BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17660_g1_i1 len=1824 path=[1:0-72 3636:73-73 @74@!:74-948
949:949-1823]

Length=1824
                                                                      Score     E

emb|CDP12594.1|  unnamed protein product                                751   0.0      
ref|XP_002269462.1|  PREDICTED: reticuline oxidase-like protein         747   0.0      Vitis vinifera
gb|KDP36348.1|  hypothetical protein JCGZ_09768                         747   0.0      
emb|CAN80091.1|  hypothetical protein VITISV_015121                     745   0.0      Vitis vinifera
emb|CAN60572.1|  hypothetical protein VITISV_000229                     745   0.0      Vitis vinifera
ref|XP_004295451.1|  PREDICTED: reticuline oxidase-like protein-like    744   0.0      
ref|XP_009803657.1|  PREDICTED: reticuline oxidase-like protein         744   0.0      
ref|XP_002270585.1|  PREDICTED: reticuline oxidase-like protein         743   0.0      Vitis vinifera
ref|XP_008225674.1|  PREDICTED: reticuline oxidase-like protein         736   0.0      
ref|XP_010655774.1|  PREDICTED: reticuline oxidase-like protein         736   0.0      
ref|XP_009596049.1|  PREDICTED: reticuline oxidase-like protein         736   0.0      
ref|XP_002523151.1|  Reticuline oxidase precursor, putative             736   0.0      Ricinus communis
ref|XP_007211543.1|  hypothetical protein PRUPE_ppa004021mg             735   0.0      
ref|XP_006370773.1|  FAD-binding domain-containing family protein       733   0.0      
ref|XP_011039280.1|  PREDICTED: reticuline oxidase-like protein         730   0.0      
emb|CDP12592.1|  unnamed protein product                                726   0.0      
ref|XP_006352998.1|  PREDICTED: reticuline oxidase-like protein-like    720   0.0      
gb|KCW75699.1|  hypothetical protein EUGRSUZ_D00073                     720   0.0      
ref|XP_011096701.1|  PREDICTED: reticuline oxidase-like protein         719   0.0      
ref|XP_010051867.1|  PREDICTED: reticuline oxidase-like protein         720   0.0      
ref|XP_009362182.1|  PREDICTED: reticuline oxidase-like protein         716   0.0      
ref|XP_004295450.1|  PREDICTED: reticuline oxidase-like protein-like    717   0.0      
ref|XP_002267904.2|  PREDICTED: reticuline oxidase-like protein         709   0.0      Vitis vinifera
ref|XP_010054196.1|  PREDICTED: reticuline oxidase-like protein         707   0.0      
ref|XP_004233150.1|  PREDICTED: reticuline oxidase-like protein         706   0.0      
ref|XP_009362286.1|  PREDICTED: reticuline oxidase-like protein         708   0.0      
ref|XP_006468466.1|  PREDICTED: reticuline oxidase-like protein-like    704   0.0      
ref|XP_007203267.1|  hypothetical protein PRUPE_ppa019803mg             703   0.0      
ref|XP_009362285.1|  PREDICTED: reticuline oxidase-like protein         702   0.0      
gb|KEH37087.1|  FAD-binding berberine family protein                    702   0.0      
ref|XP_006448845.1|  hypothetical protein CICLE_v10018073mg             702   0.0      
gb|EYU19100.1|  hypothetical protein MIMGU_mgv1a004305mg                702   0.0      
ref|XP_008360665.1|  PREDICTED: reticuline oxidase-like protein         702   0.0      
ref|XP_006448838.1|  hypothetical protein CICLE_v10014838mg             701   0.0      
ref|XP_010674638.1|  PREDICTED: reticuline oxidase-like protein         693   0.0      
ref|XP_007023039.1|  FAD-binding Berberine family protein               693   0.0      
ref|XP_007226571.1|  hypothetical protein PRUPE_ppa024148mg             692   0.0      
gb|KDO48902.1|  hypothetical protein CISIN_1g009297mg                   686   0.0      
ref|XP_008352411.1|  PREDICTED: LOW QUALITY PROTEIN: reticuline o...    682   0.0      
ref|XP_004486494.1|  PREDICTED: reticuline oxidase-like protein-like    683   0.0      
ref|XP_002523152.1|  Reticuline oxidase precursor, putative             681   0.0      Ricinus communis
ref|XP_006432918.1|  hypothetical protein CICLE_v10000808mg             682   0.0      
ref|XP_008222794.1|  PREDICTED: reticuline oxidase-like protein         681   0.0      
gb|KCW76615.1|  hypothetical protein EUGRSUZ_D01003                     677   0.0      
ref|XP_006377911.1|  hypothetical protein POPTR_0011s16160g             679   0.0      
ref|XP_003546286.1|  PREDICTED: reticuline oxidase-like protein-like    674   0.0      
ref|XP_002299026.2|  hypothetical protein POPTR_0001s46680g             673   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008445642.1|  PREDICTED: reticuline oxidase-like protein         669   0.0      
ref|XP_004135723.1|  PREDICTED: reticuline oxidase-like protein-like    667   0.0      
ref|XP_007147438.1|  hypothetical protein PHAVU_006G124600g             666   0.0      
ref|XP_011006011.1|  PREDICTED: reticuline oxidase-like protein         664   0.0      
ref|XP_003547341.1|  PREDICTED: reticuline oxidase-like protein-like    665   0.0      
gb|KHN14296.1|  Reticuline oxidase-like protein                         665   0.0      
gb|EYU43211.1|  hypothetical protein MIMGU_mgv1a004698mg                663   0.0      
ref|XP_004486573.1|  PREDICTED: reticuline oxidase-like protein-like    662   0.0      
ref|XP_007033584.1|  FAD-binding Berberine family protein isoform 1     660   0.0      
ref|XP_008392313.1|  PREDICTED: reticuline oxidase-like protein         659   0.0      
ref|XP_008356815.1|  PREDICTED: reticuline oxidase-like protein         659   0.0      
ref|XP_010519042.1|  PREDICTED: reticuline oxidase-like protein         649   0.0      
ref|XP_007147441.1|  hypothetical protein PHAVU_006G124800g             649   0.0      
gb|AFK34476.1|  unknown                                                 650   0.0      
gb|KCW76692.1|  hypothetical protein EUGRSUZ_D01053                     640   0.0      
