKIETNGTIQLQPLP---------PINLFS-RKSRKKIQ  154

Query  377  PSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKT  198
            PSLTAVTSV DGLKRLYN KLKPLE+TYRFNDF SP LT+SDFDAKPM+MLLGQYSTGKT
Sbjct  155  PSLTAVTSVTDGLKRLYNEKLKPLELTYRFNDFASPALTESDFDAKPMVMLLGQYSTGKT  214

Query  197  TFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAF  18
            TFIKHLLK +YPGAHIGPEPTTDRFIVVTSGPDERSIPGNT+AVH D+PFT L+ FGGAF
Sbjct  215  TFIKHLLKSNYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTIAVHNDLPFTDLTKFGGAF  274

Query  17   LSKFE  3
            LSKFE
Sbjct  275  LSKFE  279



>ref|XP_009626939.1| PREDICTED: EH domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=548

 Score =   391 bits (1005),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 213/305 (70%), Positives = 241/305 (79%), Gaps = 30/305 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S   +SCSK+ QK++Q+WFNF DSDGDGR+TGNDATKLF +S+LS+P+LKQVWA+A
Sbjct  1    MEIVSSSISSCSKDDQKIYQNWFNFVDSDGDGRITGNDATKLFSLSNLSRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAG-VSPPTMKDLDallasang  549
            D+KRQGFLG NEF TAMQLISLAQEG EL+SDLL  K     +SPP+M+ LDALL     
Sbjct  61   DTKRQGFLGFNEFVTAMQLISLAQEGRELSSDLLRSKANMEFLSPPSMEGLDALL-----  115

Query  548  sspnssgsLTESPPQTNGS---KPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQ  378
                       S  +TNGS   K +TNGT  L+P P          I +FS R SRKK+Q
Sbjct  116  -----------SSQKTNGSSMKKIETNGTIQLQPPP---------PINLFS-RKSRKKIQ  154

Query  377  PSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKT  198
            PSLTAVTSV DGLKRLYN KLKPLE+TYRFNDF SP LT+SDFDAKPM+MLLGQYSTGKT
Sbjct  155  PSLTAVTSVTDGLKRLYNEKLKPLELTYRFNDFASPALTESDFDAKPMVMLLGQYSTGKT  214

Query  197  TFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAF  18
            TFIKHLLK +YPGAHIGPEPTTDRFIVVTSGPDERSIPGNT+AVH D+PFT L+ FGGAF
Sbjct  215  TFIKHLLKSNYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTIAVHNDLPFTDLTKFGGAF  274

Query  17   LSKFE  3
            LSKFE
Sbjct  275  LSKFE  279



>ref|XP_011096032.1| PREDICTED: EH domain-containing protein 1-like [Sesamum indicum]
 ref|XP_011096033.1| PREDICTED: EH domain-containing protein 1-like [Sesamum indicum]
Length=547

 Score =   386 bits (991),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/302 (69%), Positives = 231/302 (76%), Gaps = 25/302 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEIASGP +SCSKEQ K++Q WFNFADSD DGR+TGNDAT  F MS+LSK +LKQVWA+A
Sbjct  1    MEIASGPISSCSKEQLKIYQTWFNFADSDRDGRLTGNDATSFFAMSNLSKHELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG  EFTTAMQLIS AQEG EL S+LL    +   ++PP M+ LDALL    G
Sbjct  61   DSKRQGFLGFKEFTTAMQLISFAQEGYELTSELLKSTVSLETLNPPYMEGLDALLEKNKG  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                         P +NG+  +TNG   ++P P           K   S  S+KK   SL
Sbjct  121  -------------PVSNGNY-ETNGNIQVQPTPP----------KSLFSTHSKKKNNISL  156

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            TAVTSVIDGLK LYN KLKPLE TYRFNDFVSP LT SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  157  TAVTSVIDGLKILYNEKLKPLEATYRFNDFVSPFLTSSDFDAKPMVMLLGQYSTGKTTFI  216

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+CSYPGAHIGPEPTTDRFIVV SGPDERSIPGNT+AVHAD+PFTGL+TFGG+FLSK
Sbjct  217  KHLLQCSYPGAHIGPEPTTDRFIVVMSGPDERSIPGNTIAVHADLPFTGLTTFGGSFLSK  276

Query  8    FE  3
            FE
Sbjct  277  FE  278



>ref|XP_007026229.1| EPS15 domain 2 isoform 5 [Theobroma cacao]
 gb|EOY28851.1| EPS15 domain 2 isoform 5 [Theobroma cacao]
Length=511

 Score =   378 bits (971),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 226/302 (75%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME +  P  SCSKE QK+++DWFN ADSDGDGRVTGNDATK F MS LS+ +LKQ+WA+A
Sbjct  1    MEASPIPIGSCSKEHQKIYRDWFNVADSDGDGRVTGNDATKFFSMSKLSRQELKQIWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQGFLG+ EF  AMQL+SLAQ G EL SD+L     A  +S P M+ LDAL      
Sbjct  61   DSKRQGFLGLTEFIVAMQLVSLAQAGNELTSDVLKSSVDAENISLPIMEGLDALA-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S   T   +P+ NGTT  +            S K F+S+S+RK   P+ 
Sbjct  116  ---------VKSKDSTTNGEPEMNGTTHPQVPT---------SAKWFTSKSARK--TPA-  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS+IDGLKRLY  KLKPLEVTYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SAVTSIIDGLKRLYIEKLKPLEVTYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AVHAD+PF GL+TFGGAFLSK
Sbjct  215  KHLLQCDYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVHADLPFGGLTTFGGAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_007026225.1| EPS15 domain 2 isoform 1 [Theobroma cacao]
 gb|EOY28847.1| EPS15 domain 2 isoform 1 [Theobroma cacao]
Length=545

 Score =   378 bits (970),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 226/302 (75%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME +  P  SCSKE QK+++DWFN ADSDGDGRVTGNDATK F MS LS+ +LKQ+WA+A
Sbjct  1    MEASPIPIGSCSKEHQKIYRDWFNVADSDGDGRVTGNDATKFFSMSKLSRQELKQIWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQGFLG+ EF  AMQL+SLAQ G EL SD+L     A  +S P M+ LDAL      
Sbjct  61   DSKRQGFLGLTEFIVAMQLVSLAQAGNELTSDVLKSSVDAENISLPIMEGLDALA-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S   T   +P+ NGTT  +            S K F+S+S+RK   P+ 
Sbjct  116  ---------VKSKDSTTNGEPEMNGTTHPQVPT---------SAKWFTSKSARK--TPA-  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS+IDGLKRLY  KLKPLEVTYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SAVTSIIDGLKRLYIEKLKPLEVTYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AVHAD+PF GL+TFGGAFLSK
Sbjct  215  KHLLQCDYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVHADLPFGGLTTFGGAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_007026227.1| EPS15 domain 2 isoform 3 [Theobroma cacao]
 gb|EOY28849.1| EPS15 domain 2 isoform 3 [Theobroma cacao]
Length=574

 Score =   378 bits (971),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 226/302 (75%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME +  P  SCSKE QK+++DWFN ADSDGDGRVTGNDATK F MS LS+ +LKQ+WA+A
Sbjct  1    MEASPIPIGSCSKEHQKIYRDWFNVADSDGDGRVTGNDATKFFSMSKLSRQELKQIWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQGFLG+ EF  AMQL+SLAQ G EL SD+L     A  +S P M+ LDAL      
Sbjct  61   DSKRQGFLGLTEFIVAMQLVSLAQAGNELTSDVLKSSVDAENISLPIMEGLDALA-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S   T   +P+ NGTT  +            S K F+S+S+RK   P+ 
Sbjct  116  ---------VKSKDSTTNGEPEMNGTTHPQVPT---------SAKWFTSKSARK--TPA-  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS+IDGLKRLY  KLKPLEVTYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SAVTSIIDGLKRLYIEKLKPLEVTYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AVHAD+PF GL+TFGGAFLSK
Sbjct  215  KHLLQCDYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVHADLPFGGLTTFGGAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_007026226.1| EPS15 domain 2 isoform 2 [Theobroma cacao]
 gb|EOY28848.1| EPS15 domain 2 isoform 2 [Theobroma cacao]
Length=544

 Score =   377 bits (968),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 225/302 (75%), Gaps = 28/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME +  P  SCSKE QK+++DWFN ADSDGDGRVTGNDATK F MS LS+ +LKQ+WA+A
Sbjct  1    MEASPIPIGSCSKEHQKIYRDWFNVADSDGDGRVTGNDATKFFSMSKLSRQELKQIWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQGFLG+ EF  AMQL+SLAQ G EL SD+L     A  +S P M+ LDAL      
Sbjct  61   DSKRQGFLGLTEFIVAMQLVSLAQAGNELTSDVLKSSVDAENISLPIMEGLDALAV----  116

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       S   T   +P+ NGTT  +            S K F+S+S+RK   P+ 
Sbjct  117  -----------SKDSTTNGEPEMNGTTHPQVPT---------SAKWFTSKSARK--TPA-  153

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS+IDGLKRLY  KLKPLEVTYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  154  SAVTSIIDGLKRLYIEKLKPLEVTYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFI  213

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AVHAD+PF GL+TFGGAFLSK
Sbjct  214  KHLLQCDYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVHADLPFGGLTTFGGAFLSK  273

Query  8    FE  3
            FE
Sbjct  274  FE  275



>gb|KDP20684.1| hypothetical protein JCGZ_21155 [Jatropha curcas]
Length=545

 Score =   374 bits (960),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 196/305 (64%), Positives = 228/305 (75%), Gaps = 33/305 (11%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME+  G   SCSKE Q+++++WFN ADSDGDGR+TGNDATK   MS+LS+ +LKQVWALA
Sbjct  1    MELGKGTVGSCSKEHQQMYKEWFNSADSDGDGRITGNDATKFLAMSNLSRQELKQVWALA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF  AMQLISLAQ G E+ SD+L    +   + PP M+ +DALL  + G
Sbjct  61   DSKRQGFLGFTEFILAMQLISLAQAGHEITSDILKTTCSIENIKPPLMEGIDALLVKSKG  120

Query  548  sspnssgsLTESPPQTNGS---KPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQ  378
            SS       T+  P+ NGS   +P   G                   + F+S+SSRK   
Sbjct  121  SS-------TDYEPEINGSAQLQPSITG-------------------QRFNSKSSRKM--  152

Query  377  PSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKT  198
              L AVTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKT
Sbjct  153  -PLIAVTSIIDGLKRLYLEKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKT  211

Query  197  TFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAF  18
            TFIKHLL+C+YPGAHIGPEPTTDRF+VV SG DERSIPGNTVAVHADMPF+GL+TFGGAF
Sbjct  212  TFIKHLLRCNYPGAHIGPEPTTDRFVVVMSGSDERSIPGNTVAVHADMPFSGLTTFGGAF  271

Query  17   LSKFE  3
            LSKFE
Sbjct  272  LSKFE  276



>ref|XP_007026228.1| EPS15 domain 2 isoform 4 [Theobroma cacao]
 gb|EOY28850.1| EPS15 domain 2 isoform 4 [Theobroma cacao]
Length=546

 Score =   373 bits (958),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/303 (64%), Positives = 224/303 (74%), Gaps = 28/303 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME +  P  SCSKE QK+++DWFN ADSDGDGRVTGNDATK F MS LS+ +LKQ+WA+A
Sbjct  1    MEASPIPIGSCSKEHQKIYRDWFNVADSDGDGRVTGNDATKFFSMSKLSRQELKQIWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQGFLG+ EF  AMQL+SLAQ G EL SD+L     A  +S P M+ LD        
Sbjct  61   DSKRQGFLGLTEFIVAMQLVSLAQAGNELTSDVLKSSVDAENISLPIMEGLD--------  112

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S   T   +P+ NGTT           +   S K F+S+S+RK   P+ 
Sbjct  113  ------ALAVKSKDSTTNGEPEMNGTT---------HPQVPTSAKWFTSKSARK--TPA-  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS+IDGLKRLY  KLKPLEVTYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SAVTSIIDGLKRLYIEKLKPLEVTYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYP-GAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            KHLL+C YP GAHIGPEPTTDRF+VV +GPDERSIPGNT+AVHAD+PF GL+TFGGAFLS
Sbjct  215  KHLLQCDYPAGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVHADLPFGGLTTFGGAFLS  274

Query  11   KFE  3
            KFE
Sbjct  275  KFE  277



>ref|XP_006829517.1| hypothetical protein AMTR_s00074p00139810 [Amborella trichopoda]
 gb|ERM96933.1| hypothetical protein AMTR_s00074p00139810 [Amborella trichopoda]
Length=543

 Score =   372 bits (955),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 221/301 (73%), Gaps = 27/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S P  +CSKE QK++Q WFN+ADSDGD R+TGNDA KLF +S LS+P+LKQVWA+A
Sbjct  1    MEIVSLPVGTCSKEHQKIYQQWFNYADSDGDARITGNDAIKLFSLSKLSRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFLG  EF TAMQLISLAQ G E+  D+L       ++PP M+ LD L+      
Sbjct  61   DSKRQGFLGFKEFITAMQLISLAQSGHEITPDVLASTDLENLNPPPMEGLDGLI------  114

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                        P    S+ D NGT   +            S + F+S+S++K     L 
Sbjct  115  --------ARGKPSPTKSESDLNGTPRQQTQ----------SAQWFTSKSAKKV---PLN  153

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  154  SVTSIIDGLKRLYLEKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  213

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFG AFLSKF
Sbjct  214  HLLRSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPFSGLTTFGSAFLSKF  273

Query  5    E  3
            E
Sbjct  274  E  274



>ref|XP_010665753.1| PREDICTED: EH domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   370 bits (949),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/301 (63%), Positives = 220/301 (73%), Gaps = 27/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEIASGP +SCSKE QK++Q WF  ADSDGDGR+TGNDATK F MS+LS+  LKQVWA A
Sbjct  1    MEIASGPISSCSKEHQKVYQQWFIVADSDGDGRITGNDATKFFAMSNLSRSDLKQVWAFA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            D+KRQG+LG  EF  AMQLISLAQ G EL SDLL+      +  P ++ LDALLA    +
Sbjct  61   DTKRQGYLGFKEFVGAMQLISLAQAGHELTSDLLSNAVMEDIQLPVLEGLDALLAKKKKT  120

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
            +       T   P+ NGS P    +                    FSS+SS+K     L+
Sbjct  121  TA------TYVEPEINGSPPSPATSA------------------WFSSKSSKKV---PLS  153

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            AVTS+ DGLKRLY  KLKPLE TYRF+DFVSP LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  154  AVTSITDGLKRLYLEKLKPLETTYRFHDFVSPALTNSDFDAKPMVMLLGQYSTGKTTFIK  213

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLLKC YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+ FGG+FLSKF
Sbjct  214  HLLKCEYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPFSGLTNFGGSFLSKF  273

Query  5    E  3
            +
Sbjct  274  Q  274



>ref|XP_002264320.1| PREDICTED: EH domain-containing protein 3-like [Vitis vinifera]
Length=545

 Score =   369 bits (947),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 190/302 (63%), Positives = 228/302 (75%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEIAS P +SCSK  QK++Q+WFN+ADSD DGR+TGNDATK F MS+LS+ +LKQVWA+A
Sbjct  1    MEIASVPISSCSKHNQKIYQEWFNYADSDNDGRITGNDATKFFAMSNLSRSELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF TAMQL+SLAQ G E+ SD+L        + PP+M+ L+ALL     
Sbjct  61   DSKRQGFLGFREFITAMQLVSLAQAGNEITSDILKTTVDLENLEPPSMEGLNALL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      ++   TN  + + NG +  +P P         S   F+S+S +K     L
Sbjct  116  ---------AKNKVSTNNGELELNGDSRPQPSP---------SAPWFTSKSVKKA---PL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
             +VTS+IDGLKRLYN KLKPLEVTYR+NDFVSP+LT SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  NSVTSIIDGLKRLYNEKLKPLEVTYRYNDFVSPLLTHSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL C++PGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV+A+MPF GL+TFGGAFLSK
Sbjct  215  KHLLGCNFPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVNAEMPFNGLTTFGGAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_010052900.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Eucalyptus 
grandis]
Length=455

 Score =   365 bits (938),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 190/302 (63%), Positives = 223/302 (74%), Gaps = 25/302 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI SG   SCSK+ Q+++Q+WF+FADSDGDGR+TGN ATK F MS LS+ +LKQVWA+A
Sbjct  1    MEIKSGALGSCSKDHQRIYQEWFHFADSDGDGRITGNAATKFFAMSKLSRQELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQGFL ++EF  AMQLISLAQEG EL    L  +     + PP M+ LDAL+     
Sbjct  61   DSKRQGFLSLHEFIIAMQLISLAQEGVELTPGSLKFEADVEKIDPPMMEGLDALV-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S   T    P+TNG+ P  P P         S + F+S+S RK   P  
Sbjct  116  ---------AKSKNSTVVVDPETNGSAPPVPPP---------SSQWFASKSGRKAQAPQY  157

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            + VTS++DGLK+LY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  158  S-VTSIVDGLKKLYIEKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  216

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AVHADMPF GL+ FGGAFLSK
Sbjct  217  KHLLRCDYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVHADMPFNGLTKFGGAFLSK  276

Query  8    FE  3
            FE
Sbjct  277  FE  278



>ref|XP_010913401.1| PREDICTED: EH domain-containing protein 1-like [Elaeis guineensis]
Length=543

 Score =   367 bits (942),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 226/306 (74%), Gaps = 37/306 (12%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+I S P ++CS+E QK++++WF+ ADSDGDGR+TG DA K F MS LS+P+LKQVWA+A
Sbjct  1    MDIVSSPMSTCSREHQKIYKEWFSAADSDGDGRITGTDAIKFFAMSKLSRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFLG+NEF TAMQL+SLAQ G E+  D L       + PP M+ LD LLA     
Sbjct  61   DSKRQGFLGLNEFITAMQLVSLAQAGNEITQDALTHSELDLLKPPVMEGLDILLAK----  116

Query  545  spnssgsLTESPPQTN-----GSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKV  381
                    T SP ++N      S+P  + TT                 + FSS+S++K  
Sbjct  117  --------TTSPKKSNPDLDVSSQPPVSLTT-----------------QWFSSKSTKKI-  150

Query  380  QPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGK  201
               L++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGK
Sbjct  151  --PLSSVTSIIDGLKRLYIEKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGK  208

Query  200  TTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGA  21
            TTFIKHLL+ SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG A
Sbjct  209  TTFIKHLLRSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTA  268

Query  20   FLSKFE  3
            FLSKFE
Sbjct  269  FLSKFE  274



>ref|XP_006449830.1| hypothetical protein CICLE_v10014814mg [Citrus clementina]
 gb|ESR63070.1| hypothetical protein CICLE_v10014814mg [Citrus clementina]
Length=547

 Score =   366 bits (940),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 225/302 (75%), Gaps = 25/302 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEIA  P T CSKE QK++++WF+ ADSDGDGR+TGNDATK   +S LS+ +LKQ+WALA
Sbjct  1    MEIAPSPITFCSKEHQKIYREWFDIADSDGDGRITGNDATKFLALSKLSRQELKQIWALA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLK-TAAGVSPPTMKDLDallasang  549
            DSKRQGFL + EF TAM+L+SLAQ G E+ SD+L          PP+M+ L+  +A   G
Sbjct  61   DSKRQGFLDLAEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPSMEGLETFVAKNKG  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                              SKP  NG+  ++   L+       S + F+S+S  KK  PS 
Sbjct  121  LKM--------------DSKPAVNGSASVQSQILS-------SAQWFTSKSV-KKTPPS-  157

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
             AVTS+IDGLKRLYN KLKPLE TYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  158  -AVTSIIDGLKRLYNEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFI  216

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C+YPGAHIGPEPTTDRF+VV SGPDER+IPGNT+AVHAD+PF+GL+TFGGAFLSK
Sbjct  217  KHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSK  276

Query  8    FE  3
            FE
Sbjct  277  FE  278



>ref|XP_006467361.1| PREDICTED: EH domain-containing protein 1-like [Citrus sinensis]
Length=547

 Score =   366 bits (940),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 225/302 (75%), Gaps = 25/302 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEIA  P T CSKE QK++++WF+ ADSDGDGR+TGNDATK   +S LS+ +LKQ+WALA
Sbjct  1    MEIAPSPITFCSKEHQKIYREWFDIADSDGDGRITGNDATKFLALSKLSRQELKQIWALA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLK-TAAGVSPPTMKDLDallasang  549
            DSKRQGFL + EF TAM+L+SLAQ G E+ SD+L          PP+M+ L+  +A   G
Sbjct  61   DSKRQGFLDLAEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPSMEGLETFVAKNKG  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                              SKP  NG+  ++   L+       S + F+S+S  KK  PS 
Sbjct  121  LKM--------------DSKPAVNGSASVQSQILS-------SAQWFTSKSV-KKTPPS-  157

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
             AVTS+IDGLKRLYN KLKPLE TYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  158  -AVTSIIDGLKRLYNEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFI  216

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C+YPGAHIGPEPTTDRF+VV SGPDER+IPGNT+AVHAD+PF+GL+TFGGAFLSK
Sbjct  217  KHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSK  276

Query  8    FE  3
            FE
Sbjct  277  FE  278



>gb|KDO78396.1| hypothetical protein CISIN_1g008954mg [Citrus sinensis]
Length=547

 Score =   366 bits (940),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 187/302 (62%), Positives = 226/302 (75%), Gaps = 25/302 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEIA  P T CSKE QK++++WF+ ADSDGDGR+TGNDATK  G+S LS+ +LKQ+WALA
Sbjct  1    MEIAPSPITFCSKEHQKIYREWFDIADSDGDGRITGNDATKFLGLSKLSRQELKQIWALA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLK-TAAGVSPPTMKDLDallasang  549
            DSKRQGFL + EF TAM+L+SLAQ G E+ SD+L          PP+M+ L+  +A   G
Sbjct  61   DSKRQGFLDLAEFVTAMKLVSLAQAGREITSDILKSGGLMENTEPPSMEGLETFVAKNKG  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S P  NGS               ++  + + S + F+S+S  KK  PS 
Sbjct  121  LK-------MDSKPAVNGS--------------ASVQSQILSSAQWFTSKSV-KKTPPS-  157

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
             AVTS+IDGLKRLY+ KLKPLE TYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  158  -AVTSIIDGLKRLYSEKLKPLEATYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFI  216

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C+YPGAHIGPEPTTDRF+VV SGPDER+IPGNT+AVHAD+PF+GL+TFGGAFLSK
Sbjct  217  KHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVHADLPFSGLTTFGGAFLSK  276

Query  8    FE  3
            FE
Sbjct  277  FE  278



>ref|XP_010052899.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW77035.1| hypothetical protein EUGRSUZ_D01381 [Eucalyptus grandis]
Length=547

 Score =   366 bits (939),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 190/302 (63%), Positives = 223/302 (74%), Gaps = 25/302 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI SG   SCSK+ Q+++Q+WF+FADSDGDGR+TGN ATK F MS LS+ +LKQVWA+A
Sbjct  1    MEIKSGALGSCSKDHQRIYQEWFHFADSDGDGRITGNAATKFFAMSKLSRQELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQGFL ++EF  AMQLISLAQEG EL    L  +     + PP M+ LDAL+     
Sbjct  61   DSKRQGFLSLHEFIIAMQLISLAQEGVELTPGSLKFEADVEKIDPPMMEGLDALV-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S   T    P+TNG+ P  P P         S + F+S+S RK   P  
Sbjct  116  ---------AKSKNSTVVVDPETNGSAPPVPPP---------SSQWFASKSGRKAQAPQY  157

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            + VTS++DGLK+LY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  158  S-VTSIVDGLKKLYIEKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  216

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AVHADMPF GL+ FGGAFLSK
Sbjct  217  KHLLRCDYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVHADMPFNGLTKFGGAFLSK  276

Query  8    FE  3
            FE
Sbjct  277  FE  278



>ref|XP_002277794.1| PREDICTED: EH domain-containing protein 1 [Vitis vinifera]
 emb|CBI26690.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   365 bits (937),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 187/302 (62%), Positives = 225/302 (75%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI SGP +SCSK+ Q ++Q+WFNFADSD DGR+TGNDA K F MS+L +P LKQVWA+A
Sbjct  1    MEIDSGPISSCSKQNQMIYQEWFNFADSDSDGRITGNDAIKFFAMSNLPRPDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAG-VSPPTMKDLDallasang  549
            D+KRQGFLG+ EF TAMQL+SLAQ G  +  DLL+ +   G ++PP M+ L         
Sbjct  61   DTKRQGFLGLKEFITAMQLVSLAQAGHAITQDLLHSEVDLGNLNPPQMEGL---------  111

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                 +  L +       S PD NG++  +P P         +   F+S+SS+K     L
Sbjct  112  -----AALLAKKKRAHKTSDPDINGSSQPQPSP---------TASWFTSKSSKKV---PL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDF SP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIIDGLKRLYIQKLKPLEVTYRFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMP++GL+TFG AFLSK
Sbjct  215  KHLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPYSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>gb|KCW70228.1| hypothetical protein EUGRSUZ_F03500 [Eucalyptus grandis]
Length=462

 Score =   362 bits (930),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/304 (62%), Positives = 231/304 (76%), Gaps = 27/304 (9%)
 Frame = -3

Query  911  IDMEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWA  732
            + MEI+  P ++CSKE Q+++Q+WF++ADSDGDGR+TG+DATK F MS+L +P LKQVWA
Sbjct  67   VSMEISPVPISTCSKENQQIYQEWFDYADSDGDGRITGSDATKFFAMSNLPRPDLKQVWA  126

Query  731  LADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasa  555
            +ADSKRQGFLG  EF TAMQL+SLAQ G+ +  DL + +     + PP M  LD+LLA  
Sbjct  127  IADSKRQGFLGFGEFITAMQLVSLAQAGQSITQDLSSSEVDLVNLGPPKMTGLDSLLAKK  186

Query  554  ngsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQP  375
                           P+TN S  D+NG++  +P P +           FSS+ S+K    
Sbjct  187  ------------RPSPRTNES--DSNGSSHSQPSPASG---------WFSSKPSKKI---  220

Query  374  SLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTT  195
            SL++VTS++DGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTT
Sbjct  221  SLSSVTSIVDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTT  280

Query  194  FIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFL  15
            FIKHLL+ SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMP++GL+TFG AFL
Sbjct  281  FIKHLLQSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPYSGLTTFGTAFL  340

Query  14   SKFE  3
            SKFE
Sbjct  341  SKFE  344



>ref|XP_010270065.1| PREDICTED: EH domain-containing protein 1 [Nelumbo nucifera]
Length=544

 Score =   365 bits (936),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 224/302 (74%), Gaps = 28/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI +GP   CSKE QK++Q+WFN+ADSDGDGR+TGNDATK F MS+LS+P+LKQVWA+A
Sbjct  1    MEIVTGPIGPCSKEHQKIYQEWFNYADSDGDGRITGNDATKFFAMSNLSRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLK-TAAGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF  AMQL++LAQ G E+  DLL+    +  ++PP M+ LD L+A    
Sbjct  61   DSKRQGFLGFTEFIAAMQLVALAQAGHEITPDLLSSGINSENLNPPVMEGLDVLIAK---  117

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +  PQ    KP+ +  T               S   FSS+SS+K     L
Sbjct  118  ---------RKRSPQ----KPELDNVTIQPQSSP--------SAHWFSSKSSKKI---PL  153

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLK+LY  KLKPLEVTYRFNDFVSP+L  SDFDA+PM+MLLGQYSTGKTTFI
Sbjct  154  SSVTSIIDGLKKLYIEKLKPLEVTYRFNDFVSPLLISSDFDARPMVMLLGQYSTGKTTFI  213

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+ SYPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL++FG AFLSK
Sbjct  214  KHLLRSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPFSGLTSFGTAFLSK  273

Query  8    FE  3
            F+
Sbjct  274  FQ  275



>ref|XP_002518408.1| EH-domain-containing protein, putative [Ricinus communis]
 gb|EEF43795.1| EH-domain-containing protein, putative [Ricinus communis]
Length=545

 Score =   364 bits (935),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 223/302 (74%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI  G   SCSKE Q L++DWFN ADSDGDGR++G DAT  F  S+LS+  LKQVWALA
Sbjct  1    MEIGKGWMGSCSKEDQHLYKDWFNSADSDGDGRISGTDATNFFAFSNLSRHDLKQVWALA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAG-VSPPTMKDLDallasang  549
            DSKRQGFLG  EF  A+QLISLAQ G E+ SDLL   ++ G + PP M+ +DALL     
Sbjct  61   DSKRQGFLGFTEFIAALQLISLAQAGHEITSDLLKSTSSMGNIKPPVMEGIDALL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                     T+    T  S+P  NG + L+            + + ++S+SSRK     L
Sbjct  116  ---------TQKEGSTTNSEPGINGFSQLQSST---------TAQRYNSKSSRKM---PL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
             AVTS+IDGLKRLY  KLKPLEVTYRFNDF+SP+LT+S+FDAKPM+MLLGQYSTGKTTFI
Sbjct  155  IAVTSIIDGLKRLYIEKLKPLEVTYRFNDFMSPLLTNSEFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KH+L+C+YPGAHIGPEPTTDRF+VV SG DERSIPGNTVAV ADMPF+GL+TFGGAFLSK
Sbjct  215  KHILRCNYPGAHIGPEPTTDRFVVVMSGSDERSIPGNTVAVQADMPFSGLTTFGGAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_008805595.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Phoenix 
dactylifera]
Length=544

 Score =   364 bits (935),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 185/301 (61%), Positives = 221/301 (73%), Gaps = 26/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+I S P  +CS+E QK++++WF+ ADSDGDGR+TGNDA K F MS LS+ +LKQVWALA
Sbjct  1    MDIVSSPIGTCSREHQKIYKEWFSAADSDGDGRITGNDAIKFFAMSKLSRAELKQVWALA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFLG+NEF  AMQL+SLAQ G E+  D L       + PP M+ LD LLA     
Sbjct  61   DSKRQGFLGLNEFIAAMQLVSLAQAGNEITQDALTHSELDSLKPPVMEGLDILLAK----  116

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                    T+  P+ +   PD +    +             + + FSS+S++K     L+
Sbjct  117  --------TKPSPKKSNPDPDVSSQPQVSL-----------TTQWFSSKSAKKI---PLS  154

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGLKRLY  KLKPLEVTYRFNDF SP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  155  SVTSIIDGLKRLYIEKLKPLEVTYRFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  214

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSKF
Sbjct  215  HLLRSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSKF  274

Query  5    E  3
            E
Sbjct  275  E  275



>ref|XP_008458980.1| PREDICTED: EH domain-containing protein 1 [Cucumis melo]
Length=545

 Score =   363 bits (931),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 196/304 (64%), Positives = 223/304 (73%), Gaps = 31/304 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI SG   S SK Q K+FQ+WF  ADSDGDGRVTGNDA + F MS LS+ +LKQVWA+A
Sbjct  1    MEIGSGAIGSSSKHQLKIFQEWFGLADSDGDGRVTGNDAIQFFSMSHLSRGELKQVWAVA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAG---VSPPTMKDLDallasa  555
            DSKRQG+LG NEF TAMQLISLAQ G +L+SD+L  K AAG   +  P ++ LDAL    
Sbjct  61   DSKRQGYLGFNEFVTAMQLISLAQAGYDLDSDIL--KKAAGMEEIKLPVLEGLDALA---  115

Query  554  ngsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQP  375
                        +S      S+ +TNGT             P PS   F+S+S  K    
Sbjct  116  -----------VKSKRLAVSSQHETNGT---------FQPMPPPSTPWFASKSGSK---I  152

Query  374  SLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTT  195
            S TAVTS+IDGLK+LYN KLKPLE TYRFNDFVSP LT SDFDAKPM+MLLGQYSTGKTT
Sbjct  153  SHTAVTSIIDGLKKLYNEKLKPLEATYRFNDFVSPFLTSSDFDAKPMVMLLGQYSTGKTT  212

Query  194  FIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFL  15
            FIKHLLKC+YPGAHIGPEPTTDRF+VV SGPDERS+PGNT+AV ADMPF+GL+TFGGAFL
Sbjct  213  FIKHLLKCNYPGAHIGPEPTTDRFVVVMSGPDERSVPGNTIAVQADMPFSGLTTFGGAFL  272

Query  14   SKFE  3
            SKFE
Sbjct  273  SKFE  276



>ref|XP_010928404.1| PREDICTED: EH domain-containing protein 1-like [Elaeis guineensis]
Length=545

 Score =   362 bits (928),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 217/301 (72%), Gaps = 25/301 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M++ + P  SC++EQQ ++Q WF+ ADSDGDGRVTGNDA K F MS LS+P+LKQVWA+A
Sbjct  1    MDLVTSPKKSCTREQQNIYQQWFSVADSDGDGRVTGNDALKFFAMSKLSRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFLG  EF  AMQL++LAQEG E+  D+L       V PP M  LD LLA  N  
Sbjct  61   DSKRQGFLGFQEFIVAMQLVALAQEGHEITQDVLTHVDLENVKPPVMGGLDILLAKFNKR  120

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
            S        +  P+T    P                       + FSS+SS+K     L 
Sbjct  121  SAKRDDPTVDEAPKTQPPSP----------------------ARWFSSKSSKKI---PLK  155

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGLK+LY  KLKPLEVTY+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  156  SVTSIIDGLKKLYIEKLKPLEVTYQFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  215

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL  SYPGAHIGPEPTTDRF+V+TSGPDERSIPGNT+AV ADMP++GL+TFG AFLSKF
Sbjct  216  HLLNSSYPGAHIGPEPTTDRFVVITSGPDERSIPGNTIAVQADMPYSGLTTFGTAFLSKF  275

Query  5    E  3
            E
Sbjct  276  E  276



>ref|XP_004145425.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
Length=545

 Score =   361 bits (926),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 194/304 (64%), Positives = 222/304 (73%), Gaps = 31/304 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI SG   S SKE  K+F +WF  ADSDGDGRVTGNDA + F MS LS+ +LKQVWA+A
Sbjct  1    MEIGSGAIASSSKEHLKIFHEWFGLADSDGDGRVTGNDAIQFFSMSHLSRAELKQVWAVA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAG---VSPPTMKDLDallasa  555
            DSKRQG+LG NEF TAMQLISLAQ G +L+SD+L  K AAG   +  P  + LDAL    
Sbjct  61   DSKRQGYLGFNEFVTAMQLISLAQAGYDLDSDIL--KKAAGMEEIKLPVPEGLDALA---  115

Query  554  ngsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQP  375
                        ++      S+P+TNGT             P PS   F+++S  K    
Sbjct  116  -----------VKTKRLAISSQPETNGT---------FQPMPPPSTPWFATKSGSKI---  152

Query  374  SLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTT  195
            S TAVTS+IDGLK+LYN KLKPLE TYRFNDFVSP LT SDFDAKPM+MLLGQYSTGKTT
Sbjct  153  SHTAVTSIIDGLKKLYNEKLKPLEATYRFNDFVSPFLTSSDFDAKPMVMLLGQYSTGKTT  212

Query  194  FIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFL  15
            FIKHLLKC+YPGAHIGPEPTTDRF+VV SGPDERS+PGNT+AV ADMPF+GL+TFGGAFL
Sbjct  213  FIKHLLKCNYPGAHIGPEPTTDRFVVVMSGPDERSVPGNTIAVQADMPFSGLTTFGGAFL  272

Query  14   SKFE  3
            SKFE
Sbjct  273  SKFE  276



>ref|XP_008805597.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Phoenix 
dactylifera]
Length=544

 Score =   361 bits (926),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 183/301 (61%), Positives = 220/301 (73%), Gaps = 26/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+I S P  +CS+E QK++++WF+ ADSDGDGR+TGNDA K F MS LS+ +LKQVWA+A
Sbjct  1    MDIVSSPIGTCSREHQKIYKEWFSAADSDGDGRITGNDAIKFFAMSKLSRAELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFLG+NEF  AMQL+SLAQ G E+  D L       + PP M+ LD LLA     
Sbjct  61   DSKRQGFLGLNEFIAAMQLVSLAQAGNEITQDALTHSELDSLKPPVMEGLDILLAK----  116

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                    T+  P+ +   PD +    +             + + FSS+S++K     L+
Sbjct  117  --------TKPSPKKSNPDPDVSSQPQVSL-----------TTQWFSSKSAKKI---PLS  154

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGLKRLY  KLKPLEVTYRFNDF SP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  155  SVTSIIDGLKRLYIEKLKPLEVTYRFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  214

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRFI+  SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSKF
Sbjct  215  HLLRSSYPGAHIGPEPTTDRFIMAMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSKF  274

Query  5    E  3
            E
Sbjct  275  E  275



>ref|XP_010063047.1| PREDICTED: EH domain-containing protein 1 [Eucalyptus grandis]
Length=545

 Score =   360 bits (925),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 230/302 (76%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI+  P ++CSKE Q+++Q+WF++ADSDGDGR+TG+DATK F MS+L +P LKQVWA+A
Sbjct  1    MEISPVPISTCSKENQQIYQEWFDYADSDGDGRITGSDATKFFAMSNLPRPDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF TAMQL+SLAQ G+ +  DL + +     + PP M  LD+LLA    
Sbjct  61   DSKRQGFLGFGEFITAMQLVSLAQAGQSITQDLSSSEVDLVNLGPPKMTGLDSLLAK---  117

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                         P+TN S  D+NG++  +P P +           FSS+ S+K    SL
Sbjct  118  ---------KRPSPRTNES--DSNGSSHSQPSPASG---------WFSSKPSKKI---SL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS++DGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIVDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+ SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMP++GL+TFG AFLSK
Sbjct  215  KHLLQSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPYSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_004157728.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
Length=545

 Score =   360 bits (924),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 193/304 (63%), Positives = 222/304 (73%), Gaps = 31/304 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI SG   S SKE  K+F +WF  ADSDGDGRVTGNDA + F MS LS+ +LKQVWA+A
Sbjct  1    MEIGSGAIASSSKEHLKIFHEWFGLADSDGDGRVTGNDAIQFFSMSHLSRAELKQVWAVA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAG---VSPPTMKDLDallasa  555
            DSKRQG+LG NEF TAMQLISLAQ G +L+SD+L  K AAG   +  P ++ LDAL    
Sbjct  61   DSKRQGYLGFNEFVTAMQLISLAQAGYDLDSDIL--KKAAGMEEIKLPVLEGLDALA---  115

Query  554  ngsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQP  375
                        ++      S+ +TNGT             P PS   F+++S  K    
Sbjct  116  -----------VKTKRLAISSQHETNGT---------FQPMPPPSTPWFATKSGSK---I  152

Query  374  SLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTT  195
            S TAVTS+IDGLK+LYN KLKPLE TYRFNDFVSP LT SDFDAKPM+MLLGQYSTGKTT
Sbjct  153  SHTAVTSIIDGLKKLYNEKLKPLEATYRFNDFVSPFLTSSDFDAKPMVMLLGQYSTGKTT  212

Query  194  FIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFL  15
            FIKHLLKC+YPGAHIGPEPTTDRF+VV SGPDERS+PGNT+AV ADMPF+GL+TFGGAFL
Sbjct  213  FIKHLLKCNYPGAHIGPEPTTDRFVVVMSGPDERSVPGNTIAVQADMPFSGLTTFGGAFL  272

Query  14   SKFE  3
            SKFE
Sbjct  273  SKFE  276



>ref|XP_010544277.1| PREDICTED: EH domain-containing protein 1 [Tarenaya hassleriana]
Length=548

 Score =   360 bits (924),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 190/302 (63%), Positives = 223/302 (74%), Gaps = 24/302 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q ++Q+WF+FADSD DGR+TGNDA K F MS+LS+ +LKQVWA+A
Sbjct  1    MEIDSVAAGSCSKENQMIYQEWFDFADSDSDGRITGNDAIKFFAMSNLSRAELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF  AMQL+SLAQ G E++ ++LN       +SPPTM+ LD L+A    
Sbjct  61   DSKRQGYLGFREFVIAMQLVSLAQAGREISHEVLNSDVDFRNLSPPTMEGLDVLVAKNKK  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +  PQ   S PD N +TP++            S   FSS+SS+K     +
Sbjct  121  ---------KKHSPQL--SDPDVNSSTPVQTSL---------SAAWFSSKSSKK---IPI  157

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLE TYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  158  SSVTSIIDGLKRLYIQKLKPLEATYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  217

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF GL +FG AFLSK
Sbjct  218  KHLLKTSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFNGLISFGTAFLSK  277

Query  8    FE  3
            FE
Sbjct  278  FE  279



>ref|XP_008226997.1| PREDICTED: EH domain-containing protein 1 [Prunus mume]
Length=545

 Score =   360 bits (924),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 224/302 (74%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI+S P +SCSKE QK++Q+WF FADSD DGR+TGNDA K FGMS+L++  LKQVWA+A
Sbjct  1    MEISSVPISSCSKEHQKIYQEWFRFADSDSDGRITGNDAIKFFGMSNLNRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG +EF  AMQL+SLAQ G +++ DLLN       ++PP M+ LDALLA    
Sbjct  61   DSKRQGYLGFSEFVAAMQLVSLAQGGHDISHDLLNSNVDLENLNPPVMEGLDALLAKKKQ  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                              ++ + NGT  +   P         S   FSS+SS+K     L
Sbjct  121  LHKM--------------NENEVNGTAVVEQSP---------SALWFSSKSSKK---VPL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIIDGLKRLYVQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPD RS+PGNT+AV ADMPF+GL+ FG AFLSK
Sbjct  215  KHLLKSSYPGAHIGPEPTTDRFVVVMSGPDGRSVPGNTIAVQADMPFSGLTKFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>emb|CBI35707.3| unnamed protein product [Vitis vinifera]
Length=575

