BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17684_g1_i1 len=642 path=[676:0-95 771:96-99 29:100-136 811:137-138
813:139-641]

Length=642
                                                                      Score     E

dbj|BAF47117.1|  MtN19 like protein                                     124   3e-32   Nicotiana tabacum [American tobacco]
ref|XP_006346625.1|  PREDICTED: uncharacterized protein LOC102590754    129   1e-31   
ref|XP_006346626.1|  PREDICTED: uncharacterized protein LOC102591330    126   2e-30   
ref|XP_004252289.1|  PREDICTED: uncharacterized protein LOC101252852    125   4e-30   
emb|CBI15775.3|  unnamed protein product                                121   5e-30   
ref|XP_009596902.1|  PREDICTED: uncharacterized protein LOC104092914    125   5e-30   
ref|XP_009610723.1|  PREDICTED: uncharacterized protein LOC104104364    124   2e-29   
ref|XP_004242193.1|  PREDICTED: uncharacterized protein LOC101264834    123   3e-29   
ref|XP_009802236.1|  PREDICTED: uncharacterized protein LOC104247817    122   4e-29   
ref|XP_008360160.1|  PREDICTED: uncharacterized protein LOC103423859    119   4e-29   
gb|EYU24544.1|  hypothetical protein MIMGU_mgv1a007758mg                122   5e-29   
ref|XP_002284739.2|  PREDICTED: uncharacterized protein LOC100243...    120   2e-28   Vitis vinifera
ref|XP_010663820.1|  PREDICTED: uncharacterized protein LOC100243...    120   2e-28   
ref|XP_009786123.1|  PREDICTED: uncharacterized protein LOC104234287    120   2e-28   
ref|XP_009373663.1|  PREDICTED: uncharacterized protein LOC103962645    120   2e-28   
ref|XP_008808813.1|  PREDICTED: uncharacterized protein LOC103720...    119   6e-28   
ref|XP_008808814.1|  PREDICTED: uncharacterized protein LOC103720...    119   7e-28   
emb|CDO98291.1|  unnamed protein product                                119   9e-28   
ref|XP_009360279.1|  PREDICTED: uncharacterized protein LOC103950769    118   1e-27   
ref|XP_010099536.1|  hypothetical protein L484_011609                   118   1e-27   
gb|KEH31349.1|  stress up-regulated Nod 19 protein                      117   3e-27   
ref|XP_008375426.1|  PREDICTED: uncharacterized protein LOC103438663    117   3e-27   
ref|XP_002511074.1|  conserved hypothetical protein                     117   3e-27   Ricinus communis
ref|XP_010099538.1|  hypothetical protein L484_011611                   117   3e-27   
dbj|BAE71234.1|  hypothetical protein                                   117   3e-27   Trifolium pratense [peavine clover]
ref|XP_010099537.1|  hypothetical protein L484_011610                   116   4e-27   
ref|XP_010255828.1|  PREDICTED: uncharacterized protein LOC104596...    117   4e-27   
ref|XP_004504713.1|  PREDICTED: uncharacterized protein LOC101499286    116   4e-27   
ref|XP_010255827.1|  PREDICTED: uncharacterized protein LOC104596...    117   6e-27   
gb|AFK39438.1|  unknown                                                 111   6e-27   
ref|XP_008375421.1|  PREDICTED: uncharacterized protein LOC103438661    115   6e-27   
ref|XP_010255826.1|  PREDICTED: uncharacterized protein LOC104596...    117   7e-27   
ref|XP_009360277.1|  PREDICTED: uncharacterized protein LOC103950768    115   8e-27   
ref|XP_009335863.1|  PREDICTED: uncharacterized protein LOC103928535    114   3e-26   
ref|XP_008367082.1|  PREDICTED: uncharacterized protein LOC103430711    114   3e-26   
ref|XP_009411808.1|  PREDICTED: uncharacterized protein LOC103993457    114   3e-26   
ref|XP_009373664.1|  PREDICTED: uncharacterized protein LOC103962646    114   4e-26   
gb|AAU14999.2|  MtN19-like protein                                      114   4e-26   Pisum sativum [garden pea]
dbj|BAJ53113.1|  JHL07K02.3                                             113   4e-26   
gb|KEH31355.1|  stress up-regulated Nod 19 protein                      114   4e-26   
dbj|BAJ88316.1|  predicted protein                                      112   5e-26   
ref|XP_011043018.1|  PREDICTED: uncharacterized protein LOC105138...    109   5e-26   
ref|XP_011043019.1|  PREDICTED: uncharacterized protein LOC105138...    108   5e-26   
ref|XP_006844650.1|  hypothetical protein AMTR_s00016p00236100          113   6e-26   
gb|KEH31350.1|  stress up-regulated Nod 19 protein                      113   6e-26   
gb|KEH31347.1|  stress up-regulated Nod 19 protein                      113   7e-26   
ref|XP_006374582.1|  hypothetical protein POPTR_0015s12010g             113   8e-26   
ref|XP_002321764.2|  hypothetical protein POPTR_0015s12000g             113   9e-26   Populus trichocarpa [western balsam poplar]
gb|KEH31351.1|  stress up-regulated Nod 19 protein                      112   9e-26   
ref|XP_002511073.1|  conserved hypothetical protein                     113   1e-25   Ricinus communis
gb|EMS67244.1|  hypothetical protein TRIUR3_19124                       112   1e-25   
dbj|BAJ86815.1|  predicted protein                                      112   1e-25   
gb|AFA26164.1|  hypothetical protein                                    106   1e-25   
dbj|BAJ87916.1|  predicted protein                                      112   1e-25   
ref|XP_003574848.1|  PREDICTED: uncharacterized protein LOC100825842    112   2e-25   
gb|EMS55330.1|  hypothetical protein TRIUR3_10894                       112   2e-25   
ref|XP_003574847.1|  PREDICTED: uncharacterized protein LOC100825330    112   2e-25   
ref|XP_006346659.1|  PREDICTED: uncharacterized protein LOC102603832    112   2e-25   
ref|XP_006374583.1|  hypothetical protein POPTR_0015s12020g             111   3e-25   
gb|EMT11028.1|  hypothetical protein F775_20874                         111   3e-25   
gb|KHN25869.1|  hypothetical protein glysoja_018723                     108   5e-25   
ref|XP_011040294.1|  PREDICTED: uncharacterized protein LOC105136594    111   5e-25   
gb|AFK43962.1|  unknown                                                 110   5e-25   
gb|ACJ85534.1|  unknown                                                 110   7e-25   Medicago truncatula
ref|XP_011040295.1|  PREDICTED: uncharacterized protein LOC105136...    110   7e-25   
ref|XP_011040297.1|  PREDICTED: uncharacterized protein LOC105136...    110   8e-25   
ref|XP_006659641.1|  PREDICTED: uncharacterized protein LOC102706312    110   8e-25   
gb|EMT06228.1|  hypothetical protein F775_26753                         110   9e-25   
gb|KEH26246.1|  stress up-regulated Nod 19 protein                      110   1e-24   
ref|XP_006376936.1|  hypothetical protein POPTR_0012s11240g             106   1e-24   
gb|KEH31348.1|  stress up-regulated Nod 19 protein                      109   1e-24   
ref|XP_010668152.1|  PREDICTED: uncharacterized protein LOC104885143    109   2e-24   
ref|XP_011073280.1|  PREDICTED: uncharacterized protein LOC105158279    109   2e-24   
gb|EEC83958.1|  hypothetical protein OsI_30065                          108   2e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001062371.1|  Os08g0538600                                       108   2e-24   Oryza sativa Japonica Group [Japonica rice]
gb|EMS67414.1|  hypothetical protein TRIUR3_30255                       108   2e-24   
ref|XP_003524108.1|  PREDICTED: uncharacterized protein LOC100785991    108   3e-24   
gb|EYU21767.1|  hypothetical protein MIMGU_mgv1a005580mg                108   3e-24   
gb|AFK45617.1|  unknown                                                 108   4e-24   
ref|XP_007147472.1|  hypothetical protein PHAVU_006G127400g             108   4e-24   
ref|XP_007147471.1|  hypothetical protein PHAVU_006G127300g             108   4e-24   
gb|KHN14319.1|  hypothetical protein glysoja_012357                     103   4e-24   
ref|XP_010036842.1|  PREDICTED: uncharacterized protein LOC104425754    108   4e-24   
ref|XP_007158975.1|  hypothetical protein PHAVU_002G197800g             108   4e-24   
ref|XP_007158977.1|  hypothetical protein PHAVU_002G197800g             108   5e-24   
ref|XP_004163909.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    107   5e-24   
ref|XP_011003519.1|  PREDICTED: uncharacterized protein LOC105110237    108   5e-24   
ref|XP_011016694.1|  PREDICTED: uncharacterized protein LOC105120200    108   5e-24   
gb|KGN43818.1|  hypothetical protein Csa_7G069440                       107   6e-24   
gb|KEH16840.1|  stress up-regulated Nod 19 protein                      107   6e-24   
ref|XP_011073598.1|  PREDICTED: uncharacterized protein LOC105158513    107   6e-24   
ref|XP_011073597.1|  PREDICTED: uncharacterized protein LOC105158512    107   6e-24   
gb|AGV54779.1|  MtN19-like protein                                      107   7e-24   
emb|CDO98292.1|  unnamed protein product                                107   8e-24   
ref|XP_006374581.1|  hypothetical protein POPTR_0015s11990g             107   8e-24   
ref|XP_007038175.1|  MtN19-like protein, putative isoform 2             108   1e-23   
gb|ACJ85863.1|  unknown                                                 107   1e-23   Medicago truncatula
ref|XP_007038174.1|  MtN19-like protein, putative isoform 1             108   1e-23   
ref|XP_003531077.1|  PREDICTED: uncharacterized protein LOC100803...    107   1e-23   
gb|KEH41600.1|  stress up-regulated Nod 19 protein                      106   1e-23   
ref|NP_001240902.1|  uncharacterized protein LOC100784767 precursor     106   2e-23   
gb|KHN25868.1|  hypothetical protein glysoja_018722                     106   2e-23   
ref|XP_006368006.1|  PREDICTED: uncharacterized protein LOC102587597    106   2e-23   
ref|XP_004300379.1|  PREDICTED: uncharacterized protein LOC101300825    106   2e-23   
gb|KHG10977.1|  G2/mitotic-specific cyclin-B                            106   3e-23   
ref|XP_006376935.1|  hypothetical protein POPTR_0012s11210g             106   3e-23   
ref|XP_004137076.1|  PREDICTED: uncharacterized protein LOC101210001    107   3e-23   
ref|XP_006436986.1|  hypothetical protein CICLE_v10031458mg             105   5e-23   
ref|XP_006485063.1|  PREDICTED: uncharacterized protein LOC102618549    105   5e-23   
gb|KEH31354.1|  stress up-regulated Nod 19 protein                      104   5e-23   
ref|XP_004974041.1|  PREDICTED: uncharacterized protein LOC101778...    105   5e-23   
gb|KHN39141.1|  hypothetical protein glysoja_027946                     107   6e-23   
gb|ACU22964.1|  unknown                                                 104   7e-23   Glycine max [soybeans]
ref|XP_002445785.1|  hypothetical protein SORBIDRAFT_07g025770          104   7e-23   Sorghum bicolor [broomcorn]
ref|XP_006844651.1|  hypothetical protein AMTR_s00016p00236400          104   7e-23   
ref|XP_003594550.1|  MtN19 protein                                      104   8e-23   
ref|XP_006436984.1|  hypothetical protein CICLE_v10031461mg             104   9e-23   
ref|XP_004974040.1|  PREDICTED: uncharacterized protein LOC101777764    104   9e-23   
ref|XP_003594548.1|  MtN19 protein                                      103   1e-22   
gb|AES64799.2|  stress up-regulated Nod 19 protein                      103   1e-22   
ref|XP_008455078.1|  PREDICTED: uncharacterized protein LOC103495342    103   1e-22   
ref|XP_008453444.1|  PREDICTED: uncharacterized protein LOC103494150    102   3e-22   
ref|XP_006586844.1|  PREDICTED: uncharacterized protein LOC100791925    102   3e-22   
ref|XP_003594549.1|  MtN19 protein                                      105   3e-22   
ref|XP_004974037.1|  PREDICTED: uncharacterized protein LOC101776...    102   4e-22   
gb|AES64800.2|  stress up-regulated Nod 19 protein                      105   4e-22   
ref|XP_011073282.1|  PREDICTED: uncharacterized protein LOC105158282    102   6e-22   
gb|KEH26244.1|  stress up-regulated Nod 19 protein                      102   6e-22   
gb|KDO37888.1|  hypothetical protein CISIN_1g033184mg                 97.4    7e-22   
ref|XP_004300378.1|  PREDICTED: uncharacterized protein LOC101300539    101   7e-22   
ref|XP_011040291.1|  PREDICTED: uncharacterized protein LOC105136589    102   9e-22   
ref|XP_002983409.1|  hypothetical protein SELMODRAFT_118146             101   1e-21   
ref|XP_011073281.1|  PREDICTED: uncharacterized protein LOC105158280    101   1e-21   
gb|AFK39203.1|  unknown                                               95.1    2e-21   
gb|KHG23950.1|  G2/mitotic-specific cyclin-B                            101   2e-21   
ref|XP_003546270.2|  PREDICTED: uncharacterized protein LOC100815629    102   2e-21   
gb|AFK34663.1|  unknown                                                 100   2e-21   
ref|XP_004974890.1|  PREDICTED: uncharacterized protein LOC101770076    100   3e-21   
ref|XP_007134079.1|  hypothetical protein PHAVU_010G0178001g          96.3    3e-21   
ref|XP_002960630.1|  hypothetical protein SELMODRAFT_75188            99.4    4e-21   
ref|XP_007134300.1|  hypothetical protein PHAVU_010G035700g           99.4    5e-21   
ref|XP_006579112.1|  PREDICTED: uncharacterized protein LOC100799740  99.0    5e-21   
ref|NP_001148097.1|  LOC100281705                                     97.4    6e-21   Zea mays [maize]
ref|XP_006844648.1|  hypothetical protein AMTR_s00016p00235580        99.0    6e-21   
dbj|BAI63593.1|  MtN19 protein                                        99.0    6e-21   Lotus japonicus
ref|XP_002960632.1|  hypothetical protein SELMODRAFT_437681           98.6    1e-20   
ref|NP_001148306.1|  mtN19-like protein precursor                     98.2    1e-20   Zea mays [maize]
ref|XP_007134296.1|  hypothetical protein PHAVU_010G0353000g          93.2    1e-20   
ref|XP_004160434.1|  PREDICTED: uncharacterized protein LOC101223324  97.8    2e-20   
ref|XP_004137324.1|  PREDICTED: uncharacterized protein LOC101215981  97.8    2e-20   
gb|KHN18974.1|  hypothetical protein glysoja_039898                   97.8    2e-20   
ref|XP_002983406.1|  hypothetical protein SELMODRAFT_422686           98.2    2e-20   
ref|XP_006574192.1|  PREDICTED: uncharacterized protein LOC100820275  99.0    2e-20   
ref|XP_002983404.1|  hypothetical protein SELMODRAFT_43474            97.1    3e-20   
ref|XP_006577651.1|  PREDICTED: uncharacterized protein LOC100806449  97.8    3e-20   
tpg|DAA48290.1|  TPA: mtN19-like protein                              97.1    3e-20   
gb|ACG30313.1|  mtN19-like protein                                    97.1    3e-20   Zea mays [maize]
tpg|DAA48291.1|  TPA: hypothetical protein ZEAMMB73_362863            97.1    3e-20   
ref|XP_006577556.1|  PREDICTED: uncharacterized protein LOC102664794  97.1    4e-20   
ref|XP_008453441.1|  PREDICTED: uncharacterized protein LOC103494146  95.9    4e-20   
gb|KHN15503.1|  hypothetical protein glysoja_049065                   96.7    4e-20   
ref|XP_007132991.1|  hypothetical protein PHAVU_011G142100g           96.3    5e-20   
ref|XP_002983407.1|  hypothetical protein SELMODRAFT_118200           96.3    5e-20   
ref|XP_007137902.1|  hypothetical protein PHAVU_009G165400g           96.3    6e-20   
ref|XP_002960631.1|  hypothetical protein SELMODRAFT_270236           96.7    6e-20   
ref|XP_006577555.1|  PREDICTED: uncharacterized protein LOC102664678  96.3    6e-20   
emb|CDY71873.1|  BnaCnng74880D                                        92.8    7e-20   
gb|KHN17845.1|  hypothetical protein glysoja_047764                   95.9    8e-20   
gb|KHN44115.1|  hypothetical protein glysoja_039253                   91.7    8e-20   
ref|XP_007134084.1|  hypothetical protein PHAVU_010G018100g           95.5    9e-20   
ref|XP_007134075.1|  hypothetical protein PHAVU_010G017500g           95.9    1e-19   
ref|XP_007134138.1|  hypothetical protein PHAVU_010G022500g           95.9    1e-19   
ref|XP_003522144.2|  PREDICTED: uncharacterized protein LOC100792489  96.7    1e-19   
ref|XP_006574191.1|  PREDICTED: uncharacterized protein LOC100818138  94.4    1e-19   
emb|CAA75589.1|  MtN19                                                95.5    1e-19   Medicago truncatula
gb|KHN44114.1|  hypothetical protein glysoja_039252                   94.7    1e-19   
gb|KDO57643.1|  hypothetical protein CISIN_1g041033mg                 90.9    1e-19   
ref|XP_007134081.1|  hypothetical protein PHAVU_010G017900g           95.1    1e-19   
ref|XP_008453438.1|  PREDICTED: uncharacterized protein LOC103494145  95.5    2e-19   
ref|XP_007134136.1|  hypothetical protein PHAVU_010G022300g           94.7    2e-19   
ref|XP_004160447.1|  PREDICTED: uncharacterized protein LOC101226295  91.3    6e-19   
ref|XP_002960633.1|  hypothetical protein SELMODRAFT_437681           93.6    8e-19   
ref|XP_008453443.1|  PREDICTED: uncharacterized protein LOC103494148  93.2    8e-19   
ref|XP_007133892.1|  hypothetical protein PHAVU_010G000800g           92.4    1e-18   
gb|KHN42509.1|  hypothetical protein glysoja_031445                   89.0    2e-18   
ref|XP_006577472.1|  PREDICTED: uncharacterized protein LOC100779893  89.4    2e-18   
ref|XP_006394466.1|  hypothetical protein EUTSA_v10004123mg           92.8    2e-18   
ref|XP_006394469.1|  hypothetical protein EUTSA_v10004141mg           92.4    3e-18   
ref|XP_009130176.1|  PREDICTED: uncharacterized protein LOC103854962  92.0    3e-18   
ref|XP_004513390.1|  PREDICTED: uncharacterized protein LOC101513345  90.5    7e-18   
emb|CDY71894.1|  BnaCnng74970D                                        88.6    8e-18   
ref|XP_010546109.1|  PREDICTED: uncharacterized protein LOC104818287  90.5    1e-17   
ref|XP_004510129.1|  PREDICTED: uncharacterized protein LOC101508405  89.0    3e-17   
gb|KGN63844.1|  hypothetical protein Csa_1G024275                     89.4    3e-17   
ref|XP_004160448.1|  PREDICTED: uncharacterized protein LOC101226527  89.0    3e-17   
ref|XP_006574193.1|  PREDICTED: uncharacterized protein LOC102666323  86.7    5e-17   
ref|XP_004506757.1|  PREDICTED: uncharacterized protein LOC101509765  87.0    1e-16   
ref|XP_004497966.1|  PREDICTED: uncharacterized protein LOC101492429  87.0    1e-16   
gb|AAL91170.1|  putative protein                                      87.4    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200990.2|  uncharacterized protein                             87.4    2e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY53158.1|  BnaCnng24580D                                        87.4    2e-16   
ref|XP_004497967.1|  PREDICTED: uncharacterized protein LOC101492762  87.8    2e-16   
dbj|BAB10082.1|  MtN19-like protein                                   87.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004512657.1|  PREDICTED: uncharacterized protein LOC101515735  84.7    8e-16   
ref|XP_010444016.1|  PREDICTED: uncharacterized protein LOC104726775  79.0    6e-15   
ref|XP_010444012.1|  PREDICTED: uncharacterized protein LOC104726772  82.8    6e-15   
emb|CDY42880.1|  BnaAnng07050D                                        78.2    6e-15   
ref|XP_009150119.1|  PREDICTED: uncharacterized protein LOC103873465  82.4    7e-15   
ref|XP_006280401.1|  hypothetical protein CARUB_v10026327mg           82.4    8e-15   
ref|XP_003620759.1|  MtN19-like protein                               82.0    9e-15   
ref|XP_002866457.1|  hypothetical protein ARALYDRAFT_496351           82.0    1e-14   
ref|XP_006279767.1|  hypothetical protein CARUB_v10027779mg           82.0    1e-14   
ref|XP_003599552.1|  MtN19-like protein                               81.3    1e-14   
ref|XP_010457823.1|  PREDICTED: uncharacterized protein LOC104739234  80.5    4e-14   
ref|XP_003620745.1|  MtN19 protein                                    79.7    5e-14   
ref|XP_003627861.1|  MtN19-like protein                               79.3    7e-14   
ref|XP_010457791.1|  PREDICTED: uncharacterized protein LOC104739210  79.3    1e-13   
ref|XP_010483865.1|  PREDICTED: uncharacterized protein LOC104762...  78.6    1e-13   
ref|XP_010483864.1|  PREDICTED: uncharacterized protein LOC104762...  78.6    1e-13   
ref|XP_010483862.1|  PREDICTED: uncharacterized protein LOC104762299  78.6    2e-13   
ref|XP_010457781.1|  PREDICTED: uncharacterized protein LOC104739202  75.9    1e-12   
ref|XP_010457757.1|  PREDICTED: uncharacterized protein LOC104739180  74.3    4e-12   
ref|XP_010444011.1|  PREDICTED: uncharacterized protein LOC104726771  73.2    9e-12   
ref|XP_010477840.1|  PREDICTED: uncharacterized protein LOC104756879  72.8    1e-11   
gb|KHN25867.1|  hypothetical protein glysoja_018721                   67.0    2e-10   
ref|XP_008392751.1|  PREDICTED: uncharacterized protein LOC103454938  67.0    1e-09   
ref|XP_001784976.1|  predicted protein                                66.2    2e-09   
ref|XP_003589696.1|  MtN19-like protein                               65.5    2e-09   
gb|KDO31539.1|  hypothetical protein SPRG_03467                       65.9    3e-09   
ref|XP_008609227.1|  hypothetical protein SDRG_05292                  65.5    3e-09   
ref|XP_001774740.1|  predicted protein                                62.0    4e-08   
gb|ETK72754.1|  hypothetical protein L915_20217                       61.2    8e-08   
gb|ETI32377.1|  hypothetical protein F443_20804                       61.2    8e-08   
ref|XP_004137547.1|  PREDICTED: uncharacterized protein LOC101210584  60.8    1e-07   
gb|ETO61110.1|  hypothetical protein F444_20823                       60.5    1e-07   
ref|XP_008898088.1|  hypothetical protein PPTG_06079                  60.5    1e-07   
ref|XP_002904847.1|  conserved hypothetical protein                   60.1    2e-07   
emb|CCI40599.1|  unnamed protein product                              59.3    4e-07   
ref|XP_001779179.1|  predicted protein                                58.5    6e-07   
ref|XP_009520872.1|  hypothetical protein PHYSODRAFT_555341           58.5    6e-07   
ref|XP_009835512.1|  hypothetical protein H257_10611                  58.5    8e-07   
ref|XP_009835513.1|  hypothetical protein H257_10612                  58.5    8e-07   
gb|EJK60813.1|  hypothetical protein THAOC_18774                      56.2    4e-06   
emb|CCA14282.1|  conserved hypothetical protein                       52.0    1e-04   