gb|EPS73320.1|  hypothetical protein M569_01431                         639   0.0      
gb|AAL77103.1|AF472609_1  carbohydrate oxidase                          637   0.0      Helianthus annuus
ref|XP_006448837.1|  hypothetical protein CICLE_v10017768mg             636   0.0      
gb|AAL77102.1|AF472608_1  carbohydrate oxidase                          637   0.0      Lactuca sativa [cultivated lettuce]
ref|XP_010667595.1|  PREDICTED: reticuline oxidase-like protein         635   0.0      
gb|KHN44657.1|  Reticuline oxidase-like protein                         631   0.0      
ref|XP_003534791.1|  PREDICTED: reticuline oxidase-like protein-like    631   0.0      
ref|XP_004486493.1|  PREDICTED: reticuline oxidase-like protein-like    627   0.0      
ref|XP_003547339.1|  PREDICTED: reticuline oxidase-like protein-like    626   0.0      
emb|CAN81650.1|  hypothetical protein VITISV_003752                     622   0.0      Vitis vinifera
ref|XP_011006009.1|  PREDICTED: reticuline oxidase-like protein         622   0.0      
ref|XP_002317086.1|  FAD-binding domain-containing family protein       621   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007023052.1|  FAD-binding Berberine family protein               621   0.0      
ref|XP_002523155.1|  Reticuline oxidase precursor, putative             620   0.0      Ricinus communis
ref|XP_010672792.1|  PREDICTED: reticuline oxidase-like protein         620   0.0      
gb|KEH37085.1|  reticuline oxidase-like protein                         619   0.0      
ref|XP_002270139.2|  PREDICTED: reticuline oxidase-like protein         614   0.0      Vitis vinifera
ref|XP_004295439.1|  PREDICTED: reticuline oxidase-like protein-like    613   0.0      
ref|XP_002523156.1|  Reticuline oxidase precursor, putative             612   0.0      Ricinus communis
ref|XP_007147442.1|  hypothetical protein PHAVU_006G125000g             613   0.0      
ref|XP_002268606.1|  PREDICTED: reticuline oxidase-like protein         612   0.0      Vitis vinifera
gb|KDO77595.1|  hypothetical protein CISIN_1g040700mg                   611   0.0      
ref|XP_007033585.1|  FAD-binding Berberine family protein isoform 2     611   0.0      
ref|XP_003631731.2|  PREDICTED: reticuline oxidase-like protein         610   0.0      
ref|XP_009768974.1|  PREDICTED: reticuline oxidase-like protein         610   0.0      
ref|XP_009603937.1|  PREDICTED: reticuline oxidase-like protein         610   0.0      
ref|XP_006307225.1|  hypothetical protein CARUB_v10008825mg             608   0.0      
ref|XP_009760106.1|  PREDICTED: reticuline oxidase-like protein         605   0.0      
ref|XP_007211821.1|  hypothetical protein PRUPE_ppa004317mg             605   0.0      
ref|XP_002300580.2|  hypothetical protein POPTR_0001s47400g             605   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU19101.1|  hypothetical protein MIMGU_mgv1a004329mg                602   0.0      
ref|XP_011039847.1|  PREDICTED: reticuline oxidase-like protein         601   0.0      
emb|CAN80105.1|  hypothetical protein VITISV_009716                     598   0.0      Vitis vinifera
ref|XP_010648252.1|  PREDICTED: reticuline oxidase-like protein         601   0.0      
ref|XP_010051869.1|  PREDICTED: reticuline oxidase-like protein         601   0.0      
gb|KCW44231.1|  hypothetical protein EUGRSUZ_L02344                     597   0.0      
ref|XP_010051871.1|  PREDICTED: reticuline oxidase-like protein         599   0.0      
ref|XP_010655770.1|  PREDICTED: reticuline oxidase-like protein         598   0.0      
ref|XP_011005333.1|  PREDICTED: reticuline oxidase-like protein         598   0.0      
emb|CDP12590.1|  unnamed protein product                                598   0.0      
ref|XP_010054197.1|  PREDICTED: reticuline oxidase-like protein         598   0.0      
ref|XP_010051873.1|  PREDICTED: reticuline oxidase-like protein         598   0.0      
ref|NP_174357.1|  FAD-binding Berberine family protein                  597   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890889.1|  FAD-binding domain-containing protein              597   0.0      
ref|XP_008225665.1|  PREDICTED: reticuline oxidase-like protein         597   0.0      
ref|XP_007023054.1|  FAD-binding Berberine family protein               595   0.0      
ref|XP_006415434.1|  hypothetical protein EUTSA_v10007341mg             594   0.0      
ref|XP_011096699.1|  PREDICTED: reticuline oxidase-like protein         594   0.0      
ref|XP_009115056.1|  PREDICTED: reticuline oxidase-like protein         594   0.0      
ref|XP_010460877.1|  PREDICTED: reticuline oxidase-like protein         593   0.0      
ref|XP_002299008.1|  hypothetical protein POPTR_0001s46340g             592   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP36345.1|  hypothetical protein JCGZ_09765                         592   0.0      
ref|XP_010478503.1|  PREDICTED: reticuline oxidase-like protein         592   0.0      
ref|XP_008439529.1|  PREDICTED: LOW QUALITY PROTEIN: reticuline o...    591   0.0      
ref|XP_010667051.1|  PREDICTED: reticuline oxidase-like protein         590   0.0      
ref|XP_010499613.1|  PREDICTED: reticuline oxidase-like protein         590   0.0      
gb|AEK87147.1|  berberine bridge enzyme                                 590   0.0      
ref|XP_010051872.1|  PREDICTED: reticuline oxidase-like protein         589   0.0      
emb|CDP12591.1|  unnamed protein product                                589   0.0      
ref|XP_011040560.1|  PREDICTED: reticuline oxidase-like protein         588   0.0      
ref|XP_010499615.1|  PREDICTED: reticuline oxidase-like protein i...    587   0.0      
ref|XP_010460878.1|  PREDICTED: reticuline oxidase-like protein         587   0.0      
ref|XP_007159396.1|  hypothetical protein PHAVU_002G234800g             585   0.0      
ref|XP_011006008.1|  PREDICTED: reticuline oxidase-like protein         585   0.0      