 Score =   361 bits (926),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 229/313 (73%), Gaps = 19/313 (6%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEIAS P +SCSK  QK++Q+WFN+ADSD DGR+TGNDATK F MS+LS+ +LKQVWA+A
Sbjct  1    MEIASVPISSCSKHNQKIYQEWFNYADSDNDGRITGNDATKFFAMSNLSRSELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLL-------NLKTAAGVSPPTMKDLDal  567
            DSKRQGFLG  EF TAMQL+SLAQ G E+ SD+L       N++ A    P    D D  
Sbjct  61   DSKRQGFLGFREFITAMQLVSLAQAGNEITSDILKTTGKQNNMRLAH--CPTQGNDWDLR  118

Query  566  lasangsspnssgsLTESPPQTNG-----SKPDTNGTTplrpiplniplrpiPSIKMFSS  402
            +     ++  +  +L   PP   G     +K   +       +  +   +P PS   F+S
Sbjct  119  INLLLTNTCRTLFNL--EPPSMEGLNALLAKNKVSTNNGELELNGDSRPQPSPSAPWFTS  176

Query  401  RSSRKKVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLL  222
            +S +K     L +VTS+IDGLKRLYN KLKPLEVTYR+NDFVSP+LT SDFDAKPM+MLL
Sbjct  177  KSVKKA---PLNSVTSIIDGLKRLYNEKLKPLEVTYRYNDFVSPLLTHSDFDAKPMVMLL  233

Query  221  GQYSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTG  42
            GQYSTGKTTFIKHLL C++PGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV+A+MPF G
Sbjct  234  GQYSTGKTTFIKHLLGCNFPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVNAEMPFNG  293

Query  41   LSTFGGAFLSKFE  3
            L+TFGGAFLSKFE
Sbjct  294  LTTFGGAFLSKFE  306



>gb|KCW70227.1| hypothetical protein EUGRSUZ_F03500 [Eucalyptus grandis]
Length=613

 Score =   362 bits (928),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 189/304 (62%), Positives = 231/304 (76%), Gaps = 27/304 (9%)
 Frame = -3

Query  911  IDMEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWA  732
            + MEI+  P ++CSKE Q+++Q+WF++ADSDGDGR+TG+DATK F MS+L +P LKQVWA
Sbjct  67   VSMEISPVPISTCSKENQQIYQEWFDYADSDGDGRITGSDATKFFAMSNLPRPDLKQVWA  126

Query  731  LADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasa  555
            +ADSKRQGFLG  EF TAMQL+SLAQ G+ +  DL + +     + PP M  LD+LLA  
Sbjct  127  IADSKRQGFLGFGEFITAMQLVSLAQAGQSITQDLSSSEVDLVNLGPPKMTGLDSLLAK-  185

Query  554  ngsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQP  375
                           P+TN S  D+NG++  +P P +           FSS+ S+K    
Sbjct  186  -----------KRPSPRTNES--DSNGSSHSQPSPASG---------WFSSKPSKKI---  220

Query  374  SLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTT  195
            SL++VTS++DGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTT
Sbjct  221  SLSSVTSIVDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTT  280

Query  194  FIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFL  15
            FIKHLL+ SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMP++GL+TFG AFL
Sbjct  281  FIKHLLQSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPYSGLTTFGTAFL  340

Query  14   SKFE  3
            SKFE
Sbjct  341  SKFE  344



>ref|XP_004293342.1| PREDICTED: EH domain-containing protein 1-like [Fragaria vesca 
subsp. vesca]
Length=543

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 222/302 (74%), Gaps = 29/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI SGP  SCSKE QK+++DWFNF DSDGDGR+TGN+  K F MS LS+P+LKQVWA A
Sbjct  1    MEIGSGPIGSCSKEHQKIYRDWFNFVDSDGDGRITGNEGAKFFAMSKLSRPELKQVWASA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQGFLG +EF TAMQLIS AQ+  EL+ D+L  +     + PP M+ +DAL+     
Sbjct  61   DSKRQGFLGFSEFITAMQLISFAQD-HELSPDVLKTEVDWENIKPPVMEGVDALMTYTKN  119

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
            SS             TNG   + NG T  +P                ++  S K++ P+ 
Sbjct  120  SS-------------TNGVAMNGNGITHNQPSAER------------TASKSVKRLPPN-  153

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
             AVTS++DGLKRLY  KLKPLE  YRFNDF +P+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  154  -AVTSIVDGLKRLYIEKLKPLEAAYRFNDFGNPLLTNSDFDAKPMVMLLGQYSTGKTTFI  212

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C+YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AVHADMPF+GL++FGG+FLSK
Sbjct  213  KHLLRCNYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVHADMPFSGLTSFGGSFLSK  272

Query  8    FE  3
            FE
Sbjct  273  FE  274



>ref|XP_009348303.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=547

 Score =   359 bits (921),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 221/302 (73%), Gaps = 26/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI+S P TSCSKE QK++Q WF FADSD DGR+TG DA K FGMS+L++  LKQVWA+A
Sbjct  1    MEISSVPITSCSKEHQKIYQGWFRFADSDSDGRITGGDAIKFFGMSNLNRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG NEF  AMQL+SLAQ G ++   L N      G+ PP M+ LDALL+    
Sbjct  61   DSKRQGYLGFNEFVAAMQLVSLAQAGHDITHGLQNSNVDLEGLKPPVMEGLDALLS----  116

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +       ++ + NGT  ++            S   FSS+S++K     L
Sbjct  117  ---------AKKKHTHKSNENEVNGTAVVQQSS---------SALWFSSKSAKK---VPL  155

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTY+FNDFVSP+L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  156  SSVTSIIDGLKRLYVQKLKPLEVTYKFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFI  215

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERS+PGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  216  KHLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSVPGNTIAVQADMPFSGLTTFGTAFLSK  275

Query  8    FE  3
            FE
Sbjct  276  FE  277



>ref|XP_007213895.1| hypothetical protein PRUPE_ppa003834mg [Prunus persica]
 gb|EMJ15094.1| hypothetical protein PRUPE_ppa003834mg [Prunus persica]
Length=545

 Score =   359 bits (921),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 225/302 (75%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI+S P +SCSKE QK++Q+WF FADSD DGR+TGNDA K F MS+L++  LKQVWA+A
Sbjct  1    MEISSVPISSCSKEHQKIYQEWFRFADSDSDGRITGNDAIKFFSMSNLNRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG +EF  AMQL+SLAQ G +++ DLLN       ++PP M+ LDALLA    
Sbjct  61   DSKRQGYLGFSEFVAAMQLVSLAQGGHDISHDLLNSNVDLENLNPPVMEGLDALLAKKKQ  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                          +TN +  + NGT  +   P         S   FSS+SS+K     L
Sbjct  121  LH------------RTNEN--EVNGTVVVEQSP---------SALWFSSKSSKK---VPL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIIDGLKRLYVQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPD RS+PGNT+AV ADMPF+GL+ FG AFLSK
Sbjct  215  KHLLKSSYPGAHIGPEPTTDRFVVVMSGPDGRSVPGNTIAVQADMPFSGLTKFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>emb|CDP04464.1| unnamed protein product [Coffea canephora]
Length=581

 Score =   360 bits (923),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 223/317 (70%), Gaps = 29/317 (9%)
 Frame = -3

Query  896  ASGPFT-SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADS  720
             S P T SCSK+ QK++Q WFNFADSDGDGR+TGNDATK+F MS+LS+P+LKQVWALADS
Sbjct  5    VSVPITYSCSKDHQKIYQYWFNFADSDGDGRLTGNDATKIFAMSNLSRPELKQVWALADS  64

Query  719  KRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPP--TMKDLDallasangs  546
            K+QGFLG+ EF TAMQLI+LAQEG E+NS LL       +S        L+    S    
Sbjct  65   KKQGFLGLTEFITAMQLIALAQEGHEINSALLKNAGKRRISKEQYIQLHLNNFKISVKIF  124

Query  545  spnssgsLTES------------PPQTNGS----KPDTNGTTplrpiplniplrpiPSIK  414
                  ++ ES              +TN S    K + NGT  L+             + 
Sbjct  125  LCLVFLAVLESLNLPVMEGLAALQAKTNVSPVKEKLEGNGTAELQSN----------PLV  174

Query  413  MFSSRSSRKKVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPM  234
              S R S KK   S+  VTSV DGLKRLYN KL+PLEVTY FNDF SP+LT+SDFDAKPM
Sbjct  175  KLSKRKSAKKSLSSVAPVTSVTDGLKRLYNEKLRPLEVTYHFNDFGSPLLTNSDFDAKPM  234

Query  233  IMLLGQYSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADM  54
            +MLLGQYSTGKTTFIKHLL CSYPGAHIGPEPTTDRFIVV SGPDERSIPGNT+AVHA+M
Sbjct  235  VMLLGQYSTGKTTFIKHLLGCSYPGAHIGPEPTTDRFIVVMSGPDERSIPGNTIAVHAEM  294

Query  53   PFTGLSTFGGAFLSKFE  3
            PFTGL+TFGGAFLSKFE
Sbjct  295  PFTGLTTFGGAFLSKFE  311



>gb|KHG30640.1| EH domain-containing 1 [Gossypium arboreum]
Length=542

 Score =   358 bits (919),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 189/301 (63%), Positives = 219/301 (73%), Gaps = 27/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME +S P  SCSKE QK+++DWFN ADSD DGRVTGND TK F MS LS+ +LKQ+WA+A
Sbjct  1    MEASSLPIDSCSKEHQKIYRDWFNIADSDRDGRVTGNDGTKFFAMSKLSRQELKQIWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQG+LG+ EF  AMQLIS AQ G E+  D+L +     +  P M+ +DAL A     
Sbjct  61   DSKRQGYLGLKEFIVAMQLISWAQAGHEITFDILKIDLE-NIGLPAMEGVDALAAKKKDF  119

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
            +             TNG   D NG+   +            S K F+S+SS KK+ PS  
Sbjct  120  A-------------TNGVH-DINGSNHHQVPA---------SAKWFTSKSS-KKIPPS--  153

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            AVTSV+DGLKRLY  KLKPLE TYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  154  AVTSVVDGLKRLYIEKLKPLESTYRFNDFVSPSLTNSDFDAKPMVMLLGQYSTGKTTFIK  213

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+C YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV AD+PF GL+TFGGAFLSKF
Sbjct  214  HLLQCDYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADLPFGGLTTFGGAFLSKF  273

Query  5    E  3
            E
Sbjct  274  E  274



>ref|XP_007153999.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
 gb|ESW25993.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
Length=406

 Score =   353 bits (907),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 224/302 (74%), Gaps = 29/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+  S    SCSKEQ   +++WFN ADSDGDGR++GNDAT  F +S+LS+ QLKQVWA+A
Sbjct  1    MKTVSDWIHSCSKEQSTTYKEWFNSADSDGDGRISGNDATTFFSLSNLSRSQLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            D+KRQGFLG  EF  AMQL++LAQ G ++NSD+ N +     +  P M+ LDAL+     
Sbjct  61   DAKRQGFLGFQEFVIAMQLVALAQAGYDINSDIFNAEIDKENIKSPVMEGLDALI-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       +  ++  S+PD +GT   + +          S+  +++  S KK+  SL
Sbjct  116  -----------AKTKSLHSQPDASGTAQPQLL----------SLNSWAAPKSAKKL--SL  152

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS+IDGLKRLY  KLKPLEVTY+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  153  SAVTSIIDGLKRLYMEKLKPLEVTYQFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  212

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFGG+FLSK
Sbjct  213  KHLLRCDYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVDADMPFSGLTTFGGSFLSK  272

Query  8    FE  3
            F+
Sbjct  273  FQ  274



>ref|XP_008799457.1| PREDICTED: EH domain-containing protein 1-like [Phoenix dactylifera]
Length=544

 Score =   358 bits (918),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 183/301 (61%), Positives = 219/301 (73%), Gaps = 26/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M++ + P  SC++EQQ ++Q WF+ ADSDGDGRVTGNDA K F MS LS+P+LKQVWA+A
Sbjct  1    MDLVTSPKKSCTREQQNIYQQWFSVADSDGDGRVTGNDALKFFAMSKLSRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSK QGFLG  EF  AMQL++LAQEG E+  D+L       + PP M+ LD LLA    S
Sbjct  61   DSKHQGFLGFQEFIIAMQLVALAQEGHEITQDVLTHLDLENIKPPVMEGLDILLAKNKRS  120

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
               +  ++ ESP Q     P                       + FSS+SS+K     L 
Sbjct  121  PKRNDPNVDESP-QIQPPSP----------------------ARWFSSKSSKKI---PLK  154

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGLK+LY  KLKPLEVTYRF+DFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  155  SVTSIIDGLKKLYIEKLKPLEVTYRFHDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  214

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL  SYPGAHIGPEPTTDRF+V+TSGPDERSIPGNT+AV ADMP++GL+TFG AFLSKF
Sbjct  215  HLLNSSYPGAHIGPEPTTDRFVVITSGPDERSIPGNTIAVQADMPYSGLTTFGTAFLSKF  274

Query  5    E  3
            E
Sbjct  275  E  275



>ref|XP_007154001.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
 gb|ESW25995.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
Length=392

 Score =   353 bits (905),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 224/302 (74%), Gaps = 29/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+  S    SCSKEQ   +++WFN ADSDGDGR++GNDAT  F +S+LS+ QLKQVWA+A
Sbjct  1    MKTVSDWIHSCSKEQSTTYKEWFNSADSDGDGRISGNDATTFFSLSNLSRSQLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            D+KRQGFLG  EF  AMQL++LAQ G ++NSD+ N +     +  P M+ LDAL+     
Sbjct  61   DAKRQGFLGFQEFVIAMQLVALAQAGYDINSDIFNAEIDKENIKSPVMEGLDALI-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       +  ++  S+PD +GT   + +          S+  +++  S KK+  SL
Sbjct  116  -----------AKTKSLHSQPDASGTAQPQLL----------SLNSWAAPKSAKKL--SL  152

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS+IDGLKRLY  KLKPLEVTY+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  153  SAVTSIIDGLKRLYMEKLKPLEVTYQFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  212

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFGG+FLSK
Sbjct  213  KHLLRCDYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVDADMPFSGLTTFGGSFLSK  272

Query  8    FE  3
            F+
Sbjct  273  FQ  274



>gb|EMT01492.1| EH domain-containing protein 1 [Aegilops tauschii]
Length=556

 Score =   358 bits (919),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 213/302 (71%), Gaps = 16/302 (5%)
 Frame = -3

Query  905  MEIA-SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            MEIA S     CSKE Q+++ DWF  AD DGDGRVTG DATK F MS LS+  LKQVWA+
Sbjct  1    MEIARSAAAVGCSKEHQRIYADWFAIADPDGDGRVTGADATKFFAMSGLSRADLKQVWAI  60

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasang  549
            ADSKRQG+LG  EF  AMQL+SLAQ G E+  D L  +  + + PP MK LD LL     
Sbjct  61   ADSKRQGYLGFGEFAAAMQLVSLAQAGNEITQDSLKREDLSSLDPPEMKGLDELL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       S    N  +P  NG            ++   +   FSS+S+ KK+Q  L
Sbjct  116  ---------ARSMAIVNVVRPQENGNQSAPFSHGTPQVQAPSTNSWFSSKSA-KKIQTPL  165

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            TAVTSVIDGLKRLY  KLKPLEV YRFNDF SP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  166  TAVTSVIDGLKRLYIEKLKPLEVAYRFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFI  225

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK ++PGAHIGPEPTTDRF+VV SG DER++PGNT+AV ADMPF GL+TFGGAFLSK
Sbjct  226  KHLLKSNFPGAHIGPEPTTDRFVVVMSGSDERTVPGNTIAVQADMPFNGLTTFGGAFLSK  285

Query  8    FE  3
            FE
Sbjct  286  FE  287



>ref|XP_008805596.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Phoenix 
dactylifera]
Length=549

 Score =   357 bits (917),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/306 (59%), Positives = 219/306 (72%), Gaps = 31/306 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+I S P  +CS+E QK++++WF+ ADSDGDGR+TGNDA K F MS LS+ +LKQVWA+A
Sbjct  1    MDIVSSPIGTCSREHQKIYKEWFSAADSDGDGRITGNDAIKFFAMSKLSRAELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFLG+NEF  AMQL+SLAQ G E+  D L       + PP M+ LD         
Sbjct  61   DSKRQGFLGLNEFIAAMQLVSLAQAGNEITQDALTHSELDSLKPPVMEGLD---------  111

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                  + T+  P+ +   PD +              +   + + FSS+S++K     L+
Sbjct  112  ---ILLAKTKPSPKKSNPDPDVSSQP-----------QVSLTTQWFSSKSAKKI---PLS  154

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGLKRLY  KLKPLEVTYRFNDF SP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  155  SVTSIIDGLKRLYIEKLKPLEVTYRFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  214

Query  185  HLLKCSYP-----GAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGA  21
            HLL+ SYP     GAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG A
Sbjct  215  HLLRSSYPGTIYAGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTA  274

Query  20   FLSKFE  3
            FLSKFE
Sbjct  275  FLSKFE  280



>ref|XP_009334157.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=547

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 222/302 (74%), Gaps = 26/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI+S P TSCSKE QK++Q+WF FADSD DGR+TG DA K FGMS+L++  LKQVWA+A
Sbjct  1    MEISSVPITSCSKEHQKIYQEWFRFADSDSDGRITGGDAIKFFGMSNLNRQDLKQVWAVA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG NEF  AMQL+SLAQ G ++   L N       + PP M+ LDALL+    
Sbjct  61   DSKRQGYLGFNEFVAAMQLVSLAQAGHDITHGLQNSNVDLESLKPPVMEGLDALLS----  116

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +       ++ + NGT  ++  P         S   FSS+S++K     L
Sbjct  117  ---------AKKKHTHKSNENEVNGTAVVQQSP---------SALWFSSKSAKK---VPL  155

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTY+FNDFVSP+L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  156  SSVTSIIDGLKRLYVQKLKPLEVTYKFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFI  215

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERS+PGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  216  KHLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSVPGNTIAVQADMPFSGLTTFGTAFLSK  275

Query  8    FE  3
            FE
Sbjct  276  FE  277



>ref|XP_003574764.1| PREDICTED: EH domain-containing protein 1-like [Brachypodium 
distachyon]
Length=545

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 214/301 (71%), Gaps = 25/301 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEIA+     CSKE QK++ DWF  AD DGDGRVTG+DATK F MS LS+  LKQVWA+A
Sbjct  1    MEIAAAA-VGCSKEHQKIYADWFALADPDGDGRVTGSDATKFFAMSGLSRSDLKQVWAIA  59

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQG+LG  EF  AMQL+SLAQ G+E+  + L L+  + + PP MK LD LLA +   
Sbjct  60   DSKRQGYLGFGEFAAAMQLVSLAQAGKEITQNSLKLEDLSSLDPPVMKGLDELLARSMAI  119

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                     ++P       P  N                      F S+S+ KK+Q  LT
Sbjct  120  VNVVRKEENDTP---QVQAPFANN--------------------WFGSKSA-KKMQTPLT  155

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            AVTSV+DGLKRLY  KLKPLEV YRFNDF SP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  156  AVTSVVDGLKRLYVEKLKPLEVAYRFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  215

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLLK SYPGAH+GPEPTTDRF+VV SGPDER++PGNT+AV ADMPF GL+TFGGAFLSKF
Sbjct  216  HLLKTSYPGAHVGPEPTTDRFVVVMSGPDERTVPGNTIAVQADMPFNGLTTFGGAFLSKF  275

Query  5    E  3
            E
Sbjct  276  E  276



>ref|XP_002298819.2| hypothetical protein POPTR_0001s36630g [Populus trichocarpa]
 gb|EEE83624.2| hypothetical protein POPTR_0001s36630g [Populus trichocarpa]
Length=512

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 222/302 (74%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI+SG   SCSK+Q+ ++Q+WF++ADSDGDGR+TGNDATK F +S LS+  LK VWA+A
Sbjct  1    MEISSGAIGSCSKDQKTMYQEWFHYADSDGDGRITGNDATKFFSLSKLSRQDLKPVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF  AMQL+SLAQ G E+ +D+LN       + PP+M+ LDAL+A    
Sbjct  61   DSKRQGYLGFIEFIIAMQLVSLAQSGREITNDILNSDVDFQSLKPPSMEGLDALMAKKRR  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
            S  ++      +P  T  S P  N                      FSS+ SRK    SL
Sbjct  121  SLKSNDNEANGTP--TVQSTPSAN---------------------WFSSKPSRK---ASL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPALTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+ SYPGAHIGPEPTTDRF+VV SG DERS+PGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLRSSYPGAHIGPEPTTDRFVVVMSGTDERSVPGNTIAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>gb|KDP39189.1| hypothetical protein JCGZ_00946 [Jatropha curcas]
Length=545

 Score =   356 bits (914),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 193/317 (61%), Positives = 214/317 (68%), Gaps = 57/317 (18%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI+SGP  SCSK+ QK++ +WFNFADSDGDGR+TGNDA K FGMS+LS+  LKQVWA+A
Sbjct  1    MEISSGPIGSCSKDNQKIYLEWFNFADSDGDGRITGNDAIKFFGMSNLSRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQG+LG NEF TAMQLISLAQ G E+  DLLN       +  P M  LD LLA    
Sbjct  61   DSKRQGYLGFNEFITAMQLISLAQAGHEITHDLLNSNIDFENLKTPFMDGLDLLLAKKKR  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                           +  S+PDTNG+                             VQPS 
Sbjct  121  L--------------SKSSEPDTNGSHL---------------------------VQPSP  139

Query  368  TA---------------VTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPM  234
            +A               VTS+IDGLKRLY  KLKPLEV YRFNDFVSP+LT SDFDAKPM
Sbjct  140  SANWFSSKSSKKISLSSVTSIIDGLKRLYIQKLKPLEVAYRFNDFVSPLLTSSDFDAKPM  199

Query  233  IMLLGQYSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADM  54
            +MLLGQYSTGKTTFIKHLLK SYPGAHIGPEPTTDRF+VV SG DERSIPGNTVAV ADM
Sbjct  200  VMLLGQYSTGKTTFIKHLLKTSYPGAHIGPEPTTDRFVVVMSGTDERSIPGNTVAVQADM  259

Query  53   PFTGLSTFGGAFLSKFE  3
            PF GL+TFG AFLSKFE
Sbjct  260  PFNGLTTFGTAFLSKFE  276



>ref|XP_003529656.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=545

 Score =   356 bits (914),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 224/302 (74%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+  S    SCSKEQ K +QDWFN ADSDGDGR+TGNDATK F +S+LS+ QLKQVWA+A
Sbjct  1    MKTVSDWIDSCSKEQLKTYQDWFNLADSDGDGRITGNDATKFFALSNLSRSQLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            D+KRQG+LG  EF  AMQL++LAQ G ++NSD+L  +     +  P M+ LDAL+     
Sbjct  61   DAKRQGYLGFQEFVMAMQLVALAQVGHDINSDILKTEIDKENIKSPVMEGLDALI-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      ++   T  ++PD  GT   +P+           +  +++  S KK+   L
Sbjct  116  ---------AKTKSLTVNAQPDVFGTAIPQPL----------PLNSWAAPKSVKKL--PL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS+IDGLKRLY  +LKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SAVTSIIDGLKRLYVERLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFGG+FLSK
Sbjct  215  KHLLRCDYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVDADMPFSGLTTFGGSFLSK  274

Query  8    FE  3
            F+
Sbjct  275  FQ  276



>ref|XP_008359253.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=546

 Score =   356 bits (914),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 183/302 (61%), Positives = 222/302 (74%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI+S P +SCSK  QK++Q+WF FADSDGDGR+TG DA K FGMS+L++  LKQVWA+A
Sbjct  1    MEISSVPISSCSKXHQKIYQEWFRFADSDGDGRITGGDAIKFFGMSNLNRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG +EF  AMQL+SLAQ G ++   L N       + PP M+ LD LL     
Sbjct  61   DSKRQGYLGFSEFVAAMQLVSLAQAGHDITHGLQNSNVDLESLKPPVMEGLDXLL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                     ++       ++ + NGT  ++  P         S   FSS+S++K     L
Sbjct  116  ---------SKKKHTXKSNENEVNGTAVVQQSP---------SALWFSSKSAKK---VPL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTY+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIIDGLKRLYVQKLKPLEVTYKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERS+PGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSVPGNTIAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_011046717.1| PREDICTED: EH domain-containing protein 3 [Populus euphratica]
Length=545

 Score =   355 bits (911),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 221/302 (73%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI+SG   SCSK+Q+ ++Q+WF++ADSDGDGR+TGNDATK F +S LS+  LK VWA+A
Sbjct  1    MEISSGAIGSCSKDQKTMYQEWFHYADSDGDGRITGNDATKFFSLSKLSRQDLKPVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF  AMQL+SLAQ G E+ +D+LN       + PP+M+ LDALL     
Sbjct  61   DSKRQGYLGFIEFIIAMQLVSLAQSGREITNDILNSDVDFQSLKPPSMEGLDALLVKKRR  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
            S  ++      +P  T  S P  N                      FSS+ SRK    SL
Sbjct  121  SLKSNDNEANGTP--TVQSTPSAN---------------------WFSSKPSRK---ASL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIIDGLKRLYLQKLKPLEVTYRFNDFVSPALTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+ SYPGAHIGPEPTTDRF+VV SG DERS+PGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLRSSYPGAHIGPEPTTDRFVVVMSGTDERSVPGNTIAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_009361045.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=546

 Score =   355 bits (910),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 225/302 (75%), Gaps = 26/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI+S P +SCSKE Q ++Q+WF FAD+D DGR+TG+DA K FGMS+L++  LKQVWA+A
Sbjct  1    MEISSVPISSCSKEHQNIYQEWFRFADADTDGRITGSDAIKFFGMSNLNRQDLKQVWAMA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG +EF  AMQL+SLAQ G ++   LLN       + PP M+ LDALL +   
Sbjct  61   DSKRQGYLGFSEFVAAMQLVSLAQAGHDITHGLLNSNVDLESLKPPVMEGLDALLLAK--  118

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +   ++N +K   NGT  ++  P         S   FSS+SS+K     L
Sbjct  119  ---------KKHSHKSNENK--VNGTAVVQQTP---------SALWFSSKSSKK---VPL  155

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTY+FNDFVSP+L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  156  SSVTSIIDGLKRLYVQKLKPLEVTYKFNDFVSPLLRNSDFDAKPMVMLLGQYSTGKTTFI  215

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERS+PGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  216  KHLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSVPGNTIAVQADMPFSGLTTFGTAFLSK  275

Query  8    FE  3
            FE
Sbjct  276  FE  277



>gb|KEH28435.1| calcium-binding EF hand protein [Medicago truncatula]
Length=423

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 217/302 (72%), Gaps = 29/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME    P  SCSK+ Q ++Q WFN ADSDGDGR+TGNDATK F MS+LS+  LKQVWA+A
Sbjct  1    MEFDPIPIGSCSKDHQNIYQQWFNHADSDGDGRITGNDATKFFAMSNLSRQHLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF  AMQL+SLAQ G  +  DLLN       + PP ++ LDALL     
Sbjct  61   DSKRQGYLGFQEFIIAMQLVSLAQSGHPITHDLLNSDVDLKNLKPPILEGLDALL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       +  +   S+ D NG++ L+P P +       + K+             L
Sbjct  116  -----------AKKKHKQSELDVNGSSQLQPSPSSSWFSSKSTKKV------------PL  152

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  153  SSVTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  212

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLKCSYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  213  KHLLKCSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSK  272

Query  8    FE  3
            FE
Sbjct  273  FE  274



>ref|XP_011000650.1| PREDICTED: EH domain-containing protein 1-like [Populus euphratica]
Length=545

 Score =   354 bits (909),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 192/303 (63%), Positives = 219/303 (72%), Gaps = 32/303 (11%)
 Frame = -3

Query  902  EIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALAD  723
            EI     +S SKEQQ+++++WFN  DSDGDGR+TGNDATK F MS+LS+ QLKQVWALAD
Sbjct  3    EIGKSAGSSFSKEQQQIYKEWFNLVDSDGDGRLTGNDATKFFSMSNLSRQQLKQVWALAD  62

Query  722  SKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAA---GVSPPTMKDLDallasan  552
            SKRQGFLG  EF TAMQL+SLAQ G EL  D   +KTA+    V PP M  +DALLA   
Sbjct  63   SKRQGFLGFTEFVTAMQLVSLAQAGHELTPD--TIKTASKMEDVKPPLMDGIDALLAKNK  120

Query  551  gsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
                            +  S+ D NG+T LR                F ++SSRK     
Sbjct  121  S---------------SRISENDINGSTQLRLPT---------GTPQFGAKSSRKM---P  153

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            L AVTS+IDGLKRLY  KLKPLE TYRFNDFVSP+LT SDFDA+PM+MLLGQYSTGKTTF
Sbjct  154  LNAVTSIIDGLKRLYIEKLKPLEATYRFNDFVSPLLTTSDFDARPMVMLLGQYSTGKTTF  213

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            IKHLL+C+YPGAHIGPEPTTDRF+VV SG DERSIPGNTVAV ADMPF+GL+ FGGAFLS
Sbjct  214  IKHLLRCNYPGAHIGPEPTTDRFVVVMSGHDERSIPGNTVAVQADMPFSGLTHFGGAFLS  273

Query  11   KFE  3
            KFE
Sbjct  274  KFE  276



>ref|XP_003550477.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=545

 Score =   354 bits (908),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 181/302 (60%), Positives = 223/302 (74%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+  S    SCSKEQ K +Q+WFN ADSDGDGR+TGNDATK F +S+LS+ QLKQVWA+A
Sbjct  1    MKTVSDWIDSCSKEQLKTYQEWFNLADSDGDGRITGNDATKFFALSNLSRSQLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            D+KRQG+LG  EF  AMQL++LAQ G ++NSD+L  +     +  P M+ LDAL+     
Sbjct  61   DAKRQGYLGFQEFVMAMQLVALAQVGHDINSDILKTEIDKENIKSPVMEGLDALI-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      ++   T  ++PD  GT   +P            +  +++  S KK+   L
Sbjct  116  ---------AKTKSLTINAQPDIFGTAQPQPF----------PLNSWAAPKSVKKL--PL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS+IDGLKRLY  +LKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SAVTSIIDGLKRLYVERLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFGG+FLSK
Sbjct  215  KHLLRCDYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVDADMPFSGLTTFGGSFLSK  274

Query  8    FE  3
            F+
Sbjct  275  FQ  276



>gb|ACJ85603.1| unknown [Medicago truncatula]
Length=430

 Score =   350 bits (898),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 217/302 (72%), Gaps = 29/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME    P  SCSK+ Q ++Q WFN ADSDGDGR+TGNDATK F MS+LS+  LKQVWA+A
Sbjct  1    MEFDPIPIGSCSKDHQNIYQQWFNHADSDGDGRITGNDATKFFAMSNLSRQHLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF  AMQL+SLAQ G  +  DLLN       + PP ++ LDALL     
Sbjct  61   DSKRQGYLGFQEFIIAMQLVSLAQSGHPITHDLLNSDVDLKNLKPPILEGLDALL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       +  +   S+ D NG++ L+P P +       + K+             L
Sbjct  116  -----------AKKKHKQSELDVNGSSQLQPSPSSSWFSSKSTKKV------------PL  152

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  153  SSVTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  212

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLKCSYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  213  KHLLKCSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSK  272

Query  8    FE  3
            FE
Sbjct  273  FE  274



>gb|KHN03510.1| EH domain-containing protein 1 [Glycine soja]
Length=545

 Score =   353 bits (907),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 181/302 (60%), Positives = 223/302 (74%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+  S    SCSKEQ K +Q+WFN ADSDGDGR+TGNDATK F +S+LS+ QLKQVWA+A
Sbjct  1    MKTVSDWIDSCSKEQLKTYQEWFNLADSDGDGRITGNDATKFFALSNLSRSQLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            D+KRQG+LG  EF  AMQL++LAQ G ++NSD+L  +     +  P M+ LDAL+     
Sbjct  61   DAKRQGYLGFQEFVMAMQLVALAQVGHDINSDILKTEIDKENIKSPVMEGLDALI-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      ++   T  ++PD  GT   +P            +  +++  S KK+   L
Sbjct  116  ---------AKTKSLTINAQPDIFGTAQPQPF----------PLNSWAAPKSVKKL--PL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS+IDGLKRLY  +LKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SAVTSIIDGLKRLYVERLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFGG+FLSK
Sbjct  215  KHLLRCDYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVDADMPFSGLTTFGGSFLSK  274

Query  8    FE  3
            F+
Sbjct  275  FQ  276



>ref|XP_007154000.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
 gb|ESW25994.1| hypothetical protein PHAVU_003G082600g [Phaseolus vulgaris]
Length=543

 Score =   353 bits (905),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 224/302 (74%), Gaps = 29/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+  S    SCSKEQ   +++WFN ADSDGDGR++GNDAT  F +S+LS+ QLKQVWA+A
Sbjct  1    MKTVSDWIHSCSKEQSTTYKEWFNSADSDGDGRISGNDATTFFSLSNLSRSQLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            D+KRQGFLG  EF  AMQL++LAQ G ++NSD+ N +     +  P M+ LDAL+     
Sbjct  61   DAKRQGFLGFQEFVIAMQLVALAQAGYDINSDIFNAEIDKENIKSPVMEGLDALI-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       +  ++  S+PD +GT   + +          S+  +++  S KK+  SL
Sbjct  116  -----------AKTKSLHSQPDASGTAQPQLL----------SLNSWAAPKSAKKL--SL  152

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS+IDGLKRLY  KLKPLEVTY+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  153  SAVTSIIDGLKRLYMEKLKPLEVTYQFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  212

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFGG+FLSK
Sbjct  213  KHLLRCDYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVDADMPFSGLTTFGGSFLSK  272

Query  8    FE  3
            F+
Sbjct  273  FQ  274



>ref|XP_010090952.1| EH domain-containing protein 1 [Morus notabilis]
 gb|EXB41537.1| EH domain-containing protein 1 [Morus notabilis]
Length=510

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 209/301 (69%), Gaps = 60/301 (20%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI SGP   C+KE QK++Q+WFN ADSDGDGR+TGNDATK F MS LS+ +LKQVWA+A
Sbjct  1    MEIGSGPIGPCTKEHQKMYQEWFNLADSDGDGRITGNDATKFFAMSKLSRQELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFLG+ EF TAMQL+SLAQ G EL  ++  +   AG++ P               
Sbjct  61   DSKRQGFLGLTEFITAMQLVSLAQAGHELTPEIHKI---AGIAQP---------------  102

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                              +P T                     + F S+S +K     L 
Sbjct  103  ------------------QPST---------------------QWFPSKSVKKL---PLN  120

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            AVTS+IDGLKRLY  KLKPLEVTYRFNDF +P LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  121  AVTSIIDGLKRLYMEKLKPLEVTYRFNDFSTPSLTNSDFDAKPMVMLLGQYSTGKTTFIK  180

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+C+YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFGGAFLSKF
Sbjct  181  HLLRCNYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPFSGLTTFGGAFLSKF  240

Query  5    E  3
            +
Sbjct  241  Q  241



>ref|XP_004294399.1| PREDICTED: EH domain-containing protein 1-like [Fragaria vesca 
subsp. vesca]
Length=545

 Score =   352 bits (904),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 221/302 (73%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI+S P +SCSKE QK++++WF FADSD DGR+TG+DA K F MS+LS+  LKQVWA+ 
Sbjct  1    MEISSVPISSCSKEHQKIYREWFQFADSDSDGRITGSDAIKFFSMSNLSRQDLKQVWAIT  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF  AMQL+SLAQ G E+ +DLL        + PP M+ LD LLA    
Sbjct  61   DSKRQGFLGFTEFVAAMQLVSLAQAGNEITNDLLTRNADLENLKPPVMEGLDVLLAKKKR  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
            S+            +TN ++ + N      P           S   FSS+SS+K     L
Sbjct  121  SN------------KTNENEVNGNPVVQQSP-----------SALWFSSKSSKK---VPL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS++DGLKRLY  KLKPLEVTY+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SAVTSIVDGLKRLYVQKLKPLEVTYKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SG DERS+PGNT+AV ADMPF+GL++FG AFLSK
Sbjct  215  KHLLKTSYPGAHIGPEPTTDRFVVVMSGSDERSVPGNTIAVQADMPFSGLTSFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_009357509.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=541

 Score =   352 bits (903),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/304 (62%), Positives = 223/304 (73%), Gaps = 35/304 (12%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  SG    C KE QK++Q+WFN  DSDGDGR+TGN+ATK F MS LS+ +LKQVWA+A
Sbjct  1    MENGSGRTGVCPKEHQKIYQEWFNLVDSDGDGRITGNEATKFFAMSKLSREELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAA---GVSPPTMKDLDallasa  555
            D KRQGFLG +EF TAMQ+ISLAQE  EL+ D+L  KTA     + PP ++ LD L+A  
Sbjct  61   DMKRQGFLGFSEFITAMQMISLAQE-HELSPDVL--KTAVDWENIKPPVIEGLDDLIAKT  117

Query  554  ngsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQP  375
               +             T G   + NGT   +P           S++ F S+S+ KK+ P
Sbjct  118  KSLT-------------TYGV--EVNGTAQFQP-----------SVQRFGSKSA-KKLPP  150

Query  374  SLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTT  195
            +  AVTS++DGLKRLYN KLKPLE+ YRFNDF SP L +SDFDAKPM+MLLGQYSTGKTT
Sbjct  151  N--AVTSIVDGLKRLYNEKLKPLELAYRFNDFASPSLINSDFDAKPMVMLLGQYSTGKTT  208

Query  194  FIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFL  15
            FIKHLL+C YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AVHADMPF+GL+TFGGAFL
Sbjct  209  FIKHLLRCDYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVHADMPFSGLTTFGGAFL  268

Query  14   SKFE  3
            SKFE
Sbjct  269  SKFE  272



>ref|XP_007211540.1| hypothetical protein PRUPE_ppa003972mg [Prunus persica]
 gb|EMJ12739.1| hypothetical protein PRUPE_ppa003972mg [Prunus persica]
Length=537

 Score =   352 bits (903),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 186/297 (63%), Positives = 217/297 (73%), Gaps = 31/297 (10%)
 Frame = -3

Query  890  GPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQ  711
            GP + C KE QK++Q+WFN  DSDGDGR+TGN+ATK F +S LS+ +LKQVWA AD KRQ
Sbjct  2    GPVSLCPKEYQKVYQEWFNLVDSDGDGRITGNEATKFFALSKLSRQELKQVWATADKKRQ  61

Query  710  GFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspns  534
            GFLG  EF TAMQLISLAQE  EL  D+L  +     ++PP M+ LDAL A    S+   
Sbjct  62   GFLGFTEFITAMQLISLAQE-HELTPDILKTEVDWENINPPLMEGLDALSAKTKSST---  117

Query  533  sgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTS  354
                      TNG   + NG+   +P             + F S+S +K     L AVTS
Sbjct  118  ----------TNGL--EVNGSIQSQPPA-----------QWFGSKSVKKL---PLIAVTS  151

Query  353  VIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLK  174
            + DGLKRLYN KLKPLE+TYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFIKHLL+
Sbjct  152  ITDGLKRLYNEKLKPLELTYRFNDFVSPSLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  211

Query  173  CSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            C+YPGAHIGPEPTTDRF+ V SGPDERSIPGNT+AVHADMPF+GL+TFGGAFLSKFE
Sbjct  212  CNYPGAHIGPEPTTDRFVAVMSGPDERSIPGNTIAVHADMPFSGLATFGGAFLSKFE  268



>ref|XP_006586764.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=539

 Score =   352 bits (902),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 179/294 (61%), Positives = 220/294 (75%), Gaps = 30/294 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            S SKE+ K +Q+WFN ADSDGDGR++GNDATK F +S+LS+ QLKQ+WALAD KRQGFLG
Sbjct  5    SRSKEETKTYQEWFNLADSDGDGRISGNDATKFFALSNLSRSQLKQLWALADVKRQGFLG  64

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgsL  522
              EF TAMQL+SLAQ G+EL SD+L  +     + PP ++ LDAL+A  + +        
Sbjct  65   FTEFVTAMQLVSLAQAGQELKSDILKTQIDKENIKPPVLEGLDALVAQMSLT--------  116

Query  521  TESPPQTNGS-KPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVID  345
              +PP+ NG+ +P    T                  + F S+SS+K    SL +VTS+ID
Sbjct  117  ISAPPEVNGTPQPQVFPTN-----------------RWFGSKSSKKL---SLNSVTSIID  156