>dbj|BAF47117.1| MtN19 like protein [Nicotiana tabacum]
Length=118

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGRV+C S PIYG G E GNE GY+VGMS+CYP+PGS+KI+  E +T+ISNYS+ Q H
Sbjct  6    GEDGRVICSSLPIYGEGKEPGNEAGYIVGMSSCYPRPGSIKISEGETVTLISNYSSAQRH  65

Query  185  TGVMGYYYILVAEPLPKSNPIFHSLD  262
            TGVMG +Y+LVAEP P  N   HS D
Sbjct  66   TGVMGLFYLLVAEPSPTPNSFLHSTD  91



>ref|XP_006346625.1| PREDICTED: uncharacterized protein LOC102590754 [Solanum tuberosum]
Length=463

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGRV+C S PIYG G E GNE GY+VGMSTCYP+PGS+KI+  E +T++SNYSN Q H
Sbjct  331  GEDGRVICSSLPIYGEGKEPGNEAGYIVGMSTCYPRPGSIKISEGETVTLLSNYSNAQRH  390

Query  185  TGVMGYYYILVAEPLPKSNPIFHSLD  262
            TGVMG +Y+LVAEP PK N I HS D
Sbjct  391  TGVMGLFYLLVAEPSPKPNSILHSTD  416



>ref|XP_006346626.1| PREDICTED: uncharacterized protein LOC102591330 [Solanum tuberosum]
Length=471

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G DGRV+C S PIYG G E GNE GY+VGMSTCYP+PGS+KI+  E +T++SNYSN Q H
Sbjct  339  GVDGRVICSSLPIYGEGKEPGNEAGYIVGMSTCYPRPGSIKISEGETVTLLSNYSNAQRH  398

Query  185  TGVMGYYYILVAEPLPKSNPIFHSLD  262
            TGVMG +Y+LVAEP PK N I HS D
Sbjct  399  TGVMGLFYLLVAEPSPKPNSILHSTD  424



>ref|XP_004252289.1| PREDICTED: uncharacterized protein LOC101252852 [Solanum lycopersicum]
 ref|XP_010314239.1| PREDICTED: uncharacterized protein LOC101252852 [Solanum lycopersicum]
Length=462

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDG V+C S PIYG G E GNE GY+VGMS+CYP+PGS+KI+  E +T++SNYSN Q H
Sbjct  331  GEDGHVICSSIPIYGEGKEPGNEAGYIVGMSSCYPRPGSIKISAGETVTLLSNYSNAQRH  390

Query  185  TGVMGYYYILVAEPLPKSNPIFHSLD  262
            TGVMG +Y+LVAEP PK N I HS D
Sbjct  391  TGVMGLFYLLVAEPSPKPNSILHSTD  416



>emb|CBI15775.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGR++C S P YG G EAGNE GY+VGMSTCYPQPGSVKI+  E L + SNYS+ Q 
Sbjct  95   YGEDGRIICSSIPTYGEGKEAGNEAGYIVGMSTCYPQPGSVKISDGETLILESNYSSTQK  154

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +YILVAEP P  + + HS
Sbjct  155  HTGVMGLFYILVAEPSPNPSLLLHS  179



>ref|XP_009596902.1| PREDICTED: uncharacterized protein LOC104092914 [Nicotiana tomentosiformis]
 ref|XP_009596903.1| PREDICTED: uncharacterized protein LOC104092914 [Nicotiana tomentosiformis]
 ref|XP_009596904.1| PREDICTED: uncharacterized protein LOC104092914 [Nicotiana tomentosiformis]
Length=457

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGRV+C S PIYG G E GNE GY+VGMSTCYP+PGSVKI+  E LT +S YS+ Q H
Sbjct  331  GEDGRVICSSLPIYGKGKEPGNEAGYIVGMSTCYPKPGSVKISKGETLTFVSKYSSAQRH  390

Query  185  TGVMGYYYILVAEPLPKSNPIFHSLD  262
            TGVMG +YILVAEP  K + I HS D
Sbjct  391  TGVMGLFYILVAEPSQKRSSILHSTD  416



>ref|XP_009610723.1| PREDICTED: uncharacterized protein LOC104104364 [Nicotiana tomentosiformis]
Length=466

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGRV+C S PIYG G E GNE GY+VGMS+CYP+PGS+KI+  E +T+ISNYS+ Q H
Sbjct  335  GEDGRVICSSLPIYGEGKEPGNEAGYIVGMSSCYPRPGSIKISEGETVTLISNYSSAQRH  394

Query  185  TGVMGYYYILVAEPLPKSNPIFHSLD  262
            TGVMG +Y+LVAEP P  N   HS D
Sbjct  395  TGVMGLFYLLVAEPSPTPNSFLHSAD  420



>ref|XP_004242193.1| PREDICTED: uncharacterized protein LOC101264834 [Solanum lycopersicum]
Length=465

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
             GEDGRV+C S PIYG G EAGNE GY+VGMS+CYP+PGSVKI+  E LT++SNYS  Q 
Sbjct  334  LGEDGRVICSSLPIYGEGKEAGNEAGYIVGMSSCYPRPGSVKISKGETLTLLSNYSCDQR  393

Query  182  HTGVMGYYYILVAEPLPKSNPIFHSLD-VADLV  277
            HTGVMG +Y+LVAE   +S+ I HS D + D+V
Sbjct  394  HTGVMGLFYLLVAEMSRQSSSILHSKDNIGDIV  426



>ref|XP_009802236.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
 ref|XP_009802237.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
 ref|XP_009802238.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
 ref|XP_009802239.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
 ref|XP_009802240.1| PREDICTED: uncharacterized protein LOC104247817 [Nicotiana sylvestris]
Length=473

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGRV+C S PIYG G E GNE GY+VGMSTCYP+PGSVKI+  E LT++S YS+ Q H
Sbjct  334  GEDGRVICSSLPIYGEGKEPGNEAGYIVGMSTCYPKPGSVKISNGETLTLVSKYSSAQRH  393

Query  185  TGVMGYYYILVAEPLPKSNPIFHSLD  262
            TGVMG +YILVAEP  K   I HS D
Sbjct  394  TGVMGLFYILVAEPPHKPRSILHSTD  419



>ref|XP_008360160.1| PREDICTED: uncharacterized protein LOC103423859 [Malus domestica]
Length=229

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PIYG G EAG+E GY+V MSTCYPQPGSVKI   E LT++SNYS+ Q 
Sbjct  142  YGEDGRVLCSSIPIYGKGKEAGHEAGYIVXMSTCYPQPGSVKINDGETLTLVSNYSSAQT  201

Query  182  HTGVMGYYYILVAEPLPKSNPIFHSLD  262
            HTGVM  +YILVA+ LPKS  +  SLD
Sbjct  202  HTGVMDLFYILVADYLPKSAAL--SLD  226



>gb|EYU24544.1| hypothetical protein MIMGU_mgv1a007758mg [Erythranthe guttata]
Length=396

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GE GR++C S PIYG G EAGNE GY+VGMSTCYP PGS+KI+  EKLT++SNYSN Q 
Sbjct  262  YGEGGRLICWSNPIYGTGEEAGNEAGYVVGMSTCYPTPGSLKISSGEKLTLVSNYSNAQS  321

Query  182  HTGVMGYYYILVAEPLPKSNPI  247
            HTGVMG++Y+L+A+  PKSNP+
Sbjct  322  HTGVMGFFYLLIADSSPKSNPL  343



>ref|XP_002284739.2| PREDICTED: uncharacterized protein LOC100243857 isoform X1 [Vitis 
vinifera]
Length=465

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGR++C S P YG G EAGNE GY+VGMSTCYPQPGSVKI+  E L + SNYS+ Q 
Sbjct  334  YGEDGRIICSSIPTYGEGKEAGNEAGYIVGMSTCYPQPGSVKISDGETLILESNYSSTQK  393

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +YILVAEP P  + + HS
Sbjct  394  HTGVMGLFYILVAEPSPNPSLLLHS  418



>ref|XP_010663820.1| PREDICTED: uncharacterized protein LOC100243857 isoform X2 [Vitis 
vinifera]
Length=422

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGR++C S P YG G EAGNE GY+VGMSTCYPQPGSVKI+  E L + SNYS+ Q 
Sbjct  334  YGEDGRIICSSIPTYGEGKEAGNEAGYIVGMSTCYPQPGSVKISDGETLILESNYSSTQK  393

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +YILVAEP P  + + HS
Sbjct  394  HTGVMGLFYILVAEPSPNPSLLLHS  418



>ref|XP_009786123.1| PREDICTED: uncharacterized protein LOC104234287 [Nicotiana sylvestris]
Length=466

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGR +C S PIYG G E GNE GY+VGMS+CYP+PGS+KI+  E +T+ISNYS+ Q H
Sbjct  335  GEDGRAICSSLPIYGEGKEPGNEAGYIVGMSSCYPKPGSIKISEGETVTLISNYSSAQRH  394

Query  185  TGVMGYYYILVAEPLPKSNPIFHSLD  262
            TGVMG +Y+LV EP P  N   HS D
Sbjct  395  TGVMGLFYLLVTEPSPTPNSFLHSTD  420



>ref|XP_009373663.1| PREDICTED: uncharacterized protein LOC103962645 [Pyrus x bretschneideri]
Length=418

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 70/87 (80%), Gaps = 2/87 (2%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PIYG G EAG+E GY+VGMSTCYPQPGSVKI   E LT++SNYS+ Q 
Sbjct  331  YGEDGRVLCSSIPIYGKGKEAGDEAGYIVGMSTCYPQPGSVKINDGETLTLVSNYSSSQT  390

Query  182  HTGVMGYYYILVAEPLPKSNPIFHSLD  262
            HTGVM  +YILVA+ LPKS+ +  SLD
Sbjct  391  HTGVMDLFYILVADYLPKSSVL--SLD  415



>ref|XP_008808813.1| PREDICTED: uncharacterized protein LOC103720742 isoform X1 [Phoenix 
dactylifera]
Length=487

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P+YG+G EAGNE GY++GMSTCYP+ GSV++A  E LT+ SNYS  QM
Sbjct  350  YGQDGRVLCTSIPVYGDGREAGNEAGYIIGMSTCYPEAGSVRVADGEVLTLESNYSRTQM  409

Query  182  HTGVMGYYYILVAEPLPKSNPIF-HSLDVA  268
            HTGVMG +YILVAEP P+   +  HS  ++
Sbjct  410  HTGVMGLFYILVAEPQPQPKTLHDHSFPIS  439



>ref|XP_008808814.1| PREDICTED: uncharacterized protein LOC103720742 isoform X2 [Phoenix 
dactylifera]
Length=472

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P+YG+G EAGNE GY++GMSTCYP+ GSV++A  E LT+ SNYS  QM
Sbjct  335  YGQDGRVLCTSIPVYGDGREAGNEAGYIIGMSTCYPEAGSVRVADGEVLTLESNYSRTQM  394

Query  182  HTGVMGYYYILVAEPLPKSNPIF-HSLDVA  268
            HTGVMG +YILVAEP P+   +  HS  ++
Sbjct  395  HTGVMGLFYILVAEPQPQPKTLHDHSFPIS  424



>emb|CDO98291.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRV+C S PIYG G E GNE GY+VGMSTCYP+PGS+KI+  E LT++SNYSN Q 
Sbjct  385  YGEDGRVICSSIPIYGQGMEPGNESGYIVGMSTCYPKPGSIKISSGESLTLVSNYSNAQR  444

Query  182  HTGVMGYYYILVAEP  226
            HTGVMG +YILVA+P
Sbjct  445  HTGVMGLFYILVADP  459



>ref|XP_009360279.1| PREDICTED: uncharacterized protein LOC103950769 [Pyrus x bretschneideri]
 ref|XP_009360280.1| PREDICTED: uncharacterized protein LOC103950769 [Pyrus x bretschneideri]
 ref|XP_009360286.1| PREDICTED: uncharacterized protein LOC103950773 [Pyrus x bretschneideri]
 ref|XP_009360287.1| PREDICTED: uncharacterized protein LOC103950773 [Pyrus x bretschneideri]
Length=417

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 2/89 (2%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PIYG G EAG+E GY+VGMS+CYP+PGS++I   E LT++SNYS+ Q 
Sbjct  330  YGEDGRVLCSSIPIYGKGKEAGDEAGYIVGMSSCYPRPGSIRINDGETLTLVSNYSSTQT  389

Query  182  HTGVMGYYYILVAEPLPKSNPIFHSLDVA  268
            HTGVMG +YILVA+ LP S+ +  S D A
Sbjct  390  HTGVMGLFYILVADYLPTSSVL--SFDTA  416



>ref|XP_010099536.1| hypothetical protein L484_011609 [Morus notabilis]
 gb|EXB79416.1| hypothetical protein L484_011609 [Morus notabilis]
Length=420

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRV+C S PIYG G EAGNE+GY+VGM+TCYPQPGSVKI   E L + SNYS+ Q 
Sbjct  334  YGEDGRVICSSIPIYGKGEEAGNEEGYIVGMTTCYPQPGSVKILDGETLILESNYSSSQP  393

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +YILVAE LP      HS
Sbjct  394  HTGVMGLFYILVAEKLPNPTVSMHS  418



>gb|KEH31349.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=435

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YGNG EAGNE GY+VGMSTCYP+PGSVKI   E LT++SNYS+ + 
Sbjct  336  YGQDGRVICSSIPSYGNGNEAGNETGYIVGMSTCYPKPGSVKIVDGETLTLVSNYSSTKE  395

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG +Y+LVAE LP  +
Sbjct  396  HTGVMGLFYLLVAEQLPDQH  415



>ref|XP_008375426.1| PREDICTED: uncharacterized protein LOC103438663 [Malus domestica]
Length=410

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PIYG G EAG+E GY+VGMS+CYP+PGS++I   E LT++SNYS+ Q 
Sbjct  330  YGEDGRVLCSSIPIYGKGKEAGDEAGYIVGMSSCYPRPGSIRINDGETLTLVSNYSSTQT  389

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG +YILVA+ LP S+
Sbjct  390  HTGVMGLFYILVADYLPNSS  409



>ref|XP_002511074.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51676.1| conserved hypothetical protein [Ricinus communis]
Length=467

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S PIYG G EAGNE GY+VGMSTCYP+PGSVKIA  E LT+ SNYS+ Q 
Sbjct  331  YGQDGRVICTSLPIYGEGKEAGNEAGYIVGMSTCYPKPGSVKIADGENLTLESNYSSTQT  390

Query  182  HTGVMGYYYILVAEPLPKSNPI  247
            HTGVMG +YILVA+  P  NP+
Sbjct  391  HTGVMGLFYILVADQTP--NPV  410



>ref|XP_010099538.1| hypothetical protein L484_011611 [Morus notabilis]
 gb|EXB79418.1| hypothetical protein L484_011611 [Morus notabilis]
Length=420

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PIYG G EAGNE GY+VGM+TCYPQPGSVKI   E + + SNYS+ Q 
Sbjct  334  YGEDGRVLCSSIPIYGKGKEAGNEKGYIVGMTTCYPQPGSVKILDGETMILESNYSSSQP  393

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +YILVA+ LP  +   HS
Sbjct  394  HTGVMGLFYILVADKLPNPSLSMHS  418



>dbj|BAE71234.1| hypothetical protein [Trifolium pratense]
Length=404

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YGNG EAGNE GY+VGMSTCYPQPGSVKI   E LT+ SNY+N++ 
Sbjct  324  YGQDGRVICSSIPTYGNGNEAGNEVGYIVGMSTCYPQPGSVKIIDGETLTLESNYNNIKE  383

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +Y+LVAE LP
Sbjct  384  HTGVMGLFYLLVAEQLP  400



>ref|XP_010099537.1| hypothetical protein L484_011610 [Morus notabilis]
 gb|EXB79417.1| hypothetical protein L484_011610 [Morus notabilis]
Length=420

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PIYG G EAGNE GY+VGM+TCYPQPGSVKI   E + + SNYS+ Q 
Sbjct  334  YGEDGRVLCSSIPIYGKGKEAGNEKGYIVGMTTCYPQPGSVKILDGETMILESNYSSSQP  393

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +YILVA+ LP  +   HS
Sbjct  394  HTGVMGLFYILVADKLPNPSLSMHS  418



>ref|XP_010255828.1| PREDICTED: uncharacterized protein LOC104596392 isoform X3 [Nelumbo 
nucifera]
Length=465

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PIYG G EAGNE GY+VGMS CYP PGSV+++  E LT+ SNYS+ Q 
Sbjct  336  YGEDGRVLCSSIPIYGEGKEAGNEAGYIVGMSACYPHPGSVQVSSGETLTLESNYSSTQK  395

Query  182  HTGVMGYYYILVAEPLPKS  238
            HTGVMG +YILVA+P P+S
Sbjct  396  HTGVMGLFYILVADPPPES  414



>ref|XP_004504713.1| PREDICTED: uncharacterized protein LOC101499286 [Cicer arietinum]
Length=431

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YGNG EAGNE GY+VGMSTCYPQPGSVKI   E LT+ S+Y+N Q 
Sbjct  338  YGQDGRVICSSIPSYGNGNEAGNEAGYIVGMSTCYPQPGSVKIIDGETLTLESSYNNSQE  397

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +Y+LVAE LP      HS
Sbjct  398  HTGVMGLFYLLVAEQLPYQQYFRHS  422



>ref|XP_010255827.1| PREDICTED: uncharacterized protein LOC104596392 isoform X2 [Nelumbo 
nucifera]
Length=543

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PIYG G EAGNE GY+VGMS CYP PGSV+++  E LT+ SNYS+ Q 
Sbjct  414  YGEDGRVLCSSIPIYGEGKEAGNEAGYIVGMSACYPHPGSVQVSSGETLTLESNYSSTQK  473

Query  182  HTGVMGYYYILVAEPLPKS  238
            HTGVMG +YILVA+P P+S
Sbjct  474  HTGVMGLFYILVADPPPES  492



>gb|AFK39438.1| unknown [Medicago truncatula]
Length=158

 Score =   111 bits (278),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YGNG+EAGNE GY+VGMSTCYP+ GSVKI   E LT+ SNY++ + 
Sbjct  59   YGQDGRVICSSIPSYGNGSEAGNEAGYIVGMSTCYPKSGSVKIIDGETLTLESNYNSTKE  118