ref|XP_011085609.1|  PREDICTED: reticuline oxidase-like protein         585   0.0      
ref|XP_004504726.1|  PREDICTED: reticuline oxidase-like protein-like    584   0.0      
ref|XP_002317074.2|  FAD-binding domain-containing family protein       583   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007212419.1|  hypothetical protein PRUPE_ppa016588mg             582   0.0      
ref|XP_010478504.1|  PREDICTED: reticuline oxidase-like protein         584   0.0      
ref|XP_002300550.2|  hypothetical protein POPTR_0001s46390g             583   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010435245.1|  PREDICTED: reticuline oxidase-like protein         583   0.0      
ref|XP_004293693.1|  PREDICTED: reticuline oxidase-like protein-like    581   0.0      
gb|KFK44874.1|  hypothetical protein AALP_AA1G313900                    582   0.0      
ref|XP_002523158.1|  Reticuline oxidase precursor, putative             582   0.0      Ricinus communis
ref|XP_009362186.1|  PREDICTED: reticuline oxidase-like protein i...    581   0.0      
ref|XP_004134553.1|  PREDICTED: reticuline oxidase-like protein-like    581   0.0      
ref|XP_009362185.1|  PREDICTED: reticuline oxidase-like protein i...    581   0.0      
gb|KCW75709.1|  hypothetical protein EUGRSUZ_D00086                     580   0.0      
ref|XP_008225664.1|  PREDICTED: reticuline oxidase-like protein         582   0.0      
ref|XP_010054199.1|  PREDICTED: reticuline oxidase-like protein         580   0.0      
ref|XP_002317087.1|  hypothetical protein POPTR_0011s16180g             580   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU29613.1|  hypothetical protein MIMGU_mgv1a004108mg                580   0.0      
ref|XP_011005328.1|  PREDICTED: reticuline oxidase-like protein         579   0.0      
gb|KGN49482.1|  hypothetical protein Csa_6G525670                       580   0.0      
ref|XP_002523157.1|  Reticuline oxidase precursor, putative             578   0.0      Ricinus communis
ref|XP_010098534.1|  Reticuline oxidase-like protein                    578   0.0      
ref|XP_010450189.1|  PREDICTED: reticuline oxidase-like protein         576   0.0      
ref|XP_004162850.1|  PREDICTED: LOW QUALITY PROTEIN: reticuline o...    575   0.0      
ref|XP_006348174.1|  PREDICTED: reticuline oxidase-like protein-like    575   0.0      
ref|XP_010316563.1|  PREDICTED: reticuline oxidase-like protein         575   0.0      
ref|XP_008225669.1|  PREDICTED: reticuline oxidase-like protein         574   0.0      
ref|XP_004134894.1|  PREDICTED: reticuline oxidase-like protein-like    574   0.0      
ref|XP_009795337.1|  PREDICTED: reticuline oxidase-like protein         575   0.0      
gb|EYU43212.1|  hypothetical protein MIMGU_mgv1a021309mg                572   0.0      
emb|CBI31067.3|  unnamed protein product                                573   0.0      
ref|XP_009795338.1|  PREDICTED: reticuline oxidase-like protein         574   0.0      
ref|XP_008225758.1|  PREDICTED: reticuline oxidase-like protein         572   0.0      
ref|XP_006307149.1|  hypothetical protein CARUB_v10008739mg             573   0.0      
ref|XP_010478500.1|  PREDICTED: reticuline oxidase-like protein i...    572   0.0      
ref|XP_010519037.1|  PREDICTED: reticuline oxidase-like protein         572   0.0      
gb|KHN44659.1|  Reticuline oxidase-like protein                         567   0.0      
ref|XP_008228986.1|  PREDICTED: reticuline oxidase-like protein         573   0.0      
ref|XP_007158997.1|  hypothetical protein PHAVU_002G199500g             571   0.0      
ref|XP_004162849.1|  PREDICTED: LOW QUALITY PROTEIN: reticuline o...    571   0.0      
ref|XP_002529891.1|  Reticuline oxidase precursor, putative             570   0.0      Ricinus communis
ref|XP_009362291.1|  PREDICTED: reticuline oxidase-like protein         570   0.0      
emb|CDP21199.1|  unnamed protein product                                570   0.0      
ref|XP_008220339.1|  PREDICTED: reticuline oxidase-like protein         572   0.0      
ref|XP_011040559.1|  PREDICTED: reticuline oxidase-like protein         568   0.0      
ref|XP_009362289.1|  PREDICTED: reticuline oxidase-like protein         568   0.0      
ref|XP_007217492.1|  hypothetical protein PRUPE_ppa026518mg             569   0.0      
ref|XP_008439526.1|  PREDICTED: reticuline oxidase-like protein         569   0.0      
ref|XP_009354038.1|  PREDICTED: reticuline oxidase-like protein         567   0.0      
gb|EYU19102.1|  hypothetical protein MIMGU_mgv1a022353mg                567   0.0      
ref|XP_011005332.1|  PREDICTED: reticuline oxidase-like protein         566   0.0      
ref|XP_003532641.1|  PREDICTED: reticuline oxidase-like protein-like    565   0.0      
gb|KEH31324.1|  reticuline oxidase-like protein                         566   0.0      
ref|XP_002317686.2|  hypothetical protein POPTR_0011s15950g             565   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006360316.1|  PREDICTED: reticuline oxidase-like protein-like    565   0.0      
ref|XP_002277310.1|  PREDICTED: inactive tetrahydrocannabinolic a...    565   0.0      Vitis vinifera
ref|XP_010042218.1|  PREDICTED: reticuline oxidase-like protein         564   0.0      
ref|XP_010657063.1|  PREDICTED: tetrahydrocannabinolic acid synth...    564   0.0      
ref|XP_002299010.2|  hypothetical protein POPTR_0001s46360g             563   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003524102.1|  PREDICTED: reticuline oxidase-like protein-like    565   0.0      
ref|XP_010440562.1|  PREDICTED: reticuline oxidase-like protein         562   0.0      
gb|KHN39155.1|  Reticuline oxidase-like protein                         562   0.0      
ref|XP_006306380.1|  hypothetical protein CARUB_v10012287mg             562   0.0      