Query  344  GLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSY  165
            GLKRLY  +LKPLEV Y++NDFVSP+LT++DFDAKPM+MLLGQYSTGKTTFIKHLLKC Y
Sbjct  157  GLKRLYIERLKPLEVAYQYNDFVSPLLTNTDFDAKPMVMLLGQYSTGKTTFIKHLLKCDY  216

Query  164  PGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PGAH+GPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF GL+TFGG+FLSKF+
Sbjct  217  PGAHVGPEPTTDRFVVVMSGPDERSIPGNTIAVDADMPFGGLTTFGGSFLSKFQ  270



>gb|EAZ02155.1| hypothetical protein OsI_24244 [Oryza sativa Indica Group]
Length=544

 Score =   351 bits (901),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 215/301 (71%), Gaps = 26/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI   P +  SKE QK +Q+WF FADSDGDGR+TG DA K F MS L +  LKQVWA+A
Sbjct  1    MEIGQHPASGYSKEHQKTYQEWFAFADSDGDGRITGPDAIKFFAMSKLPRADLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQG+LG +EF TAMQL+SLAQ G+E+  D L       ++PPTM  LDALL      
Sbjct  61   DSKRQGYLGFSEFVTAMQLVSLAQAGDEITQDSLKRDDLGSLNPPTMDGLDALL------  114

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                     +S        PD +G    +    +         + FSS+SS+K     L 
Sbjct  115  --------VKSKHHAKRVDPDIDGFPQAQSPATS---------QWFSSKSSKKI---PLN  154

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            AVTSVIDGLK+LY  KLKPLEVTY+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  155  AVTSVIDGLKKLYIEKLKPLEVTYKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  214

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRF+VV SGPDER+IPGNT+AV ADMPF+GL+TFG AFLSKF
Sbjct  215  HLLRTSYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVQADMPFSGLTTFGTAFLSKF  274

Query  5    E  3
            E
Sbjct  275  E  275



>ref|NP_001058410.1| Os06g0687800 [Oryza sativa Japonica Group]
 dbj|BAD45606.1| putative receptor-mediated endocytosis 1 isoform I [Oryza sativa 
Japonica Group]
 dbj|BAD46062.1| putative receptor-mediated endocytosis 1 isoform I [Oryza sativa 
Japonica Group]
 dbj|BAF20324.1| Os06g0687800 [Oryza sativa Japonica Group]
 gb|EAZ38080.1| hypothetical protein OsJ_22427 [Oryza sativa Japonica Group]
 dbj|BAG93051.1| unnamed protein product [Oryza sativa Japonica Group]
Length=544

 Score =   351 bits (901),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 215/301 (71%), Gaps = 26/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI   P +  SKE QK +Q+WF FADSDGDGR+TG DA K F MS L +  LKQVWA+A
Sbjct  1    MEIGQHPASGYSKEHQKTYQEWFAFADSDGDGRITGPDAIKFFAMSKLPRADLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQG+LG +EF TAMQL+SLAQ G+E+  D L       ++PPTM  LDALL      
Sbjct  61   DSKRQGYLGFSEFVTAMQLVSLAQAGDEITQDSLKRDDLGSLNPPTMDGLDALL------  114

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                     +S        PD +G    +    +         + FSS+SS+K     L 
Sbjct  115  --------VKSKHHAKRVDPDIDGFPQAQSPATS---------QWFSSKSSKKI---PLN  154

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            AVTSVIDGLK+LY  KLKPLEVTY+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  155  AVTSVIDGLKKLYIEKLKPLEVTYKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  214

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRF+VV SGPDER+IPGNT+AV ADMPF+GL+TFG AFLSKF
Sbjct  215  HLLRTSYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVQADMPFSGLTTFGTAFLSKF  274

Query  5    E  3
            E
Sbjct  275  E  275



>gb|KHN40844.1| EH domain-containing protein 1 [Glycine soja]
Length=541

 Score =   351 bits (900),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 179/296 (60%), Positives = 221/296 (75%), Gaps = 32/296 (11%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            S SKE+ K +Q+WFN ADSDGDGR++GNDATK F +S+LS+ QLKQ+WALAD KRQGFLG
Sbjct  5    SRSKEETKTYQEWFNLADSDGDGRISGNDATKFFALSNLSRSQLKQLWALADVKRQGFLG  64

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKTA---AGVSPPTMKDLDallasangsspnssg  528
              EF TAMQL+SLAQ G+EL SD+L  ++      + PP ++ LDAL+A  + +      
Sbjct  65   FTEFVTAMQLVSLAQAGQELKSDILKTQSKFDKENIKPPVLEGLDALVAQMSLT------  118

Query  527  sLTESPPQTNGS-KPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSV  351
                +PP+ NG+ +P    T                  + F S+SS+K    SL +VTS+
Sbjct  119  --ISAPPEVNGTPQPQVFPTN-----------------RWFGSKSSKKL---SLNSVTSI  156

Query  350  IDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKC  171
            IDGLKRLY  +LKPLEV Y++NDFVSP+LT++DFDAKPM+MLLGQYSTGKTTFIKHLLKC
Sbjct  157  IDGLKRLYIERLKPLEVAYQYNDFVSPLLTNTDFDAKPMVMLLGQYSTGKTTFIKHLLKC  216

Query  170  SYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
             YPGAH+GPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF GL+TFGG+FLSKF+
Sbjct  217  DYPGAHVGPEPTTDRFVVVMSGPDERSIPGNTIAVDADMPFGGLTTFGGSFLSKFQ  272



>ref|XP_008384122.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=541

 Score =   351 bits (900),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 186/304 (61%), Positives = 222/304 (73%), Gaps = 35/304 (12%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI SG    C KE QK++Q+WFN  DSDGDGR+TGN+ TK F MS LS+ +LKQVWA+ 
Sbjct  1    MEIGSGRTGVCPKEHQKIYQEWFNLVDSDGDGRITGNEXTKFFAMSKLSREELKQVWAIX  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAA---GVSPPTMKDLDallasa  555
            D+KRQGFLG +EF TAMQ+ISLAQE  E + D+L  KTA     + PP ++ LD L+A  
Sbjct  61   DTKRQGFLGFSEFVTAMQMISLAQE-HEXSPDIL--KTAVDWENIKPPVIEGLDDLIAKT  117

Query  554  ngsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQP  375
               +             T G   + NGT   +P           S++ F S+S+ KK+ P
Sbjct  118  KSLT-------------TYGV--EVNGTAQFQP-----------SVQRFGSKSA-KKLPP  150

Query  374  SLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTT  195
            +  AVTS++DGLKRLYN KLKPLE+ YRFNDF SP LT+SDFDAKPM+MLLGQYSTGKTT
Sbjct  151  N--AVTSIVDGLKRLYNEKLKPLELAYRFNDFASPSLTNSDFDAKPMVMLLGQYSTGKTT  208

Query  194  FIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFL  15
            FIKHLL+C YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AVHADMPF+GL+ FGGAFL
Sbjct  209  FIKHLLRCDYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVHADMPFSGLTXFGGAFL  268

Query  14   SKFE  3
            SKFE
Sbjct  269  SKFE  272



>gb|AFK42442.1| unknown [Medicago truncatula]
Length=543

 Score =   350 bits (899),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 217/302 (72%), Gaps = 29/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME    P  SCSK+ Q ++Q WFN ADSDGDGR+TGNDATK F MS+LS+  LKQVWA+A
Sbjct  1    MEFDPIPIGSCSKDHQNIYQQWFNHADSDGDGRITGNDATKFFAMSNLSRQHLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF  AMQL+SLAQ G  +  DLLN       + PP ++ LDALL     
Sbjct  61   DSKRQGYLGFQEFIIAMQLVSLAQSGHPITHDLLNSDVDLKNLKPPILEGLDALL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       +  +   S+ D NG++ L+P P +       + K+             L
Sbjct  116  -----------AKKKHKQSELDVNGSSQLQPSPSSSWFSSKSTKKV------------PL  152

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  153  SSVTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  212

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLKCSYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  213  KHLLKCSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSK  272

Query  8    FE  3
            FE
Sbjct  273  FE  274



>ref|XP_010675784.1| PREDICTED: EH domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=544

 Score =   350 bits (899),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 215/302 (71%), Gaps = 28/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI+  P   CSKE +K++QDWFNFADSDGDGR+TGNDA K FGMSDL +  LKQVWA+A
Sbjct  1    MEISGTPINLCSKESRKIYQDWFNFADSDGDGRLTGNDAIKFFGMSDLPREDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLK-TAAGVSPPTMKDLDallasang  549
            D+KRQGFLG+ EF TAMQL+SLAQ G  +N DLL  +     + PP+M+ L+  +     
Sbjct  61   DAKRQGFLGLQEFITAMQLVSLAQSGHTINQDLLIAEFDWDTLEPPSMQGLNEKITKKKS  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                     ++S  ++   +P                     S   F+S  S KK+Q  L
Sbjct  121  KLR------SDSGNESKKLQP-------------------TRSSHWFTSSRSSKKIQ--L  153

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLK LYN  LKPLE +Y FN+F SP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  154  SSVTSIIDGLKTLYNQNLKPLETSYHFNNFASPLLTNSDFDAKPMVMLLGQYSTGKTTFI  213

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VVT GPDERSIPGNT+AV ADMP++GL+ FG AFLSK
Sbjct  214  KHLLKSSYPGAHIGPEPTTDRFVVVTYGPDERSIPGNTIAVQADMPYSGLTAFGTAFLSK  273

Query  8    FE  3
            FE
Sbjct  274  FE  275



>emb|CDO98110.1| unnamed protein product [Coffea canephora]
Length=536

 Score =   350 bits (898),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 183/292 (63%), Positives = 213/292 (73%), Gaps = 26/292 (9%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            SCSK+ QK++QDWFN ADSDGDGR+TGNDATK+F MS+LS+P+LKQVWALADSK+QGFLG
Sbjct  12   SCSKDHQKIYQDWFNLADSDGDGRLTGNDATKIFAMSNLSRPELKQVWALADSKKQGFLG  71

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsLT  519
            + EF TAMQLI+LAQ+G E+NS LL  K    ++ P M+ L AL A +            
Sbjct  72   LTEFITAMQLIALAQKGREINSALL--KNKGNLNLPVMEGLAALQAVSTSFHF-------  122

Query  518  ESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGL  339
             S  + N    +   +                 +   S R S KK   S+  VTSV DGL
Sbjct  123  -SIVKKNAGTAELQCS----------------PLVKLSKRKSAKKSLSSVAPVTSVTDGL  165

Query  338  KRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPG  159
            KRLYN KL+PLEVTY FNDF SP+LT+SDFDAKPM+MLLGQYSTGKTTFIK+LL  SYPG
Sbjct  166  KRLYNEKLRPLEVTYHFNDFGSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKYLLGRSYPG  225

Query  158  AHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            AHIGPE TTDRFI V SGPDERSIPGNT+AVHA+MPFTGL+TFGGAFLSKFE
Sbjct  226  AHIGPELTTDRFIAVMSGPDERSIPGNTIAVHAEMPFTGLTTFGGAFLSKFE  277



>ref|NP_001045954.1| Os02g0158100 [Oryza sativa Japonica Group]
 dbj|BAD28029.1| putative receptor Mediated Endocytosis RME-1 [Oryza sativa Japonica 
Group]
 dbj|BAD28174.1| putative receptor Mediated Endocytosis RME-1 [Oryza sativa Japonica 
Group]
 dbj|BAF07868.1| Os02g0158100 [Oryza sativa Japonica Group]
 gb|EEC72529.1| hypothetical protein OsI_05922 [Oryza sativa Indica Group]
 gb|EEE56343.1| hypothetical protein OsJ_05448 [Oryza sativa Japonica Group]
Length=543

 Score =   350 bits (898),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 212/301 (70%), Gaps = 27/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME+A    ++CSKE  K++  WF  AD DGDGRVTG DATK F MS LS+  LKQVWA+A
Sbjct  1    MELAR---SACSKEHHKIYAGWFAVADPDGDGRVTGADATKFFAMSGLSRADLKQVWAIA  57

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            D+KRQGFLG  EF  AMQL+SLAQ GEE+  D L  +  + + PP M+ LD LL      
Sbjct  58   DTKRQGFLGFGEFVAAMQLVSLAQAGEEITQDSLKREDLSSLDPPVMEGLDELL------  111

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                      S        P+ NG   ++    N           FSS+S+ KK+Q  LT
Sbjct  112  --------ARSKAGVKRVHPEENGAPQVQVHSANS---------WFSSKSA-KKMQVPLT  153

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            AVTSVIDGLKRLY  KLKPLEV YRFNDF SP+LT SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  154  AVTSVIDGLKRLYVEKLKPLEVAYRFNDFASPLLTSSDFDAKPMVMLLGQYSTGKTTFIK  213

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAH+GPEPTTDRF+VV SG DER+IPGNT+AV ADMPFTGL+TFGGAFLSKF
Sbjct  214  HLLQTSYPGAHVGPEPTTDRFVVVMSGSDERTIPGNTIAVQADMPFTGLTTFGGAFLSKF  273

Query  5    E  3
            E
Sbjct  274  E  274



>ref|XP_003617631.1| EH-domain-containing protein [Medicago truncatula]
 gb|AET00590.1| calcium-binding EF hand protein [Medicago truncatula]
Length=543

 Score =   350 bits (898),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 217/302 (72%), Gaps = 29/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME    P  SCSK+ Q ++Q WFN ADSDGDGR+TGNDATK F MS+LS+  LKQVWA+A
Sbjct  1    MEFDPIPIGSCSKDHQNIYQQWFNHADSDGDGRITGNDATKFFAMSNLSRQHLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF  AMQL+SLAQ G  +  DLLN       + PP ++ LDALL     
Sbjct  61   DSKRQGYLGFQEFIIAMQLVSLAQSGHPITHDLLNSDVDLKNLKPPILEGLDALL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       +  +   S+ D NG++ L+P P +       + K+             L
Sbjct  116  -----------AKKKHKQSELDVNGSSQLQPSPSSSWFSSKSTKKV------------PL  152

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  153  SSVTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  212

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLKCSYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  213  KHLLKCSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSK  272

Query  8    FE  3
            FE
Sbjct  273  FE  274



>emb|CAN67909.1| hypothetical protein VITISV_034695 [Vitis vinifera]
Length=546

 Score =   350 bits (897),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/301 (59%), Positives = 212/301 (70%), Gaps = 24/301 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI SGP +SCSK+ Q ++Q+WFNFADSD DGR+TGNDA K F MS+L +P LKQVWA+A
Sbjct  1    MEIDSGPISSCSKQNQMIYQEWFNFADSDSDGRITGNDAIKFFXMSNLPRPDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            D+KRQGFLG  EF TAMQL+SLAQ G  +  DLL+  +    S   +K++          
Sbjct  61   DTKRQGFLGXKEFITAMQLVSLAQAGHAITQDLLH--SEGKHSDLFIKNI----------  108

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                     +       S PD NG         N  +    +  + +       +Q  L+
Sbjct  109  --------XKKKRAHKTSDPDINGKKFXIFNNNNTII----AFILLAQVHCLAMMQVPLS  156

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGLKRLY  KLKPLEVTYRFNDF SP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  157  SVTSIIDGLKRLYIQKLKPLEVTYRFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  216

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMP++GL+TFG AFLSKF
Sbjct  217  HLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPYSGLTTFGTAFLSKF  276

Query  5    E  3
            E
Sbjct  277  E  277



>ref|XP_004951833.1| PREDICTED: EH domain-containing protein 1-like [Setaria italica]
Length=597

 Score =   351 bits (901),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 182/303 (60%), Positives = 212/303 (70%), Gaps = 25/303 (8%)
 Frame = -3

Query  908  DMEIA-SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWA  732
            +MEIA +    +CSKE Q+++ +WF  AD DGDGRVTG DAT  F MS LS+  LKQVWA
Sbjct  50   EMEIARAAAGVACSKEHQRIYAEWFALADPDGDGRVTGADATSFFVMSGLSRADLKQVWA  109

Query  731  LADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasan  552
            +ADSKRQG+LG  EF TAMQL+SLAQ G E+  D LN +  + + PP M+ +D L+    
Sbjct  110  IADSKRQGYLGFAEFVTAMQLVSLAQAGNEITQDSLNREDLSTLDPPVMEGVDELV----  165

Query  551  gsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
                        S        P+ NGT  ++            SI  +    S +K Q  
Sbjct  166  ----------ARSKAVVKRVHPEDNGTPQVQAS----------SIYHWFGSKSAQKAQMP  205

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            LTAVTSVIDGLKRLY  KLKPLEV YRFNDF SP+LT SDFDAKPM+MLLGQYSTGKTTF
Sbjct  206  LTAVTSVIDGLKRLYLEKLKPLEVAYRFNDFASPLLTSSDFDAKPMVMLLGQYSTGKTTF  265

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            IKHLLK SYPGAH+GPEPTTDRF+VV SGPD R+IPGNT+AV ADMPFTGL+TFGGAFLS
Sbjct  266  IKHLLKTSYPGAHVGPEPTTDRFVVVMSGPDGRTIPGNTIAVQADMPFTGLTTFGGAFLS  325

Query  11   KFE  3
            KFE
Sbjct  326  KFE  328



>ref|XP_011095452.1| PREDICTED: EH domain-containing protein 1-like [Sesamum indicum]
Length=544

 Score =   350 bits (897),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 219/303 (72%), Gaps = 30/303 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S P + CSKE QK++QDWF+FADSDGDGR+TG DA K F MS+L +  LK VWA+A
Sbjct  1    MEIDSAPISRCSKEHQKIYQDWFSFADSDGDGRLTGGDAIKFFAMSNLPRQDLKLVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF TAMQL+SLAQ G  LNSD+L  +     + PP M+ LDALLA    
Sbjct  61   DSKRQGFLGFKEFITAMQLVSLAQAGHALNSDILTSEVDFENLQPPAMEGLDALLAKKKR  120

Query  548  sspnssgsLTESPPQTNGS-KPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
                       S P+ NGS +P +                   S       SS+   + S
Sbjct  121  ---------VSSEPEQNGSVQPQS-------------------SPAASWFSSSKSAKKVS  152

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            L++VTS+IDGLK+LY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTF
Sbjct  153  LSSVTSIIDGLKKLYVQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTF  212

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            IKHLL+ SYPGAHIGPEPTTDRF+VV +GPDERSIPGNTVAV ADMPF+GL+TFG AFLS
Sbjct  213  IKHLLRTSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTVAVQADMPFSGLTTFGTAFLS  272

Query  11   KFE  3
            KFE
Sbjct  273  KFE  275



>ref|XP_002531194.1| EH-domain-containing protein, putative [Ricinus communis]
 gb|EEF31171.1| EH-domain-containing protein, putative [Ricinus communis]
Length=550

 Score =   350 bits (897),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 191/303 (63%), Positives = 221/303 (73%), Gaps = 24/303 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI++GP  SCSKE QK++ +WF FADSDGDGR+TGNDA K FGMS+LS+  LKQVWA+A
Sbjct  1    MEISAGPVGSCSKENQKIYLEWFAFADSDGDGRITGNDAIKFFGMSNLSRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            +SKRQG+LG NEF T+MQLISLAQ G ++  DLL+ +     + PPTM+ LD LL     
Sbjct  61   NSKRQGYLGFNEFITSMQLISLAQAGHQIAHDLLSSQVDFENLRPPTMEGLDELLEQKKR  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMF-SSRSSRKKVQPS  372
                S                D NGT          P+   PS+  F    SS+   +  
Sbjct  121  RRSRSRDF-------------DVNGTP---------PVETSPSVNWFSPKSSSKSSKKVP  158

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            L++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTF
Sbjct  159  LSSVTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTF  218

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            IKHLLK SYPGAHIGPEPTTDRF+VV SG DERSIPGNTVAV ADMPF GL+TFG AFLS
Sbjct  219  IKHLLKSSYPGAHIGPEPTTDRFVVVMSGTDERSIPGNTVAVQADMPFNGLTTFGTAFLS  278

Query  11   KFE  3
            KFE
Sbjct  279  KFE  281



>ref|XP_003594167.1| EH-domain-containing protein [Medicago truncatula]
 gb|AES64418.1| calcium-binding EF hand protein [Medicago truncatula]
Length=540

 Score =   349 bits (896),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 182/292 (62%), Positives = 217/292 (74%), Gaps = 29/292 (10%)
 Frame = -3

Query  872  SKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGIN  693
            SKE+   +Q WFN ADSDGDGR++GN+ATK F +S+LS+ QLKQ+WALAD+KRQGFLG +
Sbjct  7    SKEETATYQQWFNLADSDGDGRISGNEATKFFALSNLSRSQLKQLWALADNKRQGFLGFS  66

Query  692  EFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgsLTE  516
            EF TAMQL+SLAQ G ELNSD+L ++     V PP ++ LD L+A     +         
Sbjct  67   EFVTAMQLVSLAQAGYELNSDILKIQMDKENVKPPVIEGLDTLVAQTKKLTIT-------  119

Query  515  SPPQTN-GSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGL  339
            +P + N  SKP                         F+S+SS KK+ PS  AVTS++DGL
Sbjct  120  TPSEVNVTSKPQP-----------------FLPNSWFTSKSS-KKLPPS--AVTSIVDGL  159

Query  338  KRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPG  159
            KRLY  KLKPLEV YR+NDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIKHLLKC YPG
Sbjct  160  KRLYTEKLKPLEVAYRYNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLKCDYPG  219

Query  158  AHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            AHIGPEPTTDRF+VV SGPDERSIPGNT+AV+ADMPF GL+TFGG+FLSKFE
Sbjct  220  AHIGPEPTTDRFVVVMSGPDERSIPGNTIAVNADMPFNGLTTFGGSFLSKFE  271



>ref|XP_002453335.1| hypothetical protein SORBIDRAFT_04g004020 [Sorghum bicolor]
 gb|EES06311.1| hypothetical protein SORBIDRAFT_04g004020 [Sorghum bicolor]
Length=547

 Score =   349 bits (896),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 214/302 (71%), Gaps = 25/302 (8%)
 Frame = -3

Query  905  MEIA-SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            MEIA +    +CSKE Q+++ +WF  AD DGDGRVTG DAT  FGMS LS+  LKQVWA+
Sbjct  1    MEIARAAAGVACSKEHQRIYAEWFALADPDGDGRVTGADATSFFGMSALSRADLKQVWAI  60

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasang  549
            ADSKRQG+LG  EF TAMQL+SLAQ G E+  D L  +  + + PP M+ +D LL     
Sbjct  61   ADSKRQGYLGFAEFVTAMQLVSLAQAGNEITEDSLKREDLSTLDPPVMEGVDGLL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       S        PD NGT  ++   +            F S+++ +KVQ  L
Sbjct  116  ---------ARSKAVVKRIHPDDNGTAQVQAPSM---------YHWFGSKAA-QKVQMPL  156

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            TAVTSVIDGLKRLY  KLKPLEV YR+NDF SP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  157  TAVTSVIDGLKRLYVEKLKPLEVAYRYNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFI  216

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAH+GPEPTTDRF+VV SG D R+IPGNT+AV ADMPFTGL+TFGGAFLSK
Sbjct  217  KHLLKTSYPGAHVGPEPTTDRFVVVMSGSDGRTIPGNTIAVQADMPFTGLTTFGGAFLSK  276

Query  8    FE  3
            FE
Sbjct  277  FE  278



>ref|XP_010096102.1| EH domain-containing protein 1 [Morus notabilis]
 gb|EXB63267.1| EH domain-containing protein 1 [Morus notabilis]
Length=542

 Score =   349 bits (895),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 216/302 (72%), Gaps = 30/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEIAS P +SCSKE QK++Q+WF++ADSDGDGR+TGNDA K F MS+L +  LKQVWA+A
Sbjct  1    MEIASSPISSCSKEHQKIYQEWFSYADSDGDGRITGNDAIKFFAMSNLPRQDLKQVWAVA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF  AMQL+SLAQ G  +  DLLN       +  P M+ LD        
Sbjct  61   DSKRQGYLGFGEFVAAMQLVSLAQAGHGITHDLLNSNVDLENLKLPVMEGLD--------  112

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                  G L +       S+PD NG +          +   PS + FSS+SS K    SL
Sbjct  113  ------GLLAKKKRSQKTSEPDVNGGS---------IVEQSPSAQWFSSKSSTK---VSL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLE TYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIIDGLKRLYIKKLKPLEATYRFNDFVSPALTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+     AHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLRSR---AHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSK  271

Query  8    FE  3
            FE
Sbjct  272  FE  273



>ref|XP_009398680.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   348 bits (894),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 216/301 (72%), Gaps = 26/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M + S    SC KE+QK++Q+WF+ AD DGDGR+TGNDA K F MS LS+ +LKQVWA+A
Sbjct  1    MNLVSSSVASCPKEKQKIYQEWFSVADKDGDGRITGNDALKFFAMSKLSRSELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFL + EF  AMQL++LAQEG E+  DLLN      + PP M+ LD  LA +  S
Sbjct  61   DSKRQGFLDLQEFINAMQLVALAQEGHEMTPDLLNHADLENLKPPVMEGLDIRLAKSKRS  120

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
               S    ++ PPQ                           S + F+S+S++K   PS  
Sbjct  121  EKKSDPC-SDVPPQPQSP----------------------ASARWFNSKSAKK--IPS-K  154

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGLK+LY  KLKPLEVTY+F+DFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  155  SVTSIIDGLKKLYIEKLKPLEVTYQFSDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  214

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLLK SYPGAHIGPEPTTDRF+V+TSGPDERSIPGNT+AV ADMP+ GL+ FG  FLSKF
Sbjct  215  HLLKSSYPGAHIGPEPTTDRFVVITSGPDERSIPGNTIAVQADMPYNGLTAFGTGFLSKF  274

Query  5    E  3
            E
Sbjct  275  E  275



>gb|KDO62120.1| hypothetical protein CISIN_1g009050mg [Citrus sinensis]
Length=394

 Score =   343 bits (881),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 190/303 (63%), Positives = 225/303 (74%), Gaps = 29/303 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI +GP  SCSK+ QK++ +WFN+ADSDGDGR+TGNDATK F +S+LS+  LKQVWA+A
Sbjct  1    MEIGTGPIGSCSKDHQKIYLEWFNYADSDGDGRITGNDATKFFALSNLSRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            D+KRQG+LG  EF  AMQLISL Q+G ++  DL N       + PP M+ LD LLA+   
Sbjct  61   DAKRQGYLGYREFIAAMQLISLVQDGHQVTHDLWNSDVDFQNLKPPAMEGLDKLLANKRH  120

Query  548  sspnssgsLTESPPQTNGS-KPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
            SS         S P  NGS +P  +                 PS   FSS+SS+K    S
Sbjct  121  SSKT-------SDPNLNGSLQPQPS-----------------PSANWFSSKSSKKI---S  153

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            +++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTF
Sbjct  154  MSSVTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTF  213

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            IKHLL+ SYPGAHIGPEPTTDRF+VV SG D+RSIPGNTVAV ADMPF+GL+TFG AFLS
Sbjct  214  IKHLLRTSYPGAHIGPEPTTDRFVVVMSGVDDRSIPGNTVAVQADMPFSGLTTFGTAFLS  273

Query  11   KFE  3
            KFE
Sbjct  274  KFE  276



>ref|XP_009334827.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009334845.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Pyrus 
x bretschneideri]
Length=545

 Score =   348 bits (893),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 180/302 (60%), Positives = 219/302 (73%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S P +SCSK+ QK++Q+WF F DSD DGR+T +DA K FGMS+L++ +LKQVWA+A
Sbjct  1    MEICSVPISSCSKDHQKIYQEWFRFVDSDADGRITVSDAVKFFGMSNLNRKELKQVWAMA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG +EF  AMQL+SLAQ G ++   LLN     A + PP M+ LDALL     
Sbjct  61   DSKRQGYLGFSEFVAAMQLVSLAQAGHDITHGLLNSNVDLASLKPPVMEGLDALLLVNKK  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                          ++N +K   NGT   +            S   FS  SS+K     L
Sbjct  121  HLH-----------KSNENK--VNGTAVQQSP----------SALWFSPESSKK---IPL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTY+FN+FVSP++ +SDFDAKPM+MLLGQYSTGKTTF+
Sbjct  155  SSVTSIIDGLKRLYVQKLKPLEVTYKFNNFVSPLMKNSDFDAKPMVMLLGQYSTGKTTFV  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFG AFLS+
Sbjct  215  KHLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSR  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_008224739.1| PREDICTED: EH domain-containing protein 1-like [Prunus mume]
 ref|XP_008224740.1| PREDICTED: EH domain-containing protein 1-like [Prunus mume]
Length=537

 Score =   348 bits (892),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 216/297 (73%), Gaps = 31/297 (10%)
 Frame = -3

Query  890  GPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQ  711
            G  + C KE QK++Q+WFN  DSDGDGR+TGN+ATK F +S LS+ +LKQVWA AD KRQ
Sbjct  2    GTVSLCPKEYQKVYQEWFNLVDSDGDGRITGNEATKFFALSKLSRQELKQVWATADKKRQ  61

Query  710  GFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspns  534
            GFLG  EF TAMQLISLAQE  EL  D+L  +     ++PP M+ LDAL A    S+   
Sbjct  62   GFLGFTEFITAMQLISLAQE-HELTPDVLKTEVDWENINPPLMEGLDALSAKTKSST---  117

Query  533  sgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTS  354
                      TNG   + NG+   +P             + F S+S +K     L AVTS
Sbjct  118  ----------TNGL--EVNGSIQSQPPA-----------QWFGSKSVKKL---PLIAVTS  151

Query  353  VIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLK  174
            + DGLKRLYN KLKPLE+TYRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFIKHLL+
Sbjct  152  ITDGLKRLYNEKLKPLELTYRFNDFVSPSLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLR  211

Query  173  CSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            C+YPGAHIGPEPTTDRF+ V SGPDERSIPGNT+AVHADMPF+GL+TFGGAFLSKFE
Sbjct  212  CNYPGAHIGPEPTTDRFVAVMSGPDERSIPGNTIAVHADMPFSGLATFGGAFLSKFE  268



>gb|EMT05303.1| EH domain-containing protein 1 [Aegilops tauschii]
Length=545

 Score =   348 bits (892),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 216/302 (72%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIA-SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            MEI    P +SCSKE QK+++DWF  ADSDGDGR+TG DA K F MS L +  LKQVWA+
Sbjct  1    MEIGGQHPASSCSKEHQKIYRDWFALADSDGDGRITGPDAIKFFAMSSLPRADLKQVWAI  60

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasang  549
            ADSKR G+LG  EF TAMQL+SLAQ G E++ D L  +     +PP M+ LDA LA +  
Sbjct  61   ADSKRLGYLGFGEFITAMQLVSLAQAGNEISQDSLQREDLISFNPPVMEGLDAQLAKSKH  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
             +        +  PQ  G  P TN                      F+S+SS+K     L
Sbjct  121  LAKRVDQD-MDGFPQAQG--PSTN--------------------HWFNSKSSKKI---PL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            TAVTSVIDGLKRLY  KLKPLEVTY+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  TAVTSVIDGLKRLYIEKLKPLEVTYKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDER+IPGNT+AV ADMPF+GL+TFG +FLSK
Sbjct  215  KHLLKTSYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTLAVQADMPFSGLTTFGTSFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>dbj|BAJ95881.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   348 bits (892),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 218/302 (72%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIA-SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            MEI    P +SCSKE QK+++DWF  ADSDGDGR+TG DA + F MS L +  LKQVWA+
Sbjct  1    MEIGGQHPASSCSKEHQKIYRDWFALADSDGDGRITGPDAIRFFAMSSLPRADLKQVWAI  60

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasang  549
            ADSKR G+LG +EF TAMQL+SLAQ G E++ D L  +     +PP M+ LDALLA +  
Sbjct  61   ADSKRLGYLGFSEFITAMQLVSLAQSGNEISQDSLQREDLISFNPPVMEGLDALLAKSKH  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
             +        +  PQ  G  P TN                      F+S+SS+K     L
Sbjct  121  LAKRVDHD-MDGFPQAQG--PSTN--------------------HWFNSKSSKKI---PL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            TAVTSVIDGLKRLY  KLKPLEVTY+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  TAVTSVIDGLKRLYIEKLKPLEVTYKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDER+IPGNT+AV ADMPF+GL+TFG +FLSK
Sbjct  215  KHLLKTSYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTLAVQADMPFSGLTTFGTSFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_003547274.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
 gb|KHN32982.1| EH domain-containing protein 1 [Glycine soja]
Length=539

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 218/294 (74%), Gaps = 30/294 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            S SKE+ K +Q+WF+ ADSDGDGR++GNDAT  F +S+LS+ QLKQ+WALAD KRQGFLG
Sbjct  5    SRSKEETKTYQEWFDLADSDGDGRISGNDATNFFALSNLSRSQLKQLWALADVKRQGFLG  64

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgsL  522
              EF TAMQL+SLAQ G ELNSD+L  +     + PP +  L+AL+A  + +        
Sbjct  65   FTEFVTAMQLVSLAQAGHELNSDILKTQIDKENIKPPVLDGLEALVAQKSLA--------  116

Query  521  TESPPQTNGS-KPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVID  345
              +PP+ NG+ +P    T                  + F S+SS+K    SL +VTS+ID
Sbjct  117  ISAPPEVNGTPQPQVFPTN-----------------RWFGSKSSKKL---SLNSVTSIID  156

Query  344  GLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSY  165
            GLKRLY  +LKPLEV Y++NDFVSP+LT++DFDAKPM+MLLGQYSTGKTTFIKHLLKC Y
Sbjct  157  GLKRLYIERLKPLEVAYQYNDFVSPLLTNTDFDAKPMVMLLGQYSTGKTTFIKHLLKCDY  216

Query  164  PGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PGAH+GPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF GL+TFGG+FLSKF+
Sbjct  217  PGAHVGPEPTTDRFVVVMSGPDERSIPGNTIAVDADMPFGGLTTFGGSFLSKFQ  270



>ref|XP_009352442.1| PREDICTED: EH domain-containing protein 1-like [Pyrus x bretschneideri]
Length=550

 Score =   348 bits (892),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 180/302 (60%), Positives = 218/302 (72%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S P +SCSK+ QK++Q+WF F DSD DGR+T +DA K FGMS+L++ +LKQVWA+A
Sbjct  1    MEICSVPISSCSKDHQKIYQEWFRFVDSDADGRITVSDAVKFFGMSNLNRKELKQVWAMA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG +EF  AMQL+SLAQ G ++   LLN     A + PP M  LDALL     
Sbjct  61   DSKRQGYLGFSEFVAAMQLVSLAQAGHDITHGLLNSNVDLASLKPPVMDGLDALLLVNKK  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                          ++N +K   NGT   +            S   FS  SS+K     L
Sbjct  121  HLH-----------KSNENK--VNGTAVQQSP----------SALWFSPESSKK---IPL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTY+FN+FVSP++ +SDFDAKPM+MLLGQYSTGKTTF+
Sbjct  155  SSVTSIIDGLKRLYVQKLKPLEVTYKFNNFVSPLMKNSDFDAKPMVMLLGQYSTGKTTFV  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFG AFLS+
Sbjct  215  KHLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSR  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_010252585.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=536

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 211/302 (70%), Gaps = 37/302 (12%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+I SGP  SCSKE QK++QDWFN+ADSDGDGR+TGNDATK   MS LS+ +LK+VWA+A
Sbjct  2    MDIVSGPIGSCSKEHQKIYQDWFNYADSDGDGRLTGNDATKFLAMSKLSRSELKEVWAIA  61

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF TAMQLI+LAQ G E+  DLL+       ++PP M+ L         
Sbjct  62   DSKRQGFLGFKEFITAMQLIALAQAGHEITLDLLSSGIDLENLNPPVMEGL---------  112

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                    + ++P +    K +                        FSS  S KK+   L
Sbjct  113  --TILMAKIKQAPKKPESEKAN-----------------------WFSSSRSSKKL--FL  145

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
             +VTS++DGLK+LY  KLKPLEVTY FNDFVSP+LT+SDFDA+PM+MLLGQYSTGKTTFI
Sbjct  146  NSVTSIVDGLKKLYTEKLKPLEVTYHFNDFVSPLLTNSDFDARPMVMLLGQYSTGKTTFI  205

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
             HLLK SYPGAHIGPEPTTDRF+VV SG DERSIPGNT+AV ADMPF GL+TFG  FLSK
Sbjct  206  THLLKSSYPGAHIGPEPTTDRFVVVMSGHDERSIPGNTIAVQADMPFGGLTTFGTTFLSK  265

Query  8    FE  3
            F+
Sbjct  266  FQ  267



>ref|XP_006657273.1| PREDICTED: EH domain-containing protein 1-like [Oryza brachyantha]
Length=545

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 183/302 (61%), Positives = 219/302 (73%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTS-CSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            MEI   P +   SKE QK +Q+WF FADSDGDGR+TG DA K F MS L +  LKQVWA+
Sbjct  1    MEIGQNPASGGYSKEHQKTYQEWFAFADSDGDGRITGPDAIKFFAMSKLPRADLKQVWAI  60

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasang  549
            ADSKRQG+LG +EF TAMQL++LAQ G+E++ D L  +    ++PPTM  L+ALL     
Sbjct  61   ADSKRQGYLGFSEFVTAMQLVALAQVGDEISQDSLKREDLGNLNPPTMDGLEALL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S        PD++G    +    +         + FSS+SS+K     L
Sbjct  116  ---------MKSKHHAKRVDPDSDGFPQAQSSATS---------QWFSSKSSKKI---PL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            TAVTSVIDGLK+LY  KLKPLEVTY+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  TAVTSVIDGLKKLYIEKLKPLEVTYKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+ SYPGAHIGPEPTTDRF+VV SGPDER+IPGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLRTSYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>gb|EMS68080.1| EH domain-containing protein 1 [Triticum urartu]
Length=545

 Score =   347 bits (890),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 216/302 (72%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIA-SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            MEI    P +SCSKE QK+++DWF  ADSDGDGR+TG DA + F MS L +  LKQVWA+
Sbjct  1    MEIGGQHPASSCSKEHQKIYRDWFALADSDGDGRITGPDAIRFFAMSSLPRADLKQVWAI  60

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasang  549
            ADSKR G+LG  EF TAMQL+SLAQ G E++ D L  +     +PP M+ LDA LA +  
Sbjct  61   ADSKRLGYLGFGEFITAMQLVSLAQAGNEISQDSLQREDLISFNPPVMEGLDAQLAKSKH  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
             +        +  PQ  G  P TN                      F+S+SS+K     L
Sbjct  121  LAKRVDQD-MDGFPQAQG--PSTN--------------------HWFNSKSSKKI---PL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            TAVTSVIDGLKRLY  KLKPLEVTY+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  TAVTSVIDGLKRLYIEKLKPLEVTYKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDER+IPGNT+AV ADMPF+GL+TFG +FLSK
Sbjct  215  KHLLKTSYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTLAVQADMPFSGLTTFGTSFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>dbj|BAJ86819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=547

 Score =   347 bits (889),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 211/302 (70%), Gaps = 25/302 (8%)
 Frame = -3

Query  905  MEIA-SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            MEIA S     CSKE Q+++ DWF  AD DGDGRVTG DATK F MS LS+  LKQVWA+
Sbjct  1    MEIARSVASLGCSKEHQRIYADWFALADPDGDGRVTGADATKFFAMSGLSRADLKQVWAI  60

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasang  549
            ADSKRQG+LG  EF  AMQL+SLAQ G E+  D L  +  +   PP MK LD LL     
Sbjct  61   ADSKRQGYLGFGEFAAAMQLVSLAQAGNEITQDSLKREDLSSFDPPVMKGLDELL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       S    N  +P  NGT+ ++            S   + S  S KK+Q  L
Sbjct  116  ---------ARSMAIVNVVRPQENGTSQVQAP----------STNSWFSSKSSKKIQTPL  156

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            TAVTSVIDGLKRLY  KLKPLEV YRFNDF SP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  157  TAVTSVIDGLKRLYIEKLKPLEVAYRFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFI  216

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK ++PGAHIGPEPTTDRF+VV SG DER++PGNT+AV ADMPF GL+TFGGAFLSK
Sbjct  217  KHLLKTNFPGAHIGPEPTTDRFVVVMSGSDERTVPGNTIAVQADMPFNGLTTFGGAFLSK  276

Query  8    FE  3
            FE
Sbjct  277  FE  278



>ref|XP_009598339.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=541

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 180/302 (60%), Positives = 211/302 (70%), Gaps = 26/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSKE +K++Q+WFNFADSDGDGR+TG DATK F MS+L +P+LKQVWA+A
Sbjct  1    MEFDTSPINRCSKEHEKIYQEWFNFADSDGDGRLTGGDATKFFAMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFL   EF  AMQL+SLAQ G  + +DLLN       + PP M+ LD  LA    
Sbjct  61   DSKRQGFLSFREFVIAMQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAQKKK  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S P  NGS P  +                          SS+   + SL
Sbjct  121  PM-------PKSEPDQNGSAPVPSAPATS------------------WFSSSKSAKKVSL  155

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            T+VTS++DGLK+LY  KLKPLEV Y FNDFVSP+L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  156  TSVTSIVDGLKKLYIQKLKPLEVAYHFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFI  215

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  216  KHLLKTSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSK  275