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +Y+LVAE LP
Sbjct  119  HTGVMGLFYLLVAEQLP  135



>ref|XP_008375421.1| PREDICTED: uncharacterized protein LOC103438661 [Malus domestica]
 ref|XP_008375422.1| PREDICTED: uncharacterized protein LOC103438661 [Malus domestica]
Length=406

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S PIYGNGT+AGNE GY+VGM+TCYP PGSVKI   E LT++S Y++ QM
Sbjct  331  YGQDGRVLCSSTPIYGNGTKAGNEAGYIVGMTTCYPWPGSVKIKNAEPLTLVSTYNSTQM  390

Query  182  HTGVMGYYYILVAEPL  229
            H+GVMG +YILVAE L
Sbjct  391  HSGVMGLFYILVAETL  406



>ref|XP_010255826.1| PREDICTED: uncharacterized protein LOC104596392 isoform X1 [Nelumbo 
nucifera]
Length=574

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PIYG G EAGNE GY+VGMS CYP PGSV+++  E LT+ SNYS+ Q 
Sbjct  445  YGEDGRVLCSSIPIYGEGKEAGNEAGYIVGMSACYPHPGSVQVSSGETLTLESNYSSTQK  504

Query  182  HTGVMGYYYILVAEPLPKS  238
            HTGVMG +YILVA+P P+S
Sbjct  505  HTGVMGLFYILVADPPPES  523



>ref|XP_009360277.1| PREDICTED: uncharacterized protein LOC103950768 [Pyrus x bretschneideri]
 ref|XP_009360278.1| PREDICTED: uncharacterized protein LOC103950768 [Pyrus x bretschneideri]
 ref|XP_009360288.1| PREDICTED: uncharacterized protein LOC103950774 [Pyrus x bretschneideri]
 ref|XP_009360289.1| PREDICTED: uncharacterized protein LOC103950774 [Pyrus x bretschneideri]
Length=406

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P+YGNGT+AGNE GY+VGM+TCYP PGSVKI   E LT++S+Y++ QM
Sbjct  331  YGQDGRVLCSSTPMYGNGTKAGNEAGYIVGMTTCYPWPGSVKIKNAESLTLVSSYNSTQM  390

Query  182  HTGVMGYYYILVAEPL  229
            H+GVMG +YILVAE L
Sbjct  391  HSGVMGLFYILVAETL  406



>ref|XP_009335863.1| PREDICTED: uncharacterized protein LOC103928535 [Pyrus x bretschneideri]
 ref|XP_009335864.1| PREDICTED: uncharacterized protein LOC103928535 [Pyrus x bretschneideri]
Length=406

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGRVLC S PIYG G +AGNE GY++GM+TCYP+PGSVKI   E LT++SNY + QMH
Sbjct  332  GEDGRVLCSSTPIYGKGKKAGNEAGYIIGMTTCYPRPGSVKIKDGETLTVVSNYESAQMH  391

Query  185  TGVMGYYYILVAEPL  229
            +GVMG +YILVAE L
Sbjct  392  SGVMGLFYILVAETL  406



>ref|XP_008367082.1| PREDICTED: uncharacterized protein LOC103430711 [Malus domestica]
Length=406

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGRVLC S PIYG G EAGNE GY+VGM+TCYP PGSVKI   E LT++SNY + Q+H
Sbjct  332  GEDGRVLCSSTPIYGKGKEAGNEAGYIVGMTTCYPWPGSVKIKDGETLTVVSNYESTQLH  391

Query  185  TGVMGYYYILVAEPL  229
            +GVMG +YILVAE L
Sbjct  392  SGVMGLFYILVAETL  406



>ref|XP_009411808.1| PREDICTED: uncharacterized protein LOC103993457 [Musa acuminata 
subsp. malaccensis]
Length=463

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG+G EAGNE GY+VGMSTCYP+PGSV++   E LT+ SNYS+ Q 
Sbjct  331  YGQDGRVLCTSNPTYGDGEEAGNEAGYIVGMSTCYPKPGSVQVVDGEMLTLESNYSSNQA  390

Query  182  HTGVMGYYYILVAEPLPKSNPIF  250
            HTGVMG +Y+LVAE +PKS  + 
Sbjct  391  HTGVMGLFYVLVAEAVPKSKTML  413



>ref|XP_009373664.1| PREDICTED: uncharacterized protein LOC103962646 [Pyrus x bretschneideri]
 ref|XP_009373665.1| PREDICTED: uncharacterized protein LOC103962646 [Pyrus x bretschneideri]
Length=406

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGRVLC S PIYG G +AGNE GY++GM+TCYP+PGSVKI   E LT++SNY + QMH
Sbjct  332  GEDGRVLCSSTPIYGKGKKAGNEAGYVIGMTTCYPRPGSVKIKDGETLTVVSNYESTQMH  391

Query  185  TGVMGYYYILVAEPL  229
            +GVMG +YILVAE L
Sbjct  392  SGVMGLFYILVAETL  406



>gb|AAU14999.2| MtN19-like protein [Pisum sativum]
Length=435

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 76/106 (72%), Gaps = 6/106 (6%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YGNG EAGNE GY+VGMSTCYP+PGS+KI   E LT+ SNY++ + 
Sbjct  336  YGQDGRVICSSIPSYGNGNEAGNESGYIVGMSTCYPKPGSMKIMDGETLTLESNYNSTKE  395

Query  182  HTGVMGYYYILVAEPLPKSNPIFHSLDVADLV*VFKLGSNDLMCSS  319
            HTGVMG +YILVAE LP  + + HS   +     F + SN+++  S
Sbjct  396  HTGVMGLFYILVAEQLPYQH-LRHSTRSS-----FFMDSNNMLLDS  435



>dbj|BAJ53113.1| JHL07K02.3 [Jatropha curcas]
 gb|KDP22519.1| hypothetical protein JCGZ_26350 [Jatropha curcas]
Length=409

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + +DGRV+C S P YGNGTEAGNE GY+VGMSTCYP+PGSVKI+  E L + S YS+ Q 
Sbjct  328  YRKDGRVICTSVPTYGNGTEAGNEAGYIVGMSTCYPKPGSVKISDGENLILESKYSSAQR  387

Query  182  HTGVMGYYYILVAEPLPKSNPI  247
            HTGVMG +YILVA+  P+ +P 
Sbjct  388  HTGVMGLFYILVADRTPRHSPF  409



>gb|KEH31355.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=433

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            FG+DGRV+C S P YG G+EAGNE GY+VGMSTCYP+PGSVKI   E LT+ SNY++ + 
Sbjct  336  FGQDGRVICSSIPNYGKGSEAGNESGYIVGMSTCYPKPGSVKIIDGETLTLESNYNSTKE  395

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +YILVAE LP
Sbjct  396  HTGVMGLFYILVAEQLP  412



>dbj|BAJ88316.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DGR+LC S PIYG G EAGNE+GY+VGMSTCYP+PG+VK++  E LTI+SNYS+ + H
Sbjct  200  GQDGRLLCKSMPIYGTGQEAGNEEGYIVGMSTCYPEPGTVKVSDGEVLTIVSNYSSERQH  259

Query  185  TGVMGYYYILVAE  223
            TGVMG++YILVA+
Sbjct  260  TGVMGHFYILVAD  272



>ref|XP_011043018.1| PREDICTED: uncharacterized protein LOC105138584 isoform X1 [Populus 
euphratica]
Length=177

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            FGE+GRV+C S PIYG G +AG+E GY+VGMSTCYP+PGS++I   E L + S YS+ Q 
Sbjct  46   FGEEGRVICTSEPIYGEGKDAGDEAGYVVGMSTCYPEPGSIQITAGENLVLESYYSSTQK  105

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +YILVAE  P      HS
Sbjct  106  HTGVMGIFYILVAERTPNPTNFLHS  130



>ref|XP_011043019.1| PREDICTED: uncharacterized protein LOC105138584 isoform X2 [Populus 
euphratica]
Length=155

 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            FGE+GRV+C S PIYG G +AG+E GY+VGMSTCYP+PGS++I   E L + S YS+ Q 
Sbjct  24   FGEEGRVICTSEPIYGEGKDAGDEAGYVVGMSTCYPEPGSIQITAGENLVLESYYSSTQK  83

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +YILVAE  P      HS
Sbjct  84   HTGVMGIFYILVAERTPNPTNFLHS  108



>ref|XP_006844650.1| hypothetical protein AMTR_s00016p00236100 [Amborella trichopoda]
 gb|ERN06325.1| hypothetical protein AMTR_s00016p00236100 [Amborella trichopoda]
Length=465

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            FG+DGRV+C+S P YG G EAGNE GY+VGMSTCYP+PGSVK+   E LT+ S YS   M
Sbjct  326  FGQDGRVICNSMPTYGKGEEAGNEAGYIVGMSTCYPEPGSVKVKDGETLTLESRYSGATM  385

Query  182  HTGVMGYYYILVAEPLPKS  238
            HTGVMG +YILVAEP   S
Sbjct  386  HTGVMGLFYILVAEPTGNS  404



>gb|KEH31350.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=425

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YGNG+EAGNE GY+VGMSTCYP+PGSVKI   E LT+ SNY++ + 
Sbjct  326  YGQDGRVICSSIPSYGNGSEAGNEAGYIVGMSTCYPKPGSVKIIDGETLTLESNYNSTKE  385

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +Y+LVAE LP
Sbjct  386  HTGVMGLFYLLVAEQLP  402



>gb|KEH31347.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=437

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G EAGNE  Y+VGMSTCYP+PGSVKI   E LT++SNYSN + 
Sbjct  338  YGQDGRVICSSIPSYGTGNEAGNEANYIVGMSTCYPKPGSVKIIDGETLTLVSNYSNSKE  397

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +Y+LVAE LP
Sbjct  398  HTGVMGLFYLLVAEQLP  414



>ref|XP_006374582.1| hypothetical protein POPTR_0015s12010g [Populus trichocarpa]
 gb|ERP52379.1| hypothetical protein POPTR_0015s12010g [Populus trichocarpa]
Length=446

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DG V+C S PIYGNG EAGNEDGY+VGMSTCYP+PGSVKI   E LT+ SNY +   
Sbjct  315  YGQDGNVICASIPIYGNGNEAGNEDGYIVGMSTCYPEPGSVKITAGENLTLESNYDSTNK  374

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG++YI +AE  P
Sbjct  375  HTGVMGFFYIYIAEQAP  391



>ref|XP_002321764.2| hypothetical protein POPTR_0015s12000g [Populus trichocarpa]
 gb|EEF05891.2| hypothetical protein POPTR_0015s12000g [Populus trichocarpa]
Length=466

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G EAGNE GY+VGMSTCYP+PGS++I   EKL + SNYS  Q 
Sbjct  334  YGKDGRVICTSLPTYGEGKEAGNEAGYIVGMSTCYPEPGSIQITAGEKLVLESNYSRDQN  393

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +YILVA+  P    + H+
Sbjct  394  HTGVMGLFYILVADRTPNPTSLLHA  418



>gb|KEH31351.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=420

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YGNG+EAGNE GY+VGMSTCYP+PGS+KI   E LT+ SNY+N Q 
Sbjct  336  YGQDGRVICSSKPSYGNGSEAGNEVGYIVGMSTCYPKPGSIKIIDGETLTLESNYNNSQE  395

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG++Y+LVAE   +S+
Sbjct  396  HTGVMGFFYLLVAEHSTRSS  415



>ref|XP_002511073.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51675.1| conserved hypothetical protein [Ricinus communis]
Length=463

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DG V+C S PIYG G EAGNE GY+VGMSTCYP+PGS+KIA  E L + S YS  Q 
Sbjct  331  YGKDGLVICTSVPIYGEGMEAGNEAGYIVGMSTCYPKPGSIKIADGENLILESRYSRAQE  390

Query  182  HTGVMGYYYILVAEPLPKSNPIFHSL  259
            HTGVMG +YILVA+ +P+  P   SL
Sbjct  391  HTGVMGLFYILVADRVPERMPFIESL  416



>gb|EMS67244.1| hypothetical protein TRIUR3_19124 [Triticum urartu]
Length=434

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DGR+LC+S P YG G EAGNE  Y+VGMSTCYP+PGS+K++  E LTI+SNYS+V+ H
Sbjct  324  GQDGRLLCESLPTYGTGKEAGNEANYIVGMSTCYPKPGSIKVSDGEVLTIVSNYSSVRQH  383

Query  185  TGVMGYYYILVAEP  226
            TGVMG  YILVAEP
Sbjct  384  TGVMGLVYILVAEP  397



>dbj|BAJ86815.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=422

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DGR+LC S PIYG G EAGNE+GY+VGMSTCYP+PG+VK++  E LTI+SNYS+ + H
Sbjct  320  GQDGRLLCKSMPIYGTGQEAGNEEGYIVGMSTCYPEPGTVKVSDGEVLTIVSNYSSERQH  379

Query  185  TGVMGYYYILVAE  223
            TGVMG++YILVA+
Sbjct  380  TGVMGHFYILVAD  392



>gb|AFA26164.1| hypothetical protein, partial [Lolium perenne]
Length=98

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +2

Query  14   GRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGV  193
            GR+LC+S P YG G EAGNE  Y+VGMSTCYP+PGS+K++  E LT++SNYS+ + HTGV
Sbjct  1    GRLLCESLPTYGTGQEAGNEANYIVGMSTCYPKPGSIKVSDSEVLTVVSNYSSDRQHTGV  60

Query  194  MGYYYILVAEP  226
            MG +YILVAEP
Sbjct  61   MGLFYILVAEP  71



>dbj|BAJ87916.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=422

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DGR+LC S PIYG G EAGNE+GY+VGMSTCYP+PG+VK++  E LTI+SNYS+ + H
Sbjct  320  GQDGRLLCKSMPIYGTGQEAGNEEGYIVGMSTCYPEPGTVKVSDGEVLTIVSNYSSERQH  379

Query  185  TGVMGYYYILVAE  223
            TGVMG++YILVA+
Sbjct  380  TGVMGHFYILVAD  392



>ref|XP_003574848.1| PREDICTED: uncharacterized protein LOC100825842 [Brachypodium 
distachyon]
Length=404

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +2

Query  8    EDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHT  187
            +DGR+LC+S P YG G EAGNE GY+VGMSTCYP+PGSVK++  E LT++SNYS+ + HT
Sbjct  329  QDGRLLCESLPTYGTGKEAGNEAGYVVGMSTCYPKPGSVKVSDGEVLTVVSNYSSYRRHT  388

Query  188  GVMGYYYILVAEP  226
            GVMG +YILVAEP
Sbjct  389  GVMGLFYILVAEP  401



>gb|EMS55330.1| hypothetical protein TRIUR3_10894 [Triticum urartu]
Length=419

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DGR+LC S PIYG G EAGNE+GY+VGMSTCYP+PG+VK++  E LTI+SNYS+ + H
Sbjct  317  GQDGRLLCKSMPIYGTGQEAGNEEGYVVGMSTCYPEPGTVKVSDGEVLTIVSNYSSERQH  376

Query  185  TGVMGYYYILVAE  223
            TGVMG++YILVA+
Sbjct  377  TGVMGHFYILVAD  389



>ref|XP_003574847.1| PREDICTED: uncharacterized protein LOC100825330 [Brachypodium 
distachyon]
Length=421

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DGR+LC+S P YG G EAGNE  Y+VGMSTCYP+PGSVK++  E LT +SNYS+ + H
Sbjct  320  GQDGRLLCESLPTYGTGKEAGNEANYIVGMSTCYPKPGSVKVSDGEVLTQVSNYSSDRQH  379

Query  185  TGVMGYYYILVAEPLPKSNP  244
            TGVMG +YILVAEP  ++ P
Sbjct  380  TGVMGLFYILVAEPQQQTAP  399



>ref|XP_006346659.1| PREDICTED: uncharacterized protein LOC102603832 [Solanum tuberosum]
Length=468

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GE+G V+C S PIYG G E G E GY+VGMS+ YP+PGS+KI+  E +T++SNYSN Q  
Sbjct  337  GEEGHVICSSLPIYGKGKEPGYEAGYIVGMSSFYPRPGSIKISEGETITLLSNYSNDQRQ  396

Query  185  TGVMGYYYILVAEPLPKSNPIFHSLD  262
            TGV+G +Y+LVAEP PK N I HS D
Sbjct  397  TGVLGLFYLLVAEPSPKPNSILHSAD  422



>ref|XP_006374583.1| hypothetical protein POPTR_0015s12020g [Populus trichocarpa]
 gb|ERP52380.1| hypothetical protein POPTR_0015s12020g [Populus trichocarpa]
Length=465

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DG VLC S PIYGNG EAGNEDGY+VGMS+CYP+PGSVKI   E LT+ SNY++   
Sbjct  332  YGQDGNVLCTSIPIYGNGNEAGNEDGYIVGMSSCYPEPGSVKITAGENLTLESNYNSTNK  391

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +YI +AE  P
Sbjct  392  HTGVMGLFYIYIAEQAP  408



>gb|EMT11028.1| hypothetical protein F775_20874 [Aegilops tauschii]
Length=441

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DGR+LC S PIYG G EAGNE+GY+VGMSTCYP+PG+VK++  E LT++SNYS+ + H
Sbjct  339  GQDGRLLCKSMPIYGTGQEAGNEEGYVVGMSTCYPEPGTVKVSDGEVLTMVSNYSSERQH  398

Query  185  TGVMGYYYILVAE  223
            TGVMG++YILVA+
Sbjct  399  TGVMGHFYILVAD  411



>gb|KHN25869.1| hypothetical protein glysoja_018723 [Glycine soja]
Length=245

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G EAGNE  Y+VGMSTCYP+PGSVKI   E LT+ SNYS+ + 
Sbjct  148  YGQDGRVICSSIPSYGKGKEAGNEADYIVGMSTCYPRPGSVKIIDGETLTLESNYSSSRE  207

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG +Y+LVAE LP  +
Sbjct  208  HTGVMGLFYLLVAEQLPDQH  227



>ref|XP_011040294.1| PREDICTED: uncharacterized protein LOC105136594 [Populus euphratica]
Length=466

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S PIYG G EAGNE GY+VGMSTCYP+PGS++I   EKL + SNYS  Q 
Sbjct  334  YGKDGRVICTSLPIYGEGKEAGNEAGYIVGMSTCYPEPGSIQITAGEKLVLESNYSRDQN  393

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +Y+LVA+  P    +  +
Sbjct  394  HTGVMGLFYMLVADRTPNPTSLLQA  418



>gb|AFK43962.1| unknown [Medicago truncatula]
Length=425

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YGNG+EAGNE GY+VGMSTCYP+ GSVKI   E LT+ SNY++ + 
Sbjct  326  YGQDGRVICSSIPSYGNGSEAGNEAGYIVGMSTCYPKSGSVKIIDGETLTLESNYNSTKE  385

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +Y+LVAE LP
Sbjct  386  HTGVMGLFYLLVAEQLP  402



>gb|ACJ85534.1| unknown [Medicago truncatula]
Length=420

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YGN +EAGNE GY+VGMSTCYP+PGS+KI   E LT+ SNY+N Q 
Sbjct  336  YGQDGRVICSSKPSYGNRSEAGNEVGYIVGMSTCYPKPGSIKIIDGETLTLESNYNNSQE  395

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG++Y+LVAE   +S+
Sbjct  396  HTGVMGFFYLLVAEHSTRSS  415



>ref|XP_011040295.1| PREDICTED: uncharacterized protein LOC105136595 isoform X1 [Populus 
euphratica]
 ref|XP_011040296.1| PREDICTED: uncharacterized protein LOC105136595 isoform X1 [Populus 
euphratica]
Length=467

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DG V+C S PIYGNG EAGNEDGY+VGMS+CYP+PGSVK+   E LT+ SNY++   
Sbjct  332  YGQDGNVICTSIPIYGNGNEAGNEDGYIVGMSSCYPKPGSVKLTAGENLTLESNYNSTNK  391

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +YI VAE  P
Sbjct  392  HTGVMGLFYIYVAEQAP  408



>ref|XP_011040297.1| PREDICTED: uncharacterized protein LOC105136595 isoform X2 [Populus 
euphratica]
Length=462

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DG V+C S PIYGNG EAGNEDGY+VGMS+CYP+PGSVK+   E LT+ SNY++   
Sbjct  327  YGQDGNVICTSIPIYGNGNEAGNEDGYIVGMSSCYPKPGSVKLTAGENLTLESNYNSTNK  386

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +YI VAE  P
Sbjct  387  HTGVMGLFYIYVAEQAP  403



>ref|XP_006659641.1| PREDICTED: uncharacterized protein LOC102706312 [Oryza brachyantha]
Length=424

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 65/85 (76%), Gaps = 3/85 (4%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DGR+LC S P YGNG EAGNE+ Y+VGMSTCYP+PGSVK++  E LT++SNYS+ + H
Sbjct  324  GQDGRLLCASIPTYGNGEEAGNEENYIVGMSTCYPKPGSVKVSDGEVLTVVSNYSSDRQH  383