ref|XP_009630062.1|  PREDICTED: reticuline oxidase-like protein         563   0.0      
ref|XP_006587985.1|  PREDICTED: reticuline oxidase-like protein-like    559   0.0      
ref|XP_008227084.1|  PREDICTED: reticuline oxidase-like protein         561   0.0      
ref|XP_004504723.1|  PREDICTED: reticuline oxidase-like protein-like    561   0.0      
ref|XP_010053029.1|  PREDICTED: reticuline oxidase-like protein i...    562   0.0      
ref|XP_011039281.1|  PREDICTED: reticuline oxidase-like protein         562   0.0      
ref|XP_008358604.1|  PREDICTED: reticuline oxidase-like protein         561   0.0      
gb|KCW77269.1|  hypothetical protein EUGRSUZ_D01626                     562   0.0      
ref|XP_007213528.1|  hypothetical protein PRUPE_ppa019761mg             560   0.0      
ref|NP_174358.1|  FAD-binding and BBE domain-containing protein         560   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004134895.1|  PREDICTED: reticuline oxidase-like protein-like    560   0.0      
gb|KCW75706.1|  hypothetical protein EUGRSUZ_D00082                     560   0.0      
ref|XP_010053028.1|  PREDICTED: reticuline oxidase-like protein i...    562   0.0      
ref|XP_010053030.1|  PREDICTED: reticuline oxidase-like protein i...    561   0.0      
ref|XP_008225671.1|  PREDICTED: reticuline oxidase-like protein         559   0.0      
ref|XP_007158995.1|  hypothetical protein PHAVU_002G199300g             560   0.0      
ref|XP_009362288.1|  PREDICTED: reticuline oxidase-like protein         558   0.0      
gb|KDO77596.1|  hypothetical protein CISIN_1g015646mg                   554   0.0      
ref|XP_006370482.1|  FAD-binding domain-containing family protein       558   0.0      
ref|XP_008439528.1|  PREDICTED: reticuline oxidase-like protein         559   0.0      
ref|XP_003531233.1|  PREDICTED: reticuline oxidase-like protein-like    558   0.0      
gb|KHN39153.1|  Reticuline oxidase-like protein                         560   0.0      
ref|XP_004504724.1|  PREDICTED: reticuline oxidase-like protein-like    558   0.0      
ref|XP_002300558.2|  hypothetical protein POPTR_0001s46690g             559   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007222484.1|  hypothetical protein PRUPE_ppa004103mg             557   0.0      
ref|XP_006468347.1|  PREDICTED: reticuline oxidase-like protein-l...    558   0.0      
ref|XP_004231557.1|  PREDICTED: reticuline oxidase-like protein         558   0.0      
ref|XP_003532642.1|  PREDICTED: reticuline oxidase-like protein-like    559   0.0      
ref|XP_002890890.1|  FAD-binding domain-containing protein              557   0.0      
ref|XP_007212391.1|  hypothetical protein PRUPE_ppa016294mg             556   0.0      
ref|XP_002299028.2|  hypothetical protein POPTR_0001s46690g             559   0.0      Populus trichocarpa [western balsam poplar]
emb|CDY50727.1|  BnaA05g35540D                                          556   0.0      
gb|KDP36342.1|  hypothetical protein JCGZ_09762                         556   0.0      
ref|XP_007212998.1|  hypothetical protein PRUPE_ppa022785mg             556   0.0      
ref|XP_006468346.1|  PREDICTED: reticuline oxidase-like protein-l...    557   0.0      
ref|XP_003594610.1|  Reticuline oxidase-like protein                    556   0.0      
ref|XP_011085610.1|  PREDICTED: reticuline oxidase-like protein         556   0.0      
ref|XP_009102690.1|  PREDICTED: reticuline oxidase-like protein         555   0.0      
ref|XP_010685243.1|  PREDICTED: reticuline oxidase-like protein         555   0.0      
ref|XP_006448860.1|  hypothetical protein CICLE_v10014748mg             556   0.0      
ref|XP_008225666.1|  PREDICTED: reticuline oxidase-like protein         554   0.0      
ref|XP_010685240.1|  PREDICTED: reticuline oxidase-like protein         554   0.0      
ref|XP_007212909.1|  hypothetical protein PRUPE_ppa022216mg             554   0.0      
emb|CDX77576.1|  BnaA07g07140D                                          554   0.0      
ref|XP_007212681.1|  hypothetical protein PRUPE_ppa018446mg             553   0.0      
ref|XP_002277294.1|  PREDICTED: inactive tetrahydrocannabinolic a...    554   0.0      Vitis vinifera
ref|XP_010463011.1|  PREDICTED: reticuline oxidase-like protein         553   0.0      
ref|XP_006448857.1|  hypothetical protein CICLE_v10014826mg             553   0.0      
ref|XP_007211550.1|  hypothetical protein PRUPE_ppa004087mg             553   0.0      
gb|KHN25855.1|  Reticuline oxidase-like protein                         553   0.0      
ref|XP_007023044.1|  FAD-binding and BBE domain-containing protein      552   0.0      
ref|XP_009353860.1|  PREDICTED: reticuline oxidase-like protein i...    553   0.0      
ref|XP_009115055.1|  PREDICTED: reticuline oxidase-like protein         552   0.0      
emb|CAN63059.1|  hypothetical protein VITISV_004192                     552   0.0      Vitis vinifera
ref|XP_007212705.1|  hypothetical protein PRUPE_ppa018650mg             551   0.0      
ref|XP_009353861.1|  PREDICTED: reticuline oxidase-like protein i...    552   0.0      
gb|KDP36344.1|  hypothetical protein JCGZ_09764                         551   0.0      
ref|XP_007212922.1|  hypothetical protein PRUPE_ppa022296mg             551   0.0      
ref|XP_003534766.1|  PREDICTED: reticuline oxidase-like protein-like    551   0.0      
emb|CAN63058.1|  hypothetical protein VITISV_004191                     551   0.0      Vitis vinifera
emb|CDP12593.1|  unnamed protein product                                550   0.0      
ref|XP_010098533.1|  Reticuline oxidase-like protein                    550   0.0      
ref|XP_008225668.1|  PREDICTED: reticuline oxidase-like protein         550   0.0      
ref|XP_008225667.1|  PREDICTED: reticuline oxidase-like protein         550   0.0      
ref|XP_007158993.1|  hypothetical protein PHAVU_002G199100g             550   0.0      