Query  8    FE  3
            FE
Sbjct  276  FE  277



>ref|XP_002437485.1| hypothetical protein SORBIDRAFT_10g027960 [Sorghum bicolor]
 gb|EER88852.1| hypothetical protein SORBIDRAFT_10g027960 [Sorghum bicolor]
Length=544

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 218/301 (72%), Gaps = 26/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI   P +SCSKE QK++Q+WF  AD+DGDGR+TG DA K FGMS LS+P LKQVWA++
Sbjct  1    MEIGQYPVSSCSKEHQKIYQEWFALADADGDGRITGPDAIKFFGMSKLSRPDLKQVWAIS  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            D++RQG+LG  EF TAMQL+SLAQ G E+  D L       ++PP M+ LDALLA +   
Sbjct  61   DTRRQGYLGFPEFVTAMQLVSLAQAGNEITQDSLKRDDLISLNPPVMEGLDALLAKSKHL  120

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                        P+ +G   + +  T                 K FSS+SS    +  LT
Sbjct  121  VKRVD-------PEMDGYPQEQSTLTN----------------KWFSSKSS---KKIPLT  154

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            AVTSVIDGLK+LY  KLKPLEVTY+FNDFVSP+LT SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  155  AVTSVIDGLKKLYIEKLKPLEVTYKFNDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIK  214

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRF+VV SGPDER+IPGNT+AV ADMPF+GL+TFG AFLSKF
Sbjct  215  HLLRTSYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVQADMPFSGLTTFGTAFLSKF  274

Query  5    E  3
            E
Sbjct  275  E  275



>ref|XP_009598337.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=546

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 180/302 (60%), Positives = 211/302 (70%), Gaps = 26/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSKE +K++Q+WFNFADSDGDGR+TG DATK F MS+L +P+LKQVWA+A
Sbjct  1    MEFDTSPINRCSKEHEKIYQEWFNFADSDGDGRLTGGDATKFFAMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFL   EF  AMQL+SLAQ G  + +DLLN       + PP M+ LD  LA    
Sbjct  61   DSKRQGFLSFREFVIAMQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAQKKK  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S P  NGS P  +                          SS+   + SL
Sbjct  121  PM-------PKSEPDQNGSAPVPSAPATS------------------WFSSSKSAKKVSL  155

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            T+VTS++DGLK+LY  KLKPLEV Y FNDFVSP+L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  156  TSVTSIVDGLKKLYIQKLKPLEVAYHFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFI  215

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  216  KHLLKTSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSK  275

Query  8    FE  3
            FE
Sbjct  276  FE  277



>ref|XP_009393691.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   346 bits (888),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 214/295 (73%), Gaps = 25/295 (8%)
 Frame = -3

Query  887  PFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQG  708
            P  S SKEQ +++ +WF+FADSDGDGR+TGNDA K F +S+LS+P LKQ+WA+ADSKRQG
Sbjct  4    PSYSTSKEQARIYNEWFSFADSDGDGRITGNDAIKFFSLSNLSRPDLKQIWAIADSKRQG  63

Query  707  FLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssg  528
            FLG  EF TAMQL++LAQ G E+  D L       ++PP M+ LD LL+    S+     
Sbjct  64   FLGFGEFVTAMQLVALAQAGNEITQDTLANADLEKLNPPVMEGLDTLLSRNKASTKKI--  121

Query  527  sLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVI  348
                 P     SKP    +T                ++ FSS+S++K     L+ VTS+I
Sbjct  122  ----DPEIDVNSKPQNPPST----------------VQWFSSKSAKKI---PLSQVTSII  158

Query  347  DGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCS  168
            DGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIKHLLK S
Sbjct  159  DGLKRLYVEKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLKTS  218

Query  167  YPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            YPGAHIGPEPTTDRF+VV SGPDER+IPGNT+AV ADM F+GL+ FG AFLSKFE
Sbjct  219  YPGAHIGPEPTTDRFVVVMSGPDERTIPGNTIAVQADMAFSGLTMFGTAFLSKFE  273



>ref|XP_009598338.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score =   346 bits (888),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 180/302 (60%), Positives = 211/302 (70%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSKE +K++Q+WFNFADSDGDGR+TG DATK F MS+L +P+LKQVWA+A
Sbjct  1    MEFDTSPINRCSKEHEKIYQEWFNFADSDGDGRLTGGDATKFFAMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFL   EF  AMQL+SLAQ G  + +DLLN       + PP M+ LD  LA    
Sbjct  61   DSKRQGFLSFREFVIAMQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAKKKP  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S P  NGS P  +                          SS+   + SL
Sbjct  121  M--------PKSEPDQNGSAPVPSAPATS------------------WFSSSKSAKKVSL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            T+VTS++DGLK+LY  KLKPLEV Y FNDFVSP+L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  TSVTSIVDGLKKLYIQKLKPLEVAYHFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLKTSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_002316591.2| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEE97203.2| calcium-binding EF hand family protein [Populus trichocarpa]
Length=525

 Score =   345 bits (886),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 211/303 (70%), Gaps = 52/303 (17%)
 Frame = -3

Query  902  EIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALAD  723
            EI     +S SKEQQ+++++WFN ADSDGDGR TGNDATK F MS+LS+ QLKQVWALAD
Sbjct  3    EIGKSAGSSFSKEQQQIYKEWFNLADSDGDGRFTGNDATKFFAMSNLSRQQLKQVWALAD  62

Query  722  SKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAG---VSPPTMKDLDallasan  552
            SKRQGFLG+ EF TAMQL+SLAQ G EL  D   +KTA+    V PP M  +DALLA   
Sbjct  63   SKRQGFLGLTEFVTAMQLVSLAQAGHELTPD--TIKTASKMEDVKPPLMDGIDALLA---  117

Query  551  gsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
                          PQ                                 ++SSRK     
Sbjct  118  ----------VSGTPQV-------------------------------GAKSSRKM---P  133

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            L AVTS+IDGLKRLY  KLKPLE TY FNDFVSP+LT+SDFDA+PM+MLLGQYSTGKTTF
Sbjct  134  LNAVTSIIDGLKRLYIEKLKPLEATYHFNDFVSPLLTNSDFDARPMVMLLGQYSTGKTTF  193

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            IKHLL+C+YPGAHIGPEPTTDRF+VV SG DERSIPGNTVAV ADMPF+GL+ FGGAFLS
Sbjct  194  IKHLLRCNYPGAHIGPEPTTDRFVVVMSGHDERSIPGNTVAVQADMPFSGLTHFGGAFLS  253

Query  11   KFE  3
            KFE
Sbjct  254  KFE  256



>gb|KHN28769.1| EH domain-containing protein 1 [Glycine soja]
Length=822

 Score =   353 bits (907),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 181/302 (60%), Positives = 223/302 (74%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+  S    SCSKEQ K +QDWFN ADSDGDGR+TGNDATK   +S+LS+ QLKQVWA+A
Sbjct  278  MKTVSDWIDSCSKEQLKTYQDWFNLADSDGDGRITGNDATKFSALSNLSRSQLKQVWAIA  337

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            D+KRQG+LG  EF  AMQL++LAQ G ++NSD+L  +     +  P M+ LDAL+     
Sbjct  338  DAKRQGYLGFQEFVMAMQLVALAQVGHDINSDILKTEIDKENIKSPVMEGLDALI-----  392

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      ++   T  ++PD  GT   +P+           +  +++  S KK+   L
Sbjct  393  ---------AKTKSLTVNAQPDVFGTAIPQPL----------PLNSWAAPKSVKKL--PL  431

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS+IDGLKRLY  +LKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  432  SAVTSIIDGLKRLYVERLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  491

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFGG+FLSK
Sbjct  492  KHLLRCDYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVDADMPFSGLTTFGGSFLSK  551

Query  8    FE  3
            F+
Sbjct  552  FQ  553



>ref|NP_974517.1| EPS15 homology domain 2 protein [Arabidopsis thaliana]
 gb|AEE82530.1| EPS15 homology domain 2 protein [Arabidopsis thaliana]
Length=545

 Score =   345 bits (886),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 175/293 (60%), Positives = 207/293 (71%), Gaps = 29/293 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            SC KE QK++++WFN ADSDGDGRV+GNDATK F MS LS+ +LKQVWA+ADSKRQGFLG
Sbjct  11   SCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLG  70

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgsL  522
            ++EF TAM+L+SLAQEG E+ SDLL        V  P ++ L+ +++    S  N     
Sbjct  71   LSEFITAMKLVSLAQEGHEITSDLLKGSIDMKSVELPVLEGLENVVSKQKVSKTNVDVED  130

Query  521  TESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDG  342
              + PQ     P                         F S+S    ++P +  VT ++DG
Sbjct  131  NVTKPQVTAKTP------------------------WFKSKSI---IKPQVNVVT-IVDG  162

Query  341  LKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYP  162
            LKRLY  KLKPLEVTYRFNDF SPVLT SDFDAKPM+MLLGQYSTGKTTFIKHLL C YP
Sbjct  163  LKRLYTEKLKPLEVTYRFNDFASPVLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLGCDYP  222

Query  161  GAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            GAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  223  GAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  275



>ref|XP_006646902.1| PREDICTED: EH domain-containing protein 1-like [Oryza brachyantha]
Length=542

 Score =   345 bits (886),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 182/301 (60%), Positives = 212/301 (70%), Gaps = 28/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME+A    + CSKE Q+++  WF  AD DGDGRVTG DAT+ F MS LS+  LKQVWA+A
Sbjct  1    MELAR---SCCSKEHQRIYAGWFAVADPDGDGRVTGADATRFFAMSGLSRADLKQVWAIA  57

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            D++RQGFLG  EF  AMQL+SLAQ G E+  D L  +  + + PP M  LD LLA +   
Sbjct  58   DTRRQGFLGFGEFVAAMQLVSLAQAGNEITQDSLKREDLSSLDPPVMAGLDELLARSKA-  116

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                               P+ NGT  ++    N           FSS+S+ KK+Q  LT
Sbjct  117  --------------VKRVHPEENGTPQVQVPSANS---------WFSSKSA-KKMQDPLT  152

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            AVTSVIDGLKRLY  KLKPLEV YRFNDF SP+LT SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  153  AVTSVIDGLKRLYIEKLKPLEVAYRFNDFASPLLTSSDFDAKPMVMLLGQYSTGKTTFIK  212

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAH+GPEPTTDRF+VV SG DER+IPGNT+AV ADMPFTGL+TFGGAFLSKF
Sbjct  213  HLLQTSYPGAHVGPEPTTDRFVVVMSGSDERTIPGNTIAVQADMPFTGLTTFGGAFLSKF  272

Query  5    E  3
            E
Sbjct  273  E  273



>ref|XP_009776639.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Nicotiana 
sylvestris]
Length=545

 Score =   345 bits (886),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 210/302 (70%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSKE +K++Q+WFNFADSDGDGR+TG DATK F MS+L +P+LKQVWA+A
Sbjct  1    MEFDTSPINRCSKEHEKIYQEWFNFADSDGDGRLTGGDATKFFAMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFL   EF  AMQL+SLAQ G  + +DLLN       + PP M+ LD  LA    
Sbjct  61   DSKRQGFLSFREFVIAMQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAKKKP  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S P  NGS P                             SS+   + SL
Sbjct  121  M--------PKSEPDQNGSAPVPTAPATS------------------WFSSSKSAKKVSL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            T+VTS++DGLK+LY  KLKPLE+ Y FNDFVSP+L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  TSVTSIVDGLKKLYIQKLKPLEIAYHFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLKTSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_009776640.1| PREDICTED: EH domain-containing protein 1 isoform X3 [Nicotiana 
sylvestris]
Length=541

 Score =   345 bits (885),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 210/302 (70%), Gaps = 26/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSKE +K++Q+WFNFADSDGDGR+TG DATK F MS+L +P+LKQVWA+A
Sbjct  1    MEFDTSPINRCSKEHEKIYQEWFNFADSDGDGRLTGGDATKFFAMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFL   EF  AMQL+SLAQ G  + +DLLN       + PP M+ LD  LA    
Sbjct  61   DSKRQGFLSFREFVIAMQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAKKKK  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S P  NGS P                             SS+   + SL
Sbjct  121  PM-------PKSEPDQNGSAPVPTAPATS------------------WFSSSKSAKKVSL  155

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            T+VTS++DGLK+LY  KLKPLE+ Y FNDFVSP+L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  156  TSVTSIVDGLKKLYIQKLKPLEIAYHFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFI  215

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  216  KHLLKTSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSK  275

Query  8    FE  3
            FE
Sbjct  276  FE  277



>ref|XP_009776638.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Nicotiana 
sylvestris]
Length=546

 Score =   345 bits (886),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 210/302 (70%), Gaps = 26/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSKE +K++Q+WFNFADSDGDGR+TG DATK F MS+L +P+LKQVWA+A
Sbjct  1    MEFDTSPINRCSKEHEKIYQEWFNFADSDGDGRLTGGDATKFFAMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFL   EF  AMQL+SLAQ G  + +DLLN       + PP M+ LD  LA    
Sbjct  61   DSKRQGFLSFREFVIAMQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAKKKK  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S P  NGS P                             SS+   + SL
Sbjct  121  PM-------PKSEPDQNGSAPVPTAPATS------------------WFSSSKSAKKVSL  155

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            T+VTS++DGLK+LY  KLKPLE+ Y FNDFVSP+L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  156  TSVTSIVDGLKKLYIQKLKPLEIAYHFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFI  215

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  216  KHLLKTSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSK  275

Query  8    FE  3
            FE
Sbjct  276  FE  277



>ref|XP_004486203.1| PREDICTED: EH domain-containing protein 1-like [Cicer arietinum]
Length=542

 Score =   345 bits (884),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 179/291 (62%), Positives = 214/291 (74%), Gaps = 25/291 (9%)
 Frame = -3

Query  872  SKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGIN  693
            SKE+   +Q+WFN ADSDGDGR++GNDATK F +S+LS+PQLKQ+WAL+D+KRQGFLG  
Sbjct  7    SKEETATYQEWFNLADSDGDGRISGNDATKFFALSNLSRPQLKQLWALSDTKRQGFLGFP  66

Query  692  EFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgsLTE  516
            EF TAMQL+SLAQ G ELNSD+L  +     V PP M+ LD L+A     +         
Sbjct  67   EFVTAMQLVSLAQAGYELNSDILQTQMDKENVQPPVMEGLDTLVAKTKSLT-------IS  119

Query  515  SPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLK  336
             PP+ N +      TT                   F+S+S   K  P   AVTS++DGLK
Sbjct  120  VPPEVNVTVQPQPFTTNS----------------WFTSKSKSSKKLPPY-AVTSIVDGLK  162

Query  335  RLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGA  156
            RLY  +LKPLEVTYR+NDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIKHLLKC YPGA
Sbjct  163  RLYIERLKPLEVTYRYNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLKCDYPGA  222

Query  155  HIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            H+GPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFGG+FLSKF+
Sbjct  223  HVGPEPTTDRFVVVMSGPDERSIPGNTIAVDADMPFSGLTTFGGSFLSKFQ  273



>ref|XP_004507655.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Cicer 
arietinum]
Length=542

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/302 (60%), Positives = 214/302 (71%), Gaps = 30/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+  S    SCS EQ+  +Q WFNFADSDGDGR++GNDATK F +S+LS+PQLKQVWA+A
Sbjct  1    MKTVSDWIGSCSNEQRNTYQQWFNFADSDGDGRISGNDATKFFALSNLSRPQLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            D+KR+GFLG  EF TAMQLIS+ Q G +LNSD+L  +     + PP M  +DAL+A    
Sbjct  61   DTKRKGFLGFEEFVTAMQLISVGQAGYDLNSDILKTEIDNENIKPPVMDGIDALVAK---  117

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                     TES      ++ D  GT                  + F   SS+   +  L
Sbjct  118  ---------TES--SAINAQSDEFGTGQP---------------RPFPPVSSKSVKKLPL  151

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
             AVTS+IDGLKRLY  +LKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  152  NAVTSIIDGLKRLYVDRLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  211

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+ V SG DERSIPGNT AV A MPF+GLSTFGG+FLSK
Sbjct  212  KHLLRCEYPGAHIGPEPTTDRFVAVMSGADERSIPGNTAAVDASMPFSGLSTFGGSFLSK  271

Query  8    FE  3
            F+
Sbjct  272  FQ  273



>ref|NP_001266688.1| EH-domain-containing protein 1 [Zea mays]
 gb|ACG43126.1| EH-domain-containing protein 1 [Zea mays]
Length=547

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 209/302 (69%), Gaps = 25/302 (8%)
 Frame = -3

Query  905  MEIA-SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            M+IA +    +C KE Q+++ +WF  AD DGDGRVTG DAT  F MS LS+  LKQVWA+
Sbjct  1    MDIARAAAGVACCKEHQRIYAEWFALADPDGDGRVTGADATSFFAMSALSRADLKQVWAI  60

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasang  549
            ADS+RQG+LG  EF TAMQL+SLAQ G E+  D L  +  + + PP M+ +D LL     
Sbjct  61   ADSRRQGYLGFAEFVTAMQLVSLAQAGNEITQDSLKREDLSTLDPPVMEGVDELL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       S        PD NGTT  +            SI  +    S +KVQ  L
Sbjct  116  ---------ARSKAVVKRVHPDDNGTTQAQAP----------SIYHWFGSKSAQKVQMPL  156

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            TAVTSVIDGLKRLY  KLKPLEV YR+NDF  P+LT+SDF+AKPM+MLLGQYSTGKTTFI
Sbjct  157  TAVTSVIDGLKRLYVEKLKPLEVAYRYNDFSHPLLTNSDFEAKPMVMLLGQYSTGKTTFI  216

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAH+GPEPTTDRF+VV SG D R+IPGNT+AV ADMPFTGL+TFGGAFLSK
Sbjct  217  KHLLKTSYPGAHVGPEPTTDRFVVVMSGSDGRTIPGNTIAVQADMPFTGLTTFGGAFLSK  276

Query  8    FE  3
            FE
Sbjct  277  FE  278



>ref|NP_001140588.1| uncharacterized protein LOC100272658 [Zea mays]
 gb|ACF84132.1| unknown [Zea mays]
 gb|AFW66483.1| EH-domain-containing protein 1 [Zea mays]
Length=547

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 209/302 (69%), Gaps = 25/302 (8%)
 Frame = -3

Query  905  MEIA-SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            M+IA +    +C KE Q+++ +WF  AD DGDGRVTG DAT  F MS LS+  LKQVWA+
Sbjct  1    MDIARAAAGVACCKEHQRIYAEWFALADPDGDGRVTGADATSFFAMSALSRADLKQVWAI  60

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasang  549
            ADS+RQG+LG  EF TAMQL+SLAQ G E+  D L  +  + + PP M+ +D LL     
Sbjct  61   ADSRRQGYLGFAEFVTAMQLVSLAQAGNEITQDSLKREDLSTLDPPVMEGVDELL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       S        PD NGTT  +            SI  +    S +KVQ  L
Sbjct  116  ---------ARSKAVVKRVHPDDNGTTQAQAP----------SIYHWFGSKSAQKVQMPL  156

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            TAVTSVIDGLKRLY  KLKPLEV YR+NDF  P+LT+SDF+AKPM+MLLGQYSTGKTTFI
Sbjct  157  TAVTSVIDGLKRLYVEKLKPLEVAYRYNDFSHPLLTNSDFEAKPMVMLLGQYSTGKTTFI  216

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAH+GPEPTTDRF+VV SG D R+IPGNT+AV ADMPFTGL+TFGGAFLSK
Sbjct  217  KHLLKTSYPGAHVGPEPTTDRFVVVMSGSDGRTIPGNTIAVQADMPFTGLTTFGGAFLSK  276

Query  8    FE  3
            FE
Sbjct  277  FE  278



>ref|XP_004507654.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Cicer 
arietinum]
Length=567

 Score =   345 bits (884),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 181/302 (60%), Positives = 214/302 (71%), Gaps = 30/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+  S    SCS EQ+  +Q WFNFADSDGDGR++GNDATK F +S+LS+PQLKQVWA+A
Sbjct  1    MKTVSDWIGSCSNEQRNTYQQWFNFADSDGDGRISGNDATKFFALSNLSRPQLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            D+KR+GFLG  EF TAMQLIS+ Q G +LNSD+L  +     + PP M  +DAL+A    
Sbjct  61   DTKRKGFLGFEEFVTAMQLISVGQAGYDLNSDILKTEIDNENIKPPVMDGIDALVAK---  117

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                     TES      ++ D  GT                  + F   SS+   +  L
Sbjct  118  ---------TES--SAINAQSDEFGTGQP---------------RPFPPVSSKSVKKLPL  151

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
             AVTS+IDGLKRLY  +LKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  152  NAVTSIIDGLKRLYVDRLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  211

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+ V SG DERSIPGNT AV A MPF+GLSTFGG+FLSK
Sbjct  212  KHLLRCEYPGAHIGPEPTTDRFVAVMSGADERSIPGNTAAVDASMPFSGLSTFGGSFLSK  271

Query  8    FE  3
            F+
Sbjct  272  FQ  273



>ref|XP_003563453.1| PREDICTED: EH domain-containing protein 1-like [Brachypodium 
distachyon]
Length=545

 Score =   344 bits (882),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 184/302 (61%), Positives = 214/302 (71%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASG-PFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            MEI    P +SCSKE QK++Q+WF FADSDGDGR+TG DA K F MS L +  LKQVWA+
Sbjct  1    MEIGGQYPGSSCSKEHQKIYQEWFAFADSDGDGRITGPDAIKFFAMSKLPRADLKQVWAI  60

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasang  549
            ADSKR G+LG  EF TAMQL+SLAQ G E+  D L     + ++PP  + LD LLA +  
Sbjct  61   ADSKRLGYLGFGEFVTAMQLVSLAQAGNEITQDSLKRDDLSSLNPPVTEGLDVLLAKSKH  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
             +      +   P       P TN                      FSS+SS+K     L
Sbjct  121  LAKRVDPDIDGFP---QAQPPSTN--------------------HWFSSKSSKKI---PL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            TAVTSVIDGLK+LY  KLKPLEVTY+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  TAVTSVIDGLKKLYVEKLKPLEVTYKFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDER+IPGNT+AV ADMPF+GL+TFG +FLSK
Sbjct  215  KHLLKTSYPGAHIGPEPTTDRFVVVMSGPDERTIPGNTLAVQADMPFSGLTTFGTSFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_008644157.1| PREDICTED: uncharacterized protein LOC100384394 isoform X1 [Zea 
mays]
 ref|XP_008644158.1| PREDICTED: uncharacterized protein LOC100384394 isoform X1 [Zea 
mays]
 gb|AFW69172.1| hypothetical protein ZEAMMB73_263235 [Zea mays]
Length=544

 Score =   343 bits (881),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 183/301 (61%), Positives = 218/301 (72%), Gaps = 26/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI   P + CSKE QK++Q+WF  AD+DGDGR+TG DA K FGMS LS+P LKQVWA+A
Sbjct  1    MEIGQYPASGCSKEHQKIYQEWFALADADGDGRITGPDAIKFFGMSKLSRPDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            D++RQG+LG +EF TAMQL+SLAQ G E+  D L     + ++PP M+ LDALLA +   
Sbjct  61   DTRRQGYLGFSEFVTAMQLVSLAQAGNEITQDSLKRDDLSSLNPPVMEGLDALLAKSKHL  120

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                        P+ +G   + +  T                 K FSS+SS    +  LT
Sbjct  121  VKRVD-------PEMDGYPQEQSPLTN----------------KWFSSKSS---KKIPLT  154

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            AVTSVIDGLK+LY  KLKPLEVTY+FNDFVSP+LT SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  155  AVTSVIDGLKKLYIEKLKPLEVTYKFNDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIK  214

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRF+VV SG DER+IPGNT+AV ADMPF+GL+TFG AFLSKF
Sbjct  215  HLLRTSYPGAHIGPEPTTDRFVVVMSGSDERTIPGNTIAVQADMPFSGLTTFGTAFLSKF  274

Query  5    E  3
            E
Sbjct  275  E  275



>ref|XP_009589162.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=545

 Score =   343 bits (880),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 215/302 (71%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P + CSKE +K++Q WF+ ADSDGDGR+TG DA K F +S+LS+  LKQVWA+A
Sbjct  1    MEFDTSPISRCSKEHEKIYQQWFSLADSDGDGRLTGGDAIKFFALSNLSRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF T+MQL+SLAQ G  + SDLLN +     + PPT++ LD L A    
Sbjct  61   DSKRQGFLGFREFITSMQLVSLAQAGHPVTSDLLNAEVNFENLQPPTLEGLDLLQAKKK-  119

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                          +   S+P+ NG   ++            S+      SS    + SL
Sbjct  120  --------------RAPKSEPEQNGNPTVQS-----------SVTANWFSSSTSVKKVSL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            T+VTS+IDGLK+LY  KLKPLEV YRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  TSVTSIIDGLKKLYIQKLKPLEVAYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+ SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLRTSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_002874791.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51050.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   343 bits (880),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 208/294 (71%), Gaps = 30/294 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            +C KE QK+++DWFN ADSDGDGRV+GNDATK F MS LS+ +LKQVWA+ADSKRQGFLG
Sbjct  11   TCLKEHQKIYKDWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLG  70

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspns-sgs  525
            ++EF TAM+L+SLAQEG E+ SDLL        V  P ++ L+ +++    +  N     
Sbjct  71   LSEFITAMKLVSLAQEGHEITSDLLKGSVDMKSVELPVLEGLENVVSKLKVAKTNVDVEE  130

Query  524  LTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVID  345
               + PQ     P                         F S+S    ++P +  VT ++D
Sbjct  131  NVVTKPQVTAKAP------------------------WFKSKSI---IKPQVNVVT-IVD  162

Query  344  GLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSY  165
            GLKRLY  KLKPLEVTYRFNDF SPVLT+SDFDAKPM+MLLGQYSTGKTTFIKHLL C Y
Sbjct  163  GLKRLYTEKLKPLEVTYRFNDFASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLGCDY  222

Query  164  PGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PGAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  223  PGAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  276



>gb|KFK32206.1| hypothetical protein AALP_AA6G211000 [Arabis alpina]
Length=545

 Score =   343 bits (879),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 176/298 (59%), Positives = 211/298 (71%), Gaps = 34/298 (11%)
 Frame = -3

Query  884  FTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGF  705
              +C KE QK++++WFN ADSDGDGRV+GNDATK F MS LS+ +LKQVWA+ADSKRQGF
Sbjct  9    INTCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFTMSKLSRQELKQVWAIADSKRQGF  68

Query  704  LGINEFTTAMQLISLAQEGEELNSDLLNLKTA---AGVSPPTMKDLDallasangsspns  534
            LG+ EF TAM+L+SLAQEG E+NS+LL  K+A     V  P ++ L+ +++    S   +
Sbjct  69   LGLAEFITAMKLVSLAQEGHEINSELL--KSAIDMKSVELPVLEGLENVISKQKTSKQYT  126

Query  533  sgs-LTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVT  357
                   S PQ     P                         F S+S    ++P +  VT
Sbjct  127  DVEDNVVSQPQVTAKAP------------------------WFKSKSI---IKPQVNVVT  159

Query  356  SVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLL  177
             ++DGLK+LYN KLKPLEVTYRFNDF SPVLT SDFDAKPM+MLLGQYSTGKTTFIKHLL
Sbjct  160  -IVDGLKKLYNEKLKPLEVTYRFNDFASPVLTSSDFDAKPMVMLLGQYSTGKTTFIKHLL  218

Query  176  KCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
             C YPGAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  219  GCDYPGAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  276



>ref|XP_006475006.1| PREDICTED: EH domain-containing protein 3-like [Citrus sinensis]
Length=545

 Score =   343 bits (879),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 225/302 (75%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI +GP  SCSK+ QK++ +WFN+ADSDGDGR+TGNDATK F +S+LS+  LKQVWA+A
Sbjct  1    MEIGTGPIGSCSKDHQKIYLEWFNYADSDGDGRITGNDATKFFALSNLSRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            D+KRQG+LG  EF  AMQLISL Q+G ++  DL N       + PP M+ LD LLA+   
Sbjct  61   DAKRQGYLGYREFIAAMQLISLVQDGHQVTHDLWNSDVDFQNLKPPAMEGLDKLLANKRH  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
            S              +  S P+ NG+   +P P         S   FSS+SS+K    S+
Sbjct  121  S--------------SKTSDPNLNGSLQPQPSP---------SANWFSSKSSKKI---SM  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+ SYPGAHIGPEPTTDRF+VV SG D+RSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLRTSYPGAHIGPEPTTDRFVVVMSGVDDRSIPGNTVAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>gb|KDO62119.1| hypothetical protein CISIN_1g009050mg [Citrus sinensis]
Length=545

 Score =   342 bits (878),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 225/302 (75%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI +GP  SCSK+ QK++ +WFN+ADSDGDGR+TGNDATK F +S+LS+  LKQVWA+A
Sbjct  1    MEIGTGPIGSCSKDHQKIYLEWFNYADSDGDGRITGNDATKFFALSNLSRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            D+KRQG+LG  EF  AMQLISL Q+G ++  DL N       + PP M+ LD LLA+   
Sbjct  61   DAKRQGYLGYREFIAAMQLISLVQDGHQVTHDLWNSDVDFQNLKPPAMEGLDKLLANKRH  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
            S              +  S P+ NG+   +P P         S   FSS+SS+K    S+
Sbjct  121  S--------------SKTSDPNLNGSLQPQPSP---------SANWFSSKSSKKI---SM  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+ SYPGAHIGPEPTTDRF+VV SG D+RSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLRTSYPGAHIGPEPTTDRFVVVMSGVDDRSIPGNTVAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_004966283.1| PREDICTED: EH domain-containing protein 1-like [Setaria italica]
Length=544

 Score =   342 bits (878),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 184/301 (61%), Positives = 216/301 (72%), Gaps = 26/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI   P + CSKE QK++Q+WF  ADSDGDGR+TG DA K FGMS LS+P LKQVWA+A
Sbjct  1    MEIGQYPASGCSKEHQKIYQEWFALADSDGDGRITGPDAIKFFGMSKLSRPDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DS+RQG+LG  EF  AMQL+SLAQ G E+  D L     + ++PP M+ LDALLA +   
Sbjct  61   DSRRQGYLGFPEFVAAMQLVSLAQAGNEITQDSLKRDDLSSLNPPVMEGLDALLAKSKHV  120

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                        P+ +G   + +  T                 K FSS+SS    +  LT
Sbjct  121  VKRVD-------PEMDGFPQEQSPLTN----------------KWFSSKSS---KKIPLT  154

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            AVTSVIDGLK+LY  KLKPLEVTY+FNDFVSP+LT SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  155  AVTSVIDGLKKLYIEKLKPLEVTYKFNDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIK  214

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRF+VV SG DER+IPGNT+AV ADMPF+GL+TFG AFLSKF
Sbjct  215  HLLRTSYPGAHIGPEPTTDRFVVVMSGSDERTIPGNTIAVQADMPFSGLTTFGTAFLSKF  274

Query  5    E  3
            E
Sbjct  275  E  275



>ref|XP_010455720.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=544

 Score =   342 bits (878),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 171/293 (58%), Positives = 205/293 (70%), Gaps = 29/293 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            SC KE QK++++WFN ADSDGDGRV+GNDATK F MS LS+ +LKQVWA+ADSKRQGFLG
Sbjct  11   SCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLG  70

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgsL  522
            + EF  AM+L+SLAQEG E+ SDLL        V  P ++ L+ +++     +       
Sbjct  71   LAEFIIAMKLVSLAQEGHEITSDLLKGSIDMKSVEFPVLEGLENVVSQKASKTNVDVEDN  130

Query  521  TESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDG  342
              + PQ     P                         + S+S    ++P +  VT ++DG
Sbjct  131  VVTQPQVTAKAP------------------------WYKSKSI---IKPQVNVVT-IVDG  162

Query  341  LKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYP  162
            LKRLY  KLKPLEVTYRFNDF SPVLT+SDFDAKPM+MLLGQYSTGKTTFIKHLL C YP
Sbjct  163  LKRLYTEKLKPLEVTYRFNDFASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLGCDYP  222

Query  161  GAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            GAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  223  GAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  275



>ref|XP_006452452.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
 gb|ESR65692.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
Length=563

 Score =   343 bits (880),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 225/302 (75%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI +GP  SCSK+ QK++ +WFN+ADSDGDGR+TGNDATK F +S+LS+  LKQVWA+A
Sbjct  19   MEIGTGPIGSCSKDHQKIYLEWFNYADSDGDGRITGNDATKFFALSNLSRQDLKQVWAIA  78

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            D+KRQG+LG  EF  AMQLISL Q+G ++  DL N       + PP M+ LD LLA+   
Sbjct  79   DAKRQGYLGYREFIAAMQLISLVQDGHQVTHDLWNSDVDFQNLKPPAMEGLDKLLANKRH  138

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
            S              +  S P+ NG+   +P P         S   FSS+SS+K    S+
Sbjct  139  S--------------SKTSDPNLNGSLQPQPSP---------SANWFSSKSSKKI---SM  172

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  173  SSVTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  232

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+ SYPGAHIGPEPTTDRF+VV SG D+RSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  233  KHLLRTSYPGAHIGPEPTTDRFVVVMSGVDDRSIPGNTVAVQADMPFSGLTTFGTAFLSK  292

Query  8    FE  3
            FE
Sbjct  293  FE  294



>ref|XP_008449138.1| PREDICTED: EH domain-containing protein 1 [Cucumis melo]
Length=547

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 179/304 (59%), Positives = 219/304 (72%), Gaps = 29/304 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEIAS P  SCS++ QK++Q+WF++ADSDGDGR+TGNDA K F MS L +  LKQVWA+A
Sbjct  1    MEIASYPIGSCSRDHQKIYQEWFDYADSDGDGRITGNDAIKFFSMSTLPRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA---AGVSPPTMKDLDallasa  555
            DSKRQG+LG  EF TAMQL+SLAQ G E+  D+L   +      ++PP M+ LD +L   
Sbjct  61   DSKRQGYLGFKEFVTAMQLVSLAQSGGEVTHDVLTSNSEDDLKSLNPPRMEGLDVIL---  117

Query  554  ngsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQP  375
                        +   +   +  +TNG++  +P                S  SS+   + 
Sbjct  118  -----------AKKARKQKSNDHETNGSSKGQPPVSA------------SWFSSKSSKKI  154

Query  374  SLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTT  195
             L++VTS++DGLKRLY  KLKPLEV+YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTT
Sbjct  155  PLSSVTSIVDGLKRLYIQKLKPLEVSYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTT  214

Query  194  FIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFL  15
            FIKHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF GL+TFG +FL
Sbjct  215  FIKHLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPFNGLTTFGTSFL  274

Query  14   SKFE  3
            SKFE
Sbjct  275  SKFE  278



>ref|XP_006396726.1| hypothetical protein EUTSA_v10028561mg [Eutrema salsugineum]
 gb|ESQ38179.1| hypothetical protein EUTSA_v10028561mg [Eutrema salsugineum]
Length=544

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/293 (59%), Positives = 208/293 (71%), Gaps = 29/293 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            +C KE QK++++WFN ADSDGDGRV+GNDATK F MS LS+ +LKQVWA++DSKRQGFLG
Sbjct  11   TCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVSDSKRQGFLG  70

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgsL  522
            + EF TAM+L+SLAQEG E+  DLL        V PP ++ L+ +++    S+P +    
Sbjct  71   LAEFITAMKLVSLAQEGHEVTPDLLKGSVDMKSVEPPVLEGLENIVSKQKSSNPYTDDED  130

Query  521  TESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDG  342
              + PQ     P                         F S+S    ++P +  VT ++DG
Sbjct  131  NVTQPQVTAKVP------------------------WFKSKSV---IKPQVNVVT-IVDG  162

Query  341  LKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYP  162
            LKRLY  KLKPLEVTYRFNDF SP LT+SDFDAKPM+MLLGQYSTGKTTFIKHLL C YP
Sbjct  163  LKRLYAEKLKPLEVTYRFNDFASPALTNSDFDAKPMVMLLGQYSTGKTTFIKHLLGCEYP  222

Query  161  GAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            GAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  223  GAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  275



>ref|XP_007020711.1| EPS15 domain 1 [Theobroma cacao]
 gb|EOY12236.1| EPS15 domain 1 [Theobroma cacao]
Length=547

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 226/302 (75%), Gaps = 25/302 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI +G   SCSKE Q+++Q+WF+F DSD DGR+TG DA K FGMS+LS+  LKQVWA+A
Sbjct  1    MEIGAGRIGSCSKEHQQIYQEWFSFVDSDNDGRITGTDAIKFFGMSNLSRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF  AMQL+SLAQ+G E++ DLLN         PP M+ LDAL+     
Sbjct  61   DSKRQGYLGFKEFVFAMQLVSLAQDGHEISHDLLNGDVDFENAKPPVMEGLDALIMKKKH  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
            SS ++S +        NGS P                ++  P+ + FSS+SS+K    S+
Sbjct  121  SSKSTSPASN-----ANGSSP----------------MQSSPAAQWFSSKSSKKI---SM  156

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  157  SSVTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  216

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SG DERS+PGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  217  KHLLKSSYPGAHIGPEPTTDRFVVVMSGTDERSVPGNTIAVQADMPFSGLTTFGTAFLSK  276

Query  8    FE  3
            FE
Sbjct  277  FE  278



>ref|XP_004491428.1| PREDICTED: EH domain-containing protein 3-like [Cicer arietinum]
Length=543

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 214/302 (71%), Gaps = 29/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME    P  SCSKE Q ++Q+WF++ADSDGDGR+TGNDATK F MS+LS+  LKQVWA+A
Sbjct  1    MEFDPVPIGSCSKEHQNIYQNWFSYADSDGDGRITGNDATKFFSMSNLSRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF  AMQL+SLAQ G  +  DLL+       + PPT++ LD LLA    
Sbjct  61   DSKRQGYLGFQEFIIAMQLVSLAQSGHPITHDLLSSDVDLKDLKPPTLEGLDVLLAKN--  118

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                          +      D NG++ L+P   +       + K+             L
Sbjct  119  --------------KHKQKDVDVNGSSQLQPSLSSSWFSSKSTKKV------------PL  152

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  153  SSVTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  212

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLKCSYPGAHIGPEPTTDRF+VV SG D RSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  213  KHLLKCSYPGAHIGPEPTTDRFVVVMSGSDARSIPGNTVAVQADMPFSGLTTFGTAFLSK  272

Query  8    FE  3
            FE
Sbjct  273  FE  274



>ref|NP_567299.2| EPS15 homology domain 2 protein [Arabidopsis thaliana]
 gb|ACE79044.1| At4g05520 [Arabidopsis thaliana]
 gb|AEE82529.1| EPS15 homology domain 2 protein [Arabidopsis thaliana]
Length=546

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 207/294 (70%), Gaps = 30/294 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            SC KE QK++++WFN ADSDGDGRV+GNDATK F MS LS+ +LKQVWA+ADSKRQGFLG
Sbjct  11   SCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLG  70

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgs-  525
            ++EF TAM+L+SLAQEG E+ SDLL        V  P ++ L+ +++    S  N     
Sbjct  71   LSEFITAMKLVSLAQEGHEITSDLLKGSIDMKSVELPVLEGLENVVSKQKVSKTNVDVED  130

Query  524  LTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVID  345
               + PQ     P                         F S+S    ++P +  VT ++D
Sbjct  131  NVVTKPQVTAKTP------------------------WFKSKSI---IKPQVNVVT-IVD  162

Query  344  GLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSY  165
            GLKRLY  KLKPLEVTYRFNDF SPVLT SDFDAKPM+MLLGQYSTGKTTFIKHLL C Y
Sbjct  163  GLKRLYTEKLKPLEVTYRFNDFASPVLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLGCDY  222

Query  164  PGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PGAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  223  PGAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  276



>ref|XP_009334825.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009334842.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=591

 Score =   342 bits (878),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 218/302 (72%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            + + + P +SCSK+ QK++Q+WF F DSD DGR+T +DA K FGMS+L++ +LKQVWA+A
Sbjct  47   LNLETVPISSCSKDHQKIYQEWFRFVDSDADGRITVSDAVKFFGMSNLNRKELKQVWAMA  106

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG +EF  AMQL+SLAQ G ++   LLN     A + PP M+ LDALL     
Sbjct  107  DSKRQGYLGFSEFVAAMQLVSLAQAGHDITHGLLNSNVDLASLKPPVMEGLDALLLVNKK  166

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                          ++N +K   NGT   +            S   FS  SS+K     L
Sbjct  167  HLH-----------KSNENK--VNGTAVQQSP----------SALWFSPESSKK---IPL  200

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTY+FN+FVSP++ +SDFDAKPM+MLLGQYSTGKTTF+
Sbjct  201  SSVTSIIDGLKRLYVQKLKPLEVTYKFNNFVSPLMKNSDFDAKPMVMLLGQYSTGKTTFV  260

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFG AFLS+
Sbjct  261  KHLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSR  320

Query  8    FE  3
            FE
Sbjct  321  FE  322



>ref|XP_009114593.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Brassica 
rapa]
Length=545

 Score =   340 bits (873),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 171/293 (58%), Positives = 207/293 (71%), Gaps = 28/293 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            +C KE QK++++WFN ADSDGDGRV+GNDATK F MS LS+ +LKQVWA+ADSKRQGFLG
Sbjct  11   TCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLG  70