Query  185  TGVMGYYYILVAE---PLPKSNPIF  250
            TGVMG  YILVAE   P PK    F
Sbjct  384  TGVMGLLYILVAENEQPAPKPALCF  408



>gb|EMT06228.1| hypothetical protein F775_26753 [Aegilops tauschii]
Length=422

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DGR+LC+S P YG G EAGNE  Y+VGMSTCYP+PGS+K++  E LTI+SNYS+ + H
Sbjct  322  GQDGRLLCESLPTYGTGKEAGNEANYIVGMSTCYPKPGSIKVSDGEVLTIVSNYSSDRQH  381

Query  185  TGVMGYYYILVAEP  226
            TGVMG  YILVAEP
Sbjct  382  TGVMGLVYILVAEP  395



>gb|KEH26246.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=432

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG+G EAGNE GY+VGMSTCYP+PGSVKI   E LT  SNY+N + 
Sbjct  336  YGQDGRVICSSVPSYGHGNEAGNEAGYIVGMSTCYPKPGSVKIIDGEILTHESNYNNTKE  395

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +Y+LVAE LP
Sbjct  396  HTGVMGLFYLLVAEQLP  412



>ref|XP_006376936.1| hypothetical protein POPTR_0012s11240g, partial [Populus trichocarpa]
 gb|ERP54733.1| hypothetical protein POPTR_0012s11240g, partial [Populus trichocarpa]
Length=182

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GE+GRV+C S PI+G G +AG+E GY+VGMSTCYP+PGS++I   E L + S YS+ Q 
Sbjct  51   YGEEGRVICTSEPIFGEGKDAGDEAGYVVGMSTCYPEPGSIQITAGENLVLESYYSSTQK  110

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +Y+LVAE  P      HS
Sbjct  111  HTGVMGIFYVLVAERTPNPTNFLHS  135



>gb|KEH31348.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=430

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+D RV+C S P YGNG EAGNE GY+VGMSTCYP+PGS+KI   E LT++S Y+N Q 
Sbjct  337  YGQDERVICSSIPRYGNGNEAGNETGYIVGMSTCYPKPGSIKIIDGETLTLVSIYNNSQE  396

Query  182  HTGVMGYYYILVAEPLPKSN  241
            H GVMG +Y+LVAE LP  +
Sbjct  397  HNGVMGLFYLLVAEQLPDQH  416



>ref|XP_010668152.1| PREDICTED: uncharacterized protein LOC104885143 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010668153.1| PREDICTED: uncharacterized protein LOC104885143 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010668154.1| PREDICTED: uncharacterized protein LOC104885143 [Beta vulgaris 
subsp. vulgaris]
Length=413

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + +DGRV+C S P YG GTEAGNE GY+VGMSTCYP PGS+KI   E L + SNYS+ + 
Sbjct  329  YRKDGRVICSSLPSYGKGTEAGNESGYIVGMSTCYPDPGSIKIYDGETLVLESNYSSSRK  388

Query  182  HTGVMGYYYILVAEPLPKSNPI  247
            HTGVMG +YILVAE LP    +
Sbjct  389  HTGVMGLFYILVAEQLPTQKSL  410



>ref|XP_011073280.1| PREDICTED: uncharacterized protein LOC105158279 [Sesamum indicum]
Length=457

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GE GRV+C S P YG G E G+E GY+VGMSTCYP PGSVKIA  E LT++SNYS+ Q 
Sbjct  326  YGEGGRVICSSNPTYGTGEEPGDEAGYIVGMSTCYPSPGSVKIAAGETLTLVSNYSSSQR  385

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +Y+L+++   K + + H+
Sbjct  386  HTGVMGLFYLLISDSSAKPDAVLHA  410



>gb|EEC83958.1| hypothetical protein OsI_30065 [Oryza sativa Indica Group]
Length=424

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DGR+LC S P YG G EAGNED Y+VGMSTCYP+PGSVK++  E LT++SNYS+ + H
Sbjct  324  GQDGRLLCASIPSYGKGEEAGNEDNYIVGMSTCYPKPGSVKVSDGEVLTVVSNYSSDRQH  383

Query  185  TGVMGYYYILVAE---PLPKSNPIF  250
            TGVMG  YILVAE   P PK    F
Sbjct  384  TGVMGLLYILVAEQEQPAPKPALCF  408



>ref|NP_001062371.1| Os08g0538600 [Oryza sativa Japonica Group]
 dbj|BAD01246.1| putative MtN19 [Oryza sativa Japonica Group]
 dbj|BAD33139.1| putative MtN19 [Oryza sativa Japonica Group]
 dbj|BAF24285.1| Os08g0538600 [Oryza sativa Japonica Group]
 dbj|BAG90628.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55136.1| hypothetical protein OsJ_02924 [Oryza sativa Japonica Group]
Length=424

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 3/85 (4%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DGR+LC S P YG G EAGNED Y+VGMSTCYP+PGSVK++  E LT++SNYS+ + H
Sbjct  324  GQDGRLLCASIPSYGKGEEAGNEDNYIVGMSTCYPKPGSVKVSDGEVLTVVSNYSSDRQH  383

Query  185  TGVMGYYYILVAE---PLPKSNPIF  250
            TGVMG  YILVAE   P PK    F
Sbjct  384  TGVMGLLYILVAEQEQPAPKPALCF  408



>gb|EMS67414.1| hypothetical protein TRIUR3_30255 [Triticum urartu]
Length=424

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DGR+LC+S P YG G EAGNE  Y+VGMSTCYP+PGS+K++  E LTI+SNYS+   H
Sbjct  331  GQDGRLLCESLPTYGTGKEAGNEANYIVGMSTCYPKPGSIKVSDGEVLTIVSNYSSDCEH  390

Query  185  TGVMGYYYILVAEP  226
            TGVMG  YILVAEP
Sbjct  391  TGVMGLVYILVAEP  404



>ref|XP_003524108.1| PREDICTED: uncharacterized protein LOC100785991 [Glycine max]
Length=429

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G EAGNE  Y+VGMSTCYP+PGSVKI   E LT+ SNYS+ + 
Sbjct  332  YGQDGRVICSSIPSYGKGKEAGNEADYIVGMSTCYPRPGSVKIIDGETLTLESNYSSSRE  391

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG +Y+LVAE LP  +
Sbjct  392  HTGVMGLFYLLVAEQLPDQH  411



>gb|EYU21767.1| hypothetical protein MIMGU_mgv1a005580mg [Erythranthe guttata]
Length=478

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GE GR++C S P YG G E GNE GY+VGMSTCYP PGSVKI+  E LT++SNYS+ Q 
Sbjct  336  YGEGGRLICSSNPTYGTGKEPGNEAGYIVGMSTCYPSPGSVKISDGETLTLVSNYSSTQT  395

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +Y+LV++  P+ + +  S
Sbjct  396  HTGVMGLFYLLVSDSSPERDNLVQS  420



>gb|AFK45617.1| unknown [Medicago truncatula]
Length=420

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YGN +EAGNE GY+VGMSTCYP+PGS+ I   E LT+ SNY+N Q 
Sbjct  336  YGQDGRVICSSKPSYGNRSEAGNEVGYIVGMSTCYPKPGSINIIDGETLTLESNYNNSQE  395

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG++Y+LVAE   +S+
Sbjct  396  HTGVMGFFYLLVAEHSTRSS  415



>ref|XP_007147472.1| hypothetical protein PHAVU_006G127400g [Phaseolus vulgaris]
 gb|ESW19466.1| hypothetical protein PHAVU_006G127400g [Phaseolus vulgaris]
Length=404

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            F +DG V+C S P YGNG EAGNE GY+VGMSTCYP+PG++KI   E +T+   Y+N QM
Sbjct  327  FAQDGGVICSSIPKYGNGNEAGNEKGYIVGMSTCYPKPGTIKIKDGETITLEIKYNNSQM  386

Query  182  HTGVMGYYYILVAEPLP  232
            H+GVMG +YILVAE LP
Sbjct  387  HSGVMGLFYILVAEQLP  403



>ref|XP_007147471.1| hypothetical protein PHAVU_006G127300g [Phaseolus vulgaris]
 gb|ESW19465.1| hypothetical protein PHAVU_006G127300g [Phaseolus vulgaris]
Length=404

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            F +DG V+C S P YGNG EAGNE GY+VGMSTCYP+PG++KI   E +T+   Y+N QM
Sbjct  327  FAQDGGVICSSIPKYGNGNEAGNEKGYIVGMSTCYPKPGTIKIKDGETITLEIKYNNSQM  386

Query  182  HTGVMGYYYILVAEPLP  232
            H+GVMG +YILVAE LP
Sbjct  387  HSGVMGLFYILVAEQLP  403



>gb|KHN14319.1| hypothetical protein glysoja_012357 [Glycine soja]
Length=136

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DG V+C S P YG G+E GNE GY+VGMSTCYP+PG++KI   E LT+   YSN +M
Sbjct  55   YGQDGGVICSSIPKYGTGSEVGNEGGYVVGMSTCYPRPGTIKIKDGETLTLEIIYSNSEM  114

Query  182  HTGVMGYYYILVAEPLPKSN  241
            H+GVMG +YILVAE LP  +
Sbjct  115  HSGVMGLFYILVAEQLPHQH  134



>ref|XP_010036842.1| PREDICTED: uncharacterized protein LOC104425754 [Eucalyptus grandis]
 gb|KCW48501.1| hypothetical protein EUGRSUZ_K02186 [Eucalyptus grandis]
Length=460

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGR++C S  +YG G EAGNE GY+VGMSTCYP+PGSVKI   E L + SNYS  Q 
Sbjct  335  YGEDGRIVCSSVSVYGTGKEAGNEAGYIVGMSTCYPRPGSVKINDGEILVLESNYSKSQN  394

Query  182  HTGVMGYYYILVAEPLPKS  238
            HTGVMG +Y+LVA  LP S
Sbjct  395  HTGVMGLFYLLVARDLPSS  413



>ref|XP_007158975.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
 gb|ESW30969.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
Length=425

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G +AGNE+ Y+VGMSTCYP+PGSVKI   E LT+ SNYS+   
Sbjct  328  YGKDGRVICSSVPKYGKGKDAGNEENYIVGMSTCYPRPGSVKIMHGETLTLESNYSSTHG  387

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +Y+LVAE LP
Sbjct  388  HTGVMGLFYLLVAEQLP  404



>ref|XP_007158977.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
 gb|ESW30971.1| hypothetical protein PHAVU_002G197800g [Phaseolus vulgaris]
Length=439

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G +AGNE+ Y+VGMSTCYP+PGSVKI   E LT+ SNYS+   
Sbjct  342  YGKDGRVICSSVPKYGKGKDAGNEENYIVGMSTCYPRPGSVKIMHGETLTLESNYSSTHG  401

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +Y+LVAE LP
Sbjct  402  HTGVMGLFYLLVAEQLP  418



>ref|XP_004163909.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101231400 
[Cucumis sativus]
Length=402

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR LC S PIYGNG+E GNE GY+VGMSTCYP+PGSVK+   E LT+IS Y   Q 
Sbjct  304  YGQDGRELCSSSPIYGNGSEIGNEKGYVVGMSTCYPKPGSVKLNNKEMLTLISKYHPSQT  363

Query  182  HTGVMGYYYILVAEPLPKS  238
            H GVMG ++I+VA+ LP S
Sbjct  364  HIGVMGLFHIMVAQKLPNS  382



>ref|XP_011003519.1| PREDICTED: uncharacterized protein LOC105110237 [Populus euphratica]
Length=467

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            FGE+GRV+C S PIYG G +AG+E GY+VGMSTCYP+PGS++I   E L + S YS+ Q 
Sbjct  336  FGEEGRVICTSEPIYGEGKDAGDEAGYVVGMSTCYPEPGSIQITAGENLVLESYYSSTQK  395

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +YILVAE  P      HS
Sbjct  396  HTGVMGIFYILVAERTPNPTNFLHS  420



>ref|XP_011016694.1| PREDICTED: uncharacterized protein LOC105120200 [Populus euphratica]
Length=467

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            FGE+GRV+C S PIYG G +AG+E GY+VGMSTCYP+PGS++I   E L + S YS+ Q 
Sbjct  336  FGEEGRVICTSEPIYGEGKDAGDEAGYVVGMSTCYPEPGSIQITAGENLVLESYYSSTQK  395

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +YILVAE  P      HS
Sbjct  396  HTGVMGIFYILVAERTPNPTNFLHS  420



>gb|KGN43818.1| hypothetical protein Csa_7G069440 [Cucumis sativus]
Length=445

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR LC S PIYGNG+E GNE GY+VGMSTCYP+PGSVK+   E LT+IS Y   Q 
Sbjct  347  YGQDGRELCSSSPIYGNGSEIGNEKGYVVGMSTCYPKPGSVKLNNKEMLTLISKYHPSQT  406

Query  182  HTGVMGYYYILVAEPLPKS  238
            H GVMG ++I+VA+ LP S
Sbjct  407  HIGVMGLFHIMVAQKLPNS  425



>gb|KEH16840.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=412

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DG+V+C+S P YGNG EAGNE GY+VGMSTCYPQPGS+KI   E LT+  NY+N + 
Sbjct  332  YGQDGKVICNSKPKYGNGKEAGNEKGYVVGMSTCYPQPGSIKIFNGETLTLEVNYNNSRR  391

Query  182  HTGVMGYYYILVAEPLP  232
            H+GVMG +Y LV E LP
Sbjct  392  HSGVMGLFYFLVEEKLP  408



>ref|XP_011073598.1| PREDICTED: uncharacterized protein LOC105158513 [Sesamum indicum]
Length=418

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GE GR +C S P YG G E GNE GY+VGMSTCYP PGSVKIA  E LT++SNYS+ Q 
Sbjct  334  YGEGGRAICTSNPTYGMGDEPGNEAGYIVGMSTCYPSPGSVKIAAGETLTLVSNYSSTQN  393

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +Y+L+++   K + + H+
Sbjct  394  HTGVMGLFYLLISDSSAKPDAVLHA  418



>ref|XP_011073597.1| PREDICTED: uncharacterized protein LOC105158512 [Sesamum indicum]
Length=417

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GE GR +C S P YG G E GNE GY+VGMSTCYP PGSVKIA  E LT++SNYS+ Q 
Sbjct  334  YGEGGRAICTSNPTYGMGDEPGNEAGYIVGMSTCYPSPGSVKIAAGETLTLVSNYSSTQN  393

Query  182  HTGVMGYYYILVAEPLPKSNPIFH  253
            HTGVMG +Y+L+++   K N   H
Sbjct  394  HTGVMGLFYLLISDSSAKPNAFLH  417



>gb|AGV54779.1| MtN19-like protein [Phaseolus vulgaris]
Length=466

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G +AGNE+ Y+VGMSTCYP+PGSVKI   E LT+ SNYS+   
Sbjct  343  YGKDGRVICSSVPKYGKGKDAGNEENYIVGMSTCYPRPGSVKIMHGETLTLESNYSSTHG  402

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +Y+LVAE LP
Sbjct  403  HTGVMGLFYLLVAEQLP  419



>emb|CDO98292.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGRV+C S PIYG G E GNE GY+VGMSTCYPQPGSVKI+  E LT+ S YS+ Q H
Sbjct  332  GEDGRVICSSLPIYGEGKEPGNEAGYIVGMSTCYPQPGSVKISNGETLTVKSYYSSEQGH  391

Query  185  TGVMGYYYILVAE  223
            TGVMG +YILVA+
Sbjct  392  TGVMGLFYILVAD  404



>ref|XP_006374581.1| hypothetical protein POPTR_0015s11990g [Populus trichocarpa]
 gb|ERP52378.1| hypothetical protein POPTR_0015s11990g [Populus trichocarpa]
Length=466

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRV+C S PIYG G + G+E GY+VGMSTCYP+PGS++I   E L + SNY++ Q 
Sbjct  334  YGEDGRVICTSEPIYGTGKDVGDEAGYIVGMSTCYPEPGSIQITAGENLLLESNYNSTQK  393

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +YILVA+  P      HS
Sbjct  394  HTGVMGLFYILVADRTPNPTNFLHS  418



>ref|XP_007038175.1| MtN19-like protein, putative isoform 2 [Theobroma cacao]
 gb|EOY22676.1| MtN19-like protein, putative isoform 2 [Theobroma cacao]
Length=544

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E+G++LC S P YG G EAGNE GY+VGMSTCYPQPG+VKI+  E L + SNYS++  
Sbjct  412  YRENGQLLCSSIPTYGEGEEAGNEAGYIVGMSTCYPQPGTVKISKGETLILESNYSSIGH  471

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LPK
Sbjct  472  HTGVMGLFYILVADALPK  489



>gb|ACJ85863.1| unknown [Medicago truncatula]
 gb|AFK38198.1| unknown [Medicago truncatula]
Length=430

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+D RV+C S P YGNG EA NE GY+VGMSTCYP+PGS+KI   E LT++S Y+N Q 
Sbjct  337  YGQDERVICSSIPRYGNGNEARNETGYIVGMSTCYPKPGSIKIIDGETLTLVSIYNNSQE  396

Query  182  HTGVMGYYYILVAEPLPKSN  241
            H GVMG +Y+LVAE LP  +
Sbjct  397  HNGVMGLFYLLVAEQLPDQH  416



>ref|XP_007038174.1| MtN19-like protein, putative isoform 1 [Theobroma cacao]
 gb|EOY22675.1| MtN19-like protein, putative isoform 1 [Theobroma cacao]
Length=570

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E+G++LC S P YG G EAGNE GY+VGMSTCYPQPG+VKI+  E L + SNYS++  
Sbjct  438  YRENGQLLCSSIPTYGEGEEAGNEAGYIVGMSTCYPQPGTVKISKGETLILESNYSSIGH  497

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LPK
Sbjct  498  HTGVMGLFYILVADALPK  515



>ref|XP_003531077.1| PREDICTED: uncharacterized protein LOC100803184 isoform X1 [Glycine 
max]
 ref|XP_006585010.1| PREDICTED: uncharacterized protein LOC100803184 isoform X2 [Glycine 
max]
 ref|XP_006585011.1| PREDICTED: uncharacterized protein LOC100803184 isoform X3 [Glycine 
max]
 ref|XP_006585012.1| PREDICTED: uncharacterized protein LOC100803184 isoform X4 [Glycine 
max]
Length=429

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G EAGNE  Y+VGMSTCYP+PGSV I   E LT+ SNYS+ + 
Sbjct  332  YGQDGRVICSSIPSYGKGKEAGNEADYIVGMSTCYPRPGSVNIIDGETLTLESNYSSSRE  391

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG +Y+LVAE LP  +
Sbjct  392  HTGVMGLFYLLVAEQLPHQH  411



>gb|KEH41600.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=412

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DG+V+C+S P YGNG EAGNE GY+VGM+TCYPQPGS+KI   E L +  NY+N + 
Sbjct  332  YGQDGKVICNSNPKYGNGKEAGNEKGYVVGMTTCYPQPGSIKILNGETLILEVNYNNSRR  391

Query  182  HTGVMGYYYILVAEPLPKSN  241
            H+GVMG +Y LVAE LP  +
Sbjct  392  HSGVMGLFYFLVAEKLPHQH  411



>ref|NP_001240902.1| uncharacterized protein LOC100784767 precursor [Glycine max]
 gb|ACU17750.1| unknown [Glycine max]
Length=434

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + +DGRV+C S P YG G EAGNE  Y+VGMSTCYPQPGSVKI   E +T+ SNYS+ + 
Sbjct  337  YAQDGRVICSSIPRYGKGKEAGNEVDYIVGMSTCYPQPGSVKIIDGETITLESNYSSSRG  396

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG +Y+LVAE LP  +
Sbjct  397  HTGVMGLFYLLVAEQLPHQH  416



>gb|KHN25868.1| hypothetical protein glysoja_018722 [Glycine soja]
Length=434

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + +DGRV+C S P YG G EAGNE  Y+VGMSTCYPQPGSVKI   E +T+ SNYS+ + 
Sbjct  337  YAQDGRVICSSIPRYGKGKEAGNEVDYIVGMSTCYPQPGSVKIIDGETITLESNYSSSRG  396

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG +Y+LVAE LP  +
Sbjct  397  HTGVMGLFYLLVAEQLPHQH  416



>ref|XP_006368006.1| PREDICTED: uncharacterized protein LOC102587597 [Solanum tuberosum]
Length=458

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 69/93 (74%), Gaps = 8/93 (9%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
             GEDGRV+C S PIYG G EAG    Y+VGMSTCYP+PGSVKI+  E LT++SNYS+ Q 
Sbjct  334  LGEDGRVICSSLPIYGEGNEAG----YIVGMSTCYPRPGSVKISEGETLTLLSNYSSDQR  389

Query  182  HTGVMGYYYILVAEPLPKSNPIFHSLD-VADLV  277
            HTGVMG +YILV+    +S+ I HS D + D+V
Sbjct  390  HTGVMGLFYILVS---GQSSSILHSRDNMGDIV  419



>ref|XP_004300379.1| PREDICTED: uncharacterized protein LOC101300825 [Fragaria vesca 
subsp. vesca]
Length=420