ref|XP_002275045.1|  PREDICTED: reticuline oxidase-like protein         549   0.0      Vitis vinifera
ref|XP_008439524.1|  PREDICTED: reticuline oxidase-like protein         549   0.0      
gb|EYU43213.1|  hypothetical protein MIMGU_mgv1a021270mg                548   0.0      
ref|XP_009362187.1|  PREDICTED: reticuline oxidase-like protein         549   0.0      
ref|XP_009787052.1|  PREDICTED: cannabidiolic acid synthase-like 1      548   0.0      
gb|KDP34868.1|  hypothetical protein JCGZ_09156                         548   0.0      
gb|KDP34867.1|  hypothetical protein JCGZ_09155                         548   0.0      
ref|XP_006415433.1|  hypothetical protein EUTSA_v10007337mg             546   0.0      
gb|KHN44646.1|  Reticuline oxidase-like protein                         547   0.0      
ref|XP_004505015.1|  PREDICTED: cannabidiolic acid synthase-like        546   0.0      
ref|XP_009362183.1|  PREDICTED: reticuline oxidase-like protein         546   0.0      
ref|XP_010275367.1|  PREDICTED: tetrahydrocannabinolic acid synth...    546   0.0      
ref|XP_003594612.1|  Reticuline oxidase-like protein                    546   0.0      
emb|CAN78950.1|  hypothetical protein VITISV_014049                     546   0.0      Vitis vinifera
ref|XP_010685242.1|  PREDICTED: reticuline oxidase-like protein         546   0.0      
ref|XP_009615787.1|  PREDICTED: cannabidiolic acid synthase-like        546   0.0      
ref|XP_007023055.1|  FAD-binding Berberine family protein               550   0.0      
gb|EPS70047.1|  hypothetical protein M569_04713                         544   0.0      
emb|CDY50728.1|  BnaA05g35550D                                          545   0.0      
ref|NP_564449.1|  FAD-binding and BBE domain-containing protein         545   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003531066.1|  PREDICTED: reticuline oxidase-like protein-like    545   0.0      
ref|XP_007158994.1|  hypothetical protein PHAVU_002G199200g             546   0.0      
ref|XP_010261633.1|  PREDICTED: tetrahydrocannabinolic acid synth...    545   0.0      
ref|XP_009102689.1|  PREDICTED: reticuline oxidase-like protein         544   0.0      
ref|XP_003535121.1|  PREDICTED: reticuline oxidase-like protein-like    544   0.0      
gb|KCW75701.1|  hypothetical protein EUGRSUZ_D00075                     544   0.0      
ref|XP_007147449.1|  hypothetical protein PHAVU_006G125600g             544   0.0      
gb|KFK44875.1|  hypothetical protein AALP_AA1G314000                    543   0.0      
ref|XP_010051868.1|  PREDICTED: reticuline oxidase-like protein         544   0.0      
ref|XP_010501669.1|  PREDICTED: reticuline oxidase-like protein         543   0.0      
gb|KDP34866.1|  hypothetical protein JCGZ_09154                         542   0.0      
ref|XP_004242239.1|  PREDICTED: cannabidiolic acid synthase-like        542   0.0      
ref|XP_004295442.1|  PREDICTED: reticuline oxidase-like protein-like    542   0.0      
ref|XP_008225673.1|  PREDICTED: reticuline oxidase-like protein         541   0.0      
ref|XP_007023056.1|  FAD-binding Berberine family protein               541   0.0      
ref|XP_010685265.1|  PREDICTED: reticuline oxidase-like protein         542   0.0      
ref|XP_006448861.1|  hypothetical protein CICLE_v10017845mg             541   0.0      
ref|XP_009362283.1|  PREDICTED: reticuline oxidase-like protein         536   0.0      
ref|XP_010680366.1|  PREDICTED: reticuline oxidase-like protein         540   0.0      
ref|XP_007023045.1|  FAD-binding and BBE domain-containing protei...    540   0.0      
ref|XP_011037730.1|  PREDICTED: cannabidiolic acid synthase-like        540   0.0      
ref|XP_003532558.1|  PREDICTED: reticuline oxidase-like protein-like    540   0.0      
gb|KHN22988.1|  Reticuline oxidase-like protein                         540   0.0      
ref|XP_011037732.1|  PREDICTED: cannabidiolic acid synthase-like        540   0.0      
ref|XP_011040518.1|  PREDICTED: cannabidiolic acid synthase-like 1      540   0.0      
ref|XP_006468356.1|  PREDICTED: tetrahydrocannabinolic acid synth...    540   0.0      
gb|AAF79255.1|AC023279_4  F12K21.9                                      546   0.0      
ref|XP_006377946.1|  hypothetical protein POPTR_0011s16570g             539   0.0      
gb|EPS70046.1|  hypothetical protein M569_04712                         539   0.0      
ref|XP_010500000.1|  PREDICTED: reticuline oxidase-like protein         539   0.0      
gb|KEH31331.1|  FAD-binding berberine family protein                    559   0.0      
ref|XP_003546281.1|  PREDICTED: reticuline oxidase-like protein-like    538   0.0      
ref|XP_002890891.1|  FAD-binding domain-containing protein              537   0.0      
ref|XP_006356501.1|  PREDICTED: cannabidiolic acid synthase-like        537   0.0      
ref|XP_003608238.1|  Reticuline oxidase-like protein                    537   0.0      
ref|XP_010478505.1|  PREDICTED: reticuline oxidase-like protein         536   0.0      
gb|KHN14306.1|  Reticuline oxidase-like protein                         536   0.0      
ref|XP_007212360.1|  hypothetical protein PRUPE_ppa014683mg             534   0.0      
ref|XP_010686120.1|  PREDICTED: reticuline oxidase-like protein         536   0.0      
gb|KFK31563.1|  hypothetical protein AALP_AA6G128100                    536   0.0      
ref|XP_011039290.1|  PREDICTED: cannabidiolic acid synthase-like 1      536   0.0      
ref|XP_002299022.2|  hypothetical protein POPTR_0001s46620g             536   0.0      
ref|XP_003534781.1|  PREDICTED: reticuline oxidase-like protein-like    536   0.0      
ref|XP_006306030.1|  hypothetical protein CARUB_v10011326mg             536   0.0      
gb|KDO75193.1|  hypothetical protein CISIN_1g037058mg                   536   0.0      
ref|XP_007147450.1|  hypothetical protein PHAVU_006G125700g             536   0.0      