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgsL  522
            + EF TAM+L++LAQEG E+ SDLL        V  P ++ L+ +++    S   +    
Sbjct  71   LTEFITAMKLVTLAQEGHEITSDLLKGSVDLMSVELPVLEGLENVVSKQKASKAYADDED  130

Query  521  TESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDG  342
              + PQ    K                          F S++    ++P +  VT ++DG
Sbjct  131  NVTQPQVVKEKA-----------------------PWFKSKAI---IKPQVNVVT-IVDG  163

Query  341  LKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYP  162
            LKRLY  KLKPLEVTYRFNDF SPVLT+SDFDAKPM+MLLGQYSTGKTTFIKHLL C YP
Sbjct  164  LKRLYAEKLKPLEVTYRFNDFASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLGCEYP  223

Query  161  GAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            GAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  224  GAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  276



>ref|XP_009334826.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009334843.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=591

 Score =   342 bits (876),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 218/302 (72%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            + + + P +SCSK+ QK++Q+WF F DSD DGR+T +DA K FGMS+L++ +LKQVWA+A
Sbjct  47   LNLETVPISSCSKDHQKIYQEWFRFVDSDADGRITVSDAVKFFGMSNLNRKELKQVWAMA  106

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            DSKRQG+LG +EF  AMQL+SLAQ G ++   LLN     A + PP M+ LDALL     
Sbjct  107  DSKRQGYLGFSEFVAAMQLVSLAQAGHDITHGLLNSNVDLASLKPPVMEGLDALLLVNKK  166

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                          ++N +K   NGT   +            S   FS  SS+K     L
Sbjct  167  HLH-----------KSNENK--VNGTAVQQSP----------SALWFSPESSKK---IPL  200

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEVTY+FN+FVSP++ +SDFDAKPM+MLLGQYSTGKTTF+
Sbjct  201  SSVTSIIDGLKRLYVQKLKPLEVTYKFNNFVSPLMKNSDFDAKPMVMLLGQYSTGKTTFV  260

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFG AFLS+
Sbjct  261  KHLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSR  320

Query  8    FE  3
            FE
Sbjct  321  FE  322



>ref|XP_004149345.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
 ref|XP_004167751.1| PREDICTED: EH domain-containing protein 1-like [Cucumis sativus]
Length=547

 Score =   340 bits (872),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 177/304 (58%), Positives = 217/304 (71%), Gaps = 29/304 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S P  SCS++ QK++Q+WF++ADSDGDGR+TGNDA K F MS L +  LKQVWA+A
Sbjct  1    MEIGSYPIGSCSRDHQKIYQEWFDYADSDGDGRITGNDAIKFFSMSTLPRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAA---GVSPPTMKDLDallasa  555
            DSKRQG+LG  EF TAMQL+SLAQ G E+  D+L   +      ++PP M+ LD +L   
Sbjct  61   DSKRQGYLGFKEFVTAMQLVSLAQSGGEVTHDVLTSNSEVDLKSLNPPRMEGLDVIL---  117

Query  554  ngsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQP  375
                        +   +   +  +TNG++  +            S    S  SS+   + 
Sbjct  118  -----------AKKARKQKSNDHETNGSSKGQ------------SPVSASWFSSKSSKKI  154

Query  374  SLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTT  195
             L++VTS++DGLKRLY  KLKPLEV+YRFNDFVSP+L +SDFDAKPM+MLLGQYSTGKTT
Sbjct  155  PLSSVTSIVDGLKRLYIQKLKPLEVSYRFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTT  214

Query  194  FIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFL  15
            FIKHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF GL+TFG +FL
Sbjct  215  FIKHLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPFNGLTTFGTSFL  274

Query  14   SKFE  3
            SKFE
Sbjct  275  SKFE  278



>ref|XP_010433120.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=544

 Score =   340 bits (872),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 172/293 (59%), Positives = 205/293 (70%), Gaps = 29/293 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            SC KE QK++++WFN ADSDGDG V+GNDATK F MS LS+ +LKQVWA+ADSKRQGFLG
Sbjct  11   SCLKEHQKIYKEWFNIADSDGDGHVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLG  70

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgsL  522
            + EF  AM+L+SLAQEG E+ SDLL        V  P ++ L+ +++    S  N     
Sbjct  71   LAEFIIAMKLVSLAQEGHEITSDLLKGSIDMKSVEFPVLEGLENVVSKQKSSKTNVDVED  130

Query  521  TESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDG  342
              + PQ     P                         + S+S    ++P +  VT ++DG
Sbjct  131  NVTQPQVTAKAP------------------------WYKSKSI---IKPQVNVVT-IVDG  162

Query  341  LKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYP  162
            LKRLY  KLKPLEVTYRFNDF SPVLT+SDFDAKPM+MLLGQYSTGKTTFIKHLL C YP
Sbjct  163  LKRLYTEKLKPLEVTYRFNDFASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLGCDYP  222

Query  161  GAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            GAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  223  GAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  275



>gb|KGN56098.1| hypothetical protein Csa_3G073890 [Cucumis sativus]
Length=562

 Score =   340 bits (873),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 177/304 (58%), Positives = 217/304 (71%), Gaps = 29/304 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S P  SCS++ QK++Q+WF++ADSDGDGR+TGNDA K F MS L +  LKQVWA+A
Sbjct  1    MEIGSYPIGSCSRDHQKIYQEWFDYADSDGDGRITGNDAIKFFSMSTLPRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAA---GVSPPTMKDLDallasa  555
            DSKRQG+LG  EF TAMQL+SLAQ G E+  D+L   +      ++PP M+ LD +L   
Sbjct  61   DSKRQGYLGFKEFVTAMQLVSLAQSGGEVTHDVLTSNSEVDLKSLNPPRMEGLDVIL---  117

Query  554  ngsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQP  375
                        +   +   +  +TNG++  +            S    S  SS+   + 
Sbjct  118  -----------AKKARKQKSNDHETNGSSKGQ------------SPVSASWFSSKSSKKI  154

Query  374  SLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTT  195
             L++VTS++DGLKRLY  KLKPLEV+YRFNDFVSP+L +SDFDAKPM+MLLGQYSTGKTT
Sbjct  155  PLSSVTSIVDGLKRLYIQKLKPLEVSYRFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTT  214

Query  194  FIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFL  15
            FIKHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF GL+TFG +FL
Sbjct  215  FIKHLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPFNGLTTFGTSFL  274

Query  14   SKFE  3
            SKFE
Sbjct  275  SKFE  278



>ref|XP_006602183.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=541

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 213/301 (71%), Gaps = 29/301 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME+   PF SCSKE Q L+++WFN+AD+DGDGR TGN+A K F MS+LS+ +LKQVWA+A
Sbjct  1    MELDIVPFDSCSKEYQNLYEEWFNYADADGDGRFTGNEAIKFFAMSNLSRQELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKR+G+LG  EF  AMQL+SL Q G  +  DLL         PP M  LD LL      
Sbjct  61   DSKREGYLGFKEFVIAMQLVSLGQCGYSITHDLLTSDAMRHAKPPIMDGLDVLLTKKKRK  120

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
              +     + SPP  + +                         K F+++S++K   P+ +
Sbjct  121  QKDKEL--SVSPPHPSPTS------------------------KWFTAKSAKK--VPA-S  151

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS++DGLKRLY  KLKPLEVTY +NDFVSP+LT+SDFDAKPM++LLGQYSTGKTTFIK
Sbjct  152  SVTSIVDGLKRLYLQKLKPLEVTYHYNDFVSPLLTNSDFDAKPMVLLLGQYSTGKTTFIK  211

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            H+LK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFG +FLSKF
Sbjct  212  HMLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADMPFSGLTTFGTSFLSKF  271

Query  5    E  3
            E
Sbjct  272  E  272



>ref|XP_004500109.1| PREDICTED: EH domain-containing protein 1-like [Cicer arietinum]
Length=542

 Score =   339 bits (869),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/301 (59%), Positives = 212/301 (70%), Gaps = 28/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S  F SCSKE   L+Q+WFN+ADSDGDGR TGN+ATK F MS LS+ +LKQVWA+A
Sbjct  1    MEIDSIAFDSCSKENLTLYQEWFNYADSDGDGRFTGNEATKFFAMSHLSRQELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKR+G+LG  EF  +MQL+SL Q G  +  DLL       + PP M+ LDAL+A     
Sbjct  61   DSKREGYLGFKEFVISMQLVSLGQSGHSITHDLLTTDILQNIKPPQMEGLDALVAK----  116

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                                        + +  +    P PS   FS++S++K   P+ +
Sbjct  117  ---------------------KKRKQKDKDVNASPSPLPSPSSNWFSAKSTKK--VPA-S  152

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGLKRLY  KLKPLEV YR+NDFVSP+L +SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  153  SVTSIIDGLKRLYIQKLKPLEVAYRYNDFVSPLLNNSDFDAKPMVMLLGQYSTGKTTFIK  212

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            H+L+ SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF GL+TFG AFLSKF
Sbjct  213  HMLQSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFGGLTTFGTAFLSKF  272

Query  5    E  3
            E
Sbjct  273  E  273



>ref|XP_006287437.1| hypothetical protein CARUB_v10000641mg [Capsella rubella]
 gb|EOA20335.1| hypothetical protein CARUB_v10000641mg [Capsella rubella]
Length=545

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 206/294 (70%), Gaps = 30/294 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            SC KE QK++++WF  ADSDGDGRV+GNDATK F MS LS+ +LKQVWA+ADSKRQGFLG
Sbjct  11   SCLKEHQKIYKEWFTIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLG  70

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgsL  522
            + EF TAM+L+SLAQEG E+ SDLL        V  P ++ L+ +++    S  +     
Sbjct  71   LAEFITAMKLVSLAQEGHEITSDLLKGSVDMKSVELPVLEGLENVVSKQKASKTHVDVED  130

Query  521  -TESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVID  345
               + PQ     P                         + S+S    ++P +  VT ++D
Sbjct  131  DVVTQPQVTAKAP------------------------WYKSKSI---IKPQVNVVT-IVD  162

Query  344  GLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSY  165
            GLKRLY  KLKPLEVTYRFNDF SPVLT+SDFDAKPM+MLLGQYSTGKTTFIKHLL C Y
Sbjct  163  GLKRLYTEKLKPLEVTYRFNDFASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLGCDY  222

Query  164  PGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PGAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  223  PGAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  276



>ref|XP_010466211.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=545

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 184/302 (61%), Positives = 219/302 (73%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q ++++WF FADSDGDGR+TGNDA K F MS+L +P+LKQVWA+A
Sbjct  1    MEIESVAAGSCSKENQIIYKEWFEFADSDGDGRITGNDAIKFFSMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            D+KRQG+L   EF  AMQL+SLAQ G E++ ++LN       ++PPTM+ L  L+A    
Sbjct  61   DAKRQGYLSFKEFIVAMQLVSLAQTGHEISHEVLNSDVDFQNINPPTMEGLGVLMAKKKH  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
            SS +S   +  SP        DT+ T                        SS+   + SL
Sbjct  121  SSKSSDLDINGSPA------ADTSLTAHWF--------------------SSKSSKKISL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS++DGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIVDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLKASYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_003519595.1| PREDICTED: EH domain-containing protein 1-like [Glycine max]
Length=543

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 183/302 (61%), Positives = 218/302 (72%), Gaps = 31/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME    P  SCSKE Q ++++WFN+ADSD DGR+TG+DATK F MS+L +  LKQVWA+A
Sbjct  1    MEFDPIPIGSCSKEHQMIYKEWFNYADSDSDGRITGSDATKFFAMSNLPREDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLL--NLKTAAGVSPPTMKDLDallasan  552
            DSKRQG+LG  EF  AMQL+SLAQ G  +  DLL  ++    G  PP+M+ LD LL    
Sbjct  61   DSKRQGYLGFTEFIIAMQLVSLAQSGHSITPDLLTSDVDFTNG-KPPSMEGLDVLLVKK-  118

Query  551  gsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
                           +    + D NG++ L+P P         S   FSS+S++K     
Sbjct  119  ---------------KHKQKEVDANGSSQLQPSP---------SSNWFSSKSTKKV---P  151

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            L++VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTF
Sbjct  152  LSSVTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTF  211

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            IKHLLK SYPGAHIGPEPTTDRF+VV SG DERS+PGNTVAV ADMPF+GL+TFG AFLS
Sbjct  212  IKHLLKSSYPGAHIGPEPTTDRFVVVMSGSDERSVPGNTVAVQADMPFSGLTTFGTAFLS  271

Query  11   KF  6
            KF
Sbjct  272  KF  273



>ref|XP_010455719.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Camelina 
sativa]
Length=545

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 206/294 (70%), Gaps = 30/294 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            SC KE QK++++WFN ADSDGDGRV+GNDATK F MS LS+ +LKQVWA+ADSKRQGFLG
Sbjct  11   SCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLG  70

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgs-  525
            + EF  AM+L+SLAQEG E+ SDLL        V  P ++ L+ +++    S  N     
Sbjct  71   LAEFIIAMKLVSLAQEGHEITSDLLKGSIDMKSVEFPVLEGLENVVSKQKASKTNVDVED  130

Query  524  LTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVID  345
               + PQ     P                         + S+S    ++P +  VT ++D
Sbjct  131  NVVTQPQVTAKAP------------------------WYKSKSI---IKPQVNVVT-IVD  162

Query  344  GLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSY  165
            GLKRLY  KLKPLEVTYRFNDF SPVLT+SDFDAKPM+MLLGQYSTGKTTFIKHLL C Y
Sbjct  163  GLKRLYTEKLKPLEVTYRFNDFASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLGCDY  222

Query  164  PGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PGAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  223  PGAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  276



>gb|EPS68571.1| hypothetical protein M569_06192, partial [Genlisea aurea]
Length=541

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 182/318 (57%), Positives = 214/318 (67%), Gaps = 60/318 (19%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S P T CS+E +K++QDWF+FADSDGDGRVTG DATK F MSDL +  LKQ+W++A
Sbjct  1    MEIDSAPITRCSQEHKKIYQDWFSFADSDGDGRVTGADATKFFAMSDLPRADLKQIWSIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG+ EF TAMQL+SLAQ G  ++++++  +     +SPP M  LDALLA    
Sbjct  61   DSKRQGFLGLKEFITAMQLVSLAQAGNTISNNIVYSEVDFDDLSPPNMNGLDALLAKKKR  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +  PQ NGS                                   +VQPS 
Sbjct  121  ---------AQQEPQDNGSN----------------------------------QVQPSP  137

Query  368  TA----------------VTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKP  237
            TA                VTS+IDGLK+LY  KLKPLE TY FNDFVSP+LT+SDFDAKP
Sbjct  138  TAGWFSSSKSAKKVSLSSVTSIIDGLKKLYVQKLKPLETTYLFNDFVSPLLTNSDFDAKP  197

Query  236  MIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHAD  57
            M+MLLGQYSTGKTTFIKHLL  +YPGAHIGPEPTTDRF+VV +GPDERSIPGNTVAV AD
Sbjct  198  MVMLLGQYSTGKTTFIKHLLGSTYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTVAVQAD  257

Query  56   MPFTGLSTFGGAFLSKFE  3
            MPF+GL+TFG AFLSKF+
Sbjct  258  MPFSGLTTFGTAFLSKFQ  275



>emb|CDX94536.1| BnaC09g23000D [Brassica napus]
Length=547

 Score =   338 bits (866),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 174/298 (58%), Positives = 213/298 (71%), Gaps = 36/298 (12%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            +C KE QK++++WFN ADSDGDGRV+GNDATK F MS LS+ +LKQVWA+ADSKRQGFLG
Sbjct  11   TCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLG  70

Query  698  INEFTTAMQLISLAQEGEELNSDLL----NLKTAAGVSPPTMKDLDallasangsspnss  531
            + EF TAM+L++LAQEG E+ SDLL    ++KT   V  P ++ L+ ++ S   +S   +
Sbjct  71   LTEFITAMKLVTLAQEGHEITSDLLKGSVDMKT---VELPVLEGLENVVVSKQKASKAYA  127

Query  530  gsLTE--SPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVT  357
                   + PQ   +K                          F S++    ++P +  VT
Sbjct  128  VDEDNVVTQPQAVTAKA-----------------------PWFKSKAI---IKPQVNVVT  161

Query  356  SVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLL  177
             ++DGLKRLY  KLKPLEVTYRFNDF SPVLT+SDFDAKPM+MLLGQYSTGKTTFIKHLL
Sbjct  162  -IVDGLKRLYAEKLKPLEVTYRFNDFASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  220

Query  176  KCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
             C YPGAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  221  GCEYPGAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  278



>ref|XP_010487999.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=545

 Score =   337 bits (865),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 187/302 (62%), Positives = 224/302 (74%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q ++++WF FADSDGDGR+TGNDA K F MS+L +P+LKQVWA+A
Sbjct  1    MEIESVAAGSCSKENQLIYKEWFEFADSDGDGRITGNDAIKFFSMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            D+KRQG+L   EF  AMQL+SLAQ G E++ ++LN +     ++PPTM+ L  L+A    
Sbjct  61   DAKRQGYLSFKEFIVAMQLVSLAQTGHEISHEVLNSEVDFQNINPPTMEGLGVLMAKKKH  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
            SS +S   +  SP        DT+ T                  + FSS+SS+K    SL
Sbjct  121  SSKSSDLDINGSPA------ADTSLTA-----------------QWFSSKSSKKI---SL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS++DGLKRLY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIVDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLKASYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_010508763.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=563

 Score =   337 bits (864),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 187/303 (62%), Positives = 225/303 (74%), Gaps = 27/303 (9%)
 Frame = -3

Query  908  DMEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            +MEI +    SCSKE Q ++++WF FADSDGDGR+TGNDA K F MS+L +P+LKQVWA+
Sbjct  18   EMEIEAVAAGSCSKENQIIYKEWFEFADSDGDGRITGNDAIKFFSMSNLPRPELKQVWAI  77

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasan  552
            AD+KRQG+L   EF  AMQL+SLAQ G E++ ++LN       ++PPTM+ L  L+A   
Sbjct  78   ADAKRQGYLSFKEFIVAMQLVSLAQTGHEISHEVLNSDVDFQNINPPTMEGLGVLMAKKK  137

Query  551  gsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
             SS +S  S+  SP        DT+ T                  + FSS+SS+K    S
Sbjct  138  HSSKSSDLSINGSP------AADTSLTA-----------------QWFSSKSSKKI---S  171

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            L++VTS++DGLKRLY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTF
Sbjct  172  LSSVTSIVDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTF  231

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            IKHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLS
Sbjct  232  IKHLLKASYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLS  291

Query  11   KFE  3
            KFE
Sbjct  292  KFE  294



>ref|XP_006346193.1| PREDICTED: EH domain-containing protein 1-like [Solanum tuberosum]
Length=545

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 209/302 (69%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSKE +K++Q WFNFADSDGDGR+TG DATK F MS L +P+LKQVWA+A
Sbjct  1    MEFDTNPINRCSKEHEKIYQQWFNFADSDGDGRLTGGDATKFFAMSSLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFL   +F   MQL++LAQ G  + SDLLN       + PP M+ LD LLA    
Sbjct  61   DSKRQGFLSFRDFVVGMQLVALAQAGHAVTSDLLNADVDFENLPPPAMEGLDVLLAKKKL  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S    NGS P                     +       SS+   + SL
Sbjct  121  M--------PKSEQDQNGSAP------------------VPAAPTTSWFSSSKSSKKISL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            T+VTS++DGLK+LY  KLKPLEV Y FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  TSVTSIVDGLKKLYIQKLKPLEVAYHFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLKMSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>emb|CDY16689.1| BnaA09g20670D [Brassica napus]
Length=546

 Score =   336 bits (862),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 207/294 (70%), Gaps = 29/294 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            +C KE QK++++WFN ADSDGDGRV+GNDATK F MS LS+ +LKQVWA+ADSKRQGFLG
Sbjct  11   TCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLG  70

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgs-  525
            + EF TAM+L++LAQEG E+ SDLL        V  P ++ L+ +++    S   +    
Sbjct  71   LTEFITAMKLVTLAQEGHEITSDLLKGSVDLMSVELPVLEGLENVVSKQKASKAYADDED  130

Query  524  LTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVID  345
               + PQ    K                          F S++    ++P +  VT ++D
Sbjct  131  NVVTQPQVVKEKA-----------------------PWFKSKAI---IKPQVNVVT-IVD  163

Query  344  GLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSY  165
            GLKRLY  KLKPLEVTYRFNDF SPVLT+SDFDAKPM+MLLGQYSTGKTTFIKHLL C Y
Sbjct  164  GLKRLYAEKLKPLEVTYRFNDFASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLGCEY  223

Query  164  PGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PGAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  224  PGAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  277



>ref|XP_009114592.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Brassica 
rapa]
Length=546

 Score =   336 bits (862),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 207/294 (70%), Gaps = 29/294 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            +C KE QK++++WFN ADSDGDGRV+GNDATK F MS LS+ +LKQVWA+ADSKRQGFLG
Sbjct  11   TCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLG  70

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgs-  525
            + EF TAM+L++LAQEG E+ SDLL        V  P ++ L+ +++    S   +    
Sbjct  71   LTEFITAMKLVTLAQEGHEITSDLLKGSVDLMSVELPVLEGLENVVSKQKASKAYADDED  130

Query  524  LTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVID  345
               + PQ    K                          F S++    ++P +  VT ++D
Sbjct  131  NVVTQPQVVKEKA-----------------------PWFKSKAI---IKPQVNVVT-IVD  163

Query  344  GLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSY  165
            GLKRLY  KLKPLEVTYRFNDF SPVLT+SDFDAKPM+MLLGQYSTGKTTFIKHLL C Y
Sbjct  164  GLKRLYAEKLKPLEVTYRFNDFASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLGCEY  223

Query  164  PGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PGAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  224  PGAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  277



>ref|XP_006406401.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
 gb|ESQ47854.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
Length=545

 Score =   336 bits (861),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 214/303 (71%), Gaps = 29/303 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q ++++WF FADSDGDGR+TGNDA K F MS+L +P+LKQVWA+A
Sbjct  1    MEIDSIAAGSCSKENQMIYKEWFEFADSDGDGRITGNDAIKFFSMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            D+KRQG+LG  EF  AMQL+SLAQ G E++ ++L+       ++PP M+ L         
Sbjct  61   DAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDVDFKNMNPPIMEGL-------GV  113

Query  548  sspnssgsLTESPPQTNGS-KPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
                   S   S P  NGS   DT+ T                        SS+   + S
Sbjct  114  LMAKKKHSSKSSDPSVNGSPAADTSLTAHWF--------------------SSKSSKKIS  153

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            L++VTS++DGLKRLY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTF
Sbjct  154  LSSVTSIVDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTF  213

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            IKHLLK +YPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLS
Sbjct  214  IKHLLKANYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLS  273

Query  11   KFE  3
            KFE
Sbjct  274  KFE  276



>ref|XP_010433113.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Camelina 
sativa]
Length=545

 Score =   336 bits (861),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 170/293 (58%), Positives = 205/293 (70%), Gaps = 28/293 (10%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            SC KE QK++++WFN ADSDGDG V+GNDATK F MS LS+ +LKQVWA+ADSKRQGFLG
Sbjct  11   SCLKEHQKIYKEWFNIADSDGDGHVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLG  70

Query  698  INEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgsL  522
            + EF  AM+L+SLAQEG E+ SDLL        V  P ++ L+ ++              
Sbjct  71   LAEFIIAMKLVSLAQEGHEITSDLLKGSIDMKSVEFPVLEGLENVV--------------  116

Query  521  TESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDG  342
                     SK  ++ T       +    +       + S+S    ++P +  VT ++DG
Sbjct  117  ---------SKQKSSKTNVDVEDNVVTQPQVTAKAPWYKSKSI---IKPQVNVVT-IVDG  163

Query  341  LKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYP  162
            LKRLY  KLKPLEVTYRFNDF SPVLT+SDFDAKPM+MLLGQYSTGKTTFIKHLL C YP
Sbjct  164  LKRLYTEKLKPLEVTYRFNDFASPVLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLGCDYP  223

Query  161  GAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            GAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  224  GAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  276



>emb|CDP13787.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   335 bits (860),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 188/302 (62%), Positives = 219/302 (73%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S P + CSKE QK++QDWF FADSDGDGR+TG DATK F +S+L +  LKQVWA+A
Sbjct  1    MEIDSAPISRCSKENQKIYQDWFAFADSDGDGRLTGADATKFFALSNLPRHDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF TA+QL+SLAQ G  L SD++  +     + PP M  L+ALLA    
Sbjct  61   DSKRQGFLGFKEFITAVQLVSLAQAGHALTSDIIYAEVDFESLKPPAMDGLEALLAKKK-  119

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                           T  S  + NG   L+  P         S   FSS  S KKV  SL
Sbjct  120  --------------HTPKSDLEQNGIPQLQSSP---------SANWFSSSKSAKKV--SL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS++DGLK+LY  KLKPLE TYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIVDGLKKLYVQKLKPLEATYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG +FLSK
Sbjct  215  KHLLKTSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTSFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|NP_566657.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
 ref|NP_001030731.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
 gb|AAK59418.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42408.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH19984.1| AT3G20290 [Arabidopsis thaliana]
 gb|AEE76359.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
 gb|AEE76360.1| EPS15 homology domain 1 protein [Arabidopsis thaliana]
Length=545

 Score =   335 bits (860),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 214/303 (71%), Gaps = 29/303 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q ++++WF F+DSDGDGR+TGNDA K F MS+L +P+LKQ+WA+A
Sbjct  1    MEIESVAAGSCSKENQMIYKEWFEFSDSDGDGRITGNDAIKFFTMSNLPRPELKQIWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF  AMQL+SLAQ G E++ ++L        ++PPTM+ L         
Sbjct  61   DSKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLISDVDFKNINPPTMEGL-------GV  113

Query  548  sspnssgsLTESPPQTNGS-KPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
                   S   S P  NGS   DT+ T                        SS+   + S
Sbjct  114  LMAKKKHSSKSSDPNMNGSPAADTSLTAHWF--------------------SSKSSKKIS  153

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            L++VTS++DGLKRLY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTF
Sbjct  154  LSSVTSIVDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTF  213

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            IKHLLK +YPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLS
Sbjct  214  IKHLLKSTYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLS  273

Query  11   KFE  3
            KFE
Sbjct  274  KFE  276



>ref|XP_010324305.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Solanum 
lycopersicum]
Length=545

 Score =   335 bits (858),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 209/302 (69%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSKE +K++Q WFNFADSDGDGR+TG DA K F MS+L +P+LKQVWA+A
Sbjct  1    MEFDTSPINRCSKEHEKIYQQWFNFADSDGDGRLTGGDAIKFFAMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFL   +F   MQL++LAQ G  + SDLLN       + PP M+ LD LLA    
Sbjct  61   DSKRQGFLNFRDFVVGMQLVALAQAGHAVTSDLLNADVDFENLPPPAMEGLDVLLAKKKL  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S    NGS P                     +       SS+   + SL
Sbjct  121  M--------PKSEQDQNGSAP------------------VPAAPTTSWFSSSKSSKKISL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            T+VTS++DGLK+LY  KLKPLEV Y FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  TSVTSIVDGLKKLYIQKLKPLEVAYHFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLKMSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_006296699.1| hypothetical protein CARUB_v10013398mg [Capsella rubella]
 gb|EOA29597.1| hypothetical protein CARUB_v10013398mg [Capsella rubella]
Length=545

 Score =   334 bits (857),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 218/302 (72%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q ++++WF FADSDGDGR+TGNDA K F MS+L +P+LKQ+WA+A
Sbjct  1    MEIESVAAGSCSKENQMIYKEWFEFADSDGDGRITGNDAIKFFSMSNLPRPELKQIWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQG+LG  +F  AMQL+SLAQ G E++ ++LN       +  PTM+ L  L+A    
Sbjct  61   DSKRQGYLGFKDFIVAMQLVSLAQTGHEISHEVLNSDVDFKDIKSPTMEGLGVLMAKKKH  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
            SS +S  ++  SP        DT+ T                        SS+   + SL
Sbjct  121  SSKSSDLNINGSPA------ADTSLTAHWF--------------------SSKSSKKISL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS++DGLKRLY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIVDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  215  KHLLKASYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>gb|EYU27376.1| hypothetical protein MIMGU_mgv1a004087mg [Erythranthe guttata]
Length=544

 Score =   334 bits (856),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 212/302 (70%), Gaps = 28/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S P + CSKE QK++QDWF+FADSDGDGR+TG DATK F +S+L +  LK VWA+A
Sbjct  1    MEIDSAPISRCSKEHQKIYQDWFSFADSDGDGRLTGADATKFFSLSNLPRQDLKLVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF TAMQL+SLAQ G  L SD+L+ +     +  P +  L         
Sbjct  61   DSKRQGFLGFKEFITAMQLVSLAQAGHALTSDILSSEVDFENLQTPALDGL---------  111

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
             +  +      + P+ NGS P                     S+      SS+   + SL
Sbjct  112  GALLTKKKRLSNEPEQNGS-PQVQS-----------------SLAASWFSSSKSAKKISL  153

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS++DGLKRLY  KLKPLE TY+FNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  154  SSVTSIVDGLKRLYIQKLKPLETTYQFNDFVSPSLTNSDFDAKPMVMLLGQYSTGKTTFI  213

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+ SYPGAHIGPEPTTDRF+VV +GPDERS+PGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  214  KHLLRTSYPGAHIGPEPTTDRFVVVMNGPDERSVPGNTIAVQADMPFSGLTTFGSAFLSK  273

Query  8    FE  3
            FE
Sbjct  274  FE  275



>ref|XP_010538744.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010538745.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Tarenaya 
hassleriana]
Length=545

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/298 (57%), Positives = 206/298 (69%), Gaps = 28/298 (9%)
 Frame = -3

Query  893  SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKR  714
            S P  SC+KE QK++++WFN ADSDGD R++GNDAT  F MS LS+ +LKQVWA+ADSKR
Sbjct  6    SIPIGSCTKEHQKIYKEWFNIADSDGDDRISGNDATIFFAMSKLSRQELKQVWAVADSKR  65

Query  713  QGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspn  537
            QGFLG+ EF TAM+L+SLAQ+G E+ SDLL        + PP ++ L+ L          
Sbjct  66   QGFLGLAEFITAMKLVSLAQDGHEITSDLLKGSVDIKSIEPPVLEGLENL----------  115

Query  536  ssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVT  357
                      +   SK  TN    +        +   P  K        K +  +   V 
Sbjct  116  ----------KQKASKACTNAEENVAGATQPQVVPKAPWFK-------SKPITKAPENVV  158

Query  356  SVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLL  177
            +++DGLKRLYN KLKPLE+TY FNDF SP+LT+SDFDAKPM+MLLGQYSTGKTTFIKHLL
Sbjct  159  TIVDGLKRLYNEKLKPLEMTYHFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  218

Query  176  KCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
             C YPGAHIGPEPTTDRF+VV +GPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  219  GCDYPGAHIGPEPTTDRFVVVMTGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  276



>ref|XP_010538746.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Tarenaya 
hassleriana]
Length=543

 Score =   333 bits (855),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 173/298 (58%), Positives = 210/298 (70%), Gaps = 30/298 (10%)
 Frame = -3

Query  893  SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKR  714
            S P  SC+KE QK++++WFN ADSDGD R++GNDAT  F MS LS+ +LKQVWA+ADSKR
Sbjct  6    SIPIGSCTKEHQKIYKEWFNIADSDGDDRISGNDATIFFAMSKLSRQELKQVWAVADSKR  65

Query  713  QGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspn  537
            QGFLG+ EF TAM+L+SLAQ+G E+ SDLL        + PP ++ L+ L   A      
Sbjct  66   QGFLGLAEFITAMKLVSLAQDGHEITSDLLKGSVDIKSIEPPVLEGLENLKQKA------  119

Query  536  ssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVT  357
                   S   TN    + NG T  + +P             F S    K +  +   V 
Sbjct  120  -------SKACTNA---EENGATQPQVVPKAP---------WFKS----KPITKAPENVV  156

Query  356  SVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLL  177
            +++DGLKRLYN KLKPLE+TY FNDF SP+LT+SDFDAKPM+MLLGQYSTGKTTFIKHLL
Sbjct  157  TIVDGLKRLYNEKLKPLEMTYHFNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLL  216

Query  176  KCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
             C YPGAHIGPEPTTDRF+VV +GPDER+IPGNT+AV ADMPF GL++FGGAFLSKFE
Sbjct  217  GCDYPGAHIGPEPTTDRFVVVMTGPDERTIPGNTMAVQADMPFNGLTSFGGAFLSKFE  274



>ref|XP_007142331.1| hypothetical protein PHAVU_008G271300g [Phaseolus vulgaris]
 gb|ESW14325.1| hypothetical protein PHAVU_008G271300g [Phaseolus vulgaris]
Length=543

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 180/301 (60%), Positives = 214/301 (71%), Gaps = 29/301 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME    P  SCSKE Q +++DWFN ADSD DGR+TG+DATK F MS+LS+  LKQVWA+A
Sbjct  1    MEFDPIPIGSCSKEHQAIYKDWFNCADSDSDGRITGSDATKFFSMSNLSRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            D+KRQG+LG ++F  AMQL+SLAQ G  +  DL         + PP M  LDALL     
Sbjct  61   DTKRQGYLGFSDFIIAMQLVSLAQSGHAITPDLRTSDVDFTNLKPPVMDGLDALLVKK--  118

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                          +    + DTNG++ L+P P         S   FSS+S++K     L
Sbjct  119  --------------KNKHKEVDTNGSSQLQPSP---------SSNWFSSKSTKK---VPL  152

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLE TYRFNDFVSP+L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  153  SSVTSIIDGLKRLYLNKLKPLEATYRFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFI  212

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SG DER++PGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  213  KHLLKSSYPGAHIGPEPTTDRFVVVMSGSDERTVPGNTVAVQADMPFSGLTTFGTAFLSK  272

Query  8    F  6
            F
Sbjct  273  F  273



>ref|XP_009390978.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=544

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 171/301 (57%), Positives = 212/301 (70%), Gaps = 26/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M + +    SCSKEQQK++Q WF +AD DGDGR+TG+DA K F MS LS+P+LKQVWA+A
Sbjct  1    MNLMASSRASCSKEQQKIYQQWFAYADKDGDGRITGSDALKFFAMSKLSRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFL + +F +AMQL++LAQ G E+  D+L+      +  P M+ LDALLA     
Sbjct  61   DSKRQGFLDLLDFISAMQLVALAQAGYEITPDVLSHADLENLKLPVMEGLDALLAVRQLL  120

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                S  ++ SP                             S   F+S++S+K     L+
Sbjct  121  LSEISDDVSASPQHL-----------------------LPASAAWFNSKASKKV---PLS  154

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGLK+LY  KLKPLEV Y+FN+FVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  155  SVTSIIDGLKKLYIEKLKPLEVAYQFNEFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  214

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRF+VVTSGPDERSIPGNT+AV A MP+ GL+ +G  FLSKF
Sbjct  215  HLLQSSYPGAHIGPEPTTDRFVVVTSGPDERSIPGNTIAVQAHMPYHGLTAYGTGFLSKF  274

Query  5    E  3
            E
Sbjct  275  E  275



>ref|XP_009390977.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=544

 Score =   333 bits (854),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 214/301 (71%), Gaps = 26/301 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M + +    SCSKEQQK++Q WF +AD DGDGR+TG+DA K F MS LS+P+LKQVWA+A
Sbjct  1    MNLMASSRASCSKEQQKIYQQWFAYADKDGDGRITGSDALKFFAMSKLSRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFL + +F +AMQL++LAQ G E+  D+L+      +  P M+ LDALLA +  S
Sbjct  61   DSKRQGFLDLLDFISAMQLVALAQAGYEITPDVLSHADLENLKLPVMEGLDALLAKSKRS  120

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
            +  S   L  SP                             S   F+S++S+K     L+
Sbjct  121  AKKSDHRLDASPQHL-----------------------LPASAAWFNSKASKK---VPLS  154

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGLK+LY  KLKPLEV Y+FN+FVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  155  SVTSIIDGLKKLYIEKLKPLEVAYQFNEFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  214

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRF+VVTSGPDERSIPGNT+AV A MP+ GL+ +G  FLSKF
Sbjct  215  HLLQSSYPGAHIGPEPTTDRFVVVTSGPDERSIPGNTIAVQAHMPYHGLTAYGTGFLSKF  274

Query  5    E  3
            E
Sbjct  275  E  275



>ref|XP_009111201.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Brassica 
rapa]
Length=546

 Score =   333 bits (853),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 182/302 (60%), Positives = 219/302 (73%), Gaps = 26/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q ++++WF FADSDGDGR+TG+DA K F MS+L +P+LKQVWA+A
Sbjct  1    MEIDSVAAGSCSKENQLIYKEWFEFADSDGDGRITGSDAIKFFSMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            D+KRQG+LG  +F  AMQL+SLAQ G E++ D+L+       ++PP M+ L  L+A    
Sbjct  61   DAKRQGYLGFKDFIVAMQLVSLAQTGHEISHDVLHSDVDFKNMNPPVMEGLGVLMAKKKH  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
            SS  S+       P  + S                       +   FSS+SS+K    SL
Sbjct  121  SSSKSNDLSVNGSPSADAS----------------------LTAHWFSSKSSKKI---SL  155

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS++DGLKRLY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  156  SSVTSIVDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  215

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  216  KHLLKASYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSK  275

Query  8    FE  3
            FE
Sbjct  276  FE  277



>ref|XP_007147670.1| hypothetical protein PHAVU_006G144500g [Phaseolus vulgaris]
 gb|ESW19664.1| hypothetical protein PHAVU_006G144500g [Phaseolus vulgaris]
Length=535

 Score =   332 bits (851),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 174/288 (60%), Positives = 212/288 (74%), Gaps = 28/288 (10%)
 Frame = -3

Query  863  QQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINEFT  684
            + K +Q+WFN ADSDGDGR++GN+ATK F +S+LS+ QLKQ+W LAD KRQGFLG  EF 
Sbjct  6    RSKEYQEWFNLADSDGDGRISGNEATKFFALSNLSRSQLKQLWTLADVKRQGFLGFPEFV  65

Query  683  TAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasangsspnssgsLTESPP  507
            TAMQL+SLAQ G+ELNSD+L  +     + PP ++ LDALLA  N               
Sbjct  66   TAMQLVSLAQAGQELNSDILKTQVDKENIKPPVLEGLDALLAQKNL--------------  111

Query  506  QTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLKRLY  327
             T  +  D NG    + +P N           F S+SS+K     L +VTS+IDGLKRLY
Sbjct  112  -TITTLSDVNGIAQPQVLPTNW---------WFGSKSSKKL---PLNSVTSIIDGLKRLY  158

Query  326  NAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIG  147
              +LKPLEV YR+NDFVSP+LT++DFDAKPM+MLLGQYSTGKTTFIKHLL+C YPGAH+G
Sbjct  159  IERLKPLEVAYRYNDFVSPLLTNTDFDAKPMVMLLGQYSTGKTTFIKHLLRCDYPGAHVG  218

Query  146  PEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PEPTTDRF+VV SG DERSIPGNT+AV ADMPF+GL+TFGG+FLSKF+
Sbjct  219  PEPTTDRFVVVMSGSDERSIPGNTIAVDADMPFSGLTTFGGSFLSKFQ  266



>ref|XP_010324304.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Solanum 
lycopersicum]
Length=554

 Score =   332 bits (852),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 180/311 (58%), Positives = 211/311 (68%), Gaps = 36/311 (12%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSKE +K++Q WFNFADSDGDGR+TG DA K F MS+L +P+LKQVWA+A
Sbjct  1    MEFDTSPINRCSKEHEKIYQQWFNFADSDGDGRLTGGDAIKFFAMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLN-------LKTAA---GVSPPTMKDL  576
            DSKRQGFL   +F   MQL++LAQ G  + SDLLN       L  A     + PP M+ L
Sbjct  61   DSKRQGFLNFRDFVVGMQLVALAQAGHAVTSDLLNADVDFENLSIAVDFENLPPPAMEGL  120

Query  575  DallasangsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRS  396
            D LLA              +S    NGS P                     +       S
Sbjct  121  DVLLAKKKLM--------PKSEQDQNGSAP------------------VPAAPTTSWFSS  154

Query  395  SRKKVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQ  216
            S+   + SLT+VTS++DGLK+LY  KLKPLEV Y FNDFVSP+LT+SDFDAKPM+MLLGQ
Sbjct  155  SKSSKKISLTSVTSIVDGLKKLYIQKLKPLEVAYHFNDFVSPLLTNSDFDAKPMVMLLGQ  214

Query  215  YSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLS  36
            YSTGKTTFIKHLLK SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+
Sbjct  215  YSTGKTTFIKHLLKMSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLT  274

Query  35   TFGGAFLSKFE  3
            TFG AFLSKFE
Sbjct  275  TFGTAFLSKFE  285



>ref|XP_003610495.1| EH-domain-containing protein [Medicago truncatula]
 gb|AES92692.1| calcium-binding EF hand protein [Medicago truncatula]
Length=542