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDGR +C S PIYG   EAG+E GY+VGMSTCYP+PGSVKI   E L + SNYS+ Q 
Sbjct  333  YREDGRGICSSIPIYGQSEEAGDEAGYIVGMSTCYPRPGSVKINDGETLVVGSNYSSSQP  392

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVAE LPK
Sbjct  393  HTGVMGLFYILVAENLPK  410



>gb|KHG10977.1| G2/mitotic-specific cyclin-B [Gossypium arboreum]
Length=465

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDG+++C S P YG G E GNE GY+VGM+TCYP+PG+V+I+  E L + SNYS ++ 
Sbjct  333  YREDGQLMCSSLPTYGEGEEPGNEAGYIVGMTTCYPKPGTVEISKGETLILESNYSRIRH  392

Query  182  HTGVMGYYYILVAEPLPKSNPIFHSL  259
            HTGVMG +YILVA+ LPK     H++
Sbjct  393  HTGVMGLFYILVADKLPKPMQALHTV  418



>ref|XP_006376935.1| hypothetical protein POPTR_0012s11210g [Populus trichocarpa]
 gb|ERP54732.1| hypothetical protein POPTR_0012s11210g [Populus trichocarpa]
Length=467

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GE+GRV+C S PIYG G +AG+E GY+VGMSTCYP+PGS++I   E L + S YS+ Q 
Sbjct  336  YGEEGRVICASEPIYGEGKDAGDEAGYVVGMSTCYPEPGSIQITAGENLVLESYYSSTQK  395

Query  182  HTGVMGYYYILVAEPLPKSNPIFHS  256
            HTGVMG +Y+LVAE  P      HS
Sbjct  396  HTGVMGIFYVLVAERTPNPTNFLHS  420



>ref|XP_004137076.1| PREDICTED: uncharacterized protein LOC101210001 [Cucumis sativus]
Length=541

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR LC S PIYGNG+E GNE GY+V MSTCYP+PGSVK+   E LT+IS Y   Q 
Sbjct  443  YGQDGRELCSSSPIYGNGSEIGNEKGYVVEMSTCYPKPGSVKLNNKEMLTLISKYHPSQT  502

Query  182  HTGVMGYYYILVAEPLPKS  238
            H GVMG+++I+VA+ LP S
Sbjct  503  HIGVMGFFHIMVAQKLPNS  521



>ref|XP_006436986.1| hypothetical protein CICLE_v10031458mg [Citrus clementina]
 ref|XP_006436987.1| hypothetical protein CICLE_v10031458mg [Citrus clementina]
 gb|ESR50226.1| hypothetical protein CICLE_v10031458mg [Citrus clementina]
 gb|ESR50227.1| hypothetical protein CICLE_v10031458mg [Citrus clementina]
Length=462

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 69/90 (77%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDG+++C S P YGNG EAGNE GY+VGMSTCYP+PGS++I   E L + S+YS+ + 
Sbjct  331  YREDGQLMCSSIPAYGNGMEAGNEAGYIVGMSTCYPKPGSLRITDGETLIVESSYSSSRE  390

Query  182  HTGVMGYYYILVAEPLPKSNP---IFHSLD  262
            HTGVMG +YILVA+ +P+S+    +F+ +D
Sbjct  391  HTGVMGLFYILVADRVPESSSFLDVFNKMD  420



>ref|XP_006485063.1| PREDICTED: uncharacterized protein LOC102618549 [Citrus sinensis]
Length=462

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 69/90 (77%), Gaps = 3/90 (3%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDG+++C S P YGNG EAGNE GY+VGMSTCYP+PGS++I   E L + S+YS+ + 
Sbjct  331  YREDGQLMCSSIPAYGNGMEAGNEAGYIVGMSTCYPKPGSLRITDGETLIVESSYSSSRE  390

Query  182  HTGVMGYYYILVAEPLPKSNP---IFHSLD  262
            HTGVMG +YILVA+ +P+S+    +F+ +D
Sbjct  391  HTGVMGLFYILVADRVPESSSFLDVFNKMD  420



>gb|KEH31354.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=352

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +2

Query  8    EDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHT  187
            +DGRV+C S P YG G EAGNE  Y+VGMSTCYP+PGSVKI   E LT+ SNY++ + HT
Sbjct  257  KDGRVICSSIPSYGTGNEAGNEATYIVGMSTCYPKPGSVKIIDGETLTLESNYNSTREHT  316

Query  188  GVMGYYYILVAEPLP  232
            GVMG +Y+LVAE LP
Sbjct  317  GVMGLFYLLVAEQLP  331



>ref|XP_004974041.1| PREDICTED: uncharacterized protein LOC101778177 isoform X1 [Setaria 
italica]
 ref|XP_004974042.1| PREDICTED: uncharacterized protein LOC101778177 isoform X2 [Setaria 
italica]
 ref|XP_004974043.1| PREDICTED: uncharacterized protein LOC101778177 isoform X3 [Setaria 
italica]
Length=433

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGR+LC+S   YG+G EAGNE GY+VGMSTCYP+PG+V +   E LT++SNYS+ Q H
Sbjct  325  GEDGRLLCESTATYGDGQEAGNEAGYVVGMSTCYPKPGAVTVRDGEVLTVVSNYSSHQQH  384

Query  185  TGVMGYYYILVAE  223
            TG MG +YILVAE
Sbjct  385  TGAMGQFYILVAE  397



>gb|KHN39141.1| hypothetical protein glysoja_027946 [Glycine soja]
Length=701

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G EAGNE  Y+VGMSTCYP+PGSV I   E LT+ SNYS+ + 
Sbjct  604  YGQDGRVICSSIPSYGKGKEAGNEADYIVGMSTCYPRPGSVNIIDGETLTLESNYSSSRE  663

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG +Y+LVAE LP  +
Sbjct  664  HTGVMGLFYLLVAEQLPHQH  683



>gb|ACU22964.1| unknown [Glycine max]
 gb|KHN14320.1| hypothetical protein glysoja_012358 [Glycine soja]
Length=406

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DG V+C S P YG G+EAGNE GY+VGMSTCYP+PG++KI   E LT+   YSN +MH
Sbjct  326  GQDGGVICSSIPKYGTGSEAGNEKGYVVGMSTCYPRPGTIKIKDGETLTLEIIYSNSEMH  385

Query  185  TGVMGYYYILVAEPLPKSNPI  247
            +GVMG +YILVAE LP  + +
Sbjct  386  SGVMGLFYILVAEQLPHQHHL  406



>ref|XP_002445785.1| hypothetical protein SORBIDRAFT_07g025770 [Sorghum bicolor]
 gb|EES15280.1| hypothetical protein SORBIDRAFT_07g025770 [Sorghum bicolor]
Length=436

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGR+LC+S   YG+G EAGNE GY+VGMSTCYP+PG VK+   E LT++S YS+ + H
Sbjct  334  GEDGRLLCESTATYGDGEEAGNEAGYIVGMSTCYPKPGDVKVRDGEALTVVSRYSSERRH  393

Query  185  TGVMGYYYILVAE  223
            TGVMG +YILVAE
Sbjct  394  TGVMGLFYILVAE  406



>ref|XP_006844651.1| hypothetical protein AMTR_s00016p00236400 [Amborella trichopoda]
 gb|ERN06326.1| hypothetical protein AMTR_s00016p00236400 [Amborella trichopoda]
Length=392

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+CDS PIYG G EAG+E GY+VGMSTCYP+PGS+KI   E L + S Y++  +
Sbjct  320  YGQDGRVICDSVPIYGRGKEAGDEAGYVVGMSTCYPEPGSMKIKDGETLVLESTYNSATL  379

Query  182  HTGVMGYYYILVA  220
            HTGVMG +YILVA
Sbjct  380  HTGVMGLFYILVA  392



>ref|XP_003594550.1| MtN19 protein [Medicago truncatula]
 gb|AES64801.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=391

 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G  AGNE GY+VGMSTCYP+PGS+KI   E LT+ +NYS+   
Sbjct  311  YGKDGRVICTSIPKYGKGKRAGNEKGYVVGMSTCYPKPGSIKIFDGENLTLETNYSSNIR  370

Query  182  HTGVMGYYYILVAEPLP  232
            H+GVMG +Y LVAE LP
Sbjct  371  HSGVMGLFYFLVAEKLP  387



>ref|XP_006436984.1| hypothetical protein CICLE_v10031461mg [Citrus clementina]
 ref|XP_006436985.1| hypothetical protein CICLE_v10031461mg [Citrus clementina]
 gb|ESR50224.1| hypothetical protein CICLE_v10031461mg [Citrus clementina]
 gb|ESR50225.1| hypothetical protein CICLE_v10031461mg [Citrus clementina]
Length=462

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 66/88 (75%), Gaps = 3/88 (3%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDG+++C S P YGNG EAGNE GY+VGMSTCYP+PG ++I   E L + SNYS+ + 
Sbjct  331  YREDGQLMCSSIPAYGNGKEAGNEAGYIVGMSTCYPKPGFLRITDKETLIVESNYSSSRD  390

Query  182  HTGVMGYYYILVAEPLPKSNPIFHSLDV  265
            HTGVMG +YILVA+ +P+S+     LDV
Sbjct  391  HTGVMGLFYILVADRVPESSSF---LDV  415



>ref|XP_004974040.1| PREDICTED: uncharacterized protein LOC101777764 [Setaria italica]
Length=432

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGR+LC S P YG+G EAGNE GY+VGMS+CYP+PG+VK+   E LT++SNY+  +  
Sbjct  322  GEDGRLLCWSTPTYGDGEEAGNEAGYVVGMSSCYPEPGTVKVRDGEALTVVSNYTGERRR  381

Query  185  TGVMGYYYILVAE  223
            TGVMG++YILVAE
Sbjct  382  TGVMGHFYILVAE  394



>ref|XP_003594548.1| MtN19 protein [Medicago truncatula]
Length=404

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C+S P YG G EAGNE GY+VGMSTCYP+PGS+K+   E LT+   Y+N  M
Sbjct  324  YGQDGRVICNSVPKYGTGMEAGNEKGYVVGMSTCYPKPGSIKLFDGEILTLAIVYNNSIM  383

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG+ Y LVAE LP
Sbjct  384  HTGVMGHMYFLVAEKLP  400



>gb|AES64799.2| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=412

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C+S P YG G EAGNE GY+VGMSTCYP+PGS+K+   E LT+   Y+N  M
Sbjct  332  YGQDGRVICNSVPKYGTGMEAGNEKGYVVGMSTCYPKPGSIKLFDGEILTLAIVYNNSIM  391

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG+ Y LVAE LP
Sbjct  392  HTGVMGHMYFLVAEKLP  408



>ref|XP_008455078.1| PREDICTED: uncharacterized protein LOC103495342 [Cucumis melo]
Length=448

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GED R LC S PIYGNG E GNE GY+V MSTCYP+PGSVKI   E LT+IS Y   Q 
Sbjct  350  YGEDERELCSSSPIYGNGNEIGNEKGYVVEMSTCYPKPGSVKINNKEMLTLISKYDPSQT  409

Query  182  HTGVMGYYYILVAEPLPKS  238
            H GVMG ++I+VA+ LP S
Sbjct  410  HIGVMGLFHIMVAQKLPNS  428



>ref|XP_008453444.1| PREDICTED: uncharacterized protein LOC103494150 [Cucumis melo]
Length=414

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PIYG G E GNEDGY+VGMSTCYP+ G VKI+  E  +++S Y + Q 
Sbjct  330  YGEDGRVLCSSKPIYGEGDEIGNEDGYVVGMSTCYPRLGHVKISKGEIGSLVSKYDHTQN  389

Query  182  HTGVMGYYYILVAEPLPKS  238
            HTGVMG + I+VA  LP S
Sbjct  390  HTGVMGIFSIVVATKLPNS  408



>ref|XP_006586844.1| PREDICTED: uncharacterized protein LOC100791925 [Glycine max]
 gb|KHN23013.1| hypothetical protein glysoja_030683 [Glycine soja]
Length=408

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DG V+C S P YGNG EAGNE GY+VGMSTCYP+ G++KI   E LT+   YSN Q 
Sbjct  327  YGQDGGVICSSIPKYGNGNEAGNEKGYVVGMSTCYPRRGTIKIKDGETLTLEIIYSNNQS  386

Query  182  HTGVMGYYYILVAEPLPKSN  241
            H+GVMG +YILVAE LP  +
Sbjct  387  HSGVMGLFYILVAEQLPHQH  406



>ref|XP_003594549.1| MtN19 protein [Medicago truncatula]
Length=882

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G +AGNE GY+VGMSTCYP+PGS+KI   E LT+ SNYS+   
Sbjct  390  YGKDGRVICTSIPKYGKGRKAGNEKGYIVGMSTCYPKPGSIKIFDGETLTLESNYSSNIS  449

Query  182  HTGVMGYYYILVAEPLP  232
            H+GVMG +Y LVAE LP
Sbjct  450  HSGVMGLFYFLVAEKLP  466


 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G  AG+E GY+VGMSTCYP PGS+KI   E LT+ +N+S+   
Sbjct  802  YGQDGRVICTSIPKYGKGRRAGDEKGYVVGMSTCYPIPGSIKIFDGEILTLEANHSSNIR  861

Query  182  HTGVMGYYYILVAEPLP  232
            ++GVMG +Y LVAE LP
Sbjct  862  YSGVMGLFYFLVAEKLP  878



>ref|XP_004974037.1| PREDICTED: uncharacterized protein LOC101776668 isoform X1 [Setaria 
italica]
 ref|XP_004974038.1| PREDICTED: uncharacterized protein LOC101776668 isoform X2 [Setaria 
italica]
Length=433

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 61/83 (73%), Gaps = 3/83 (4%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGR+LC+S   YG+G EAGNE  Y+VGMSTCYP+PG+V +   E LT++S YS+ Q H
Sbjct  325  GEDGRLLCESTATYGDGQEAGNEADYIVGMSTCYPKPGAVTVRDGEVLTVVSKYSSHQQH  384

Query  185  TGVMGYYYILVAE---PLPKSNP  244
            TGVMG  YILVAE   P P+  P
Sbjct  385  TGVMGLVYILVAEHGQPQPQQLP  407



>gb|AES64800.2| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=826

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G +AGNE GY+VGMSTCYP+PGS+KI   E LT+ SNYS+   
Sbjct  334  YGKDGRVICTSIPKYGKGRKAGNEKGYIVGMSTCYPKPGSIKIFDGETLTLESNYSSNIS  393

Query  182  HTGVMGYYYILVAEPLP  232
            H+GVMG +Y LVAE LP
Sbjct  394  HSGVMGLFYFLVAEKLP  410


 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G  AG+E GY+VGMSTCYP PGS+KI   E LT+ +N+S+   
Sbjct  746  YGQDGRVICTSIPKYGKGRRAGDEKGYVVGMSTCYPIPGSIKIFDGEILTLEANHSSNIR  805

Query  182  HTGVMGYYYILVAEPLP  232
            ++GVMG +Y LVAE LP
Sbjct  806  YSGVMGLFYFLVAEKLP  822



>ref|XP_011073282.1| PREDICTED: uncharacterized protein LOC105158282 [Sesamum indicum]
Length=461

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GE GRV+C S P YG G E GNE GY+VGMSTCYP PGS+KIA  E LT++SNY++ + 
Sbjct  335  YGEGGRVICSSNPTYGTGDEPGNEAGYVVGMSTCYPSPGSIKIAAGETLTLVSNYNSARR  394

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +Y+L+++   K
Sbjct  395  HTGVMGLFYLLISDSSTK  412



>gb|KEH26244.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=421

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 60/77 (78%), Gaps = 4/77 (5%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YGNG EAG    Y+VGMSTCYP+PGSVKI   E LT+ SNY+N + 
Sbjct  334  YGQDGRVICSSTPSYGNGNEAG----YIVGMSTCYPKPGSVKINDGEILTLESNYTNTKD  389

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +Y+LVAE LP
Sbjct  390  HTGVMGLFYLLVAEELP  406



>gb|KDO37888.1| hypothetical protein CISIN_1g033184mg [Citrus sinensis]
Length=125

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 3/81 (4%)
 Frame = +2

Query  23   LCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGVMGY  202
            +C S P YGNG EAGNE GY+VGMSTCYP+PG ++I   E L + SNYS+   HTGVMG 
Sbjct  1    MCSSIPAYGNGKEAGNEAGYIVGMSTCYPKPGFLRITDKETLIVESNYSSSHDHTGVMGL  60

Query  203  YYILVAEPLPKSNPIFHSLDV  265
            +YILVA+ +P+S+     LDV
Sbjct  61   FYILVADRVPESSSF---LDV  78



>ref|XP_004300378.1| PREDICTED: uncharacterized protein LOC101300539 [Fragaria vesca 
subsp. vesca]
Length=420

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDGRVLC S PIYG   + G+E GY+VGMSTCYP PGS+KI   E L + SNYS+ Q 
Sbjct  333  YREDGRVLCSSIPIYGQSEDVGDEAGYIVGMSTCYPHPGSIKINDGETLVVGSNYSSSQR  392

Query  182  HTGVMGYYYILVAE  223
            HTGVMG +YILVAE
Sbjct  393  HTGVMGLFYILVAE  406



>ref|XP_011040291.1| PREDICTED: uncharacterized protein LOC105136589 [Populus euphratica]
Length=466

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRV+C S PIYG G + G+E GY+VGMSTCYP+PGS++I   E L + SNY++ Q 
Sbjct  334  YGEDGRVICTSEPIYGTGKDVGDEAGYIVGMSTCYPEPGSIQITAGENLLLESNYNSTQK  393

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +YILV +  P
Sbjct  394  HTGVMGLFYILVEDRTP  410



>ref|XP_002983409.1| hypothetical protein SELMODRAFT_118146 [Selaginella moellendorffii]
 gb|EFJ15751.1| hypothetical protein SELMODRAFT_118146 [Selaginella moellendorffii]
Length=405

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGR LC S PIYGNG+  GNE GY+VGMSTC P+PG+V IA  EKL + S+YS+ Q H
Sbjct  309  GEDGRHLCSSIPIYGNGSAPGNEAGYVVGMSTCTPEPGTVTIASGEKLRLSSSYSSAQEH  368

Query  185  TGVMGYYYILVAE  223
            TGVMGY+Y++V +
Sbjct  369  TGVMGYFYLVVGD  381



>ref|XP_011073281.1| PREDICTED: uncharacterized protein LOC105158280 [Sesamum indicum]
Length=460

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GE GRV+C S P YG G E GNE GY+VGMSTCYP PGSVKI+  E LT++SNY++ + 
Sbjct  334  YGEGGRVICSSNPTYGTGDEPGNEAGYVVGMSTCYPSPGSVKISTGETLTLVSNYNSARR  393

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +Y+L+++   K
Sbjct  394  HTGVMGLFYLLISDSSTK  411



>gb|AFK39203.1| unknown [Lotus japonicus]
Length=87

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 7/86 (8%)
 Frame = +2

Query  38   PIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGVMGYYYILV  217
            P YG+G EAGNE GY+VGMSTCYPQPGSVK+   E +T+ SNYS+ Q H+GVMG +Y+LV
Sbjct  2    PSYGSGKEAGNEAGYIVGMSTCYPQPGSVKVFDGETVTLESNYSSSQRHSGVMGLFYLLV  61

Query  218  AEPLPKSNPIFHS------LDVADLV  277
            AE LP  + I HS      +DV +++
Sbjct  62   AEQLPHQHFI-HSTRSSFFVDVKNII  86



>gb|KHG23950.1| G2/mitotic-specific cyclin-B [Gossypium arboreum]
Length=467

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDG+++C S P YG G E GNE GY+VGM+TCYP+PG+V+I+  E L +  NYS ++ 
Sbjct  335  YREDGQLMCSSLPTYGEGEEPGNEAGYIVGMTTCYPKPGTVEISEGETLILEFNYSRIRH  394

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LPK
Sbjct  395  HTGVMGLFYILVADDLPK  412



>ref|XP_003546270.2| PREDICTED: uncharacterized protein LOC100815629 [Glycine max]
Length=742

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DG V+C S P YG G+E GNE GY+VGMSTCYP+PG++KI   E LT+   YSN +M
Sbjct  661  YGQDGGVICSSIPKYGTGSEVGNEGGYVVGMSTCYPRPGTIKIKDGETLTLEIIYSNSEM  720

Query  182  HTGVMGYYYILVAEPLPKSN  241
            H+GVMG +YILVAE LP  +
Sbjct  721  HSGVMGLFYILVAEQLPHQH  740


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  8    EDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKI  130
            EDG V+C S P YG G+EAGNE GY+VGMSTCYP+PG+ ++
Sbjct  278  EDGGVICSSIPKYGTGSEAGNEKGYVVGMSTCYPRPGNYQL  318



>gb|AFK34663.1| unknown [Medicago truncatula]
Length=412

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G+DGRV+C+S P YG G EA NE GY+VGMSTCYP+PGS+K+   E LT+   Y+N  MH
Sbjct  333  GQDGRVICNSVPKYGTGMEAENEKGYVVGMSTCYPKPGSIKLFDGEILTLAIVYNNSIMH  392