ref|XP_003546282.1|  PREDICTED: reticuline oxidase-like protein-like    536   0.0      
ref|XP_002300557.2|  hypothetical protein POPTR_0001s46580g             535   0.0      
ref|XP_004293696.1|  PREDICTED: reticuline oxidase-like protein-like    535   0.0      
ref|XP_010463136.1|  PREDICTED: reticuline oxidase-like protein         535   0.0      
ref|XP_010478501.1|  PREDICTED: reticuline oxidase-like protein i...    535   0.0      
ref|XP_002299021.2|  hypothetical protein POPTR_0001s46610g             534   0.0      
emb|CAN81410.1|  hypothetical protein VITISV_021349                     530   0.0      
gb|KHN44648.1|  Reticuline oxidase-like protein                         535   0.0      
ref|XP_010478502.1|  PREDICTED: reticuline oxidase-like protein i...    534   0.0      
ref|XP_010480768.1|  PREDICTED: reticuline oxidase-like protein         532   0.0      
ref|XP_006304015.1|  hypothetical protein CARUB_v10011480mg             534   1e-180   
ref|XP_009362290.1|  PREDICTED: reticuline oxidase-like protein         534   1e-180   
ref|XP_010686121.1|  PREDICTED: reticuline oxidase-like protein         533   2e-180   
ref|XP_006415432.1|  hypothetical protein EUTSA_v10009705mg             533   2e-180   
ref|XP_006305939.1|  hypothetical protein CARUB_v10011178mg             533   3e-180   
ref|XP_009613445.1|  PREDICTED: tetrahydrocannabinolic acid synth...    534   3e-180   
ref|XP_010519044.1|  PREDICTED: reticuline oxidase-like protein         533   4e-180   
ref|XP_006427068.1|  hypothetical protein CICLE_v10027115mg             532   5e-180   
ref|XP_006377914.1|  hypothetical protein POPTR_0011s16260g             532   7e-180   
ref|NP_174359.1|  FAD-binding Berberine family protein                  532   8e-180   
gb|ABK94946.1|  unknown                                                 531   1e-179   
gb|KDO48833.1|  hypothetical protein CISIN_1g035812mg                   531   1e-179   
ref|XP_006377944.1|  hypothetical protein POPTR_0011s16550g             531   1e-179   
ref|XP_009780565.1|  PREDICTED: reticuline oxidase-like protein         532   1e-179   
ref|XP_010460880.1|  PREDICTED: reticuline oxidase-like protein         531   2e-179   
ref|XP_006465584.1|  PREDICTED: reticuline oxidase-like protein-like    534   2e-179   
ref|XP_006370772.1|  hypothetical protein POPTR_0001s46640g             530   2e-179   
ref|XP_010098537.1|  Reticuline oxidase-like protein                    531   2e-179   
ref|XP_008441073.1|  PREDICTED: reticuline oxidase-like protein         530   3e-179   
ref|XP_011039288.1|  PREDICTED: tetrahydrocannabinolic acid synth...    531   4e-179   
ref|XP_008445632.1|  PREDICTED: tetrahydrocannabinolic acid synth...    531   4e-179   
ref|XP_004134892.1|  PREDICTED: reticuline oxidase-like protein-like    530   4e-179   
ref|XP_002299020.2|  hypothetical protein POPTR_0001s46600g             530   4e-179   
ref|XP_006377926.1|  hypothetical protein POPTR_0011s16380g             531   4e-179   
ref|XP_010537531.1|  PREDICTED: reticuline oxidase-like protein i...    532   5e-179   
ref|XP_010537539.1|  PREDICTED: reticuline oxidase-like protein i...    531   5e-179   
ref|XP_011078509.1|  PREDICTED: cannabidiolic acid synthase-like 1      530   6e-179   
ref|XP_010449155.1|  PREDICTED: reticuline oxidase-like protein i...    530   6e-179   
ref|XP_011097021.1|  PREDICTED: cannabidiolic acid synthase-like        530   7e-179   
ref|XP_006377916.1|  hypothetical protein POPTR_0011s16280g             530   7e-179   
ref|XP_007217510.1|  hypothetical protein PRUPE_ppa024922mg             530   7e-179   
ref|XP_004162852.1|  PREDICTED: reticuline oxidase-like protein-like    530   8e-179   
ref|XP_010499617.1|  PREDICTED: reticuline oxidase-like protein         529   1e-178   
ref|XP_006285850.1|  hypothetical protein CARUB_v10007331mg             530   1e-178   
ref|XP_006367236.1|  PREDICTED: reticuline oxidase-like protein-like    530   1e-178   
ref|XP_004486487.1|  PREDICTED: reticuline oxidase-like protein-like    529   1e-178   
ref|XP_007213356.1|  hypothetical protein PRUPE_ppa027050mg             528   2e-178   
ref|XP_010276872.1|  PREDICTED: tetrahydrocannabinolic acid synth...    528   2e-178   
ref|XP_004293691.1|  PREDICTED: reticuline oxidase-like protein-like    528   2e-178   
ref|NP_174360.1|  FAD-binding and BBE domain-containing protein         528   2e-178   
ref|XP_007023049.1|  FAD-binding and BBE domain-containing protei...    530   2e-178   
ref|XP_006377921.1|  hypothetical protein POPTR_0011s16330g             528   3e-178   
ref|XP_010449154.1|  PREDICTED: reticuline oxidase-like protein i...    529   3e-178   
ref|XP_010449153.1|  PREDICTED: reticuline oxidase-like protein i...    529   3e-178   
ref|XP_010434267.1|  PREDICTED: reticuline oxidase-like protein         528   3e-178   
ref|XP_011085179.1|  PREDICTED: reticuline oxidase-like protein         528   4e-178   
ref|XP_010463012.1|  PREDICTED: reticuline oxidase-like protein         527   6e-178   
ref|XP_006377947.1|  hypothetical protein POPTR_0011s16580g             527   6e-178   
ref|XP_009148512.1|  PREDICTED: reticuline oxidase-like protein         527   6e-178   
ref|XP_009362287.1|  PREDICTED: reticuline oxidase-like protein         528   6e-178   
ref|XP_009791203.1|  PREDICTED: tetrahydrocannabinolic acid synth...    527   9e-178   
ref|XP_006427069.1|  hypothetical protein CICLE_v10027503mg             526   9e-178   
emb|CDX97984.1|  BnaA06g07350D                                          526   9e-178   
ref|XP_011078508.1|  PREDICTED: cannabidiolic acid synthase-like        527   9e-178   
emb|CDY49803.1|  BnaCnng18160D                                          526   1e-177   
ref|XP_010261630.1|  PREDICTED: tetrahydrocannabinolic acid synth...    526   1e-177   
ref|XP_004486488.1|  PREDICTED: reticuline oxidase-like protein-like    526   3e-177   