 Score =   332 bits (850),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 172/302 (57%), Positives = 207/302 (69%), Gaps = 30/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+  S    S S E  + +Q WF  ADSDGDGR++GNDA K F +S+LS+PQLKQVWA+A
Sbjct  1    MKAVSDWIHSSSNEHIETYQQWFILADSDGDGRISGNDAIKFFALSNLSRPQLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKT-AAGVSPPTMKDLDallasang  549
            D+KRQGFLG  EF TAMQLIS+ Q G +LNSD+L  +     +  P M+ +D L+     
Sbjct  61   DTKRQGFLGFEEFVTAMQLISVGQAGYDLNSDILKTQIDNEKIKLPVMEGIDVLV-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                           T  ++PD  GT                  + F   +S+   +  L
Sbjct  116  ---------ANKASSTINAQPDLFGTGQP---------------RPFPPVASKSVKKLPL  151

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +AVTS+IDGLK+LY  +LKPLEVTYRFNDFVSPVLTDSDFDAKPM+MLLGQYSTGKTTFI
Sbjct  152  SAVTSIIDGLKKLYVERLKPLEVTYRFNDFVSPVLTDSDFDAKPMVMLLGQYSTGKTTFI  211

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+C YPGAHIGPEPTTDRF+ V SG DERSIPGNTVAV A MPF+GL+TFG +FLSK
Sbjct  212  KHLLRCEYPGAHIGPEPTTDRFVAVMSGTDERSIPGNTVAVDASMPFSGLTTFGSSFLSK  271

Query  8    FE  3
            F+
Sbjct  272  FQ  273



>ref|XP_007145728.1| hypothetical protein PHAVU_007G262900g [Phaseolus vulgaris]
 gb|ESW17722.1| hypothetical protein PHAVU_007G262900g [Phaseolus vulgaris]
Length=540

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 174/301 (58%), Positives = 215/301 (71%), Gaps = 30/301 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME+A  P  S  K+ Q L+++WFN+ADSDGDGR TG++A K F MS+LS+ +LKQ+WA+A
Sbjct  1    MELAIVPVDSSFKDNQTLYEEWFNYADSDGDGRFTGHEAIKFFTMSNLSRQELKQIWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKR+G+LG  EF TAMQL+SL Q G  +  DLL       V PPTM  LDAL+A     
Sbjct  61   DSKREGYLGFKEFVTAMQLVSLGQCGYSITHDLLTSDVMRHVKPPTMDGLDALVAKKRRK  120

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
            + +   S++  P       P +N                      F ++S +K   PS +
Sbjct  121  NKDKDLSVSPQP------SPASN---------------------WFLAKSVKK--VPS-S  150

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS++DGLKRLY  KLKPLEV YR+NDFVSP+LT+SDFDAKPMI+LLGQYSTGKTTFIK
Sbjct  151  SVTSIVDGLKRLYLQKLKPLEVAYRYNDFVSPLLTNSDFDAKPMILLLGQYSTGKTTFIK  210

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            H+L+ SYPG+HIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG +FLSKF
Sbjct  211  HMLRSSYPGSHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTSFLSKF  270

Query  5    E  3
            E
Sbjct  271  E  271



>ref|XP_002885363.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61622.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 181/308 (59%), Positives = 214/308 (69%), Gaps = 34/308 (11%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q ++++WF FADSDGDGR+TGNDA K F MS+L +P+LKQ+WA+A
Sbjct  1    MEIESVAAGSCSKENQLIYKEWFEFADSDGDGRITGNDAIKFFTMSNLPRPELKQIWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQG+L   +F  AMQL+SLAQ G E++ ++LN       ++PPTM+ L         
Sbjct  61   DSKRQGYLAFKDFIVAMQLVSLAQTGHEISHEILNSDVDFKNINPPTMEGL-------GV  113

Query  548  sspnssgsLTESPPQTNGS-KPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
                   S   S P  NGS   DT+ T                        SS+   + S
Sbjct  114  LMAKKKHSSKSSDPNMNGSPAADTSLTAHWF--------------------SSKSSKKIS  153

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            L++VTS++DGLKRLY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTF
Sbjct  154  LSSVTSIVDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTF  213

Query  191  IKHLLKCSYP-----GAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFG  27
            IKHLLK SYP     GAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG
Sbjct  214  IKHLLKSSYPGNMQTGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFG  273

Query  26   GAFLSKFE  3
             AFLSKFE
Sbjct  274  TAFLSKFE  281



>ref|XP_009145649.1| PREDICTED: EH domain-containing protein 1 isoform X2 [Brassica 
rapa]
Length=544

 Score =   330 bits (847),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 179/303 (59%), Positives = 215/303 (71%), Gaps = 30/303 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q +++DWF FADSDGDGR+TG+DA K F MS+L +P+LKQVWA+A
Sbjct  1    MEIDSVAAGSCSKENQIIYKDWFEFADSDGDGRITGSDAIKFFSMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA--AGVSPPTMKDLDallasan  552
            D+KRQG+LG  EF  AMQL+SLAQ G E++ ++L+        ++PP M  L        
Sbjct  61   DAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDAVDFKNMNPPVMDGL--------  112

Query  551  gsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
                        SP  +     D NG+                +   FSS+SS+K    S
Sbjct  113  ---IVLMAKKKHSPKSS-----DPNGSPAADASL---------TAHWFSSKSSKKI---S  152

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            L++VTS+IDGLKRLY  KLKPLEV Y+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTF
Sbjct  153  LSSVTSIIDGLKRLYIQKLKPLEVAYQFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTF  212

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            IKH+LK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL++FG AFLS
Sbjct  213  IKHMLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTSFGTAFLS  272

Query  11   KFE  3
            KFE
Sbjct  273  KFE  275



>gb|EPS69769.1| hypothetical protein M569_04997, partial [Genlisea aurea]
Length=401

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 168/291 (58%), Positives = 189/291 (65%), Gaps = 56/291 (19%)
 Frame = -3

Query  875  CSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGI  696
            CSKE+ K +Q WFNFADSD DGR+T N+AT    MS LSKP+LKQ+WA+ADS+RQGFL  
Sbjct  1    CSKEELKFYQTWFNFADSDRDGRLTANEATIFLSMSGLSKPELKQIWAIADSRRQGFLDF  60

Query  695  NEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsLTE  516
             EF +AMQLISLAQEG  + +D+L +   A +                            
Sbjct  61   KEFISAMQLISLAQEGRVITADILKITVKANLEKV-------------------------  95

Query  515  SPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLK  336
            SPP   G      G T                               S  AVTSVIDGLK
Sbjct  96   SPPHMEGLDALIEGNT-------------------------------SFNAVTSVIDGLK  124

Query  335  RLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGA  156
             LYN KLKPLE TY+FNDFVSP LT SDFDAKPM+MLLGQYSTGKTTFIKHLL+ SYPGA
Sbjct  125  MLYNEKLKPLEATYQFNDFVSPFLTASDFDAKPMVMLLGQYSTGKTTFIKHLLQSSYPGA  184

Query  155  HIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            HIGPEPTTDRFIVV SGPDERSIPGNT+AV  D+PFTGL+TFGG+FLSKFE
Sbjct  185  HIGPEPTTDRFIVVMSGPDERSIPGNTIAVRKDLPFTGLTTFGGSFLSKFE  235



>ref|XP_009145651.1| PREDICTED: EH domain-containing protein 1 isoform X4 [Brassica 
rapa]
Length=543

 Score =   330 bits (846),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 215/302 (71%), Gaps = 29/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q +++DWF FADSDGDGR+TG+DA K F MS+L +P+LKQVWA+A
Sbjct  1    MEIDSVAAGSCSKENQIIYKDWFEFADSDGDGRITGSDAIKFFSMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            D+KRQG+LG  EF  AMQL+SLAQ G E++ ++L+       ++PP M  L         
Sbjct  61   DAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDVDFKNMNPPVMDGL---------  111

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       SP  +     D NG+                +   FSS+SS+K    SL
Sbjct  112  --IVLMAKKKHSPKSS-----DPNGSPAADASL---------TAHWFSSKSSKKI---SL  152

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS+IDGLKRLY  KLKPLEV Y+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  153  SSVTSIIDGLKRLYIQKLKPLEVAYQFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  212

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KH+LK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL++FG AFLSK
Sbjct  213  KHMLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTSFGTAFLSK  272

Query  8    FE  3
            FE
Sbjct  273  FE  274



>ref|XP_009390979.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=539

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/301 (57%), Positives = 212/301 (70%), Gaps = 31/301 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M + +    SCSKEQQK++Q WF +AD DGDGR+TG+DA K F MS LS+P+LKQVWA+A
Sbjct  1    MNLMASSRASCSKEQQKIYQQWFAYADKDGDGRITGSDALKFFAMSKLSRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFL + +F +AMQL++LAQ G E+  D+L+      +  P M+ LDALLA +  S
Sbjct  61   DSKRQGFLDLLDFISAMQLVALAQAGYEITPDVLSHADLENLKLPVMEGLDALLALSEIS  120

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                      + PQ                           S   F+S++S+K     L+
Sbjct  121  DD------VSASPQ----------------------HLLPASAAWFNSKASKKV---PLS  149

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGLK+LY  KLKPLEV Y+FN+FVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  150  SVTSIIDGLKKLYIEKLKPLEVAYQFNEFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  209

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRF+VVTSGPDERSIPGNT+AV A MP+ GL+ +G  FLSKF
Sbjct  210  HLLQSSYPGAHIGPEPTTDRFVVVTSGPDERSIPGNTIAVQAHMPYHGLTAYGTGFLSKF  269

Query  5    E  3
            E
Sbjct  270  E  270



>ref|XP_009401415.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=541

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 212/301 (70%), Gaps = 30/301 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+I S    S SKE  K++Q+WF+FADSDGDGR+TG DA K F MS+L +  LKQVWA+A
Sbjct  1    MDIVS---YSISKENDKIYQNWFSFADSDGDGRLTGTDAIKFFAMSNLPRGDLKQVWAIA  57

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DS+RQG+LG  EF  AM+L+SLAQEG E+    L       V+PP M+ LD  L++   S
Sbjct  58   DSRRQGYLGFKEFVIAMKLVSLAQEGNEITQVALAHADLEKVNPPVMEGLDTFLSTNKPS  117

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                       P Q   S+P T                  P ++ F ++S++K     L+
Sbjct  118  IKEI------DPEQDVNSQPQT------------------PKLQWFGTKSTKKI---PLS  150

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGL+RLY  KLKPLEVTY+F+DF S +LT SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  151  SVTSIIDGLERLYIQKLKPLEVTYQFSDFGSSLLTSSDFDAKPMVMLLGQYSTGKTTFIK  210

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLLKCSYPGAHIGPEPTTDRF++V  GPDER+IPGNT+AV ADMPFTGL+T+G AFLSKF
Sbjct  211  HLLKCSYPGAHIGPEPTTDRFVIVMLGPDERTIPGNTIAVQADMPFTGLTTYGNAFLSKF  270

Query  5    E  3
            E
Sbjct  271  E  271



>gb|KEH33921.1| EPS15-like domain protein [Medicago truncatula]
Length=543

 Score =   327 bits (838),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/301 (59%), Positives = 212/301 (70%), Gaps = 30/301 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI + P  S SKE   L+Q+WFN+AD+DGDGR TG +ATK F MS+LS+ +LKQVWA+A
Sbjct  4    MEIVTVPNDSNSKENLTLYQEWFNYADADGDGRFTGTEATKFFAMSNLSRQELKQVWAIA  63

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKR+G+LG  EF  +MQL+SL Q G  +  DLL       V PP M+ LDAL+A     
Sbjct  64   DSKREGYLGFKEFVISMQLVSLGQSGHSITQDLLTSDLIKNVKPPKMEGLDALVAKKKRK  123

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
              +   S++  P  ++                           K FS++SS+K    S +
Sbjct  124  HKDKDRSVSPLPSPSD---------------------------KWFSAKSSKKI---SAS  153

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS+IDGLKRLY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIK
Sbjct  154  SVTSIIDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIK  213

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            H+L+ SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF GL+ FG AFLSKF
Sbjct  214  HMLQSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFGGLTNFGSAFLSKF  273

Query  5    E  3
            E
Sbjct  274  E  274



>dbj|BAB02809.1| unnamed protein product [Arabidopsis thaliana]
Length=524

 Score =   326 bits (836),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 211/302 (70%), Gaps = 48/302 (16%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q ++++WF F+DSDGDGR+TGNDA K F MS+L +P+LKQ+WA+A
Sbjct  1    MEIESVAAGSCSKENQMIYKEWFEFSDSDGDGRITGNDAIKFFTMSNLPRPELKQIWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQG+LG  EF  AMQL+SLAQ G E++ ++L       +S    K+++         
Sbjct  61   DSKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVL-------ISDVDFKNIN---------  104

Query  545  spnssgsLTESPPQTNGS-KPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                       PP   GS   DT+ T                    FSS+SS+K    S+
Sbjct  105  -----------PPTMEGSPAADTSLTA-----------------HWFSSKSSKKISLSSV  136

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            T++   +DGLKRLY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  137  TSI---VDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  193

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK +YPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSK
Sbjct  194  KHLLKSTYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSK  253

Query  8    FE  3
            FE
Sbjct  254  FE  255



>ref|XP_011097835.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Sesamum 
indicum]
Length=538

 Score =   326 bits (836),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/292 (60%), Positives = 205/292 (70%), Gaps = 32/292 (11%)
 Frame = -3

Query  875  CSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGI  696
            CS+E QK++Q WF F DSDGDGR+T NDA+K F MS+L +P LKQ+WA+ADSKRQGFL  
Sbjct  9    CSQEHQKIYQTWFAFVDSDGDGRLTANDASKFFSMSNLPRPDLKQMWAIADSKRQGFLEF  68

Query  695  NEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasangsspnssgsLT  519
             EF  AMQL+SLAQ G  L  D+LN +     + PPTM+ LD LLA              
Sbjct  69   KEFVLAMQLVSLAQAGHTLTRDILNTEVDFENLPPPTMEGLDKLLAKKKRL---------  119

Query  518  ESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGL  339
             S P+ NGS+  ++                  S+ +F S  S K    S  +VTS+IDGL
Sbjct  120  -SEPE-NGSQRQSSS-----------------SVNLFHSSKSSKM---SGASVTSIIDGL  157

Query  338  KRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPG  159
            KRLY  KLKPLE TY+FN+FVSP LT+SDFDAKPM+MLLGQYSTGKTTFIKHLL  +YPG
Sbjct  158  KRLYMKKLKPLEDTYQFNNFVSPSLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLGTTYPG  217

Query  158  AHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            AHIGPEPTTDRF+VV +G DERS+PGNTVAV ADMPF GL+TFG AFLSKFE
Sbjct  218  AHIGPEPTTDRFVVVMNGADERSVPGNTVAVQADMPFNGLTTFGTAFLSKFE  269



>ref|XP_011097837.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Sesamum 
indicum]
Length=537

 Score =   326 bits (836),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/292 (60%), Positives = 205/292 (70%), Gaps = 33/292 (11%)
 Frame = -3

Query  875  CSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGI  696
            CS+E QK++Q WF F DSDGDGR+T NDA+K F MS+L +P LKQ+WA+ADSKRQGFL  
Sbjct  9    CSQEHQKIYQTWFAFVDSDGDGRLTANDASKFFSMSNLPRPDLKQMWAIADSKRQGFLEF  68

Query  695  NEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasangsspnssgsLT  519
             EF  AMQL+SLAQ G  L  D+LN +     + PPTM+ LD LLA              
Sbjct  69   KEFVLAMQLVSLAQAGHTLTRDILNTEVDFENLPPPTMEGLDKLLAKKRL----------  118

Query  518  ESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGL  339
             S P+ NGS+  ++                  S+ +F S  S K    S  +VTS+IDGL
Sbjct  119  -SEPE-NGSQRQSSS-----------------SVNLFHSSKSSKM---SGASVTSIIDGL  156

Query  338  KRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPG  159
            KRLY  KLKPLE TY+FN+FVSP LT+SDFDAKPM+MLLGQYSTGKTTFIKHLL  +YPG
Sbjct  157  KRLYMKKLKPLEDTYQFNNFVSPSLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLGTTYPG  216

Query  158  AHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            AHIGPEPTTDRF+VV +G DERS+PGNTVAV ADMPF GL+TFG AFLSKFE
Sbjct  217  AHIGPEPTTDRFVVVMNGADERSVPGNTVAVQADMPFNGLTTFGTAFLSKFE  268



>ref|XP_009145648.1| PREDICTED: EH domain-containing protein 1 isoform X1 [Brassica 
rapa]
Length=545

 Score =   326 bits (835),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/303 (58%), Positives = 212/303 (70%), Gaps = 29/303 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q +++DWF FADSDGDGR+TG+DA K F MS+L +P+LKQVWA+A
Sbjct  1    MEIDSVAAGSCSKENQIIYKDWFEFADSDGDGRITGSDAIKFFSMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA--AGVSPPTMKDLDallasan  552
            D+KRQG+LG  EF  AMQL+SLAQ G E++ ++L+        ++PP M  L        
Sbjct  61   DAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDAVDFKNMNPPVMDGL--------  112

Query  551  gsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
                     L     + +    D NG+                +   FSS+SS+K    S
Sbjct  113  -------IVLMAKKKKHSPKSSDPNGSP---------AADASLTAHWFSSKSSKKISLSS  156

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            +T   S+IDGLKRLY  KLKPLEV Y+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTF
Sbjct  157  VT---SIIDGLKRLYIQKLKPLEVAYQFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTF  213

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
            IKH+LK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL++FG AFLS
Sbjct  214  IKHMLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTSFGTAFLS  273

Query  11   KFE  3
            KFE
Sbjct  274  KFE  276



>ref|XP_009145650.1| PREDICTED: EH domain-containing protein 1 isoform X3 [Brassica 
rapa]
Length=544

 Score =   325 bits (834),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 212/302 (70%), Gaps = 28/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q +++DWF FADSDGDGR+TG+DA K F MS+L +P+LKQVWA+A
Sbjct  1    MEIDSVAAGSCSKENQIIYKDWFEFADSDGDGRITGSDAIKFFSMSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            D+KRQG+LG  EF  AMQL+SLAQ G E++ ++L+       ++PP M  L         
Sbjct  61   DAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDVDFKNMNPPVMDGL---------  111

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                    L     + +    D NG+                +   FSS+SS+K    S+
Sbjct  112  ------IVLMAKKKKHSPKSSDPNGSP---------AADASLTAHWFSSKSSKKISLSSV  156

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            T   S+IDGLKRLY  KLKPLEV Y+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  157  T---SIIDGLKRLYIQKLKPLEVAYQFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  213

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KH+LK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL++FG AFLSK
Sbjct  214  KHMLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTSFGTAFLSK  273

Query  8    FE  3
            FE
Sbjct  274  FE  275



>gb|KFK39351.1| hypothetical protein AALP_AA3G233100 [Arabis alpina]
Length=543

 Score =   325 bits (833),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 175/302 (58%), Positives = 213/302 (71%), Gaps = 29/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S    SCSKE Q ++++WF FADSDGDGR+TGNDA K F  S+L +P+LKQVWA+A
Sbjct  1    MEIDSVAAGSCSKENQIIYKEWFEFADSDGDGRITGNDAIKFFSKSNLPRPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF  AMQL+SLAQ G E++ ++L        ++PPTM+ L  L++    
Sbjct  61   DSKRQGFLGFKEFIVAMQLVSLAQTGHEISHEVLQSDVDFQNMNPPTMEGLGVLMSKK--  118

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                          + +    D NG+                +   FSS+SS+K    ++
Sbjct  119  --------------KHSSKSSDPNGSP---------TADASLTAHWFSSKSSKKISLSAV  155

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            T   S++DGLKRLY  K+KPLEV Y+FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  156  T---SIVDGLKRLYIQKVKPLEVAYQFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  212

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLLK SYPGAHIGPEPTTDRF+ V SGPDERSIPGNTVAV ADMPF+GL++FG AFLSK
Sbjct  213  KHLLKASYPGAHIGPEPTTDRFVAVMSGPDERSIPGNTVAVQADMPFSGLTSFGTAFLSK  272

Query  8    FE  3
            FE
Sbjct  273  FE  274



>ref|XP_006652990.1| PREDICTED: EH domain-containing protein 1-like [Oryza brachyantha]
Length=542

 Score =   323 bits (828),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 169/292 (58%), Positives = 206/292 (71%), Gaps = 34/292 (12%)
 Frame = -3

Query  869  KEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINE  690
            +EQ++ +  WF+ AD DGDGRVTG DA K F MS+LS+P LKQVWA+ADSKRQG+LG +E
Sbjct  13   REQRETYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPDLKQVWAIADSKRQGYLGFSE  72

Query  689  FTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsL---T  519
            F TAMQL+SLAQ G E++ D+L       + PPTM+ LD  L     S  +S+  +   +
Sbjct  73   FMTAMQLVSLAQAGNEISQDILAHADLDMLKPPTMEGLDKKLKKNYVSKSHSNIVVCHPS  132

Query  518  ESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGL  339
            ESP   N                             F+S+S +K     L +VTS+IDGL
Sbjct  133  ESPASAN----------------------------WFNSKSGKKI---PLRSVTSIIDGL  161

Query  338  KRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPG  159
            K+ Y  KL+PLE TY+F+DFVSP+LT SDFDAKPM+MLLGQYSTGKTTFIKHLLK SYPG
Sbjct  162  KKSYIEKLRPLEKTYQFDDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLKTSYPG  221

Query  158  AHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            AHIGPEPTTDRF+V+TSGPDER IPGNT+AV ADMP++GLS+FG AFLSKFE
Sbjct  222  AHIGPEPTTDRFVVITSGPDERCIPGNTIAVQADMPYSGLSSFGTAFLSKFE  273



>gb|KHN38249.1| EH domain-containing protein 1 [Glycine soja]
Length=546

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 179/305 (59%), Positives = 215/305 (70%), Gaps = 34/305 (11%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME    P  SCSKE Q ++++WFN+ADSD DGR+TG+DATK F MS+LS+  LKQVWA+A
Sbjct  1    MEFDPIPIGSCSKEHQMIYKEWFNYADSDSDGRITGSDATKFFAMSNLSREDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLL--NLKTAAGVSPPTMKDLDallasan  552
            DSKRQG+LG  EF  AMQL+SLAQ G  +  DLL  ++    G  PP+M+ LD LL    
Sbjct  61   DSKRQGYLGFTEFIIAMQLVSLAQSGHSITPDLLTSDVDFTNG-KPPSMEGLDVLLVKK-  118

Query  551  gsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKK---V  381
                           +    + D NG++ L+P P         S   FSS+S++K    +
Sbjct  119  ---------------KHKQKEVDANGSSQLQPSP---------SSNWFSSKSTKKASILL  154

Query  380  QPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGK  201
               L++VTS+IDGLKRLY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGK
Sbjct  155  LVPLSSVTSIIDGLKRLYIQKLKPLEVNYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGK  214

Query  200  TTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGA  21
            TTFIKHLLK     AHIGPEPTTDRF+VV SG DERS+PGNTVAV ADMPF+GL+TFG A
Sbjct  215  TTFIKHLLKSR---AHIGPEPTTDRFVVVMSGSDERSVPGNTVAVQADMPFSGLTTFGTA  271

Query  20   FLSKF  6
            FLSKF
Sbjct  272  FLSKF  276



>ref|NP_001054202.1| Os04g0669300 [Oryza sativa Japonica Group]
 emb|CAE02814.2| OSJNBa0043A12.19 [Oryza sativa Japonica Group]
 dbj|BAF16116.1| Os04g0669300 [Oryza sativa Japonica Group]
 gb|EEC78218.1| hypothetical protein OsI_17853 [Oryza sativa Indica Group]
 gb|EEE61874.1| hypothetical protein OsJ_16560 [Oryza sativa Japonica Group]
Length=542

 Score =   321 bits (823),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 167/289 (58%), Positives = 203/289 (70%), Gaps = 28/289 (10%)
 Frame = -3

Query  869  KEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINE  690
            +EQ++ +  WF+ AD DGDGRVTG DA K F MS+LS+P+LKQVWA+ADSKRQG+LG +E
Sbjct  13   REQREAYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPELKQVWAIADSKRQGYLGFSE  72

Query  689  FTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsLTESP  510
            F TAMQL+SLAQ G E++ D L       + PPTM+ LD  L                  
Sbjct  73   FMTAMQLVSLAQAGNEISQDTLAHADLETLLPPTMEGLDKKL------------------  114

Query  509  PQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLKRL  330
               N S   +N    +R            S   F+S+S +K     L +VTS+IDGLK+ 
Sbjct  115  --KNNSMSKSNSDIVVRHPSELPA-----SANWFNSKSGKKI---PLRSVTSIIDGLKKS  164

Query  329  YNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGAHI  150
            Y  KL+PLE TY+F+DFVSP+LT SDFDAKPM+MLLGQYSTGKTTFIKHLLK +YPGAHI
Sbjct  165  YIEKLRPLEKTYQFDDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLKTNYPGAHI  224

Query  149  GPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            GPEPTTDRF+V+TSGPDER IPGNT+AV ADMP++GLS+FG AFLSKFE
Sbjct  225  GPEPTTDRFVVITSGPDERCIPGNTIAVQADMPYSGLSSFGTAFLSKFE  273



>ref|XP_002447292.1| hypothetical protein SORBIDRAFT_06g032210 [Sorghum bicolor]
 gb|EES11620.1| hypothetical protein SORBIDRAFT_06g032210 [Sorghum bicolor]
Length=542

 Score =   320 bits (821),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 169/297 (57%), Positives = 205/297 (69%), Gaps = 28/297 (9%)
 Frame = -3

Query  893  SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKR  714
            S P     KEQ+  +  WF  AD DGDGR+TGNDA + F MS+LSKP+LKQVWA+ADSKR
Sbjct  5    SSPKKWSLKEQRAAYLQWFALADEDGDGRLTGNDALRFFAMSNLSKPELKQVWAIADSKR  64

Query  713  QGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspns  534
            QG+LG  EF TAMQL+SLAQ G E+N D L+      +  PTM+ L              
Sbjct  65   QGYLGFFEFMTAMQLVSLAQAGNEINQDTLSNSDLERLQLPTMEGL--------------  110

Query  533  sgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTS  354
                 +   + +GSK ++        I    P     S   F+S+S +K     L +VTS
Sbjct  111  ----AKKLKKNSGSKGES-------AIVACHPSESPISASWFNSKSGKKI---PLKSVTS  156

Query  353  VIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLK  174
            +IDGLK+ Y  KL+PLE TY+F+DFVSP++T SDFDAKPM+MLLGQYSTGKTTFIKHLLK
Sbjct  157  IIDGLKKSYIEKLRPLEKTYQFHDFVSPLMTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  216

Query  173  CSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
             SYPGAHIGPEPTTDRF+V+TSGPDER IPGNT+AV ADMP++GLS+FG AFLSKFE
Sbjct  217  TSYPGAHIGPEPTTDRFVVITSGPDERCIPGNTIAVQADMPYSGLSSFGTAFLSKFE  273



>gb|AEV41109.1| putative EH-domain-containing protein 1 [Oryza officinalis]
Length=542

 Score =   320 bits (821),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 168/292 (58%), Positives = 203/292 (70%), Gaps = 34/292 (12%)
 Frame = -3

Query  869  KEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINE  690
            +EQ+  +  WF+ AD DGDGRVTG DA K F MS+LS+P+LKQVWA+ADSKRQG+LG +E
Sbjct  13   REQRDAYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPELKQVWAIADSKRQGYLGFSE  72

Query  689  FTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsL---T  519
            F TAMQL+SLAQ G E++ D L       + PPTM+ LD  L   + S  +S       +
Sbjct  73   FMTAMQLVSLAQAGNEISQDTLAHADLERLLPPTMEGLDKKLKKNSVSKSHSDIIARHPS  132

Query  518  ESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGL  339
            E P   N                             F+S+S +K     L +VTS+IDGL
Sbjct  133  ELPASAN----------------------------WFNSKSGKKI---PLRSVTSIIDGL  161

Query  338  KRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPG  159
            K+ Y  KL+PLE TY+F+DFVSP+LT SDFDAKPM+MLLGQYSTGKTTFIKHLLK SYPG
Sbjct  162  KKSYIEKLRPLEKTYQFDDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLKTSYPG  221

Query  158  AHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            AHIGPEPTTDRF+V+TSGPDER IPGNT+AV ADMP++GLS+FG AFLSKFE
Sbjct  222  AHIGPEPTTDRFVVITSGPDERCIPGNTIAVQADMPYSGLSSFGTAFLSKFE  273



>gb|AEV41063.1| putative EH-domain-containing protein 1 [Oryza minuta]
Length=542

 Score =   320 bits (820),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 168/292 (58%), Positives = 202/292 (69%), Gaps = 34/292 (12%)
 Frame = -3

Query  869  KEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINE  690
            +EQ+  +  WF+ AD DGDGRVTG DA K F MS+LS+P+LKQVWA+ADSKRQG+LG +E
Sbjct  13   REQRDAYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPELKQVWAIADSKRQGYLGFSE  72

Query  689  FTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsL---T  519
            F TAMQL+SLAQ G E++ D L       + PPTM+ LD  L   + S   S       +
Sbjct  73   FMTAMQLVSLAQAGNEISQDTLAHADLERLLPPTMEGLDKKLKKNSVSKSYSDIIARHPS  132

Query  518  ESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGL  339
            E P   N                             F+S+S +K     L +VTS+IDGL
Sbjct  133  ELPASAN----------------------------WFNSKSGKKI---PLRSVTSIIDGL  161

Query  338  KRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPG  159
            K+ Y  KL+PLE TY+F+DFVSP+LT SDFDAKPM+MLLGQYSTGKTTFIKHLLK SYPG
Sbjct  162  KKSYIEKLRPLEKTYQFDDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLKTSYPG  221

Query  158  AHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            AHIGPEPTTDRF+V+TSGPDER IPGNT+AV ADMP++GLS+FG AFLSKFE
Sbjct  222  AHIGPEPTTDRFVVITSGPDERCIPGNTIAVQADMPYSGLSSFGTAFLSKFE  273



>gb|AEV40966.1| putative EH-domain-containing protein 1 [Oryza punctata]
Length=542

 Score =   320 bits (819),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 168/292 (58%), Positives = 203/292 (70%), Gaps = 34/292 (12%)
 Frame = -3

Query  869  KEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINE  690
            +EQ+  +  WF+ AD DGDGRVTG DA K F MS+LS+P+LKQVWA++DSKRQG+LG +E
Sbjct  13   REQRDTYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPELKQVWAISDSKRQGYLGFSE  72

Query  689  FTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsL---T  519
            F TAMQL+SLAQ G E++ D L       + PPTM+ LD  L   + S  +S       +
Sbjct  73   FMTAMQLVSLAQAGNEISQDTLAHADLERLLPPTMEGLDKKLKKNSVSKSHSDIVARHPS  132

Query  518  ESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGL  339
            E P   N                             F+S+S +K     L +VTSVIDGL
Sbjct  133  EVPASAN----------------------------WFNSKSGKKI---PLRSVTSVIDGL  161

Query  338  KRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPG  159
            K+ Y  KL+PLE TY+F+DFVSP+LT SDFDAKPM+MLLGQYSTGKTTFIKHLLK SYPG
Sbjct  162  KKSYIEKLRPLEKTYQFDDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLKTSYPG  221

Query  158  AHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            AHIGPEPTTDRF+V+TSGPDER IPGNT+AV ADMP++GLS+FG AFLSKFE
Sbjct  222  AHIGPEPTTDRFVVITSGPDERCIPGNTIAVQADMPYSGLSSFGTAFLSKFE  273



>ref|XP_003579456.1| PREDICTED: EH domain-containing protein 1-like [Brachypodium 
distachyon]
Length=548

 Score =   319 bits (818),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 203/292 (70%), Gaps = 34/292 (12%)
 Frame = -3

Query  869  KEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINE  690
            KEQ+ ++  WF  AD DGDGRVTG DA K F MS+L++ +LKQVWA+ADSKRQG+LG  E
Sbjct  19   KEQRSVYLRWFYIADDDGDGRVTGKDALKFFAMSNLARDELKQVWAIADSKRQGYLGFAE  78

Query  689  FTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsL---T  519
            F  AMQL+SLAQ G+E++ D +       + PPTM+ LD  L   + +  +S  +    T
Sbjct  79   FMAAMQLVSLAQAGQEISKDTIAHADLDNLQPPTMEGLDKKLKKKSANRSSSDITAYHPT  138

Query  518  ESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGL  339
            ESP                             S   F+S+S +K    +L +VTS+IDGL
Sbjct  139  ESP----------------------------LSSSWFNSKSGKK---ITLKSVTSIIDGL  167

Query  338  KRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPG  159
            K+ Y  KL+PLE TY++NDFVSP+LT SDFDAKPMIMLLGQYSTGKTTF+KHLLK SYPG
Sbjct  168  KKSYIEKLRPLEKTYQYNDFVSPLLTSSDFDAKPMIMLLGQYSTGKTTFVKHLLKTSYPG  227

Query  158  AHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            AHIGPEPTTDRF+V+TSGPDER IPGNT+AV ADMP++GLS FG AFLSKFE
Sbjct  228  AHIGPEPTTDRFVVITSGPDERCIPGNTIAVQADMPYSGLSAFGTAFLSKFE  279



>ref|NP_001167939.1| uncharacterized protein LOC100381653 [Zea mays]
 gb|ACN26585.1| unknown [Zea mays]
 tpg|DAA35458.1| TPA: hypothetical protein ZEAMMB73_021494 [Zea mays]
Length=543

 Score =   318 bits (816),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/297 (56%), Positives = 204/297 (69%), Gaps = 27/297 (9%)
 Frame = -3

Query  893  SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKR  714
            S P     KEQ+  +  WF  AD DGDGR+TGNDA + F MS+LSKP+LKQVWA+ADSKR
Sbjct  5    SSPKKLSLKEQRAAYLQWFALADEDGDGRLTGNDALRFFAMSNLSKPELKQVWAIADSKR  64

Query  713  QGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspns  534
            QG+LG  EF TAMQL+SLAQ G E+N D L       +  PTM  L              
Sbjct  65   QGYLGFYEFMTAMQLVSLAQAGNEINQDTLPNADLEKLQLPTMDGL--------------  110

Query  533  sgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTS  354
                 +   + +GSK ++        +  +    P  +   F+S+S +K     L +VTS
Sbjct  111  ----AKKLKKNSGSKVES------AIVACHPSEAPTMTASWFNSKSGKKI---PLKSVTS  157

Query  353  VIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLK  174
            ++DGLK+ Y  KL+PLE TY+F+DFVSP+LT SDFDAKPM+MLLGQYSTGKTTFIKHLLK
Sbjct  158  IVDGLKKSYIEKLRPLEKTYQFHDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  217

Query  173  CSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
             SYPGAHIGPEPTTDRF+V+TSGPDER IPGNT+AV ADMP++GLS+FG AFLSKFE
Sbjct  218  TSYPGAHIGPEPTTDRFVVITSGPDERCIPGNTIAVQADMPYSGLSSFGTAFLSKFE  274



>tpg|DAA35457.1| TPA: hypothetical protein ZEAMMB73_021494 [Zea mays]
Length=541

 Score =   318 bits (815),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/297 (56%), Positives = 197/297 (66%), Gaps = 29/297 (10%)
 Frame = -3

Query  893  SGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKR  714
            S P     KEQ+  +  WF  AD DGDGR+TGNDA + F MS+LSKP+LKQVWA+ADSKR
Sbjct  5    SSPKKLSLKEQRAAYLQWFALADEDGDGRLTGNDALRFFAMSNLSKPELKQVWAIADSKR  64

Query  713  QGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspns  534
            QG+LG  EF TAMQL+SLAQ G E+N D L       +  PTM  L   L S +      
Sbjct  65   QGYLGFYEFMTAMQLVSLAQAGNEINQDTLPNADLEKLQLPTMDGLAKKLNSGSKVESAI  124

Query  533  sgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTS  354
                    P    S                           F+S+S +K     L +VTS
Sbjct  125  VACHPSEAPTMTAS--------------------------WFNSKSGKKI---PLKSVTS  155

Query  353  VIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLK  174
            ++DGLK+ Y  KL+PLE TY+F+DFVSP+LT SDFDAKPM+MLLGQYSTGKTTFIKHLLK
Sbjct  156  IVDGLKKSYIEKLRPLEKTYQFHDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLK  215

Query  173  CSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
             SYPGAHIGPEPTTDRF+V+TSGPDER IPGNT+AV ADMP++GLS+FG AFLSKFE
Sbjct  216  TSYPGAHIGPEPTTDRFVVITSGPDERCIPGNTIAVQADMPYSGLSSFGTAFLSKFE  272



>gb|AEV41016.1| putative EH-domain-containing protein 1 [Oryza minuta]
Length=542

 Score =   317 bits (812),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 167/292 (57%), Positives = 201/292 (69%), Gaps = 34/292 (12%)
 Frame = -3

Query  869  KEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINE  690
            +EQ+  +  WF+ AD DGDGRVTG DA K F MS+LS+P+LKQVWA++DSKRQG+LG +E
Sbjct  13   REQRDTYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPELKQVWAISDSKRQGYLGFSE  72

Query  689  FTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsL---T  519
            F TAMQL+SLAQ G E++ D L       + PPTM+ LD  L   + S  +S       +
Sbjct  73   FMTAMQLVSLAQAGNEISQDTLARADLERLLPPTMEGLDKKLKKNSVSKSHSDIVARHPS  132

Query  518  ESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGL  339
            E P   N                             F+S+S RK     L +VTSVIDGL
Sbjct  133  EVPASAN----------------------------WFNSKSGRK---IPLRSVTSVIDGL  161

Query  338  KRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPG  159
            K+ Y  KL+PLE TY+F+DFVSP+LT SDF  KPM+MLLGQYSTGKTTFIKHLLK SYPG
Sbjct  162  KKSYIEKLRPLEKTYQFDDFVSPLLTSSDFHGKPMVMLLGQYSTGKTTFIKHLLKTSYPG  221

Query  158  AHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            AHIGPEPTTDRF+V+TSGPDER IPGNT+AV ADMP++GLS+FG AFLSKFE
Sbjct  222  AHIGPEPTTDRFVVITSGPDERCIPGNTIAVQADMPYSGLSSFGTAFLSKFE  273



>ref|XP_010313928.1| PREDICTED: EH domain-containing protein 3-like [Solanum lycopersicum]
Length=545

 Score =   311 bits (798),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 173/302 (57%), Positives = 209/302 (69%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSK+ +K++Q WF+ ADSDGDGR+TG DA K F MS+L +  LKQVWA+A
Sbjct  1    MEFDTSPINRCSKDHEKIYQQWFSLADSDGDGRLTGGDAIKFFAMSNLPRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF  AMQL+SLAQ G  ++SDLLN +     + PP+++ LD L      
Sbjct  61   DSKRQGFLGFREFIAAMQLVSLAQAGHPVSSDLLNAEVDFENLQPPSLEGLDLLQTKKKR  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S P+ NGS    +  T                       SS    + SL
Sbjct  121  M--------PKSEPEQNGSSTMQSSATANWFS------------------SSASVKKVSL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS++DGLK+LY  KLKPLE TY FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIVDGLKKLYLQKLKPLEATYHFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL  SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV A+MPF+GL+TFG AFLSK
Sbjct  215  KHLLGTSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQANMPFSGLTTFGSAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>gb|EYU33672.1| hypothetical protein MIMGU_mgv1a004199mg [Erythranthe guttata]
Length=539

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 177/302 (59%), Positives = 206/302 (68%), Gaps = 33/302 (11%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S     CSKE QK++Q WF++ DSDGDGR+T NDA+K F MS+LS+  LKQVWA+A
Sbjct  1    MEIGSARIGRCSKEHQKIYQSWFSYVDSDGDGRLTANDASKFFTMSNLSRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            D KRQGFLG NEF  AMQL+SLAQ G  L SD+L  +     + PP M+ LDALL     
Sbjct  61   DMKRQGFLGFNEFVAAMQLVSLAQAGHNLTSDILKSEVDFENLQPPAMEGLDALL-----  115

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                        P +   S  + NG+                +   FSS  S K    S 
Sbjct  116  ------------PKKKRSSGAEQNGSQ------------MQLAANWFSSSKSAKV---SS  148

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            T VTS++DGLK+LY  KLKPLE TY+FNDFVSP L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  149  TPVTSIVDGLKKLYLKKLKPLETTYKFNDFVSPSLINSDFDAKPMVMLLGQYSTGKTTFI  208

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL   YPG+HIGPEPTTDRF+VV +GPDERS+PGNTVAV ADMPF GL+TFG AFLSK
Sbjct  209  KHLLGSGYPGSHIGPEPTTDRFVVVMNGPDERSVPGNTVAVQADMPFNGLTTFGTAFLSK  268

Query  8    FE  3
            FE
Sbjct  269  FE  270



>ref|XP_009770782.1| PREDICTED: EH domain-containing protein 1-like isoform X4 [Nicotiana 
sylvestris]
Length=543

 Score =   307 bits (786),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 210/307 (68%), Gaps = 39/307 (13%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSK+ +K++Q+WFNFADSDGDGR+TG DAT    MS+LS+  LKQVWA+A
Sbjct  1    MEFDTFPINQCSKKHEKIYQEWFNFADSDGDGRLTGKDATNFLAMSNLSRDHLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF TAMQL+SLAQ G  + SD LN +     +  PTM+ LD LLA    
Sbjct  61   DSKRQGFLGFKEFITAMQLVSLAQAGHAVTSDSLNAEVDFETLQLPTMEGLDGLLAKKK-  119