Query  185  TGVMGYYYILVAEPLP  232
            TGVMG+ Y LVAE LP
Sbjct  393  TGVMGHMYFLVAEKLP  408



>ref|XP_004974890.1| PREDICTED: uncharacterized protein LOC101770076 [Setaria italica]
Length=442

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQP-GSVKIAPMEKLTIISNYSNVQM  181
            GEDGR+LC S P YG+G EAGNE GY+VGMS CYP+P G+ ++   E LT++SNYS+ + 
Sbjct  334  GEDGRLLCRSTPAYGDGEEAGNEAGYVVGMSACYPEPGGAARVRGGEALTVVSNYSSERQ  393

Query  182  HTGVMGYYYILVAE  223
            HTGVMG++YILVA+
Sbjct  394  HTGVMGHFYILVAD  407



>ref|XP_007134079.1| hypothetical protein PHAVU_010G0178001g, partial [Phaseolus vulgaris]
 gb|ESW06073.1| hypothetical protein PHAVU_010G0178001g, partial [Phaseolus vulgaris]
Length=149

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE GYLVGMS CYP+PGS+KI   E LT+ S Y N + 
Sbjct  68   YGQDGRVLCTSNPKYGTGKEAGNEKGYLVGMSVCYPKPGSIKIKDGEVLTLESIYEN-KF  126

Query  182  HTGVMGYYYILVAEPLPKSN  241
             TG +G++YI +A+ +PK +
Sbjct  127  RTGAIGHFYIYLADQIPKKD  146



>ref|XP_002960630.1| hypothetical protein SELMODRAFT_75188 [Selaginella moellendorffii]
 gb|EFJ38169.1| hypothetical protein SELMODRAFT_75188 [Selaginella moellendorffii]
Length=405

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGR LC S PIYGNG+  G+E GY+VGMSTC P+PG+V IA  EKL + S+YS+ Q H
Sbjct  309  GEDGRHLCSSIPIYGNGSAPGDEAGYVVGMSTCSPEPGTVTIASGEKLHLSSSYSSAQEH  368

Query  185  TGVMGYYYILVAE  223
            TGVMGY+Y++V +
Sbjct  369  TGVMGYFYLVVGD  381



>ref|XP_007134300.1| hypothetical protein PHAVU_010G035700g [Phaseolus vulgaris]
 gb|ESW06294.1| hypothetical protein PHAVU_010G035700g [Phaseolus vulgaris]
Length=413

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE GYLVGMS CYP+PGS+KI   E LT+ S Y N + 
Sbjct  332  YGQDGRVLCTSNPKYGTGKEAGNEKGYLVGMSVCYPKPGSIKIKDGEILTVESRYEN-KF  390

Query  182  HTGVMGYYYILVAEPLPKSN  241
             TG MG++YI +AE +P  +
Sbjct  391  RTGAMGHFYIYLAEQIPNKD  410



>ref|XP_006579112.1| PREDICTED: uncharacterized protein LOC100799740 [Glycine max]
Length=405

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR LC S P YG G EAGNE GYL+GMS CYPQPGS+KI   E LT+ S Y N + 
Sbjct  329  YGQDGRTLCTSTPKYGTGKEAGNEKGYLIGMSVCYPQPGSIKIHDGEILTLESRYKN-EF  387

Query  182  HTGVMGYYYILVAEPLPK  235
             TG MG++YI +AE LP+
Sbjct  388  RTGAMGHFYIYLAEELPQ  405



>ref|NP_001148097.1| LOC100281705 [Zea mays]
 gb|ACG29711.1| mtN19-like protein [Zea mays]
Length=235

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G DGR+LC+S   YG G EAG+E GY+VGMSTCYP+PG+V +   E LT++S YS+ + H
Sbjct  134  GADGRLLCESAATYGGGREAGDEAGYIVGMSTCYPRPGAVTVRDGEPLTVVSRYSSDRRH  193

Query  185  TGVMGYYYILVAEPLPKSNP  244
            TGVMG +YILVA+   +  P
Sbjct  194  TGVMGLFYILVADHARQLPP  213



>ref|XP_006844648.1| hypothetical protein AMTR_s00016p00235580 [Amborella trichopoda]
 gb|ERN06323.1| hypothetical protein AMTR_s00016p00235580 [Amborella trichopoda]
Length=416

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G EAGNE GY+VGM TCYP+PGSVK+   E L + S YS   M
Sbjct  332  YGQDGRVICTSSPTYGQGKEAGNEAGYVVGMGTCYPRPGSVKVKDGETLILESRYSATTM  391

Query  182  HTGVMGYYYILVAE  223
            HTGVMG ++I VAE
Sbjct  392  HTGVMGLFHIFVAE  405



>dbj|BAI63593.1| MtN19 protein [Lotus japonicus]
Length=405

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G + GNE GYLV MSTCYP+PGS KI   E L++   Y+N   
Sbjct  325  YGQDGRVICSSLPRYGTGKKVGNEKGYLVAMSTCYPRPGSEKIKNGETLSLEITYNNSIG  384

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +YILVAE LP
Sbjct  385  HTGVMGLFYILVAEKLP  401



>ref|XP_002960632.1| hypothetical protein SELMODRAFT_437681 [Selaginella moellendorffii]
 gb|EFJ38171.1| hypothetical protein SELMODRAFT_437681 [Selaginella moellendorffii]
Length=452

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGR LC S P+YGNG+  GNEDGY+VGMSTC P+PG++ +A  EKL   S+YS+ Q H
Sbjct  327  GEDGRHLCSSIPLYGNGSAPGNEDGYVVGMSTCIPKPGTLMVASGEKLHFSSSYSSAQEH  386

Query  185  TGVMGYYYILVAE  223
            TGVMG +Y++V++
Sbjct  387  TGVMGIFYLMVSD  399



>ref|NP_001148306.1| mtN19-like protein precursor [Zea mays]
 gb|ACG30513.1| mtN19-like protein [Zea mays]
Length=426

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 63/90 (70%), Gaps = 3/90 (3%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G DGR+LC+S   YG G EAG+E GY+VGMSTCYP+PG+V +   E LT++S YS+ + H
Sbjct  325  GADGRLLCESAATYGGGREAGDEAGYIVGMSTCYPRPGAVTVRDGEPLTVVSRYSSDRRH  384

Query  185  TGVMGYYYILVAE---PLPKSNPIFHSLDV  265
            TGVMG +YILVA+    LP+   +  S  V
Sbjct  385  TGVMGLFYILVADHARQLPQQEGLCFSFPV  414



>ref|XP_007134296.1| hypothetical protein PHAVU_010G0353000g, partial [Phaseolus vulgaris]
 gb|ESW06290.1| hypothetical protein PHAVU_010G0353000g, partial [Phaseolus vulgaris]
Length=100

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE+GYLVGMS CYP+PGS++I   E LTI S Y N + 
Sbjct  29   YGQDGRVLCTSSPKYGTGKEAGNENGYLVGMSVCYPKPGSIQIKDGEILTIESRYEN-KF  87

Query  182  HTGVMGYYYILVA  220
             TG MG++YI +A
Sbjct  88   RTGAMGHFYIYLA  100



>ref|XP_004160434.1| PREDICTED: uncharacterized protein LOC101223324 [Cucumis sativus]
Length=416

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PIYG G E GNE+GY+VGMSTCYP+ G VKI   E  + +S Y   Q 
Sbjct  332  YGEDGRVLCSSSPIYGEGDEIGNEEGYIVGMSTCYPKLGDVKINKGEIGSFVSKYDPTQN  391

Query  182  HTGVMGYYYILVAEPLPKS  238
            HTGVMG + I+VA  LP S
Sbjct  392  HTGVMGIFSIVVATKLPNS  410



>ref|XP_004137324.1| PREDICTED: uncharacterized protein LOC101215981 [Cucumis sativus]
Length=416

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PIYG G E GNE+GY+VGMSTCYP+ G VKI   E  + +S Y   Q 
Sbjct  332  YGEDGRVLCSSSPIYGEGDEIGNEEGYIVGMSTCYPKLGDVKINKGEIGSFVSKYDPTQN  391

Query  182  HTGVMGYYYILVAEPLPKS  238
            HTGVMG + I+VA  LP S
Sbjct  392  HTGVMGIFSIVVATKLPNS  410



>gb|KHN18974.1| hypothetical protein glysoja_039898 [Glycine soja]
Length=414

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE GYLVGMS CYP+PGS+KI   E LT+ + Y N + 
Sbjct  338  YGQDGRVLCTSTPKYGTGKEAGNERGYLVGMSGCYPKPGSIKIKDGEILTLETRYQN-KF  396

Query  182  HTGVMGYYYILVAEPLP  232
             TG MG++YI +AE LP
Sbjct  397  RTGAMGFFYIHLAEQLP  413



>ref|XP_002983406.1| hypothetical protein SELMODRAFT_422686 [Selaginella moellendorffii]
 gb|EFJ15748.1| hypothetical protein SELMODRAFT_422686 [Selaginella moellendorffii]
Length=452

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGR LC S P+YGNG+  GNEDGY+VGMSTC P+PG++ +A  EKL   S+YS+ Q H
Sbjct  327  GEDGRHLCSSTPLYGNGSSPGNEDGYVVGMSTCIPKPGTLMVASGEKLHFSSSYSSAQEH  386

Query  185  TGVMGYYYILVAE  223
            TGVMG +Y++V++
Sbjct  387  TGVMGIFYLMVSD  399



>ref|XP_006574192.1| PREDICTED: uncharacterized protein LOC100820275 [Glycine max]
Length=562

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR LC S P YG G EAGNE GYL+GMS CYPQPGS+KI   E LT+ S Y N + 
Sbjct  486  YGQDGRTLCTSTPKYGTGKEAGNEKGYLIGMSVCYPQPGSIKIHDGEILTLESRYKN-EF  544

Query  182  HTGVMGYYYILVAEPLPK  235
             TG MG++YI +AE LP+
Sbjct  545  RTGAMGHFYIYLAEELPQ  562


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMS  97
            +G+DGR LC S P YG G EAGNE GYL+GMS
Sbjct  123  YGQDGRTLCTSTPKYGTGKEAGNEKGYLIGMS  154



>ref|XP_002983404.1| hypothetical protein SELMODRAFT_43474, partial [Selaginella moellendorffii]
 gb|EFJ15746.1| hypothetical protein SELMODRAFT_43474, partial [Selaginella moellendorffii]
Length=395

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGR LC S P+YGNG+  GNE GY+VGMSTC+P+PG+V +A  EKL + S+YS+ Q H
Sbjct  324  GEDGRHLCSSIPLYGNGSTPGNEAGYVVGMSTCFPEPGTVTVASGEKLHLSSSYSSAQEH  383

Query  185  TGVMGYYYILVA  220
            TGVM  +Y++V+
Sbjct  384  TGVMALFYLIVS  395



>ref|XP_006577651.1| PREDICTED: uncharacterized protein LOC100806449 [Glycine max]
Length=460

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE GYLVGMS CYP+PGS+KI   E LT+ + Y N + 
Sbjct  384  YGQDGRVLCTSTPKYGTGKEAGNERGYLVGMSGCYPKPGSIKIKDGEILTLETRYQN-KF  442

Query  182  HTGVMGYYYILVAEPLP  232
             TG MG++YI +AE LP
Sbjct  443  RTGAMGFFYIHLAEQLP  459



>tpg|DAA48290.1| TPA: mtN19-like protein [Zea mays]
Length=418

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G DGR+LC+S   YG G EAG+E GY+VGMSTCYP+PG+V +   E LT++S YS+ + H
Sbjct  317  GADGRLLCESAATYGGGREAGDEAGYIVGMSTCYPRPGAVTVRDGEPLTVVSRYSSDRRH  376

Query  185  TGVMGYYYILVAE  223
            TGVMG +YILVA+
Sbjct  377  TGVMGLFYILVAD  389



>gb|ACG30313.1| mtN19-like protein [Zea mays]
Length=419

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G DGR+LC+S   YG G EAG+E GY+VGMSTCYP+PG+V +   E LT++S YS+ + H
Sbjct  318  GADGRLLCESAATYGGGREAGDEAGYIVGMSTCYPRPGAVTVRDGEPLTVVSRYSSDRRH  377

Query  185  TGVMGYYYILVAE  223
            TGVMG +YILVA+
Sbjct  378  TGVMGLFYILVAD  390



>tpg|DAA48291.1| TPA: hypothetical protein ZEAMMB73_362863 [Zea mays]
Length=412

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            G DGR+LC+S   YG G EAG+E GY+VGMSTCYP+PG+V +   E LT++S YS+ + H
Sbjct  317  GADGRLLCESAATYGGGREAGDEAGYIVGMSTCYPRPGAVTVRDGEPLTVVSRYSSDRRH  376

Query  185  TGVMGYYYILVAE  223
            TGVMG +YILVA+
Sbjct  377  TGVMGLFYILVAD  389



>ref|XP_006577556.1| PREDICTED: uncharacterized protein LOC102664794 [Glycine max]
 ref|XP_006577557.1| PREDICTED: uncharacterized protein LOC102664925 [Glycine max]
Length=411

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE GYLVGMS CYP+PGSV+I   E LT+ + Y N + 
Sbjct  331  YGQDGRVLCTSTPKYGTGKEAGNEKGYLVGMSGCYPKPGSVEIKDGEILTLETRYQN-KF  389

Query  182  HTGVMGYYYILVAEPLP  232
             TG MG++YI +AE LP
Sbjct  390  RTGAMGFFYIHLAEQLP  406



>ref|XP_008453441.1| PREDICTED: uncharacterized protein LOC103494146 [Cucumis melo]
 ref|XP_008453442.1| PREDICTED: uncharacterized protein LOC103494146 [Cucumis melo]
Length=292

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 60/80 (75%), Gaps = 4/80 (5%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PI+G G    NE+GY+VGM+TCYPQPGS+KI   E +T +SNYS+   
Sbjct  202  YGEDGRVLCSSSPIHGKG----NEEGYVVGMTTCYPQPGSMKINKGEMVTFVSNYSSTPT  257

Query  182  HTGVMGYYYILVAEPLPKSN  241
            H GVMG ++I VA+ + KS+
Sbjct  258  HRGVMGIFHIFVADKIFKSS  277



>gb|KHN15503.1| hypothetical protein glysoja_049065 [Glycine soja]
Length=404

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE GYLVGMS CYP+PGSV+I   E LT+ + Y N + 
Sbjct  324  YGQDGRVLCTSTPKYGTGKEAGNEKGYLVGMSGCYPKPGSVEIKDGEILTLETRYQN-KF  382

Query  182  HTGVMGYYYILVAEPLP  232
             TG MG++YI +AE LP
Sbjct  383  RTGAMGFFYIHLAEQLP  399



>ref|XP_007132991.1| hypothetical protein PHAVU_011G142100g [Phaseolus vulgaris]
 gb|ESW04985.1| hypothetical protein PHAVU_011G142100g [Phaseolus vulgaris]
Length=389

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE+GYLVGMS CYP+PGS+KI   E LT+ S Y N + 
Sbjct  308  YGQDGRVLCTSNPKYGTGKEAGNENGYLVGMSVCYPKPGSIKIKDGEILTLESIYEN-KF  366

Query  182  HTGVMGYYYILVAEPLPKSN  241
             TG MG++YI +A+ +P  +
Sbjct  367  RTGAMGHFYIYLADQIPNKD  386



>ref|XP_002983407.1| hypothetical protein SELMODRAFT_118200 [Selaginella moellendorffii]
 gb|EFJ15749.1| hypothetical protein SELMODRAFT_118200 [Selaginella moellendorffii]
Length=400

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGR LC S P+YGNG+  GNEDGY+VGMSTC P+PG++ +A  EKL   S+YS+ Q H
Sbjct  311  GEDGRHLCSSIPLYGNGSAPGNEDGYVVGMSTCIPEPGTLMVASGEKLHFSSSYSSAQEH  370

Query  185  TGVMGYYYILVAE  223
            TGVM  +Y++V++
Sbjct  371  TGVMAIFYLMVSD  383



>ref|XP_007137902.1| hypothetical protein PHAVU_009G165400g [Phaseolus vulgaris]
 gb|ESW09896.1| hypothetical protein PHAVU_009G165400g [Phaseolus vulgaris]
Length=399

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE+GYLVGMS CYP+PGS+KI   E LT+ S Y N + 
Sbjct  318  YGQDGRVLCTSNPKYGTGKEAGNENGYLVGMSVCYPKPGSIKIKDGEILTLESIYEN-KF  376

Query  182  HTGVMGYYYILVAEPLPKSN  241
             TG MG++YI +A+ +P  +
Sbjct  377  RTGAMGHFYIYLADQIPNKD  396



>ref|XP_002960631.1| hypothetical protein SELMODRAFT_270236 [Selaginella moellendorffii]
 gb|EFJ38170.1| hypothetical protein SELMODRAFT_270236 [Selaginella moellendorffii]
Length=448

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGR LC S P+YGNG+  GNEDGY+VGMSTC P+PG++ +A  EKL   S+YS+ Q H
Sbjct  324  GEDGRHLCSSIPLYGNGSAPGNEDGYVVGMSTCIPEPGTLMVASGEKLHFSSSYSSAQEH  383

Query  185  TGVMGYYYILVAE  223
            TGVM  +Y++V++
Sbjct  384  TGVMAIFYLMVSD  396



>ref|XP_006577555.1| PREDICTED: uncharacterized protein LOC102664678 [Glycine max]
Length=411

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE GYLVGMS CYP+PGSV+I   E LT+ + Y N + 
Sbjct  331  YGQDGRVLCTSTPKYGTGKEAGNERGYLVGMSGCYPKPGSVEIKDGEILTLETTYQN-KF  389

Query  182  HTGVMGYYYILVAEPLP  232
             TG MG++YI +AE LP
Sbjct  390  RTGAMGFFYIHLAEQLP  406



>emb|CDY71873.1| BnaCnng74880D [Brassica napus]
Length=148

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 2/77 (3%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDG V+C S P YGNG E G+E GY+VGMS+CYP+P  VK+   E L++  NYSNV  
Sbjct  24   YREDGEVICSSMPKYGNGDEPGSEAGYIVGMSSCYPEP--VKVTNGETLSLEFNYSNVIG  81

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +YILVA+ LP
Sbjct  82   HTGVMGLFYILVAQQLP  98



>gb|KHN17845.1| hypothetical protein glysoja_047764 [Glycine soja]
Length=405

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE GYLVGMS CYP+PGSV+I   E LT+ + Y N + 
Sbjct  324  YGQDGRVLCTSTPKYGTGKEAGNEKGYLVGMSGCYPKPGSVEIKDGEILTLETRYQN-KF  382

Query  182  HTGVMGYYYILVAEPLPKSN  241
             TG MG+++I +AE LP  +
Sbjct  383  RTGAMGFFHIHLAEQLPNKD  402



>gb|KHN44115.1| hypothetical protein glysoja_039253 [Glycine soja]
Length=124

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +2

Query  8    EDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHT  187
            +DGR LC S P YG G E GNE GY++GM  CYPQPGS+KI   E LT+ S Y N + HT
Sbjct  50   QDGRTLCTSTPKYGTGKEVGNEKGYVIGMFVCYPQPGSIKIHDAEILTLESKYKN-EFHT  108

Query  188  GVMGYYYILVAEPLPK  235
            G M ++YI +AE LP+
Sbjct  109  GAMRHFYIYLAEELPQ  124



>ref|XP_007134084.1| hypothetical protein PHAVU_010G018100g [Phaseolus vulgaris]
 gb|ESW06078.1| hypothetical protein PHAVU_010G018100g [Phaseolus vulgaris]
Length=399

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE+GYL+GMS CYP+PGS+KI   E LT+ S Y N + 
Sbjct  318  YGQDGRVLCTSNPKYGTGKEAGNENGYLIGMSVCYPKPGSIKIKDGEILTLESIYEN-KF  376

Query  182  HTGVMGYYYILVAEPLPKSN  241
             TG MG++YI +A+ +P  +
Sbjct  377  RTGAMGHFYIYLADQIPNKD  396



>ref|XP_007134075.1| hypothetical protein PHAVU_010G017500g [Phaseolus vulgaris]
 gb|ESW06069.1| hypothetical protein PHAVU_010G017500g [Phaseolus vulgaris]
Length=425

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE GYLVGMS CYP+PGS+KI   E LT+ S Y N + 
Sbjct  344  YGQDGRVLCTSNPKYGTGKEAGNEKGYLVGMSVCYPKPGSIKIKDGEILTLESIYEN-KF  402

Query  182  HTGVMGYYYILVAEPLPKSN  241
             TG MG++YI +A+ +P ++
Sbjct  403  RTGAMGHFYIYLADQIPNND  422



>ref|XP_007134138.1| hypothetical protein PHAVU_010G022500g [Phaseolus vulgaris]
 gb|ESW06132.1| hypothetical protein PHAVU_010G022500g [Phaseolus vulgaris]
Length=413