ref|XP_002890892.1|  FAD-binding domain-containing protein              525   3e-177   
ref|XP_010478506.1|  PREDICTED: reticuline oxidase-like protein         525   3e-177   
ref|XP_006415431.1|  hypothetical protein EUTSA_v10007354mg             525   4e-177   
ref|XP_002523154.1|  Reticuline oxidase precursor, putative             525   4e-177   
ref|XP_004247512.1|  PREDICTED: reticuline oxidase-like protein         526   4e-177   
ref|XP_002317088.2|  hypothetical protein POPTR_0011s16190g             525   4e-177   
ref|XP_004295437.1|  PREDICTED: reticuline oxidase-like protein-like    534   6e-177   
ref|XP_008383450.1|  PREDICTED: reticuline oxidase-like protein         525   8e-177   
ref|XP_011096702.1|  PREDICTED: tetrahydrocannabinolic acid synth...    524   8e-177   
ref|XP_004135724.1|  PREDICTED: reticuline oxidase-like protein-like    525   9e-177   
ref|XP_003608243.1|  Reticuline oxidase-like protein                    523   1e-176   
ref|XP_010501432.1|  PREDICTED: reticuline oxidase-like protein         524   1e-176   
ref|XP_010261629.1|  PREDICTED: inactive tetrahydrocannabinolic a...    523   1e-176   
gb|KFK44884.1|  hypothetical protein AALP_AA1G315500                    523   3e-176   
ref|XP_006465585.1|  PREDICTED: reticuline oxidase-like protein-like    523   3e-176   
ref|XP_011037734.1|  PREDICTED: cannabidiolic acid synthase-like 1      523   3e-176   
ref|XP_003638113.1|  Reticuline oxidase                                 523   4e-176   
ref|XP_011037721.1|  PREDICTED: cannabidiolic acid synthase-like 1      523   4e-176   
ref|XP_011097020.1|  PREDICTED: cannabidiolic acid synthase-like        523   5e-176   
ref|XP_011096883.1|  PREDICTED: tetrahydrocannabinolic acid synth...    523   5e-176   
gb|AGL44335.1|  FAD-dependent oxidoreductase                            522   5e-176   
ref|XP_010501670.1|  PREDICTED: reticuline oxidase-like protein         522   6e-176   
ref|XP_004135722.1|  PREDICTED: reticuline oxidase-like protein-like    522   6e-176   
ref|XP_011005994.1|  PREDICTED: tetrahydrocannabinolic acid synth...    522   6e-176   
ref|XP_008445653.1|  PREDICTED: tetrahydrocannabinolic acid synth...    522   6e-176   
ref|XP_011005993.1|  PREDICTED: tetrahydrocannabinolic acid synth...    522   7e-176   
emb|CAN81654.1|  hypothetical protein VITISV_003756                     522   7e-176   
ref|XP_008439530.1|  PREDICTED: reticuline oxidase-like protein         522   7e-176   
ref|XP_011006017.1|  PREDICTED: cannabidiolic acid synthase-like 1      521   8e-176   
ref|XP_011013628.1|  PREDICTED: tetrahydrocannabinolic acid synth...    521   1e-175   
ref|XP_004242238.1|  PREDICTED: inactive tetrahydrocannabinolic a...    521   1e-175   
ref|XP_010462643.1|  PREDICTED: reticuline oxidase-like protein         521   1e-175   
ref|XP_010052550.1|  PREDICTED: cannabidiolic acid synthase-like 2      521   2e-175   
ref|XP_006417310.1|  hypothetical protein EUTSA_v10007344mg             520   3e-175   
ref|XP_006377945.1|  hypothetical protein POPTR_0011s16560g             520   3e-175   
ref|XP_002299025.2|  hypothetical protein POPTR_0001s46650g             518   4e-175   
gb|AGL44336.1|  FAD-dependent oxidoreductase                            520   4e-175   
ref|XP_009624111.1|  PREDICTED: tetrahydrocannabinolic acid synth...    520   5e-175   
ref|XP_006304944.1|  hypothetical protein CARUB_v10011431mg             520   5e-175   
gb|KEH30985.1|  FAD-binding berberine family protein                    520   6e-175   
ref|XP_006377943.1|  hypothetical protein POPTR_0011s16540g             520   6e-175   
ref|XP_006413851.1|  hypothetical protein EUTSA_v10027426mg             520   6e-175   
ref|XP_006377923.1|  hypothetical protein POPTR_0011s16350g             520   7e-175   
ref|XP_002523160.1|  Reticuline oxidase precursor, putative             520   7e-175   
ref|XP_002299045.1|  hypothetical protein POPTR_0001s46910g             519   7e-175   
ref|XP_011096885.1|  PREDICTED: cannabidiolic acid synthase-like        519   1e-174   
ref|XP_011037731.1|  PREDICTED: tetrahydrocannabinolic acid synth...    519   1e-174   
ref|XP_006377917.1|  hypothetical protein POPTR_0011s16290g             519   1e-174   
emb|CDP12589.1|  unnamed protein product                                519   1e-174   
ref|XP_007023066.1|  FAD-binding Berberine family protein isoform 1     518   1e-174   
ref|XP_010052547.1|  PREDICTED: cannabidiolic acid synthase-like 2      518   2e-174   
ref|XP_010476115.1|  PREDICTED: reticuline oxidase-like protein         518   2e-174   
ref|XP_002268361.1|  PREDICTED: tetrahydrocannabinolic acid synthase    518   3e-174   
ref|XP_007159248.1|  hypothetical protein PHAVU_002G221800g             517   3e-174   
emb|CDY02318.1|  BnaA09g25840D                                          516   4e-174   
gb|KDP34617.1|  hypothetical protein JCGZ_11140                         517   4e-174   
ref|XP_011040519.1|  PREDICTED: cannabidiolic acid synthase-like        517   5e-174   
ref|XP_010051866.1|  PREDICTED: cannabidiolic acid synthase-like 2      517   6e-174   
ref|XP_011013934.1|  PREDICTED: tetrahydrocannabinolic acid synth...    517   6e-174   
gb|KCW75697.1|  hypothetical protein EUGRSUZ_D00070                     517   8e-174   
ref|XP_007147447.1|  hypothetical protein PHAVU_006G125400g             517   9e-174   
gb|EYU43214.1|  hypothetical protein MIMGU_mgv1a026362mg                516   1e-173   
ref|NP_193816.1|  FAD-binding and BBE domain-containing protein         516   1e-173   
ref|XP_007023058.1|  FAD-binding Berberine family protein               517   1e-173   
ref|XP_004504722.1|  PREDICTED: tetrahydrocannabinolic acid synth...    516   1e-173   
gb|KHN00106.1|  Reticuline oxidase-like protein                         514   1e-173   