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSS-----RKK  384
                          +     PD NG+                   M SS ++     +  
Sbjct  120  --------------RVAKWAPDRNGSL------------------MLSSGANWFSSSKSA  147

Query  383  VQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTG  204
             + S   VTS+IDGLK+LY  KLKPLEVTY F+DFVSP+L +SDFDAKPM+MLLGQYSTG
Sbjct  148  KKVSSNYVTSIIDGLKKLYVKKLKPLEVTYHFSDFVSPLLANSDFDAKPMVMLLGQYSTG  207

Query  203  KTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGG  24
            KTTFIKHLL+ SYPGAHIGPEPTTDRF+VV +GPDERS+PGNT+AV ADMPF+GL+TFG 
Sbjct  208  KTTFIKHLLRTSYPGAHIGPEPTTDRFVVVMNGPDERSVPGNTIAVQADMPFSGLTTFGT  267

Query  23   AFLSKFE  3
            +FLSKFE
Sbjct  268  SFLSKFE  274



>ref|XP_001772546.1| predicted protein [Physcomitrella patens]
 gb|EDQ62588.1| predicted protein [Physcomitrella patens]
Length=547

 Score =   307 bits (786),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/301 (52%), Positives = 200/301 (66%), Gaps = 24/301 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+I S    S +K+ ++ ++ WF++AD+DGDGR+TG+DA K F +S L + +LKQVWA+A
Sbjct  1    MDILSS--RSNTKQDEEKYRHWFDYADADGDGRLTGDDAVKFFSLSQLPRAELKQVWAIA  58

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            D KRQGFLG  EF +AMQ+ISL Q G ++  D+L       +  PTM  L         S
Sbjct  59   DVKRQGFLGFKEFVSAMQVISLLQSGNDIGPDILKNADLEKIGAPTMVGL-----VELLS  113

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                    +     +NGS P    +                  + F  ++ R+ +  S  
Sbjct  114  KGLRGSKSSNGSIHSNGSSPQQQASQTS---------------QWFREKTPRRSL--SSV  156

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTS++DGLK+LY  KLKPLEVTYRFNDFVSP LT+SDFDAKP +MLLGQYSTGKTTFIK
Sbjct  157  SVTSIVDGLKKLYIEKLKPLEVTYRFNDFVSPTLTESDFDAKPQVMLLGQYSTGKTTFIK  216

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRF+VV  G DER++PGNT+ V ADMPF+GL+ FG AFL+KF
Sbjct  217  HLLRTSYPGAHIGPEPTTDRFVVVMGGADERNVPGNTIVVQADMPFSGLTRFGQAFLAKF  276

Query  5    E  3
            E
Sbjct  277  E  277



>ref|XP_009770776.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009770777.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009770778.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=543

 Score =   307 bits (786),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 210/307 (68%), Gaps = 39/307 (13%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSK+ +K++Q+WFNFADSDGDGR+TG DAT    MS+LS+  LKQVWA+A
Sbjct  1    MEFDTFPINQCSKKHEKIYQEWFNFADSDGDGRLTGKDATNFLAMSNLSRDHLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF TAMQL+SLAQ G  + SD LN +     +  PTM+ LD LLA    
Sbjct  61   DSKRQGFLGFKEFITAMQLVSLAQAGHAVTSDSLNAEVDFETLQLPTMEGLDGLLAKKK-  119

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSS-----RKK  384
                          +     PD NG+                   M SS ++     +  
Sbjct  120  --------------RVAKWAPDRNGSL------------------MLSSGANWFSSSKSA  147

Query  383  VQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTG  204
             + S   VTS+IDGLK+LY  KLKPLEVTY F+DFVSP+L +SDFDAKPM+MLLGQYSTG
Sbjct  148  KKVSSNYVTSIIDGLKKLYVKKLKPLEVTYHFSDFVSPLLANSDFDAKPMVMLLGQYSTG  207

Query  203  KTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGG  24
            KTTFIKHLL+ SYPGAHIGPEPTTDRF+VV +GPDERS+PGNT+AV ADMPF+GL+TFG 
Sbjct  208  KTTFIKHLLRTSYPGAHIGPEPTTDRFVVVMNGPDERSVPGNTIAVQADMPFSGLTTFGT  267

Query  23   AFLSKFE  3
            +FLSKFE
Sbjct  268  SFLSKFE  274



>ref|XP_006352527.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Solanum 
tuberosum]
Length=543

 Score =   306 bits (785),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 206/302 (68%), Gaps = 29/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSK  +K++Q+WF+ ADSDGDGR+ G DAT    MS+L +  LKQVWA+A
Sbjct  1    MEFDTYPINRCSKRNEKIYQEWFSSADSDGDGRLIGKDATSFLAMSNLPREDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF TAMQL+SLAQ G  + SD  N       + PPTM+ LD LLA    
Sbjct  61   DSKRQGYLGFKEFITAMQLVSLAQAGHAVTSDFSNADVDFENLQPPTMEGLDGLLAKKKR  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
             +                  PD NG+  L                 FSS  S KKV PS 
Sbjct  121  VAKWV---------------PDGNGSLTLSSRA-----------NWFSSSKSAKKV-PS-  152

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
              VTS+IDGLK+LY  KLKPLEV Y ++DFVSP+L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  153  NYVTSIIDGLKKLYAKKLKPLEVAYHYSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFI  212

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+ SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  213  KHLLRSSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSK  272

Query  8    FE  3
            FE
Sbjct  273  FE  274



>ref|XP_006344871.1| PREDICTED: EH domain-containing protein 1-like [Solanum tuberosum]
Length=545

 Score =   306 bits (784),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 179/302 (59%), Positives = 214/302 (71%), Gaps = 27/302 (9%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSK+ +K++Q WF+ ADSDGDGR+TG DA K F MS+L +  LKQVWA+A
Sbjct  1    MEFDTSPINRCSKDHEKIYQQWFSLADSDGDGRLTGGDAIKFFAMSNLPRQDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF  AMQL+SLAQ G  ++SDLLN +     + PP+++ LD L      
Sbjct  61   DSKRQGFLGFREFIAAMQLVSLAQAGHPVSSDLLNAEVDFENLQPPSLEGLDLLQTKKKR  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
                      +S P+ NGS    +  T                   FSS SS KKV  SL
Sbjct  121  M--------PKSEPEQNGSSTVQSSATA----------------NWFSSSSSVKKV--SL  154

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            ++VTS++DGLK+LY  KLKPLE TY FNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  155  SSVTSIVDGLKKLYLQKLKPLEATYHFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFI  214

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL  SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV A+MPF+GL+TFG AFLSK
Sbjct  215  KHLLGTSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQANMPFSGLTTFGSAFLSK  274

Query  8    FE  3
            FE
Sbjct  275  FE  276



>ref|XP_002970092.1| hypothetical protein SELMODRAFT_92582 [Selaginella moellendorffii]
 gb|EFJ29216.1| hypothetical protein SELMODRAFT_92582 [Selaginella moellendorffii]
Length=544

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 167/305 (55%), Positives = 211/305 (69%), Gaps = 34/305 (11%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+I S      +K+ +++++ WF+FAD DGDGR+TG DA K F +S L +  LKQVWA+A
Sbjct  1    MDILSVRSVHYAKQDEQMYKQWFDFADEDGDGRITGADAVKFFSLSQLPRSHLKQVWAVA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFLG  EF  AMQ+I+LAQ G E+++D+L  +    +SPP M+ L+ ++ +    
Sbjct  61   DSKRQGFLGFKEFVAAMQIIALAQLGNEISADMLRDRDVDEISPPNMEGLEQMILAR---  117

Query  545  spnssgsLTESPPQ----TNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQ  378
                      +PP     TNG+ P     T                 + F+++  RK   
Sbjct  118  --------KRAPPTGDVFTNGTSPQLQAETA----------------QWFATKQPRKI--  151

Query  377  PSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKT  198
            PS T+VTSV+DGLK+LY  KLKPLEVTYRF+DFVSP LT+SDFD KPM+MLLGQYSTGKT
Sbjct  152  PS-TSVTSVVDGLKKLYLEKLKPLEVTYRFHDFVSPTLTESDFDCKPMVMLLGQYSTGKT  210

Query  197  TFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAF  18
            TFIKHLL+ SYPGAHIGPEPTTDRF+VV  G DERS+PGNT+AV ADMPF+GL+ FG AF
Sbjct  211  TFIKHLLRTSYPGAHIGPEPTTDRFVVVMDGTDERSVPGNTIAVQADMPFSGLTKFGTAF  270

Query  17   LSKFE  3
            LSKFE
Sbjct  271  LSKFE  275



>gb|AAD48968.1|AF147263_10 contains similarity to Pfam family PF00036 - EF hand; score=11.7, 
E=0.66,N=1 [Arabidopsis thaliana]
 emb|CAB81094.1| AT4g05520 [Arabidopsis thaliana]
Length=514

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/311 (53%), Positives = 200/311 (64%), Gaps = 47/311 (15%)
 Frame = -3

Query  878  SCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLG  699
            SC KE QK++++WFN ADSDGDGRV+GNDATK F MS LS+ +LKQVWA+ADSKRQGFLG
Sbjct  11   SCLKEHQKIYKEWFNIADSDGDGRVSGNDATKFFAMSKLSRQELKQVWAVADSKRQGFLG  70

Query  698  INEFT-------TAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangssp  540
            +++ +         +Q  S AQ   +L+  L   + +  V  P ++ L+ +++    S  
Sbjct  71   LSDSSHWHKKDMKLLQTFSKAQVSGKLHLKLFESRGSDSVELPVLEGLENVVSKQKVSKT  130

Query  539  nssgs-LTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTA  363
            N        + PQ     P                         F S+S    ++P +  
Sbjct  131  NVDVEDNVVTKPQVTAKTP------------------------WFKSKSI---IKPQVNV  163

Query  362  VTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVL-----------TDSDFDAKPMIMLLGQ  216
            VT ++DGLKRLY  KLKPLEVTYRFNDF SPVL           T SDFDAKPM+MLLGQ
Sbjct  164  VT-IVDGLKRLYTEKLKPLEVTYRFNDFASPVLVSNILTVSETLTSSDFDAKPMVMLLGQ  222

Query  215  YSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLS  36
            YSTGKTTFIKHLL C YPGAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL+
Sbjct  223  YSTGKTTFIKHLLGCDYPGAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLT  282

Query  35   TFGGAFLSKFE  3
            +FGGAFLSKFE
Sbjct  283  SFGGAFLSKFE  293



>ref|XP_009779278.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779279.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779280.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779281.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779282.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009779283.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=543

 Score =   305 bits (781),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 209/308 (68%), Gaps = 41/308 (13%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSK+ +K++Q+WFNFADSDGDGR+TG DAT    MS+L +  LKQVWA+A
Sbjct  1    MEFDNSPINQCSKKHEKIYQEWFNFADSDGDGRLTGKDATNFLEMSNLPRDHLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF TAMQL+SLAQ G  + SD LN +     +  PTM+ LD LLA    
Sbjct  61   DSKRQGFLGFKEFITAMQLVSLAQAGHAVTSDSLNAEVDFETLQLPTMEGLDGLLAKKK-  119

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSS------RK  387
                          +     PD NG+                   + SSR++        
Sbjct  120  --------------RVAKWAPDRNGSL------------------VLSSRANWFSSSKSS  147

Query  386  KVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYST  207
            K  PS   VTS+IDGLK+LY  KLKPLEV Y F+DFVSP+L +SDFDAKPM+MLLGQYST
Sbjct  148  KKVPS-HYVTSIIDGLKKLYVKKLKPLEVAYHFSDFVSPLLANSDFDAKPMVMLLGQYST  206

Query  206  GKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFG  27
            GKTTFIKHLLK SYPGAHIGPEPTTDRF+VV +GPDERS+PGNT+AV ADMPF+GL+TFG
Sbjct  207  GKTTFIKHLLKTSYPGAHIGPEPTTDRFVVVMNGPDERSVPGNTIAVQADMPFSGLTTFG  266

Query  26   GAFLSKFE  3
             +FLSKFE
Sbjct  267  TSFLSKFE  274



>gb|EYU27374.1| hypothetical protein MIMGU_mgv1a026674mg, partial [Erythranthe 
guttata]
Length=405

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 169/314 (54%), Positives = 206/314 (66%), Gaps = 39/314 (12%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S P + CSKE QK++QDWF+FADSDGDGR+TG DATK F +S+L +  LK VWA+A
Sbjct  1    MEIDSAPISRCSKEHQKIYQDWFSFADSDGDGRLTGADATKFFSLSNLPRQDLKLVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFLG  EF TAMQL++LAQ G  L SD+L+       S    ++L        G+
Sbjct  61   DSKRQGFLGFKEFITAMQLVTLAQAGHALTSDILS-------SEVDFENLQTPALDVLGA  113

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                   L+  P Q NGS P                     S+      SS+   + SL+
Sbjct  114  LFTKKKRLSNEPEQ-NGS-PQVQS-----------------SLAASWFSSSKSAKKISLS  154

Query  365  AVTSVIDGLKRLYNAKLKPLEV-----------TYRFNDFVSPV--LTDSDFDAKPMIML  225
            +VTS++DGLKRLY  KLKPL+             + F D  + +   T+SDFDAKPM+ML
Sbjct  155  SVTSIVDGLKRLYIQKLKPLKQPISLTTLFLPHCFCFFDIYNTLAAYTNSDFDAKPMVML  214

Query  224  LGQYSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFT  45
            LGQYSTGKTTFIKHLL+ SYPGAHIGPEPTTDRF+VV +GPDERS+PGNT+AV ADMPF+
Sbjct  215  LGQYSTGKTTFIKHLLRTSYPGAHIGPEPTTDRFVVVMNGPDERSVPGNTIAVQADMPFS  274

Query  44   GLSTFGGAFLSKFE  3
            GL+TFG AFLSKFE
Sbjct  275  GLTTFGSAFLSKFE  288



>ref|XP_009603507.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603508.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603509.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009603510.1| PREDICTED: EH domain-containing protein 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=543

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 171/307 (56%), Positives = 208/307 (68%), Gaps = 39/307 (13%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSK+ +K++Q+WF FADSDGDGR+TG DAT    MS+L +  LKQVWA+A
Sbjct  1    MEFDTCPINRCSKKHEKIYQEWFCFADSDGDGRLTGKDATNFLAMSNLPRDHLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQGFLG  EF TAMQL+SLAQ G  + SD LN +     +  P+++ LD LLA    
Sbjct  61   DSKRQGFLGFKEFITAMQLVSLAQAGHAVTSDFLNAEVDFENLQLPSLEGLDRLLAKKKR  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSS-----RKK  384
             +                  PD NG+                   +  SR++     +  
Sbjct  121  VAKWV---------------PDQNGSL------------------VLPSRANWFSSSKSS  147

Query  383  VQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTG  204
             + S   VTS+IDGLK+LY  KLKPLEVTY F+DFVSP+L +SDFDAKPM+MLLGQYSTG
Sbjct  148  KKVSSNYVTSIIDGLKKLYVKKLKPLEVTYHFSDFVSPLLANSDFDAKPMVMLLGQYSTG  207

Query  203  KTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGG  24
            KTTFIKHLL+ SYPGAHIGPEPTTDRF+VV +GPDERS+PGNT+AV ADMPF+GL+TFG 
Sbjct  208  KTTFIKHLLRTSYPGAHIGPEPTTDRFVVVMNGPDERSVPGNTIAVQADMPFSGLTTFGT  267

Query  23   AFLSKFE  3
            AFLSKFE
Sbjct  268  AFLSKFE  274



>ref|XP_006352528.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Solanum 
tuberosum]
Length=541

 Score =   302 bits (773),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 175/302 (58%), Positives = 205/302 (68%), Gaps = 31/302 (10%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSK  +K++Q+WF+ ADSDGDGR+ G DAT    MS+L +  LKQVWA+A
Sbjct  1    MEFDTYPINRCSKRNEKIYQEWFSSADSDGDGRLIGKDATSFLAMSNLPREDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF TAMQL+SLAQ G  + SD  N       + PPTM+ LD LLA    
Sbjct  61   DSKRQGYLGFKEFITAMQLVSLAQAGHAVTSDFSNADVDFENLQPPTMEGLDGLLAKKKR  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
             +                  PD + T   R                FSS  S KKV PS 
Sbjct  121  VAKWV---------------PDGSLTLSSRA-------------NWFSSSKSAKKV-PS-  150

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
              VTS+IDGLK+LY  KLKPLEV Y ++DFVSP+L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  151  NYVTSIIDGLKKLYAKKLKPLEVAYHYSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFI  210

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+ SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSK
Sbjct  211  KHLLRSSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSK  270

Query  8    FE  3
            FE
Sbjct  271  FE  272



>ref|XP_007145730.1| hypothetical protein PHAVU_007G263100g [Phaseolus vulgaris]
 gb|ESW17724.1| hypothetical protein PHAVU_007G263100g [Phaseolus vulgaris]
Length=538

 Score =   299 bits (766),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 158/295 (54%), Positives = 201/295 (68%), Gaps = 32/295 (11%)
 Frame = -3

Query  887  PFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQG  708
            P  S  ++ Q L+++WFN+AD+DGDGR TG +A KLF MS+LS+ +LKQVWA+AD+KR+G
Sbjct  7    PIDSTFEDYQTLYEEWFNYADADGDGRFTGKEAIKLFTMSNLSRQELKQVWAIADTKREG  66

Query  707  FLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssg  528
            +LG  EF TAMQL+SL Q G  +  DLL         PPTM+ LDAL+A       +   
Sbjct  67   YLGFKEFVTAMQLVSLGQCGYSITHDLLTSDAMKYAKPPTMEGLDALVAKKKRKHKDKES  126

Query  527  sLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVI  348
            S++ +       +P                         FS++S++   + S ++VTS+I
Sbjct  127  SVSLTYSHAVSPQPSPASN-------------------WFSAKSTK---EVSASSVTSII  164

Query  347  DGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCS  168
            DGL          LEV Y +NDFVSP+LT+SDFDAKP+I+LLGQYSTGKTTFIKH+L+ S
Sbjct  165  DGL----------LEVAYNYNDFVSPLLTNSDFDAKPLILLLGQYSTGKTTFIKHMLQSS  214

Query  167  YPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            YPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG +FLSKFE
Sbjct  215  YPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTSFLSKFE  269



>ref|XP_002985283.1| hypothetical protein SELMODRAFT_121714 [Selaginella moellendorffii]
 gb|EFJ13777.1| hypothetical protein SELMODRAFT_121714 [Selaginella moellendorffii]
Length=552

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 166/301 (55%), Positives = 210/301 (70%), Gaps = 18/301 (6%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            M+I S      +K+ +++++ WF+FAD DGDGR+TG DA K F +S L +  LKQVWA+A
Sbjct  1    MDILSVRSVHYAKQDEQMYKQWFDFADEDGDGRITGADAVKFFSLSQLPRSHLKQVWAVA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            DSKRQGFLG  EF  AMQ+I+LAQ G E+++D+L  +    +SPP M+ L+ ++      
Sbjct  61   DSKRQGFLGFKEFVAAMQIIALAQLGNEISADMLRDRDVDEISPPNMEGLEQMILVCFL-  119

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                    + S    + S  D N T    P           + + F+++  RK   PS T
Sbjct  120  --------SSSIFVYDFSFSDMNFTVCTSPQLQAE------TAQWFATKQPRKI--PS-T  162

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            +VTSV+DGLK+LY  KLKPLEVTYRF+DFVSP LT+SDFD KPM+MLLGQYSTGKTTFIK
Sbjct  163  SVTSVVDGLKKLYLEKLKPLEVTYRFHDFVSPTLTESDFDCKPMVMLLGQYSTGKTTFIK  222

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRF+VV  G DERS+PGNT+AV ADMPF+GL+ FG AFLSKF
Sbjct  223  HLLRTSYPGAHIGPEPTTDRFVVVMDGTDERSVPGNTIAVQADMPFSGLTKFGTAFLSKF  282

Query  5    E  3
            E
Sbjct  283  E  283



>ref|XP_002974220.1| hypothetical protein SELMODRAFT_414547 [Selaginella moellendorffii]
 gb|EFJ24442.1| hypothetical protein SELMODRAFT_414547 [Selaginella moellendorffii]
Length=540

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/295 (51%), Positives = 187/295 (63%), Gaps = 30/295 (10%)
 Frame = -3

Query  887  PFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQG  708
            P    SK+ +  ++ WF + D+DGDGR+TG DA K F MS L K  LKQVWA+ADS RQG
Sbjct  5    PLREISKQDEAGYKRWFEYVDADGDGRITGADAVKFFAMSKLPKSDLKQVWAMADSNRQG  64

Query  707  FLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssg  528
            +LG+ EF TAMQ+IS+AQ G EL  D+L       +  P+M+ ++  +      +P    
Sbjct  65   YLGLKEFITAMQIISVAQSGVELTGDVLKRTDWENIGMPSMELVEDHIREGRKLTPEVEV  124

Query  527  sLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVI  348
               E  P                            S   +  + + +KV  S    TS+I
Sbjct  125  QEVEPKP----------------------------SFTNWLFQKTPQKV--SQDTATSII  154

Query  347  DGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCS  168
            DGLK+LY  KLKPLE+ Y+FNDFV P LT+SDFDAKPM+MLLGQYSTGKTTF+KHLLK  
Sbjct  155  DGLKKLYFEKLKPLEMAYQFNDFVLPALTESDFDAKPMVMLLGQYSTGKTTFLKHLLKVD  214

Query  167  YPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            YPG H+GPEPTTDRFIVV  GPDER+IPGNT  V ++MPFTGLS FG AFL+KFE
Sbjct  215  YPGCHVGPEPTTDRFIVVMGGPDERTIPGNTAVVQSEMPFTGLSKFGAAFLTKFE  269



>ref|XP_010327191.1| PREDICTED: EH domain-containing protein 1-like [Solanum lycopersicum]
Length=547

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 202/302 (67%), Gaps = 25/302 (8%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  + P   CSK  +K++Q+WF+ ADSDGDGR+ G DAT    MS+L +  LKQVWA+A
Sbjct  1    MEFDTYPINRCSKRNEKIYQEWFSSADSDGDGRLIGKDATSFLAMSNLPREDLKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasang  549
            DSKRQG+LG  EF TAMQL+SLAQ G  + SD  N       + PPTM+ LD LLA    
Sbjct  61   DSKRQGYLGFKEFITAMQLVSLAQAGHAVTSDFSNADVDFENLQPPTMEGLDGLLAKKKR  120

Query  548  sspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSL  369
             +                  PD+N             L        FSS  S KKV    
Sbjct  121  VAKWV---------------PDSN---------EAGSLSLSSRANWFSSSKSAKKVSVPS  156

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
              VTS+ DGLK+LY  KLKPLEV Y ++DFVSP+L +SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  157  NYVTSITDGLKKLYAKKLKPLEVAYHYSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFI  216

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+ SYPGAHIGPEPTTDRF+VV +GPDERSIPGNT+AV A+MPF+GL++FG AFLSK
Sbjct  217  KHLLRSSYPGAHIGPEPTTDRFVVVMNGPDERSIPGNTIAVQAEMPFSGLTSFGTAFLSK  276

Query  8    FE  3
            FE
Sbjct  277  FE  278



>ref|XP_008363998.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=286

 Score =   273 bits (698),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 183/257 (71%), Gaps = 27/257 (11%)
 Frame = -3

Query  770  SDLSKPQLKQVWALADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSP  594
            S L  P LK VWA+ADSKRQG+LG +EF  AMQL+S AQ G ++   LLN       + P
Sbjct  4    SALFVPFLK-VWAIADSKRQGYLGFSEFVAAMQLVSHAQAGHDITHGLLNSNVGLESLKP  62

Query  593  PTMKDLDallasangsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIK  414
            P M+ LDALL +             +  P++N +K   NGT  ++  P         S  
Sbjct  63   PVMEGLDALLLANK-----------KHLPKSNENK--VNGTAVVQQSP---------SAL  100

Query  413  MFSSRSSRKKVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPM  234
             FS  SS+K     L++VTS+IDGLKRLY  KLKPLEVTY+FN+FVSP++T+ DFDAKPM
Sbjct  101  WFSPESSKKI---PLSSVTSIIDGLKRLYVQKLKPLEVTYKFNNFVSPLMTNGDFDAKPM  157

Query  233  IMLLGQYSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADM  54
            +MLLGQYSTGKTTFIKHLLK SYPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AV ADM
Sbjct  158  VMLLGQYSTGKTTFIKHLLKSSYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVQADM  217

Query  53   PFTGLSTFGGAFLSKFE  3
            PF+GL+TFG AFLSKFE
Sbjct  218  PFSGLTTFGTAFLSKFE  234



>emb|CDY50093.1| BnaC01g32680D [Brassica napus]
Length=531

 Score =   278 bits (711),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 165/307 (54%), Positives = 201/307 (65%), Gaps = 51/307 (17%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADS-DGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            MEI S    SCSKE Q ++++WF FADS DGDGR+TG+DA K F MS+L +P+LKQVWA+
Sbjct  1    MEIDSVAAGSCSKENQLIYKEWFEFADSADGDGRITGSDAIKFFSMSNLPRPELKQVWAI  60

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLN-----LKTAAGVSPPTMKDLDall  564
            AD+KRQG+LG  +F  AMQL+SLAQ G E++ D+L+      K    ++PP M+ L  L+
Sbjct  61   ADAKRQGYLGFKDFIVAMQLVSLAQTGHEISHDVLHSDGMATKALINMNPPVMEGLGVLM  120

Query  563  asangsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKK  384
            A    SS  SS       P  + S                       +   FSS+SS+K 
Sbjct  121  AKKKHSSSKSSDLNVNGSPSADAS----------------------LTAHWFSSKSSKKI  158

Query  383  VQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTG  204
               SL++VTS++DGLKRLY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLG     
Sbjct  159  ---SLSSVTSIVDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLG-----  210

Query  203  KTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGG  24
                           AHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG 
Sbjct  211  ---------------AHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGT  255

Query  23   AFLSKFE  3
            AFLSKFE
Sbjct  256  AFLSKFE  262



>emb|CDY29816.1| BnaC05g31740D [Brassica napus]
Length=526

 Score =   273 bits (697),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 158/303 (52%), Positives = 194/303 (64%), Gaps = 48/303 (16%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADS-DGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            MEI S    SCSKE Q +++DWF FADS DGDGR+TGNDA K F MS+L +P+LKQVWA+
Sbjct  1    MEIDSVAAGSCSKENQIIYKDWFEFADSADGDGRITGNDAIKFFSMSNLPRPELKQVWAI  60

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasan  552
            AD+KRQG+LG  EF  AMQL+SLAQ G E++ ++L+       ++PP M  L        
Sbjct  61   ADAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDVDFKNMNPPVMDGL--------  112

Query  551  gsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
                     + +   + +    D NG+                +   FSS+SS+K    S
Sbjct  113  ------IVLMAKKKKKHSPKSSDPNGSP---------AADASLTAHWFSSKSSKKISLSS  157

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            +T   S+IDGLKRLY  KLKPLEV Y+FNDFVSP+LT+SDFDAKPM+MLL          
Sbjct  158  VT---SIIDGLKRLYIQKLKPLEVAYQFNDFVSPLLTNSDFDAKPMVMLL----------  204

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
                      GAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL++FG AFLS
Sbjct  205  ----------GAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTSFGTAFLS  254

Query  11   KFE  3
            KFE
Sbjct  255  KFE  257



>ref|XP_001784382.1| predicted protein [Physcomitrella patens]
 gb|EDQ50787.1| predicted protein [Physcomitrella patens]
Length=522

 Score =   272 bits (696),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 154/301 (51%), Positives = 192/301 (64%), Gaps = 49/301 (16%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            MEI S      +K+ ++ ++ WF +AD+DGDGR+TGNDA K F +S+L + +LKQVWA+A
Sbjct  1    MEILSS--RVGTKQDEQAYRKWFEYADTDGDGRLTGNDAVKFFSISELPRAELKQVWAIA  58

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangs  546
            D KRQGFLG  EF +AMQ+ISLAQ G++             ++P  +K+ D         
Sbjct  59   DEKRQGFLGFKEFVSAMQVISLAQLGKD-------------INPDILKNSDLENI-----  100

Query  545  spnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLT  366
                      SPP   G +        +    +                        S  
Sbjct  101  ----------SPPTMTGLEELILYLRLILLHGIGWQTL-------------------SAI  131

Query  365  AVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIK  186
            AVTS++DGLK+LY  KLKPLEV YRFNDFVSP+LTDSDFDAKP +MLLGQYSTGKTTFIK
Sbjct  132  AVTSIVDGLKKLYLEKLKPLEVAYRFNDFVSPILTDSDFDAKPQVMLLGQYSTGKTTFIK  191

Query  185  HLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKF  6
            HLL+ SYPGAHIGPEPTTDRF+VV  G DER++PGNT+AV ADMPF+GL+ FG AFL+KF
Sbjct  192  HLLRSSYPGAHIGPEPTTDRFVVVMGGADERNVPGNTIAVQADMPFSGLTKFGQAFLAKF  251

Query  5    E  3
            E
Sbjct  252  E  252



>emb|CDY25408.1| BnaA05g18760D [Brassica napus]
Length=525

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 158/303 (52%), Positives = 193/303 (64%), Gaps = 49/303 (16%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADS-DGDGRVTGNDATKLFGMSDLSKPQLKQVWAL  729
            MEI S    SCSKE Q +++DWF FADS DGDGR+TG+DA K F MS+L +P+LKQVWA+
Sbjct  1    MEIDSVAAGSCSKENQIIYKDWFEFADSADGDGRITGSDAIKFFSMSNLPRPELKQVWAI  60

Query  728  ADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasan  552
            AD+KRQG+LG  EF  AMQL+SLAQ G E++ ++L+       ++PP M  L        
Sbjct  61   ADAKRQGYLGFKEFIVAMQLVSLAQTGHEISHEVLHSDVDFKNMNPPVMDGL--------  112

Query  551  gsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPS  372
                     L     + +    D NG+                +   FSS+SS+K    S
Sbjct  113  -------IVLMAKKKKHSPKSSDPNGSP---------AADASLTAHWFSSKSSKKISLSS  156

Query  371  LTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTF  192
            +T   S+IDGLKRLY  KLKPLEV Y+FNDFVSP+LT+SDFDAKPM+MLL          
Sbjct  157  VT---SIIDGLKRLYIQKLKPLEVAYQFNDFVSPLLTNSDFDAKPMVMLL----------  203

Query  191  IKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLS  12
                      GAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL++FG AFLS
Sbjct  204  ----------GAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTSFGTAFLS  253

Query  11   KFE  3
            KFE
Sbjct  254  KFE  256



>emb|CDY50090.1| BnaC01g32650D [Brassica napus]
Length=570

 Score =   260 bits (665),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 163/346 (47%), Positives = 200/346 (58%), Gaps = 90/346 (26%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQ-----  741
            MEI S    SCSKE Q ++++WF FADSDGDGR+TG+DA K F MS+L +P+LKQ     
Sbjct  1    MEIDSVAAGSCSKENQLIYKEWFEFADSDGDGRITGSDAIKFFSMSNLPRPELKQFFGVS  60

Query  740  ---------------------------------------VWALADSKRQGFLGINEFTTA  678
                                                   VWA+AD+KRQG+LG  +F  A
Sbjct  61   VNENSCCSFRRSYADADAVLITDADLNADAVPSSMKRTRVWAIADAKRQGYLGFKDFIVA  120

Query  677  MQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasangsspnssgsLTESPPQT  501
            MQL+SLAQ G E++ D+L+       ++PP M+ L  L+A    SS  S+       P  
Sbjct  121  MQLVSLAQTGHEISHDVLHSDVDFKNMNPPVMEGLGVLMAKKKHSSSKSNDLSVNGSPSA  180

Query  500  NGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLKRLYNA  321
            + S                       +   FSS+SS+K    SL++VTS++DGLKRLY  
Sbjct  181  DAS----------------------LTAHWFSSKSSKKI---SLSSVTSIVDGLKRLYIQ  215

Query  320  KLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPE  141
            KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLG                    AHIGPE
Sbjct  216  KLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLG--------------------AHIGPE  255

Query  140  PTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSKFE
Sbjct  256  PTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSKFE  301



>emb|CAJ86083.1| H0818H01.5 [Oryza sativa Indica Group]
 emb|CAJ86201.1| B0811B10.21 [Oryza sativa Indica Group]
Length=555

 Score =   246 bits (629),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 161/253 (64%), Gaps = 58/253 (23%)
 Frame = -3

Query  869  KEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINE  690
            +EQ++ +  WF+ AD DGDGRVTG DA K F MS+LS+P+LKQVWA+ADSKRQG+LG +E
Sbjct  13   REQREAYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPELKQVWAIADSKRQGYLGFSE  72

Query  689  FTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsLTESP  510
            F TAMQL+SLAQ G E++ D L    A  V  P+                       E P
Sbjct  73   FMTAMQLVSLAQAGNEISQDTL----AHAVRHPS-----------------------ELP  105

Query  509  PQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLKRL  330
               N                             F+S+S +K     L +VTS+IDGLK+ 
Sbjct  106  ASAN----------------------------WFNSKSGKK---IPLRSVTSIIDGLKKS  134

Query  329  YNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGAHI  150
            Y  KL+PLE TY+F+DFVSP+LT SDFDAKPM+MLLGQYSTGKTTFIKHLLK +YPGAHI
Sbjct  135  YIEKLRPLEKTYQFDDFVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLKTNYPGAHI  194

Query  149  GPEPTTDRFIVVT  111
            GPEPTTDRF+V+T
Sbjct  195  GPEPTTDRFVVIT  207



>gb|EMT24958.1| EH domain-containing protein 1 [Aegilops tauschii]
Length=457

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/253 (51%), Positives = 157/253 (62%), Gaps = 58/253 (23%)
 Frame = -3

Query  869  KEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINE  690
            KEQ+ ++  WF  AD D DGR+TG DA K F MS LS+  LKQVWA+ADSKRQG+LG  E
Sbjct  17   KEQRSVYLRWFYLADDDADGRLTGKDALKFFAMSKLSREDLKQVWAIADSKRQGYLGFTE  76

Query  689  FTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsLTESP  510
            F TAMQL+SLAQ G++++ D   L  AA                               P
Sbjct  77   FMTAMQLVSLAQAGQDISQD--TLAHAA-----------------------------YHP  105

Query  509  PQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLKRL  330
             QT+                         S   F+S+S +K    ++ +VTS+IDGLK+ 
Sbjct  106  VQTS------------------------MSANWFNSKSGKK---IAMKSVTSIIDGLKKA  138

Query  329  YNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGAHI  150
            Y  KL+PLE TY++NDFVSP+LT SDFDAKPMIMLLGQYSTGKTTFIKHLLK SYPG+HI
Sbjct  139  YIEKLRPLEKTYQYNDFVSPLLTSSDFDAKPMIMLLGQYSTGKTTFIKHLLKSSYPGSHI  198

Query  149  GPEPTTDRFIVVT  111
            GPEPTTDRF+VVT
Sbjct  199  GPEPTTDRFVVVT  211



>gb|EYU27756.1| hypothetical protein MIMGU_mgv1a004743mg [Erythranthe guttata]
Length=512

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  380  QPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGK  201
            Q SL +VTSVIDGLKRLYN KLKPLE TYRFNDFVSP LT SDFDAKPM+MLLGQYSTGK
Sbjct  118  QTSLPSVTSVIDGLKRLYNEKLKPLEATYRFNDFVSPFLTSSDFDAKPMVMLLGQYSTGK  177

Query  200  TTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGA  21
            TTFIKHLL+C+YPGAHIGPEPTTDRFIVV SGPDERSIPGNT+AVHA++PFTGL+TFGG+
Sbjct  178  TTFIKHLLQCNYPGAHIGPEPTTDRFIVVMSGPDERSIPGNTIAVHAELPFTGLNTFGGS  237

Query  20   FLSKFE  3
            FLSKFE
Sbjct  238  FLSKFE  243


 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 85/115 (74%), Gaps = 7/115 (6%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALA  726
            ME  S    +C+KEQ KL+Q+WF   DSD DGR+T NDAT+ F MS L+KP+LKQVWA+A
Sbjct  1    MEFVSEKMDTCTKEQLKLYQNWFTSVDSDRDGRLTANDATEFFAMSHLTKPELKQVWAIA  60

Query  725  DSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLN----LKTAAGVSPPTMKDLD  573
            D+KRQG+LG+ EF TAMQLISLAQEG EL S LL     L+T   +SPP M+ LD
Sbjct  61   DTKRQGYLGLKEFITAMQLISLAQEGHELTSSLLRSTVYLET---LSPPYMEGLD  112



>ref|XP_009589164.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009589165.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=469

 Score =   236 bits (603),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 156/226 (69%), Gaps = 27/226 (12%)
 Frame = -3

Query  677  MQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasangsspnssgsLTESPPQT  501
            MQL+SLAQ G  + SDLLN +     + PPT++ LD L A                  + 
Sbjct  1    MQLVSLAQAGHPVTSDLLNAEVNFENLQPPTLEGLDLLQAKKK---------------RA  45

Query  500  NGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLKRLYNA  321
              S+P+ NG   ++            S+      SS    + SLT+VTS+IDGLK+LY  
Sbjct  46   PKSEPEQNGNPTVQS-----------SVTANWFSSSTSVKKVSLTSVTSIIDGLKKLYIQ  94

Query  320  KLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPE  141
            KLKPLEV YRFNDFVSP LT+SDFDAKPM+MLLGQYSTGKTTFIKHLL+ SYPGAHIGPE
Sbjct  95   KLKPLEVAYRFNDFVSPFLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRTSYPGAHIGPE  154

Query  140  PTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSKFE
Sbjct  155  PTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSKFE  200



>ref|XP_009357511.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=481

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 127/140 (91%), Gaps = 3/140 (2%)
 Frame = -3

Query  422  SIKMFSSRSSRKKVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDA  243
            S++ F S+S+ KK+ P+  AVTS++DGLKRLYN KLKPLE+ YRFNDF SP L +SDFDA
Sbjct  76   SVQRFGSKSA-KKLPPN--AVTSIVDGLKRLYNEKLKPLELAYRFNDFASPSLINSDFDA  132

Query  242  KPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVH  63
            KPM+MLLGQYSTGKTTFIKHLL+C YPGAHIGPEPTTDRF+VV SGPDERSIPGNT+AVH
Sbjct  133  KPMVMLLGQYSTGKTTFIKHLLRCDYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTIAVH  192

Query  62   ADMPFTGLSTFGGAFLSKFE  3
            ADMPF+GL+TFGGAFLSKFE
Sbjct  193  ADMPFSGLTTFGGAFLSKFE  212


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -3

Query  905  MEIASGPFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQ  741
            ME  SG    C KE QK++Q+WFN  DSDGDGR+TGN+ATK F MS LS+ +LKQ
Sbjct  1    MENGSGRTGVCPKEHQKIYQEWFNLVDSDGDGRITGNEATKFFAMSKLSREELKQ  55



>ref|XP_005851211.1| hypothetical protein CHLNCDRAFT_33853 [Chlorella variabilis]
 gb|EFN59109.1| hypothetical protein CHLNCDRAFT_33853 [Chlorella variabilis]
Length=568

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/286 (44%), Positives = 177/286 (62%), Gaps = 21/286 (7%)
 Frame = -3

Query  860  QKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINEFTT  681
            Q+L+  WF  AD+D DGR+TG DA + F  S L++  L +VWA +D KRQGFL  + F  
Sbjct  37   QELYWRWFQMADTDRDGRLTGADAVRFFERSGLARELLAKVWANSDHKRQGFLDFHAFVR  96

Query  680  AMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsLTESPPQT  501
            A++L+SLAQ   E++ D      +AG+ PP ++ L+   A+   +   S+      P + 
Sbjct  97   ALELVSLAQSTGEVSMDTYANMQSAGIEPPRLRGLETDPAAPATAPHASAL-----PRRP  151

Query  500  NGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLKRLYNA  321
             G++   +  +               +  MF  R  +++   S    TS+ +GLK++Y  
Sbjct  152  AGAESSPSPAS---------------AAAMFG-RKGKRRAALSTKDCTSITEGLKKIYFH  195

Query  320  KLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPE  141
            K++PLE +Y+F  F SP+L++ DF+AKP ++LLGQYSTGK+TFIK+LL   YPG HIGPE
Sbjct  196  KIRPLEESYKFGHFFSPLLSEGDFEAKPSVLLLGQYSTGKSTFIKYLLGRDYPGIHIGPE  255

Query  140  PTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PTTDRF+VV  GPDER  PGNT+ V  D PFTGL+ FG  FLSKFE
Sbjct  256  PTTDRFVVVMHGPDERRTPGNTLVVQPDKPFTGLAQFGSGFLSKFE  301



>ref|XP_009598340.1| PREDICTED: EH domain-containing protein 1-like isoform X4 [Nicotiana 
tomentosiformis]
Length=470

 Score =   232 bits (591),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 151/226 (67%), Gaps = 26/226 (12%)
 Frame = -3

Query  677  MQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasangsspnssgsLTESPPQT  501
            MQL+SLAQ G  + +DLLN       + PP M+ LD  LA              +S P  
Sbjct  1    MQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAQKKKPM-------PKSEPDQ  53