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+D RVLC S P YG G EAGNE+GYLVGMS CYP+PGS+KI   E LT+ S Y N + 
Sbjct  332  YGQDRRVLCTSNPKYGTGKEAGNENGYLVGMSVCYPKPGSIKIKDGEILTLESIYEN-KF  390

Query  182  HTGVMGYYYILVAEPLPKSN  241
             TG MG++YI +A+ +P  N
Sbjct  391  RTGAMGHFYIYLADQIPNKN  410



>ref|XP_003522144.2| PREDICTED: uncharacterized protein LOC100792489 [Glycine max]
Length=523

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 1/77 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G EAGNE GYLVGMS CYP+PGSV+I   E LT+ + Y N + 
Sbjct  443  YGQDGRVLCTSTPKYGTGKEAGNERGYLVGMSGCYPKPGSVEIKDGEILTLETRYQN-KF  501

Query  182  HTGVMGYYYILVAEPLP  232
             TG MG++YI +AE LP
Sbjct  502  RTGAMGFFYIHLAEQLP  518



>ref|XP_006574191.1| PREDICTED: uncharacterized protein LOC100818138, partial [Glycine 
max]
Length=282

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR LC S P YG G EAGNE  YL+GMS CYPQPG +KI   E LT+ S Y N + 
Sbjct  206  YGQDGRTLCTSTPKYGTGKEAGNEKAYLIGMSICYPQPGPIKIHDGEILTLESRYKN-EF  264

Query  182  HTGVMGYYYILVAEPLPK  235
             TG MG++YI +AE LP+
Sbjct  265  RTGAMGHFYIYLAEELPQ  282



>emb|CAA75589.1| MtN19 [Medicago truncatula]
Length=411

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRV+C S P YG G  AG+E GY+VGMSTCYP PGS+KI   E LT+ +N+S+   
Sbjct  331  YGQDGRVICTSIPKYGKGRRAGDEKGYVVGMSTCYPIPGSIKIFDGEILTLEANHSSNIR  390

Query  182  HTGVMGYYYILVAEPLP  232
            ++GVMG +Y LVAE LP
Sbjct  391  YSGVMGLFYFLVAEKLP  407



>gb|KHN44114.1| hypothetical protein glysoja_039252, partial [Glycine soja]
Length=347

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR LC S P YG G EAGNE  YL+GMS CYPQPG +KI   E LT+ S Y N + 
Sbjct  271  YGQDGRTLCTSTPKYGTGKEAGNEKAYLIGMSICYPQPGPIKIHDGEILTLESRYKN-EF  329

Query  182  HTGVMGYYYILVAEPLPK  235
             TG MG++YI +AE LP+
Sbjct  330  RTGAMGHFYIYLAEELPQ  347



>gb|KDO57643.1| hypothetical protein CISIN_1g041033mg, partial [Citrus sinensis]
Length=118

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 59/76 (78%), Gaps = 3/76 (4%)
 Frame = +2

Query  44   YGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGVMGYYYILVAE  223
            YGNG EAGNE GY+VGMSTCYP+PGS++I   E L + S+YS+ + HTGVMG +YILVA+
Sbjct  1    YGNGMEAGNEAGYIVGMSTCYPKPGSLRITDGETLIVESSYSSSREHTGVMGLFYILVAD  60

Query  224  PLPKSNP---IFHSLD  262
             +P+S+    +F+ +D
Sbjct  61   RVPESSSFLDVFNKMD  76



>ref|XP_007134081.1| hypothetical protein PHAVU_010G017900g [Phaseolus vulgaris]
 gb|ESW06075.1| hypothetical protein PHAVU_010G017900g [Phaseolus vulgaris]
Length=413

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S   YG G EAGNE GYLVGMS CYP+PGS+KI   E LT+ S Y N + 
Sbjct  332  YGQDGRVLCTSNSKYGTGKEAGNEKGYLVGMSVCYPKPGSIKIKDGEVLTLESIYEN-KF  390

Query  182  HTGVMGYYYILVAEPLPKSN  241
             TG MG++YI +A+ +PK +
Sbjct  391  RTGAMGHFYIYLADQIPKKD  410



>ref|XP_008453438.1| PREDICTED: uncharacterized protein LOC103494145 [Cucumis melo]
 ref|XP_008453439.1| PREDICTED: uncharacterized protein LOC103494145 [Cucumis melo]
 ref|XP_008453440.1| PREDICTED: uncharacterized protein LOC103494145 [Cucumis melo]
Length=431

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 4/80 (5%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PI+G G    NE+GY+ GM+TCYPQPGS+KI   E +T +SNYS+   
Sbjct  341  YGEDGRVLCSSSPIHGKG----NEEGYVTGMTTCYPQPGSMKIKKGEMVTFVSNYSSTMT  396

Query  182  HTGVMGYYYILVAEPLPKSN  241
            H GVMG ++I VA+ + KS+
Sbjct  397  HRGVMGIFHIFVADKIFKSS  416



>ref|XP_007134136.1| hypothetical protein PHAVU_010G022300g [Phaseolus vulgaris]
 gb|ESW06130.1| hypothetical protein PHAVU_010G022300g [Phaseolus vulgaris]
Length=413

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+D RVLC S P YG+G EAGNE+GYLVGMS CYP PGS+KI   E LT+ S Y N + 
Sbjct  332  YGQDRRVLCTSNPKYGSGKEAGNENGYLVGMSVCYPTPGSIKIKDGEILTLESIYEN-KF  390

Query  182  HTGVMGYYYILVAEPLPKSN  241
             TG MG++YI +A+ +P  N
Sbjct  391  RTGAMGHFYIYLADQIPNKN  410



>ref|XP_004160447.1| PREDICTED: uncharacterized protein LOC101226295 [Cucumis sativus]
Length=198

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 59/82 (72%), Gaps = 4/82 (5%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S PIYG G    NE+GY++GM+TCYP+PGS+ I   E +T +SNYS+   
Sbjct  109  YGQDGRVLCSSSPIYGEG----NEEGYVIGMTTCYPKPGSITINKGEMVTFVSNYSSTLT  164

Query  182  HTGVMGYYYILVAEPLPKSNPI  247
            H GV G ++I+VA+ +  S+ +
Sbjct  165  HRGVRGIFHIIVADKIKSSSTL  186



>ref|XP_002960633.1| hypothetical protein SELMODRAFT_437681 [Selaginella moellendorffii]
 gb|EFJ38172.1| hypothetical protein SELMODRAFT_437681 [Selaginella moellendorffii]
Length=430

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            GEDGR LC S  +YGNG+  GNE GY+VGMSTC+P+PG+V +A  EKL + S+YS+ Q H
Sbjct  327  GEDGRHLCSSIALYGNGSTPGNEAGYVVGMSTCFPEPGTVTVASGEKLHLSSSYSSAQEH  386

Query  185  TGVMGYYYILVAE  223
            TGVM  +Y+++++
Sbjct  387  TGVMALFYLILSD  399



>ref|XP_008453443.1| PREDICTED: uncharacterized protein LOC103494148 [Cucumis melo]
Length=430

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 64/90 (71%), Gaps = 4/90 (4%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +GEDGRVLC S PIYG G    NE+GY++GM+ CYP+PGS+KI   E +T +SNYS+   
Sbjct  339  YGEDGRVLCSSSPIYGEG----NEEGYMIGMTACYPKPGSMKINKGEMVTFVSNYSSTLT  394

Query  182  HTGVMGYYYILVAEPLPKSNPIFHSLDVAD  271
            H GV+G ++I VA+ + KS+    S +V++
Sbjct  395  HRGVLGLFHIFVADEIFKSSSSTLSEEVSN  424



>ref|XP_007133892.1| hypothetical protein PHAVU_010G000800g [Phaseolus vulgaris]
 gb|ESW05886.1| hypothetical protein PHAVU_010G000800g [Phaseolus vulgaris]
Length=407

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E+G+ LC S P+YG+G EAGNE  YL+GMS CYPQPGS+KI   E LT+ S Y N + 
Sbjct  331  YAENGQTLCTSTPMYGSGNEAGNEKDYLIGMSICYPQPGSIKINDGEILTLESRYVN-EF  389

Query  182  HTGVMGYYYILVAEPLPK  235
             TG MG++YI +AE LP+
Sbjct  390  RTGAMGHFYIYLAENLPQ  407



>gb|KHN42509.1| hypothetical protein glysoja_031445, partial [Glycine soja]
Length=153

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR LC S P YG G EAGNE GYL+GM  CYPQPGS+KI   E L + S Y N + 
Sbjct  78   YGQDGRTLCTSTPKYGRGNEAGNEKGYLIGMFVCYPQPGSIKIHDGEILALESRYKN-EF  136

Query  182  HTGVMGYYYILVAEPLP  232
             +G M ++YI +AE LP
Sbjct  137  CSGAMRHFYIYLAEELP  153



>ref|XP_006577472.1| PREDICTED: uncharacterized protein LOC100779893 [Glycine max]
Length=164

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR LC S P YG G EAGNE GYL+GM  CYPQPGS+KI   E L + S Y N + 
Sbjct  89   YGQDGRTLCTSTPKYGRGNEAGNEKGYLIGMFVCYPQPGSIKIHDGEILALESRYKN-EF  147

Query  182  HTGVMGYYYILVAEPLP  232
             +G M ++YI +AE LP
Sbjct  148  CSGAMRHFYIYLAEELP  164



>ref|XP_006394466.1| hypothetical protein EUTSA_v10004123mg [Eutrema salsugineum]
 ref|XP_006394467.1| hypothetical protein EUTSA_v10004123mg [Eutrema salsugineum]
 dbj|BAJ33779.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31752.1| hypothetical protein EUTSA_v10004123mg [Eutrema salsugineum]
 gb|ESQ31753.1| hypothetical protein EUTSA_v10004123mg [Eutrema salsugineum]
Length=476

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDG  +C S P YGNG E GNE GY+VGMS+CYP+P +VK+   E LT+  NYS    
Sbjct  347  YREDGERICSSMPKYGNGDEPGNEAGYIVGMSSCYPEP-AVKVTKGETLTLEFNYSTTNG  405

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LP+
Sbjct  406  HTGVMGLFYILVAQQLPE  423



>ref|XP_006394469.1| hypothetical protein EUTSA_v10004141mg [Eutrema salsugineum]
 gb|ESQ31755.1| hypothetical protein EUTSA_v10004141mg [Eutrema salsugineum]
Length=472

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDG  +C S P YGNG E GNE GY+VGMS+CYP+P  V++   E LT+  NYSN   
Sbjct  344  YREDGEGICSSMPKYGNGDEPGNEAGYIVGMSSCYPEP--VRVTNGETLTLEFNYSNTHG  401

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LP+
Sbjct  402  HTGVMGLFYILVAQQLPE  419



>ref|XP_009130176.1| PREDICTED: uncharacterized protein LOC103854962 [Brassica rapa]
Length=455

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 2/77 (3%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDG V+C S P YGNG E G+E GY+VGMS+CYP+P  VK+   E L++  NYSNV  
Sbjct  331  YREDGEVICSSMPKYGNGDEPGSEAGYIVGMSSCYPEP--VKVTNGETLSLEFNYSNVIG  388

Query  182  HTGVMGYYYILVAEPLP  232
            HTGVMG +YILVA+ LP
Sbjct  389  HTGVMGLFYILVAQQLP  405



>ref|XP_004513390.1| PREDICTED: uncharacterized protein LOC101513345 [Cicer arietinum]
Length=409

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G E GNE GY+VGMSTCYP+PGS+KI   E +T+ S Y +   
Sbjct  325  YGQDGRVLCTSNPTYGKGEEPGNEKGYVVGMSTCYPEPGSIKIKDGEIVTMESRYKS-GY  383

Query  182  HTGVMGYYYILVAEPLPKS  238
             TGVMG+ YI +A+ LP++
Sbjct  384  RTGVMGHMYIYLADRLPEN  402



>emb|CDY71894.1| BnaCnng74970D [Brassica napus]
Length=225

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDG  +C S P YGNG E G E GY+VGMS+CYP+P  VK++  E LT+  NYS+   
Sbjct  132  YREDGEGICTSMPKYGNGDEPGKEAGYIVGMSSCYPEP--VKVSSGETLTLEFNYSSAVG  189

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LP+
Sbjct  190  HTGVMGLFYILVAQQLPE  207



>ref|XP_010546109.1| PREDICTED: uncharacterized protein LOC104818287 [Tarenaya hassleriana]
Length=492

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDG ++C S P YG G E GNE GY+VGMSTCYP+P  VK+   E L   SNYS+   
Sbjct  364  YREDGGLICSSTPTYGKGVEPGNEAGYIVGMSTCYPEP--VKVTKGETLVFESNYSSAIG  421

Query  182  HTGVMGYYYILVAEPLPKSNPIFHSLDVADL  274
            HTGVMG +YI+VA+ LP     F +L   +L
Sbjct  422  HTGVMGLFYIMVAQQLPDHGNSFPALIRGNL  452



>ref|XP_004510129.1| PREDICTED: uncharacterized protein LOC101508405 [Cicer arietinum]
Length=423

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G E GNE GY+VGMSTCYP+PGS+KI   E +T+ S Y +   
Sbjct  339  YGQDGRVLCTSNPTYGKGEEPGNEKGYVVGMSTCYPEPGSIKIKDGEIVTMESRYKS-GY  397

Query  182  HTGVMGYYYILVAEPLPKS  238
             TG MG+ YI +A+ LP++
Sbjct  398  RTGAMGHMYIYLADRLPEN  416



>gb|KGN63844.1| hypothetical protein Csa_1G024275 [Cucumis sativus]
Length=461

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 4/78 (5%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S PI+G      NE+GY++GM+TCYP+PGS+KI   E +T +SNYS+   
Sbjct  370  YGQDGRVLCSSSPIHGKE----NEEGYVIGMTTCYPKPGSIKINKGEMVTFVSNYSSTLT  425

Query  182  HTGVMGYYYILVAEPLPK  235
            H GVMG ++I+VA+ + K
Sbjct  426  HRGVMGIFHIIVADRIFK  443



>ref|XP_004160448.1| PREDICTED: uncharacterized protein LOC101226527 [Cucumis sativus]
Length=431

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 4/78 (5%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S PI+G      NE+GY++GM+TCYP+PGS+KI   E +T +SNYS+   
Sbjct  340  YGQDGRVLCSSSPIHG----KENEEGYVIGMTTCYPKPGSIKINKGEMVTFVSNYSSTLT  395

Query  182  HTGVMGYYYILVAEPLPK  235
            H GVMG ++I+VA+ + K
Sbjct  396  HRGVMGIFHIIVADRIFK  413



>ref|XP_006574193.1| PREDICTED: uncharacterized protein LOC102666323 [Glycine max]
Length=249

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR LC S   YG G +A NE G L+GMS CYPQPGS+KI   E LT+ S Y N + 
Sbjct  173  YGQDGRTLCTSTAKYGTGKKARNEKGNLIGMSICYPQPGSIKIHDGEILTLESRYKN-EF  231

Query  182  HTGVMGYYYILVAEPLPK  235
             TG MG++ I +AE LP+
Sbjct  232  RTGAMGHFNIYLAEELPQ  249



>ref|XP_004506757.1| PREDICTED: uncharacterized protein LOC101509765 [Cicer arietinum]
Length=423

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G E GNE GY+V MSTCYP+PGS+KI   E +T+ S Y +   
Sbjct  339  YGQDGRVLCTSNPTYGKGEEPGNEKGYVVRMSTCYPEPGSIKIKDDEIVTMESRYKS-GY  397

Query  182  HTGVMGYYYILVAEPLPKSNPI  247
             TG MG+ YI +A+ LP++  I
Sbjct  398  RTGAMGHMYIYLADRLPENRYI  419



>ref|XP_004497966.1| PREDICTED: uncharacterized protein LOC101492429 [Cicer arietinum]
Length=423

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G E GNE GY+VGMSTCYP+ GS+KI   E +T+ S Y +   
Sbjct  339  YGQDGRVLCTSKPTYGKGEEPGNEKGYVVGMSTCYPELGSIKIKDGEIVTMESRYKS-GY  397

Query  182  HTGVMGYYYILVAEPLPKS  238
             TGVMG+ YI +A+ LP++
Sbjct  398  RTGVMGHMYIYLADRLPEN  416



>gb|AAL91170.1| putative protein [Arabidopsis thaliana]
Length=475

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E+G  +C S P YGNG E GNE GY+VGMS+CYP    VK++  E LT+ SNYSN   
Sbjct  344  YRENGEGICASMPKYGNGDEPGNEAGYIVGMSSCYPA-DPVKVSYGETLTLESNYSNAVG  402

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG +YILVA+ LP+ +
Sbjct  403  HTGVMGLFYILVAQQLPEPD  422



>ref|NP_200990.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL38804.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51266.1| unknown protein [Arabidopsis thaliana]
 gb|AED97522.1| uncharacterized protein AT5G61820 [Arabidopsis thaliana]
Length=475

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E+G  +C S P YGNG E GNE GY+VGMS+CYP    VK++  E LT+ SNYSN   
Sbjct  344  YRENGEGICASMPKYGNGDEPGNEAGYIVGMSSCYPA-DPVKVSYGETLTLESNYSNAVG  402

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG +YILVA+ LP+ +
Sbjct  403  HTGVMGLFYILVAQQLPEPD  422



>emb|CDY53158.1| BnaCnng24580D [Brassica napus]
Length=494

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 55/78 (71%), Gaps = 2/78 (3%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDG  +C S   YGNG E GNE GY+VGMS+CYP+P  VK+   E LT+  NYS+   
Sbjct  366  YREDGEGICTSMAKYGNGDEPGNEAGYIVGMSSCYPEP--VKVTSGETLTLEFNYSSAVG  423

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LP+
Sbjct  424  HTGVMGLFYILVAQQLPE  441



>ref|XP_004497967.1| PREDICTED: uncharacterized protein LOC101492762 [Cicer arietinum]
Length=718

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGRVLC S P YG G E GN+ GY+VGMSTCYP+PGS+KI   E +T+ S Y +   
Sbjct  634  YGQDGRVLCTSKPTYGKGEEPGNKKGYVVGMSTCYPEPGSIKIKDGEIVTMESRYKS-GY  692

Query  182  HTGVMGYYYILVAEPLPKS  238
             TGVMG+ YI + + LP++
Sbjct  693  RTGVMGHMYIYLVDRLPEN  711



>dbj|BAB10082.1| MtN19-like protein [Arabidopsis thaliana]
Length=517

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 1/80 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E+G  +C S P YGNG E GNE GY+VGMS+CYP    VK++  E LT+ SNYSN   
Sbjct  350  YRENGEGICASMPKYGNGDEPGNEAGYIVGMSSCYPA-DPVKVSYGETLTLESNYSNAVG  408

Query  182  HTGVMGYYYILVAEPLPKSN  241
            HTGVMG +YILVA+ LP+ +
Sbjct  409  HTGVMGLFYILVAQQLPEPD  428



>ref|XP_004512657.1| PREDICTED: uncharacterized protein LOC101515735 [Cicer arietinum]
Length=415

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + +DG+ LC S P YG G EAGNE+GY VGMS CYP+P S+KI   E +T+ S Y N + 
Sbjct  337  YRQDGKTLCTSTPRYGTGKEAGNEEGYAVGMSVCYPKPDSIKINDGEIVTVESRYKN-EF  395

Query  182  HTGVMGYYYILVAEPLPKS  238
             TG MG+ YI +A+ LP +
Sbjct  396  LTGAMGHMYIYLADRLPHT  414



>ref|XP_010444016.1| PREDICTED: uncharacterized protein LOC104726775 [Camelina sativa]
 ref|XP_010483866.1| PREDICTED: uncharacterized protein LOC104762303 [Camelina sativa]
Length=153

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E G  +C S   YGNG E GNE GY+VGM++CYP    VK++  E LT+  NYS+   
Sbjct  24   YRESGEGICTSMAKYGNGVEPGNEAGYIVGMASCYPAD-PVKVSYGETLTMEFNYSSAVG  82

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LP+
Sbjct  83   HTGVMGLFYILVAQQLPE  100



>ref|XP_010444012.1| PREDICTED: uncharacterized protein LOC104726772 [Camelina sativa]
Length=474

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E+G  +C S P YGNG E GNE GY+VGM++CYP    VK++  E L++  NYS+V  
Sbjct  345  YRENGEGICTSMPKYGNGVEPGNEAGYVVGMTSCYP-ADPVKVSYGETLSLEVNYSSVVG  403

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LP+
Sbjct  404  HTGVMGLFYILVAQQLPE  421



>emb|CDY42880.1| BnaAnng07050D [Brassica napus]
Length=110

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = +2

Query  35   FPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGVMGYYYIL  214
             P YGNG E G+E GY+VGMS+CYP+P  VK+   E L++  NYSNV  HTGVMG +YIL
Sbjct  1    MPKYGNGDEPGSEAGYIVGMSSCYPEP--VKVTNGETLSLEFNYSNVIGHTGVMGLFYIL  58

Query  215  VAEPLPKSNPIFHSLDVADL  274
            V++ LP      HS  ++ L
Sbjct  59   VSQQLPGPKLPAHSSSMSFL  78



>ref|XP_009150119.1| PREDICTED: uncharacterized protein LOC103873465 [Brassica rapa]
 emb|CDY00232.1| BnaA06g21330D [Brassica napus]
Length=469

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + EDG  +C S P YGN  E GNE GY+VGMS+CYP    VK+   E LT+  NYS+   
Sbjct  340  YREDGEGICTSMPKYGNADEPGNEAGYIVGMSSCYPDE-PVKVTSGETLTLEFNYSSAVG  398

Query  182  HTGVMGYYYILVAEPLPKS  238
            HTGVMG +YILV + LP+ 
Sbjct  399  HTGVMGLFYILVTQQLPEQ  417



>ref|XP_006280401.1| hypothetical protein CARUB_v10026327mg [Capsella rubella]
 gb|EOA13299.1| hypothetical protein CARUB_v10026327mg [Capsella rubella]
Length=477

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E+G  +C S P YGNG E GNE GY+VGMS+CYP    VK+   E  T+  NYSNV  
Sbjct  348  YRENGEGICTSIPKYGNGVEPGNEAGYIVGMSSCYP-ADPVKVDYGETFTLEVNYSNVVG  406

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YI+V++ LP+
Sbjct  407  HTGVMGLFYIVVSQQLPE  424



>ref|XP_003620759.1| MtN19-like protein [Medicago truncatula]
 gb|AES76977.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=425

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR LC S P YG G EAGNE+GYLVGMS CYP+PGS+KI   E +T+ S Y N + 
Sbjct  347  YGQDGRTLCTSTPTYGTGKEAGNEEGYLVGMSVCYPKPGSMKIDDGETVTVESIYKN-EF  405

Query  182  HTGVMGYYYILVAEPL  229
               VMG  +  +A+ L
Sbjct  406  LPAVMGDMHFYLADEL  421



>ref|XP_002866457.1| hypothetical protein ARALYDRAFT_496351 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42716.1| hypothetical protein ARALYDRAFT_496351 [Arabidopsis lyrata subsp. 
lyrata]
Length=475

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E+G  +C S P YGNG E GNE GY+VGMS+CYP    VK++  E L +  NYSN   
Sbjct  346  YRENGEGICTSMPKYGNGDEPGNEAGYIVGMSSCYPA-DPVKVSYGETLKLEFNYSNDVG  404

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LP+
Sbjct  405  HTGVMGLFYILVAQQLPE  422



>ref|XP_006279767.1| hypothetical protein CARUB_v10027779mg [Capsella rubella]
 gb|EOA12665.1| hypothetical protein CARUB_v10027779mg [Capsella rubella]
Length=477

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E+G  +C S P YGNG E GNE GY+VGMSTCYP    V+++  E L +  NYS+   
Sbjct  348  YRENGEGICTSMPKYGNGVEPGNEAGYIVGMSTCYPT-DPVEVSYGETLNVEFNYSSAVG  406

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YI+VA+ LPK
Sbjct  407  HTGVMGLFYIVVAQQLPK  424



>ref|XP_003599552.1| MtN19-like protein [Medicago truncatula]
 gb|AES69803.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=409

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 1/77 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR LC S P YG GTEAGNE+GYLVGMS CYP+ GS+KI   E +T+ S Y N + 
Sbjct  331  YGQDGRTLCTSTPKYGTGTEAGNEEGYLVGMSVCYPKLGSMKIDDGETVTVESIYKN-EF  389

Query  182  HTGVMGYYYILVAEPLP  232
               VMG  +  +A+ LP
Sbjct  390  LPEVMGDMHFYLADELP  406



>ref|XP_010457823.1| PREDICTED: uncharacterized protein LOC104739234 [Camelina sativa]
Length=465

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E+G  +C S   YGNG E GNE GY+VGM++CYP    VK++  E LT+  NYS+   
Sbjct  336  YRENGEGICTSMAKYGNGVEPGNEAGYIVGMTSCYP-AAPVKVSYGETLTLEVNYSSAVG  394

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LP+
Sbjct  395  HTGVMGLFYILVAQQLPE  412



>ref|XP_003620745.1| MtN19 protein [Medicago truncatula]
 gb|AES76963.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=409

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR LC S P YG G E+GNE GYLVGMS CYP+PGS+KI   E +T+ S Y N + 
Sbjct  331  YGQDGRNLCTSTPTYGTGKESGNEKGYLVGMSVCYPKPGSIKIDDGETVTVESIYKN-EF  389

Query  182  HTGVMGYYYILVAEPL  229
               VMG  +  +A+ L
Sbjct  390  LPAVMGDMHFYLADEL  405



>ref|XP_003627861.1| MtN19-like protein [Medicago truncatula]
 gb|AET02337.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=409

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            +G+DGR+LC S P YG G EAGNE+GYLVGMS CYP+ GS+KI   E +T+ S Y N + 
Sbjct  331  YGQDGRILCTSTPTYGTGKEAGNEEGYLVGMSVCYPKLGSMKIDDGETVTVESIYKN-EF  389

Query  182  HTGVMGYYYILVAEPLPK  235
               VMG  +  +A+  P+
Sbjct  390  LPAVMGDMHFYLADAPPQ  407



>ref|XP_010457791.1| PREDICTED: uncharacterized protein LOC104739210 [Camelina sativa]
Length=475

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E G  +C S   YGNG E GNE GY+VGM++CYP    VK++  E LT+ SNYS+   
Sbjct  346  YRESGEGICTSMAKYGNGVEPGNEAGYIVGMTSCYP-ADPVKVSYGETLTLESNYSSAVG  404

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +Y++VA+ LP+
Sbjct  405  HTGVMGIFYMIVAQQLPE  422



>ref|XP_010483865.1| PREDICTED: uncharacterized protein LOC104762302 isoform X2 [Camelina 
sativa]
Length=436

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E G  +C S   YGNG E GNE GY+VGM++CYP    VK++  E LT+  NYS+   
Sbjct  342  YRESGEGICTSMAKYGNGVEPGNEAGYIVGMASCYPA-DPVKVSYGETLTMEFNYSSAVG  400

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LP+
Sbjct  401  HTGVMGLFYILVAQQLPE  418



>ref|XP_010483864.1| PREDICTED: uncharacterized protein LOC104762302 isoform X1 [Camelina 
sativa]
Length=471

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E G  +C S   YGNG E GNE GY+VGM++CYP    VK++  E LT+  NYS+   
Sbjct  342  YRESGEGICTSMAKYGNGVEPGNEAGYIVGMASCYP-ADPVKVSYGETLTMEFNYSSAVG  400

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LP+
Sbjct  401  HTGVMGLFYILVAQQLPE  418



>ref|XP_010483862.1| PREDICTED: uncharacterized protein LOC104762299 [Camelina sativa]
Length=475

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E G  +C S   YGNG E GNE GY+VGM++CYP    VK++  E LT+  NYS+   
Sbjct  346  YRESGEGICTSMAKYGNGVEPGNEAGYIVGMASCYP-ADPVKVSYGETLTMEFNYSSAVG  404

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LP+
Sbjct  405  HTGVMGLFYILVAQQLPE  422



>ref|XP_010457781.1| PREDICTED: uncharacterized protein LOC104739202 [Camelina sativa]
Length=472

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E+G  +C S   YGNG + GNE GY+VGM++CYP    VK++  E L +  NYS+   
Sbjct  343  YRENGEGICTSMAKYGNGVKPGNEAGYIVGMTSCYP-ADPVKVSYGETLNMEFNYSSAVG  401

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +YILVA+ LP+
Sbjct  402  HTGVMGLFYILVAQQLPE  419



>ref|XP_010457757.1| PREDICTED: uncharacterized protein LOC104739180 [Camelina sativa]
 ref|XP_010457764.1| PREDICTED: uncharacterized protein LOC104739180 [Camelina sativa]
 ref|XP_010457771.1| PREDICTED: uncharacterized protein LOC104739180 [Camelina sativa]
Length=466

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + + G  +C S   YGNG E GNE GY+VGM++CYP    VK++  E LT+  NYS+   
Sbjct  337  YRDSGEEICTSMAKYGNGVEPGNEAGYIVGMTSCYPA-DPVKVSYEETLTLEVNYSSAVG  395

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG ++I V + LP+
Sbjct  396  HTGVMGLFHIFVVQQLPE  413



>ref|XP_010444011.1| PREDICTED: uncharacterized protein LOC104726771 [Camelina sativa]
Length=475

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E G  +C S   YGNG E GNE GY+VGM++C P    VK++  E LT+  NYS+   
Sbjct  346  YRETGEGICTSMAKYGNGVEPGNEAGYIVGMTSCNP-ADPVKVSYGETLTLEVNYSSAVG  404

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG +Y++VA+ LP+
Sbjct  405  HTGVMGIFYMIVAQQLPE  422



>ref|XP_010477840.1| PREDICTED: uncharacterized protein LOC104756879 [Camelina sativa]
Length=543

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQM  181
            + E G  +C S   YG+G E GNE GY+VGM++CYP    VK++  E LT+  NYS+   
Sbjct  388  YRESGEGICTSMAKYGDGVEPGNEAGYIVGMTSCYP-ADPVKVSYGETLTMEFNYSSAVG  446

Query  182  HTGVMGYYYILVAEPLPK  235
            HTGVMG + +LVA+ LP+
Sbjct  447  HTGVMGLFCLLVAQQLPE  464



>gb|KHN25867.1| hypothetical protein glysoja_018721 [Glycine soja]
Length=196

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  80   YLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGVMGYYYILVAEPLPKSN  241
            Y+VGMSTCYP PGSVKI   +  T+ SNYS+   HTGVMG +Y+LVAE LP  +
Sbjct  132  YIVGMSTCYPPPGSVKIIDGKTFTMESNYSSSPGHTGVMGIFYLLVAEQLPHQH  185



>ref|XP_008392751.1| PREDICTED: uncharacterized protein LOC103454938 [Malus domestica]
Length=372

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  5    GEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVK  127
            GEDGRVLC S PIYG G EAGNE GY+VGM+TCYP P   +
Sbjct  332  GEDGRVLCSSTPIYGKGKEAGNEAGYIVGMTTCYPWPAQSR  372



>ref|XP_001784976.1| predicted protein [Physcomitrella patens]
 gb|EDQ50197.1| predicted protein [Physcomitrella patens]
Length=414

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 47/78 (60%), Gaps = 4/78 (5%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQ--PGSV-KIAPMEKLTIISNYSN  172
            +GEDGR++C S P+YG G  AGNE GY+V +  C P    G   KIA  EKL     YS 
Sbjct  320  WGEDGRLICRSDPVYGEGNTAGNESGYVVSIQHCNPALMAGEFGKIAKGEKLRFQVRYSK  379

Query  173  VQ-MHTGVMGYYYILVAE  223
            V   HTGVMG  ++ VAE
Sbjct  380  VDGPHTGVMGVAFMKVAE  397



>ref|XP_003589696.1| MtN19-like protein [Medicago truncatula]
 gb|AES59947.1| stress up-regulated Nod 19 protein [Medicago truncatula]
Length=359

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKL  148
            +G+DGR LC S P YG G EAGN  GYLVGMS CYP+ GS KI   E +
Sbjct  310  YGQDGRTLCTSTPTYGTGKEAGNAKGYLVGMSVCYPKLGSTKIDDGETM  358



>gb|KDO31539.1| hypothetical protein SPRG_03467 [Saprolegnia parasitica CBS 223.65]
Length=464

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +2

Query  23   LCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGVMGY  202
            +C S P YGNGT AGNE+GY++ MSTC   P  +++   + L I+++Y +   HTGVM  
Sbjct  338  ICSSLPTYGNGTVAGNENGYVIAMSTCTFDP-PLRMRTTDVLRIVASYDSTIAHTGVMSL  396

Query  203  YYILVAEPLPK  235
            +Y+ +A+ +PK
Sbjct  397  WYLAIAD-VPK  406



>ref|XP_008609227.1| hypothetical protein SDRG_05292 [Saprolegnia diclina VS20]
 gb|EQC37065.1| hypothetical protein SDRG_05292 [Saprolegnia diclina VS20]
Length=463

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +2

Query  23   LCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGVMGY  202
            +C S P YGNGT AGNE+GY++ MSTC   P  +++   + L I+++Y +   HTGVM  
Sbjct  337  ICSSMPTYGNGTVAGNENGYVIAMSTCTFDP-PLRMRTTDVLRIVASYDSTLAHTGVMSL  395

Query  203  YYILVAEPLPK  235
            +Y+ +A+ +PK
Sbjct  396  WYLAIAD-VPK  405



>ref|XP_001774740.1| predicted protein [Physcomitrella patens]
 gb|EDQ60411.1| predicted protein [Physcomitrella patens]
Length=379

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 4/70 (6%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPG---SVKIAPMEKLTIISNYSN  172
            +GEDGR++C + P+YGNG EAGNE  Y+VG+  C   PG   S+KI   E+L  I   + 
Sbjct  295  WGEDGRLICRTTPLYGNGHEAGNEKDYVVGIKNCIGNPGAPDSMKIKQGERLKYIVVSTK  354

Query  173  V-QMHTGVMG  199
            V   HTG+MG
Sbjct  355  VGGPHTGLMG  364



>gb|ETK72754.1| hypothetical protein L915_20217 [Phytophthora parasitica]
 gb|ETL26208.1| hypothetical protein L916_20084 [Phytophthora parasitica]
Length=473

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  14   GRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGV  193
            G +LC S P YG+G EAGNEDGY++ MSTC   P   ++   + + I++ Y+N   HTGV
Sbjct  340  GDLLCASVPEYGSGMEAGNEDGYVISMSTCTFDPPR-RMRTTDIVRIVALYNNTAPHTGV  398

Query  194  MGYYYILVAE  223
            M   Y+ +++
Sbjct  399  MSLMYMALSD  408



>gb|ETI32377.1| hypothetical protein F443_20804 [Phytophthora parasitica P1569]
 gb|ETL79413.1| hypothetical protein L917_19954 [Phytophthora parasitica]
 gb|ETM32668.1| hypothetical protein L914_19981 [Phytophthora parasitica]
 gb|ETP02241.1| hypothetical protein F441_20666 [Phytophthora parasitica CJ01A1]
Length=473

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  14   GRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGV  193
            G +LC S P YG+G EAGNEDGY++ MSTC   P   ++   + + I++ Y+N   HTGV
Sbjct  340  GDLLCASVPEYGSGMEAGNEDGYVISMSTCTFDPPR-RMRTTDIVRIVALYNNTAPHTGV  398

Query  194  MGYYYILVAE  223
            M   Y+ +++
Sbjct  399  MSLMYMALSD  408



>ref|XP_004137547.1| PREDICTED: uncharacterized protein LOC101210584 [Cucumis sativus]
Length=447

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 4/43 (9%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKI  130
            +G+DGRVLC S PI+G      NE+GY++GM+TCYP+PGS+KI
Sbjct  344  YGQDGRVLCSSSPIHGKE----NEEGYVIGMTTCYPKPGSIKI  382



>gb|ETO61110.1| hypothetical protein F444_20823 [Phytophthora parasitica P1976]
 gb|ETP30402.1| hypothetical protein F442_20601 [Phytophthora parasitica P10297]
Length=473

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  14   GRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGV  193
            G +LC S P YG+G EAGNEDGY++ MSTC   P   ++   + + I++ Y+N   HTGV
Sbjct  340  GDLLCASVPEYGSGMEAGNEDGYVISMSTCTFDPPR-RMRTTDIVRIVALYNNTVPHTGV  398

Query  194  MGYYYILVAE  223
            M   Y+ +++
Sbjct  399  MSLMYMALSD  408



>ref|XP_008898088.1| hypothetical protein PPTG_06079 [Phytophthora parasitica INRA-310]
 gb|ETN17018.1| hypothetical protein PPTG_06079 [Phytophthora parasitica INRA-310]
Length=473

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +2

Query  14   GRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGV  193
            G +LC S P YG+G EAGNEDGY++ MSTC   P   ++   + + I++ Y+N   HTGV
Sbjct  340  GDLLCASVPEYGSGMEAGNEDGYVISMSTCTFDPPR-RMRTTDIVRIVALYNNTVPHTGV  398

Query  194  MGYYYILVAE  223
            M   Y+ +++
Sbjct  399  MSLMYMALSD  408



>ref|XP_002904847.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY53229.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=441

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +2

Query  14   GRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGV  193
            G +LC S P YG+G+EAGNEDGY++ MSTC   P   ++   + + I++ Y+N   HTGV
Sbjct  340  GDLLCASVPQYGSGSEAGNEDGYVISMSTCTFNPPR-RMRTTDIVRIVALYNNTVPHTGV  398

Query  194  MGYYYILV  217
            M   + L+
Sbjct  399  MSLIWELL  406



>emb|CCI40599.1| unnamed protein product [Albugo candida]
Length=480

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +2

Query  8    EDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHT  187
            + G +LC S P YG+G EA +E GY+V MSTC   P   ++A  + L I++ Y+N + HT
Sbjct  346  QSGELLCSSIPHYGHGNEANDELGYVVSMSTCEFNPPIRRLAS-DVLRIVALYNNTKAHT  404

Query  188  GVMGYYYILVAE  223
            G M   ++ ++E
Sbjct  405  GAMSLVFVGMSE  416



>ref|XP_001779179.1| predicted protein [Physcomitrella patens]
 gb|EDQ56025.1| predicted protein [Physcomitrella patens]
Length=398

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 4/77 (5%)
 Frame = +2

Query  2    FGEDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGS---VKIAPMEKLTIISNYSN  172
            + +DG +LC+S PIYG G   GNE GY+VG+++C+P   +     I   E L  +  YS 
Sbjct  315  WSKDGTLLCESLPIYGQGHSVGNESGYVVGITSCWPPADTGVPYYITKNEMLKFVVKYSM  374

Query  173  VQ-MHTGVMGYYYILVA  220
            V   HTG+MG   + +A
Sbjct  375  VDGPHTGLMGLINLKIA  391



>ref|XP_009520872.1| hypothetical protein PHYSODRAFT_555341 [Phytophthora sojae]
 gb|EGZ25584.1| hypothetical protein PHYSODRAFT_555341 [Phytophthora sojae]
Length=445

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +2

Query  14   GRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGV  193
            G +LC S P YG+GTEAGNEDGY++ MSTC   P   ++   + + I++ Y+N    TGV
Sbjct  343  GDLLCASVPEYGSGTEAGNEDGYVISMSTCTFDPPR-RMRTTDIVRIVALYNNTVPRTGV  401

Query  194  MG  199
            MG
Sbjct  402  MG  403



>ref|XP_009835512.1| hypothetical protein H257_10611 [Aphanomyces astaci]
 gb|ETV75008.1| hypothetical protein H257_10611 [Aphanomyces astaci]
Length=472

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +2

Query  20   VLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGVMG  199
            +LC+SFP YG+G  AGNE GY++ M+TC   P   ++     + ++S Y++   HTGVM 
Sbjct  341  LLCNSFPTYGSGHVAGNESGYVIAMATCTFDPPR-RMRSSAIVRVVSTYNSTVGHTGVMS  399

Query  200  YYYILVAE  223
              YI +A+
Sbjct  400  LLYIALAD  407



>ref|XP_009835513.1| hypothetical protein H257_10612 [Aphanomyces astaci]
 gb|ETV75009.1| hypothetical protein H257_10612 [Aphanomyces astaci]
Length=472

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +2

Query  20   VLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHTGVMG  199
            +LC+SFP YG+G  AGNE GY++ M+TC   P   ++     + ++S Y++   HTGVM 
Sbjct  341  LLCNSFPTYGSGHVAGNESGYVIAMATCTFDPPR-RMRSSAIVRVVSTYNSTVGHTGVMS  399

Query  200  YYYILVAE  223
              YI +A+
Sbjct  400  LLYIALAD  407



>gb|EJK60813.1| hypothetical protein THAOC_18774 [Thalassiosira oceanica]
Length=480

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +2

Query  11   DGRVLCDSFPIYGNGT--EAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMH  184
            D  +LC+S P YG+G   E GNE GY+  MS+C   P  V +   EK+ ++  Y++ + H
Sbjct  355  DTELLCESLPTYGSGEPGEIGNEPGYINSMSSCTFDPPLV-LRTTEKIRVVGKYNSSEPH  413

Query  185  TGVMGYYYILVAE  223
             GVM  +YI V++
Sbjct  414  QGVMSLFYIAVSD  426



>emb|CCA14282.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=480

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 38/68 (56%), Gaps = 1/68 (1%)
 Frame = +2

Query  8    EDGRVLCDSFPIYGNGTEAGNEDGYLVGMSTCYPQPGSVKIAPMEKLTIISNYSNVQMHT  187
            +   +LC S P YG G E  NE GY+V MS+C   P   ++A  + L I++ Y+N   H+
Sbjct  346  QTSELLCSSIPQYGRGHEVNNELGYVVAMSSCEFNPPIRRLAS-DILRIVALYNNTNAHS  404

Query  188  GVMGYYYI  211
            G M   ++
Sbjct  405  GAMSLVFV  412



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 885178820714