Query  500  NGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLKRLYNA  321
            NGS P  +                          SS+   + SLT+VTS++DGLK+LY  
Sbjct  54   NGSAPVPSAPATS------------------WFSSSKSAKKVSLTSVTSIVDGLKKLYIQ  95

Query  320  KLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPE  141
            KLKPLEV Y FNDFVSP+L +SDFDAKPM+MLLGQYSTGKTTFIKHLLK SYPGAHIGPE
Sbjct  96   KLKPLEVAYHFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLKTSYPGAHIGPE  155

Query  140  PTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSKFE
Sbjct  156  PTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSKFE  201



>ref|XP_008370549.1| PREDICTED: EH domain-containing protein 1-like [Malus domestica]
Length=476

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 158/225 (70%), Gaps = 26/225 (12%)
 Frame = -3

Query  674  QLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasangsspnssgsLTESPPQTN  498
            QL+S AQ G ++   LLN       +  P M+ LDALL +             +  P++N
Sbjct  8    QLVSHAQAGHDITHGLLNSNVGLESLKXPVMEGLDALLLAN-----------KKHLPKSN  56

Query  497  GSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLKRLYNAK  318
             +K   NGT  ++  P         S   FS  SS+K     L++VTS+IDGLKRLY  K
Sbjct  57   ENK--VNGTAVVQQSP---------SALWFSPESSKKI---PLSSVTSIIDGLKRLYVQK  102

Query  317  LKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPEP  138
            LKPLEVTY+FN+FVSP++T+ DFDAKPM+MLLGQYSTGKTTFIKHLLK SYPGAHIGPEP
Sbjct  103  LKPLEVTYKFNNFVSPLMTNGDFDAKPMVMLLGQYSTGKTTFIKHLLKSSYPGAHIGPEP  162

Query  137  TTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            TTDRF+VV SGPDERSIPGNT+AV ADMPF+GL+TFG AFLSKFE
Sbjct  163  TTDRFVVVMSGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSKFE  207



>ref|XP_009776641.1| PREDICTED: EH domain-containing protein 1 isoform X4 [Nicotiana 
sylvestris]
Length=470

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 150/226 (66%), Gaps = 26/226 (12%)
 Frame = -3

Query  677  MQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasangsspnssgsLTESPPQT  501
            MQL+SLAQ G  + +DLLN       + PP M+ LD  LA              +S P  
Sbjct  1    MQLVSLAQAGHAVTNDLLNADVDFENLLPPAMEGLDVFLAKKKKPM-------PKSEPDQ  53

Query  500  NGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLKRLYNA  321
            NGS P                             SS+   + SLT+VTS++DGLK+LY  
Sbjct  54   NGSAPVPTAPATS------------------WFSSSKSAKKVSLTSVTSIVDGLKKLYIQ  95

Query  320  KLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPE  141
            KLKPLE+ Y FNDFVSP+L +SDFDAKPM+MLLGQYSTGKTTFIKHLLK SYPGAHIGPE
Sbjct  96   KLKPLEIAYHFNDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLKTSYPGAHIGPE  155

Query  140  PTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PTTDRF+VV +GPDERSIPGNT+AV ADMPF+GL+TFG AFLSKFE
Sbjct  156  PTTDRFVVVMNGPDERSIPGNTIAVQADMPFSGLTTFGTAFLSKFE  201



>ref|XP_007515068.1| unnamed protein product [Bathycoccus prasinos]
 emb|CCO15308.1| unnamed protein product [Bathycoccus prasinos]
Length=548

 Score =   230 bits (587),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/294 (43%), Positives = 171/294 (58%), Gaps = 27/294 (9%)
 Frame = -3

Query  860  QKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINEFTT  681
            +KL++ WF   D+D DGR+TGNDA   F  S L++  L +VW  AD  RQG+L  + F  
Sbjct  8    EKLYRQWFPLCDTDNDGRITGNDAVVFFSKSSLNQQALAKVWGCADLNRQGYLDKDGFIR  67

Query  680  AMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsLTESPPQT  501
            AM++I+LAQ G  ++  + NL+T        M                   +  E   +T
Sbjct  68   AMRVIALAQIG--VSPSVANLQTELERRQGEM-----------------PLAKMEGLDET  108

Query  500  NGSKPDTNGTTplrpiplniplrpiPSIKMF--------SSRSSRKKVQPSLTAVTSVID  345
            +G K D +  T    +            K          + +  +++ +     VT ++D
Sbjct  109  SGRKEDDDDFTSNPFMASPGEKIKDGRNKASNMLGGGAQTKKEKKRQAKVDAKTVTGIVD  168

Query  344  GLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSY  165
            GLK LY  K+KPLE  Y+F  F  P+LTD DFD KP ++LLGQYSTGKTTFI+HLLK  Y
Sbjct  169  GLKLLYKTKIKPLEEAYKFGSFYGPLLTDGDFDGKPNVLLLGQYSTGKTTFIQHLLKRPY  228

Query  164  PGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PGAHIGPEPTTDRF+V+T G D+R+ PGNT+AV++ +P+TGL +FG  FLSKFE
Sbjct  229  PGAHIGPEPTTDRFVVLTHGLDDRTTPGNTMAVNSALPYTGLQSFGTGFLSKFE  282



>ref|XP_009111206.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Brassica 
rapa]
Length=470

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 159/226 (70%), Gaps = 26/226 (12%)
 Frame = -3

Query  677  MQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasangsspnssgsLTESPPQT  501
            MQL+SLAQ G E++ D+L+       ++PP M+ L  L+A    SS  S+       P  
Sbjct  1    MQLVSLAQTGHEISHDVLHSDVDFKNMNPPVMEGLGVLMAKKKHSSSKSNDLSVNGSPSA  60

Query  500  NGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLKRLYNA  321
            + S                       +   FSS+SS+K    SL++VTS++DGLKRLY  
Sbjct  61   DAS----------------------LTAHWFSSKSSKKI---SLSSVTSIVDGLKRLYIQ  95

Query  320  KLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPE  141
            KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIKHLLK SYPGAHIGPE
Sbjct  96   KLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLKASYPGAHIGPE  155

Query  140  PTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            PTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSKFE
Sbjct  156  PTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSKFE  201



>ref|XP_010422242.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=428

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = -3

Query  395  SRKKVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQ  216
            S+  ++P +  VT ++DGLKRLY  KLKPLEVTYRFNDF SPVLT+SDFDAKPM+MLLGQ
Sbjct  30   SKSIIKPQVNVVT-IVDGLKRLYTEKLKPLEVTYRFNDFASPVLTNSDFDAKPMVMLLGQ  88

Query  215  YSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLS  36
            YSTGKTTFIKHLL C YPGAHIGPEPTTDRF+V  SGPDER+IPGNT+AV ADMPF GL+
Sbjct  89   YSTGKTTFIKHLLGCDYPGAHIGPEPTTDRFVVAMSGPDERTIPGNTMAVQADMPFNGLT  148

Query  35   TFGGAFLSKFE  3
            +FGGAFLSKFE
Sbjct  149  SFGGAFLSKFE  159



>ref|XP_006406402.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
 gb|ESQ47855.1| hypothetical protein EUTSA_v10020459mg [Eutrema salsugineum]
Length=443

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  362  VTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKH  183
            VTS++DGLKRLY  KLKPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIKH
Sbjct  55   VTSIVDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKH  114

Query  182  LLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            LLK +YPGAHIGPEPTTDRF+VV SGPDERSIPGNTVAV ADMPF+GL+TFG AFLSKFE
Sbjct  115  LLKANYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAFLSKFE  174



>gb|KFM29283.1| EH domain-containing protein 1 [Auxenochlorella protothecoides]
Length=598

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 170/300 (57%), Gaps = 10/300 (3%)
 Frame = -3

Query  881  TSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFL  702
            TS S ++  L+  WF  AD+DGDGR+TG DA   F  S L +  L +VWA AD  R+GFL
Sbjct  19   TSVSNDE--LYLSWFQTADTDGDGRLTGPDAVTFFQRSGLQRDALAKVWAAADYSRRGFL  76

Query  701  GINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLDallasangsspnss---  531
             +  F  AM+LIS+AQ   ++  +      A GV+PP M  L+      + +        
Sbjct  77   DLPAFAKAMELISVAQRTGKVGGEAYTQAKAMGVAPPRMAGLEKKAGPGSHTERGGINPF  136

Query  530  --gsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTA--  363
                 +ES P+   S P           P        PS    +SR  +   +P +T   
Sbjct  137  GGAESSESTPRL-ASSPPVGVPPFKLAFPPQAEASSHPSTARTTSRRHQSLRRPVMTTKE  195

Query  362  VTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKH  183
               + +GLK +Y  K++PLE  Y+F  F SP+L+  DF+AKP ++LLGQYSTGK+TFIK 
Sbjct  196  AVGISEGLKNIYFNKIRPLEDGYKFGHFFSPLLSAGDFEAKPSVLLLGQYSTGKSTFIKF  255

Query  182  LLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            LL   YPG HIGPEPTTDRF+VV  GP+ER  PGNT+ V  D P+TGLS FG  FLSKFE
Sbjct  256  LLGRDYPGIHIGPEPTTDRFVVVMHGPEERRTPGNTLVVQPDKPYTGLSQFGNGFLSKFE  315



>ref|XP_006452453.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
 gb|ESR65693.1| hypothetical protein CICLE_v10007883mg [Citrus clementina]
Length=438

 Score =   221 bits (562),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  362  VTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKH  183
            VTS+IDGLKRLY  KLKPLEVTYRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIKH
Sbjct  50   VTSIIDGLKRLYIQKLKPLEVTYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKH  109

Query  182  LLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            LL+ SYPGAHIGPEPTTDRF+VV SG D+RSIPGNTVAV ADMPF+GL+TFG AFLSKFE
Sbjct  110  LLRTSYPGAHIGPEPTTDRFVVVMSGVDDRSIPGNTVAVQADMPFSGLTTFGTAFLSKFE  169



>ref|XP_010252586.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=450

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 118/135 (87%), Gaps = 3/135 (2%)
 Frame = -3

Query  407  SSRSSRKKVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIM  228
            SSRSS+K     L +VTS++DGLK+LY  KLKPLEVTY FNDFVSP+LT+SDFDA+PM+M
Sbjct  50   SSRSSKKLF---LNSVTSIVDGLKKLYTEKLKPLEVTYHFNDFVSPLLTNSDFDARPMVM  106

Query  227  LLGQYSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPF  48
            LLGQYSTGKTTFI HLLK SYPGAHIGPEPTTDRF+VV SG DERSIPGNT+AV ADMPF
Sbjct  107  LLGQYSTGKTTFITHLLKSSYPGAHIGPEPTTDRFVVVMSGHDERSIPGNTIAVQADMPF  166

Query  47   TGLSTFGGAFLSKFE  3
             GL+TFG  FLSKF+
Sbjct  167  GGLTTFGTTFLSKFQ  181



>ref|XP_008371039.1| PREDICTED: EH domain-containing protein 3-like isoform X1 [Malus 
domestica]
Length=185

 Score =   209 bits (533),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 143/220 (65%), Gaps = 37/220 (17%)
 Frame = -3

Query  773  MSDLSKPQLKQVWALADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLNLKTAAGVSP  594
            MS LS+ +LKQVWA+AD+KRQGF+G +EF TAMQ+ISLAQ+ E     L          P
Sbjct  1    MSRLSREELKQVWAIADTKRQGFVGFSEFVTAMQMISLAQDHESTPDILKTTVDWENNKP  60

Query  593  PTMKDLDallasangsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIK  414
            P ++ LD L+A     +             T G +                      +++
Sbjct  61   PVIEGLDDLVAKTKSLT-------------TYGVE---------------------VNVQ  86

Query  413  MFSSRSSRKKVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPM  234
             F S+S++K     L AVTS++DGLKR+YN KLKPLE+ YRFNDF SP+LTDSDFD+KPM
Sbjct  87   RFGSKSAKKL---PLNAVTSIVDGLKRMYNEKLKPLELAYRFNDFASPLLTDSDFDSKPM  143

Query  233  IMLLGQYSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVV  114
            +MLLGQYSTGKTTFIKHLL+C+YPGAHIGPEPTTD F+VV
Sbjct  144  VMLLGQYSTGKTTFIKHLLRCNYPGAHIGPEPTTDGFVVV  183



>gb|KCW77036.1| hypothetical protein EUGRSUZ_D01382 [Eucalyptus grandis]
Length=459

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = -3

Query  422  SIKMFSSRSSRKKVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDA  243
            S + F+ +S RK  Q +   + S+ DGLKRLY  KLKPLEV YRF DFVSP+LTD DFDA
Sbjct  52   SSRWFAWKSGRK-AQATQNMIISIADGLKRLYVEKLKPLEVAYRFEDFVSPLLTDGDFDA  110

Query  242  KPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVH  63
            KPM+MLLGQYSTGKTTFIKHLL C YPGAHIGPEPTTD+F+ V SGPD+RSIPGNT AVH
Sbjct  111  KPMVMLLGQYSTGKTTFIKHLLGCEYPGAHIGPEPTTDKFVAVMSGPDKRSIPGNTAAVH  170

Query  62   ADMPFTGLSTFGGAFLSKFE  3
            AD PF GL  FGGAFLSKFE
Sbjct  171  ADKPFNGLMKFGGAFLSKFE  190



>ref|XP_010054613.1| PREDICTED: EH domain-containing protein 1-like [Eucalyptus grandis]
Length=528

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = -3

Query  422  SIKMFSSRSSRKKVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDA  243
            S + F+ +S RK  Q +   + S+ DGLKRLY  KLKPLEV YRF DFVSP+LTD DFDA
Sbjct  121  SSRWFAWKSGRK-AQATQNMIISIADGLKRLYVEKLKPLEVAYRFEDFVSPLLTDGDFDA  179

Query  242  KPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVH  63
            KPM+MLLGQYSTGKTTFIKHLL C YPGAHIGPEPTTD+F+ V SGPD+RSIPGNT AVH
Sbjct  180  KPMVMLLGQYSTGKTTFIKHLLGCEYPGAHIGPEPTTDKFVAVMSGPDKRSIPGNTAAVH  239

Query  62   ADMPFTGLSTFGGAFLSKFE  3
            AD PF GL  FGGAFLSKFE
Sbjct  240  ADKPFNGLMKFGGAFLSKFE  259



>gb|AIE88276.1| hypothetical protein OG_BBa0063K01.7 [Oryza glaberrima]
Length=487

 Score =   216 bits (550),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 121/140 (86%), Gaps = 3/140 (2%)
 Frame = -3

Query  422  SIKMFSSRSSRKKVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDA  243
            S   F+S+S +K     L +VTS+IDGLK+ Y  KL+PLE TY+F+DFVSP+LT SDFDA
Sbjct  82   SANWFNSKSGKK---IPLRSVTSIIDGLKKSYIEKLRPLEKTYQFDDFVSPLLTSSDFDA  138

Query  242  KPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVH  63
            KPM+MLLGQYSTGKTTFIKHLLK +YPGAHIGPEPTTDRF+V+TSGPDER IPGNT+AV 
Sbjct  139  KPMVMLLGQYSTGKTTFIKHLLKTNYPGAHIGPEPTTDRFVVITSGPDERCIPGNTIAVQ  198

Query  62   ADMPFTGLSTFGGAFLSKFE  3
            ADMP++GLS+FG AFLSKFE
Sbjct  199  ADMPYSGLSSFGTAFLSKFE  218


 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -3

Query  824  SDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINEFTTAMQ  672
            S GDGRVTG DA K F MS+LS+P+LKQVWA+ADSKRQG+LG +EF TAMQ
Sbjct  9    SHGDGRVTGKDALKFFAMSNLSRPELKQVWAIADSKRQGYLGFSEFMTAMQ  59



>ref|XP_005643284.1| hypothetical protein COCSUDRAFT_38543 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18740.1| hypothetical protein COCSUDRAFT_38543 [Coccomyxa subellipsoidea 
C-169]
Length=540

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 123/306 (40%), Positives = 165/306 (54%), Gaps = 42/306 (14%)
 Frame = -3

Query  899  IASGPFTSCSK-----EQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVW  735
            +A  PF S        + +  F +WF  AD D DG++TG DA + F  S L +  L +VW
Sbjct  1    MARNPFGSHETLPRNLDNEHKFAEWFRVADKDADGKLTGADAVRFFERSGLPRDLLAKVW  60

Query  734  ALADSKRQGFLGINEFTTAMQLISLAQEGEELNSDLLN--LKTAAGVSPPTMKDLDalla  561
            +LADS R+G+L +  F+ AM LIS+AQE  E++++          G+ PP          
Sbjct  61   SLADSSRRGYLDVKGFSKAMDLISVAQETGEVSAEAYTQAWNEVGGILPP----------  110

Query  560  sangsspnssgsLTESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKV  381
                             PQ  G +   +  + + P               +    + KK 
Sbjct  111  -----------------PQMVGIEDQASTPSSMTPGSARKSG--------WGRSRTTKKS  145

Query  380  QPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGK  201
            + S    TS++DGLK +Y  K++PLE  Y+F  F S  L +SDF AKP ++LLGQYSTGK
Sbjct  146  RLSTAECTSIVDGLKLIYFTKIRPLEEMYKFGAFFSSYLNESDFYAKPSVLLLGQYSTGK  205

Query  200  TTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGA  21
            TTFIKHLL   YPG HIGPEPTTDRF+VV  G +ER  PGNT+ V  D P+ GLS +G  
Sbjct  206  TTFIKHLLGREYPGIHIGPEPTTDRFVVVMHGLEERRTPGNTLIVQPDKPYQGLSQYGNG  265

Query  20   FLSKFE  3
            FL+KFE
Sbjct  266  FLAKFE  271



>gb|KEH33927.1| calcium-binding EF hand protein [Medicago truncatula]
Length=437

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -3

Query  359  TSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHL  180
            + +IDGLKRLY  KL PLEVTYRFNDFVSP+LTDSDFDAKPM++LLGQYSTGKTTFIKH+
Sbjct  54   SEIIDGLKRLYIQKLMPLEVTYRFNDFVSPLLTDSDFDAKPMVLLLGQYSTGKTTFIKHM  113

Query  179  LKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            L+ SYPGAHIGPEPTTD+F+VV SGPDER+IPGNTVAV ADMPF GL++FG AFLSKFE
Sbjct  114  LQNSYPGAHIGPEPTTDKFVVVMSGPDERTIPGNTVAVQADMPFGGLTSFGTAFLSKFE  172



>ref|XP_010042270.1| PREDICTED: EH domain-containing protein 1-like, partial [Eucalyptus 
grandis]
Length=360

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -3

Query  416  KMFSSRSSRKKVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKP  237
            + F+ +S RK  Q +   VTS+ DGLKRLY  KLKPLEV Y+F  F SP+ TD DFDAKP
Sbjct  106  QWFTWKSGRK-AQATQNVVTSIADGLKRLYVEKLKPLEVAYQFEAFDSPLWTDGDFDAKP  164

Query  236  MIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHAD  57
            M+MLLGQYSTGKTTFIKHLL C YPGAHIGPEPTTD+F+ V SGPD+RSIPGNT AVHAD
Sbjct  165  MVMLLGQYSTGKTTFIKHLLGCEYPGAHIGPEPTTDKFVAVMSGPDKRSIPGNTAAVHAD  224

Query  56   MPFTGLSTFGGAFLSKFE  3
             PF GL  FGGAFLSKFE
Sbjct  225  KPFNGLMKFGGAFLSKFE  242



>ref|XP_010042271.1| PREDICTED: EH domain-containing protein 1-like, partial [Eucalyptus 
grandis]
Length=305

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -3

Query  314  KPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPEPT  135
            KPLEV YRFNDFVSP+LT+SDFDAKPM+MLLGQYSTGKTTFIKHLL+C YPGAHIGPEPT
Sbjct  1    KPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRCDYPGAHIGPEPT  60

Query  134  TDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            TDRF+VV SGPDERSIPGNT+AVHADMPF GL+ FGGAFLSKFE
Sbjct  61   TDRFVVVMSGPDERSIPGNTIAVHADMPFNGLTKFGGAFLSKFE  104



>ref|XP_010675794.1| PREDICTED: EH domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=446

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  368  TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFI  189
            +++ S+ DGLKRLY  KLKPLE+TY+++DF SP+LT+SDFDAKPM+MLLGQYSTGKTTFI
Sbjct  56   SSMRSIFDGLKRLYEQKLKPLELTYQYHDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFI  115

Query  188  KHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSK  9
            KHLL+  YPGAH+GPEPTTD+FIV+ SGPDER IPGNT+ V  DMP+ GL+ FG AFLSK
Sbjct  116  KHLLESGYPGAHVGPEPTTDKFIVIMSGPDERRIPGNTITVQEDMPYKGLTVFGSAFLSK  175

Query  8    FE  3
            FE
Sbjct  176  FE  177



>ref|XP_002985697.1| hypothetical protein SELMODRAFT_122705 [Selaginella moellendorffii]
 gb|EFJ13275.1| hypothetical protein SELMODRAFT_122705 [Selaginella moellendorffii]
Length=558

 Score =   205 bits (521),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  359  TSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHL  180
            TS+IDGLK+LY  KLKPLE+ Y+FNDFV P LT+SDFDAKPM+MLLGQYSTGKTTF+KHL
Sbjct  169  TSIIDGLKKLYFEKLKPLEMAYQFNDFVLPALTESDFDAKPMVMLLGQYSTGKTTFLKHL  228

Query  179  LKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            LK  YPG H+GPEPTTDRFIVV  GPDER+IPGNT  V ++MPFTGLS FG AFL+KFE
Sbjct  229  LKVDYPGCHVGPEPTTDRFIVVMGGPDERTIPGNTAVVQSEMPFTGLSKFGAAFLTKFE  287


 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 0/89 (0%)
 Frame = -3

Query  887  PFTSCSKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQG  708
            P    SK+ +  ++ WF + D+DGDGR+TG DA K F MS L K  LKQVWA+ADS RQG
Sbjct  5    PLREISKQDEAGYKRWFEYVDADGDGRITGADAVKFFAMSKLPKSDLKQVWAMADSNRQG  64

Query  707  FLGINEFTTAMQLISLAQEGEELNSDLLN  621
            +LG+ EF TAMQ+IS+AQ G EL  D+L 
Sbjct  65   YLGLKEFITAMQIISVAQSGVELTGDVLK  93



>ref|XP_009402015.1| PREDICTED: EH domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=506

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -3

Query  359  TSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHL  180
            T VIDGLKRLY+ KL+ LE+TY+FN+F SP+LT+SDFDAKPM+MLLGQYSTGKTTFIKHL
Sbjct  117  TKVIDGLKRLYSQKLELLEITYQFNEFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHL  176

Query  179  LKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            LKC YPGA IG EPTTD+FIVVTSGP+ER+I GNT+A+  DMPFTGL+ FG  FLSKFE
Sbjct  177  LKCDYPGACIGLEPTTDKFIVVTSGPNERTIFGNTIALQTDMPFTGLTKFGTEFLSKFE  235


 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 66/100 (66%), Gaps = 0/100 (0%)
 Frame = -3

Query  872  SKEQQKLFQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGIN  693
            S+E  +++  WF+F DSD DGR+T  DA   F MS+L +  LKQ+WA ADSKR+G+LG  
Sbjct  8    SEEHDRIYGKWFSFVDSDRDGRITETDAICFFAMSNLPRRVLKQIWATADSKRKGYLGFK  67

Query  692  EFTTAMQLISLAQEGEELNSDLLNLKTAAGVSPPTMKDLD  573
            EF TAM+L++LAQ G E+  D L       ++PP M  LD
Sbjct  68   EFATAMKLVALAQAGNEITQDSLAHADLQKLNPPMMGGLD  107



>ref|XP_009603511.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=467

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 151/231 (65%), Gaps = 39/231 (17%)
 Frame = -3

Query  677  MQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasangsspnssgsLTESPPQT  501
            MQL+SLAQ G  + SD LN +     +  P+++ LD LLA                  + 
Sbjct  1    MQLVSLAQAGHAVTSDFLNAEVDFENLQLPSLEGLDRLLAKKK---------------RV  45

Query  500  NGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSS-----RKKVQPSLTAVTSVIDGLK  336
                PD NG+                   +  SR++     +   + S   VTS+IDGLK
Sbjct  46   AKWVPDQNGSL------------------VLPSRANWFSSSKSSKKVSSNYVTSIIDGLK  87

Query  335  RLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGA  156
            +LY  KLKPLEVTY F+DFVSP+L +SDFDAKPM+MLLGQYSTGKTTFIKHLL+ SYPGA
Sbjct  88   KLYVKKLKPLEVTYHFSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLRTSYPGA  147

Query  155  HIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            HIGPEPTTDRF+VV +GPDERS+PGNT+AV ADMPF+GL+TFG AFLSKFE
Sbjct  148  HIGPEPTTDRFVVVMNGPDERSVPGNTIAVQADMPFSGLTTFGTAFLSKFE  198



>ref|XP_009779284.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009779285.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=467

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 151/232 (65%), Gaps = 41/232 (18%)
 Frame = -3

Query  677  MQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasangsspnssgsLTESPPQT  501
            MQL+SLAQ G  + SD LN +     +  PTM+ LD LLA                  + 
Sbjct  1    MQLVSLAQAGHAVTSDSLNAEVDFETLQLPTMEGLDGLLAKKK---------------RV  45

Query  500  NGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSS------RKKVQPSLTAVTSVIDGL  339
                PD NG+                   + SSR++        K  PS   VTS+IDGL
Sbjct  46   AKWAPDRNGSL------------------VLSSRANWFSSSKSSKKVPS-HYVTSIIDGL  86

Query  338  KRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPG  159
            K+LY  KLKPLEV Y F+DFVSP+L +SDFDAKPM+MLLGQYSTGKTTFIKHLLK SYPG
Sbjct  87   KKLYVKKLKPLEVAYHFSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLKTSYPG  146

Query  158  AHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            AHIGPEPTTDRF+VV +GPDERS+PGNT+AV ADMPF+GL+TFG +FLSKFE
Sbjct  147  AHIGPEPTTDRFVVVMNGPDERSVPGNTIAVQADMPFSGLTTFGTSFLSKFE  198



>ref|XP_009770779.1| PREDICTED: EH domain-containing protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=467

 Score =   197 bits (500),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 151/231 (65%), Gaps = 39/231 (17%)
 Frame = -3

Query  677  MQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasangsspnssgsLTESPPQT  501
            MQL+SLAQ G  + SD LN +     +  PTM+ LD LLA                  + 
Sbjct  1    MQLVSLAQAGHAVTSDSLNAEVDFETLQLPTMEGLDGLLAKKK---------------RV  45

Query  500  NGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSS-----RKKVQPSLTAVTSVIDGLK  336
                PD NG+                   M SS ++     +   + S   VTS+IDGLK
Sbjct  46   AKWAPDRNGSL------------------MLSSGANWFSSSKSAKKVSSNYVTSIIDGLK  87

Query  335  RLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGA  156
            +LY  KLKPLEVTY F+DFVSP+L +SDFDAKPM+MLLGQYSTGKTTFIKHLL+ SYPGA
Sbjct  88   KLYVKKLKPLEVTYHFSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKHLLRTSYPGA  147

Query  155  HIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            HIGPEPTTDRF+VV +GPDERS+PGNT+AV ADMPF+GL+TFG +FLSKFE
Sbjct  148  HIGPEPTTDRFVVVMNGPDERSVPGNTIAVQADMPFSGLTTFGTSFLSKFE  198



>ref|XP_009770780.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
sylvestris]
Length=436

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  362  VTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKH  183
            VTS+IDGLK+LY  KLKPLEVTY F+DFVSP+L +SDFDAKPM+MLLGQYSTGKTTFIKH
Sbjct  48   VTSIIDGLKKLYVKKLKPLEVTYHFSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKH  107

Query  182  LLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            LL+ SYPGAHIGPEPTTDRF+VV +GPDERS+PGNT+AV ADMPF+GL+TFG +FLSKFE
Sbjct  108  LLRTSYPGAHIGPEPTTDRFVVVMNGPDERSVPGNTIAVQADMPFSGLTTFGTSFLSKFE  167



>ref|XP_009779286.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009779287.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009779288.1| PREDICTED: EH domain-containing protein 1-like isoform X3 [Nicotiana 
sylvestris]
Length=436

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -3

Query  362  VTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKH  183
            VTS+IDGLK+LY  KLKPLEV Y F+DFVSP+L +SDFDAKPM+MLLGQYSTGKTTFIKH
Sbjct  48   VTSIIDGLKKLYVKKLKPLEVAYHFSDFVSPLLANSDFDAKPMVMLLGQYSTGKTTFIKH  107

Query  182  LLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
            LLK SYPGAHIGPEPTTDRF+VV +GPDERS+PGNT+AV ADMPF+GL+TFG +FLSKFE
Sbjct  108  LLKTSYPGAHIGPEPTTDRFVVVMNGPDERSVPGNTIAVQADMPFSGLTTFGTSFLSKFE  167



>ref|XP_010513695.1| PREDICTED: EH domain-containing protein 1-like [Camelina sativa]
Length=314

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 97/126 (77%), Gaps = 14/126 (11%)
 Frame = -3

Query  380  QPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGK  201
            QP +  VT +++GLKRLY  K KPLE             T+SDFDAKPM+MLLGQYSTGK
Sbjct  9    QPQVNVVT-IVNGLKRLYTEKQKPLE-------------TNSDFDAKPMVMLLGQYSTGK  54

Query  200  TTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGA  21
            TTFIKHLL C YPGAHIGPEPT DRF+V  SGPDER+IPGNT+AV ADMP  GL++FGGA
Sbjct  55   TTFIKHLLGCDYPGAHIGPEPTIDRFVVAISGPDERTIPGNTMAVQADMPLNGLTSFGGA  114

Query  20   FLSKFE  3
             LSKFE
Sbjct  115  LLSKFE  120



>ref|XP_002966377.1| hypothetical protein SELMODRAFT_85478, partial [Selaginella moellendorffii]
 gb|EFJ32404.1| hypothetical protein SELMODRAFT_85478, partial [Selaginella moellendorffii]
Length=385

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -3

Query  380  QPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGK  201
            Q S   V +VI GLK LY  KLKPLE  Y+FN F SP +TDSDF+AKPM+ LLGQYSTGK
Sbjct  1    QVSSENVAAVIAGLKDLYARKLKPLERLYKFNVFSSPAMTDSDFEAKPMVTLLGQYSTGK  60

Query  200  TTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGA  21
            TTFI H+L  SYPGAHIGPEPTTDRF+ V  G  ++++PGNTV+VHA+ PF GL  FG A
Sbjct  61   TTFISHILGRSYPGAHIGPEPTTDRFVAVMGGSVDKTVPGNTVSVHANTPFGGLKRFGTA  120

Query  20   FLSKFE  3
            FLSKFE
Sbjct  121  FLSKFE  126



>ref|XP_002978188.1| hypothetical protein SELMODRAFT_108442, partial [Selaginella 
moellendorffii]
 gb|EFJ20845.1| hypothetical protein SELMODRAFT_108442, partial [Selaginella 
moellendorffii]
Length=385

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -3

Query  380  QPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGK  201
            Q S   V +VI GLK LY  KLKPLE  Y+FN F SP +TDSDF+AKPM+ LLGQYSTGK
Sbjct  1    QVSSENVAAVIAGLKDLYARKLKPLERLYKFNVFSSPAMTDSDFEAKPMVTLLGQYSTGK  60

Query  200  TTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGA  21
            TTFI H+L  SYPGAHIGPEPTTDRF+ V  G  ++++PGNTV+VHA+ PF GL  FG A
Sbjct  61   TTFISHILGRSYPGAHIGPEPTTDRFVAVMGGSVDKTVPGNTVSVHANTPFGGLKRFGTA  120

Query  20   FLSKFE  3
            FLSKFE
Sbjct  121  FLSKFE  126



>gb|KHG01502.1| EH domain-containing 1 [Gossypium arboreum]
Length=475

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 114/253 (45%), Positives = 143/253 (57%), Gaps = 75/253 (30%)
 Frame = -3

Query  677  MQLISLAQEGEELNSDLLNLKTA-AGVSPPTMKDLDallasangsspnssgsLTESPPQT  501
            MQL+SL Q+G EL+ D+L        V PP M+ LD L+               ++P  +
Sbjct  1    MQLVSLVQDGNELSHDILKGDVDFENVKPPKMEGLDELIQK------------KKNP--S  46

Query  500  NGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGLKRLYNA  321
            N SKPD++G +P +            + + FSS+ S++     L+ VTS+ DGLK+LY  
Sbjct  47   NSSKPDSDGNSPRQASI---------TTQWFSSKPSKR----YLSNVTSIQDGLKKLYTR  93

Query  320  KLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPGAHIGPE  141
            KLKPLEVTY FNDFVSP+LT+SDFDAKPM+MLLG                    AHIGPE
Sbjct  94   KLKPLEVTYCFNDFVSPLLTNSDFDAKPMVMLLG--------------------AHIGPE  133

Query  140  PTTDRFIVVT---------------------------SGPDERSIPGNTVAVHADMPFTG  42
            PTTDRF+VV                            SG DERS+PGNT+AVHADMPFTG
Sbjct  134  PTTDRFVVVMLAYWKAHILSLKLLLQLIQAIVWESLKSGTDERSVPGNTIAVHADMPFTG  193

Query  41   LSTFGGAFLSKFE  3
            L++FG AFLSKFE
Sbjct  194  LNSFGTAFLSKFE  206



>ref|XP_005792863.1| RME1A, RME-1/EHD family protein, partial [Emiliania huxleyi CCMP1516]
 gb|EOD40434.1| RME1A, RME-1/EHD family protein, partial [Emiliania huxleyi CCMP1516]
Length=148

 Score =   168 bits (425),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = -3

Query  386  KVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYST  207
            K +P      SV DGLK+LY +K++P+E  Y+F +F SP + DSDFDAKPM++LLGQYS 
Sbjct  3    KKEPVAEIFESVSDGLKQLYRSKIRPIEEAYKFGEFYSPYMNDSDFDAKPMVLLLGQYSV  62

Query  206  GKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFG  27
            GKT+FIK+LL   +PGAHIGPEPTTDRFI V  G ++++ PGN +AV A+MPF GL  FG
Sbjct  63   GKTSFIKYLLGRDFPGAHIGPEPTTDRFIAVMHGQEDKTTPGNALAVSANMPFRGLEMFG  122

Query  26   GAFLSKFE  3
              FLSKF+
Sbjct  123  NGFLSKFQ  130



>gb|ABI13180.1| hypothetical protein [Emiliania huxleyi]
Length=417

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = -3

Query  386  KVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYST  207
            K +P      SV DGLK+LY +K++P+E  Y+F +F SP + DSDFDAKPM++LLGQYS 
Sbjct  3    KKEPVAEIFESVSDGLKQLYRSKIRPIEEAYKFGEFYSPYMNDSDFDAKPMVLLLGQYSV  62

Query  206  GKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFG  27
            GKT+FIK+LL   +PGAHIGPEPTTDRFI V  G ++++ PGN +AV A+MPF GL  FG
Sbjct  63   GKTSFIKYLLGRDFPGAHIGPEPTTDRFIAVMHGQEDKTTPGNALAVSANMPFRGLEMFG  122

Query  26   GAFLSKFE  3
              FLSKF+
Sbjct  123  NGFLSKFQ  130



>ref|XP_002946165.1| hypothetical protein VOLCADRAFT_55400 [Volvox carteri f. nagariensis]
 gb|EFJ53160.1| hypothetical protein VOLCADRAFT_55400 [Volvox carteri f. nagariensis]
Length=476

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 105/256 (41%), Positives = 132/256 (52%), Gaps = 58/256 (23%)
 Frame = -3

Query  851  FQDWFNFADSDGDGRVTGNDATKLFGMSDLSKPQLKQVWALADSKRQGFLGINEFTTAMQ  672
            +  WF  ADSD DGRVTG DA   FG S L +  L  VW LA+ +R G+L    F  AM 
Sbjct  9    YDRWFQSADSDRDGRVTGGDAVAFFGRSGLPREVLATVWELANDRRLGYLDRMAFHKAMD  68

Query  671  LISLAQEGE---------ELNSDLLNLKTAAGVSPPTMKDLDallasangsspnssgsLT  519
            LISLAQ G+         ++++    L T AG+S    K +DA  A              
Sbjct  69   LISLAQSGQPVTKDGYLAQIDAGGFRLPTMAGLSDADGKPIDAAPA-------------A  115

Query  518  ESPPQTNGSKPDTNGTTplrpiplniplrpiPSIKMFSSRSSRKKVQPSLTAVTSVIDGL  339
                   GSKP                                      +   TSVIDGL
Sbjct  116  PVGGAIYGSKP------------------------------------VPMKVCTSVIDGL  139

Query  338  KRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLKCSYPG  159
            K++Y  K++PLE  ++F  F SP+L +SDF+AKP ++LLGQYSTGKTTFIK+LL   YPG
Sbjct  140  KQIYFTKVRPLEEQFKFGHFFSPLLNESDFEAKPSVLLLGQYSTGKTTFIKYLLGRDYPG  199

Query  158  AHIGPEPTTDRFIVVT  111
             HIGPEPTTDRF+VV+
Sbjct  200  THIGPEPTTDRFVVVS  215



>emb|CEG84957.1| hypothetical protein RMATCC62417_18698 [Rhizopus microsporus]
Length=242

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  353  VIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLK  174
            V+DG+K++Y  K+KPLEVTY F  F S  LTDSD +AKP+++L+GQYSTGKTTFI++LL 
Sbjct  31   VVDGIKKIYRQKIKPLEVTYNFEGFHSAPLTDSDIEAKPIVLLIGQYSTGKTTFIRYLLD  90

Query  173  CSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
             +YPG HIG EPTTDRF+ V  G +ER IPGN  AV+ ++PF GL+ FG AFLS+F+
Sbjct  91   KAYPGEHIGVEPTTDRFVAVMHGTEERVIPGNAAAVNQELPFRGLNRFGQAFLSRFQ  147



>ref|XP_005780580.1| RME1A, RME-1/EHD family protein [Emiliania huxleyi CCMP1516]
 gb|EOD28151.1| RME1A, RME-1/EHD family protein [Emiliania huxleyi CCMP1516]
Length=562

 Score =   169 bits (427),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = -3

Query  386  KVQPSLTAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYST  207
            K +P      SV DGLK+LY +K++P+E  Y+F +F SP + DSDFDAKPM++LLGQYS 
Sbjct  3    KKEPVAEIFESVSDGLKQLYRSKIRPIEEAYKFGEFYSPYMNDSDFDAKPMVLLLGQYSV  62

Query  206  GKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFG  27
            GKT+FIK+LL   +PGAHIGPEPTTDRFI V  G ++++ PGN +AV A+MPF GL  FG
Sbjct  63   GKTSFIKYLLGRDFPGAHIGPEPTTDRFIAVMHGQEDKTTPGNALAVSANMPFRGLEMFG  122

Query  26   GAFLSKFE  3
              FLSKF+
Sbjct  123  NGFLSKFQ  130



>ref|XP_008859898.1| receptor mediated endocytosis protein, putative, partial [Entamoeba 
nuttalli P19]
 gb|EKE37764.1| receptor mediated endocytosis protein, putative, partial [Entamoeba 
nuttalli P19]
Length=162

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = -3

Query  392  RKKVQPSL-TAVTSVIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQ  216
            +KK +P + T+  SVIDG+K++Y+ K+K LE  Y+++  VSP++  +DF+AKPM++ LGQ
Sbjct  4    KKKQKPQMDTSYVSVIDGVKKIYDEKIKKLEADYKYDYLVSPLMRQADFEAKPMVLFLGQ  63

Query  215  YSTGKTTFIKHLLKCSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLS  36
            YSTGKTTFI +LL   YPG+HIGPEPTTD F+ +  GP+  +IPGNT+ V +D PFT LS
Sbjct  64   YSTGKTTFINYLLNYDYPGSHIGPEPTTDGFMAIMHGPNSTNIPGNTLCVQSDKPFTSLS  123

Query  35   TFGGAFLSKF  6
             FG  F++KF
Sbjct  124  KFGNDFMAKF  133



>emb|CEJ02933.1| hypothetical protein RMCBS344292_16925 [Rhizopus microsporus]
Length=160

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  353  VIDGLKRLYNAKLKPLEVTYRFNDFVSPVLTDSDFDAKPMIMLLGQYSTGKTTFIKHLLK  174
            VI+G+K++Y  K+KPLEVTY F  F S  LTDSD +AKPM++L+GQYSTGKTTFI++LL 
Sbjct  29   VIEGVKKIYKTKIKPLEVTYNFEGFHSAPLTDSDIEAKPMVLLIGQYSTGKTTFIRYLLD  88

Query  173  CSYPGAHIGPEPTTDRFIVVTSGPDERSIPGNTVAVHADMPFTGLSTFGGAFLSKFE  3
              YPG HIG EPTTDRF+ V +G ++R IPGN  AV+ D+PF GL+ FG  FLS+F+
Sbjct  89   KKYPGEHIGVEPTTDRFLAVMNGGEDRIIPGNAAAVNQDLPFRGLNHFGQGFLSRFQ  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2351319000596