ref|XP_006377933.1|  FAD-binding domain-containing family protein       515   1e-173   
ref|XP_004134554.1|  PREDICTED: reticuline oxidase-like protein-like    516   1e-173   
ref|XP_004158101.1|  PREDICTED: reticuline oxidase-like protein-like    515   2e-173   
ref|XP_002299035.1|  hypothetical protein POPTR_0001s46760g             516   2e-173   
ref|XP_010680781.1|  PREDICTED: reticuline oxidase-like protein         516   2e-173   
ref|XP_003637344.1|  Reticuline oxidase-like protein                    516   2e-173   
emb|CDY09547.1|  BnaC05g23720D                                          515   2e-173   
ref|XP_009353859.1|  PREDICTED: tetrahydrocannabinolic acid synth...    515   3e-173   
gb|KEH25324.1|  FAD-binding berberine family protein                    515   3e-173   
ref|XP_006305964.1|  hypothetical protein CARUB_v10011221mg             515   3e-173   
ref|XP_002889895.1|  hypothetical protein ARALYDRAFT_471318             515   4e-173   
ref|XP_003534782.1|  PREDICTED: reticuline oxidase-like protein-like    514   6e-173   
ref|XP_007045724.1|  FAD-binding Berberine family protein               514   6e-173   
ref|XP_009115054.1|  PREDICTED: reticuline oxidase-like protein         514   7e-173   
gb|KDO75187.1|  hypothetical protein CISIN_1g048392mg                   513   9e-173   
ref|XP_006448851.1|  hypothetical protein CICLE_v10014802mg             514   9e-173   
ref|XP_002317084.1|  hypothetical protein POPTR_0011s16140g             513   1e-172   
gb|AGL44331.1|  FAD-dependent oxidoreductase                            513   1e-172   
ref|NP_172642.3|  FAD-binding and BBE domain-containing protein         514   1e-172   
ref|XP_007023061.1|  FAD-binding Berberine family protein               514   1e-172   
ref|XP_011037728.1|  PREDICTED: cannabidiolic acid synthase-like ...    514   1e-172   
ref|XP_004505014.1|  PREDICTED: reticuline oxidase-like protein-like    513   1e-172   
ref|XP_006468358.1|  PREDICTED: cannabidiolic acid synthase-like ...    514   1e-172   
ref|XP_004134893.1|  PREDICTED: reticuline oxidase-like protein-like    512   1e-172   
ref|XP_008225658.1|  PREDICTED: tetrahydrocannabinolic acid synth...    513   1e-172   
ref|XP_006352996.1|  PREDICTED: cannabidiolic acid synthase-like        513   2e-172   
dbj|BAL46501.1|  carbohydrate                                           513   2e-172   
gb|KDP36346.1|  hypothetical protein JCGZ_09766                         513   2e-172   
ref|XP_007023036.1|  FAD-binding Berberine family protein               513   2e-172   
ref|XP_004162839.1|  PREDICTED: reticuline oxidase-like protein-like    513   2e-172   
gb|KEH30013.1|  FAD-binding berberine family protein                    512   2e-172   
emb|CDP12588.1|  unnamed protein product                                513   3e-172   
ref|XP_009362193.1|  PREDICTED: tetrahydrocannabinolic acid synth...    513   3e-172   
ref|XP_007023064.1|  FAD-binding Berberine family protein               513   3e-172   
ref|XP_010052551.1|  PREDICTED: tetrahydrocannabinolic acid synth...    513   4e-172   
ref|XP_010479531.1|  PREDICTED: reticuline oxidase-like protein         512   6e-172   
gb|KEH31323.1|  reticuline oxidase-like protein                         512   7e-172   
ref|XP_002889343.1|  ATSEC1A                                            512   9e-172   
gb|KHN44649.1|  Reticuline oxidase-like protein                         513   1e-171   
ref|XP_002869923.1|  FAD-binding domain-containing protein              511   1e-171   
gb|KDO77597.1|  hypothetical protein CISIN_1g009115mg                   511   1e-171   
ref|XP_008446963.1|  PREDICTED: tetrahydrocannabinolic acid synth...    511   1e-171   
emb|CDY71012.1|  BnaAnng35830D                                          511   1e-171   
ref|XP_010261632.1|  PREDICTED: tetrahydrocannabinolic acid synth...    511   1e-171   
ref|XP_003532638.2|  PREDICTED: cannabidiolic acid synthase-like ...    511   2e-171   
ref|XP_006418476.1|  hypothetical protein EUTSA_v10007313mg             511   2e-171   
ref|XP_002523167.1|  Reticuline oxidase precursor, putative             510   2e-171   



>emb|CDP12594.1| unnamed protein product [Coffea canephora]
Length=532

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/506 (72%), Positives = 429/506 (85%), Gaps = 5/506 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL   S+P+  IS VIYTPNN SF +VLQ YIRNLRFNES T+KP  I+TA  +SH
Sbjct  31    TFVQCLEKHSSPN--ISAVIYTPNNSSFPTVLQAYIRNLRFNESTTRKPFLILTALDVSH  88

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQA+I+CAK  GLQMK RSGGHDYEGVSY+S+VPFFILD+FN RS++V+IE+ETAWV+ G
Sbjct  89    IQAAIICAKAQGLQMKTRSGGHDYEGVSYISEVPFFILDLFNIRSISVNIEEETAWVQVG  148

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY I  KS VHGFPAGVCPTVGVGGHF G GYGNMMRKYGL+VDNIIDA++IDV
Sbjct  149   ATLGEVYYRIYEKSKVHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLSVDNIIDAQIIDV  208

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGR+LDR +MGE+LFWAITGGGASSF V L+Y+INLVRVPPKVT+F V RTY+QNAT +V
Sbjct  209   NGRILDRAAMGEDLFWAITGGGASSFGVALAYKINLVRVPPKVTVFRVERTYEQNATFLV  268

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             + +Q ++ KLD ++FIR+ +DVVN     G KTIR+ F  LFLGDS  LLS M+ESFPEL
Sbjct  269   HRWQEVADKLDNDIFIRMIIDVVN-NNRTGGKTIRSAFFTLFLGDSARLLSLMNESFPEL  327

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL QSDC EM W ESV++YTSFP GTPV+ LLSRVPQVL HLKRKSDYL+ PMP  GIEF
Sbjct  328   GLRQSDCIEMSWAESVIYYTSFPLGTPVDMLLSRVPQVLTHLKRKSDYLKKPMPIEGIEF  387

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             IFKKM+ELQTP+LTFNPYGGRMAEIP++AKPFPHR+GNIA IQYATNWD++G + A++Y+
Sbjct  388   IFKKMIELQTPVLTFNPYGGRMAEIPASAKPFPHRAGNIAKIQYATNWDQNGVQTAEYYI  447

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              +TR L++YMTPFVSK PREAFLNYRDLD+GI HN   + SY EG  YG+KYFKEN+NRL
Sbjct  448   NLTRALHKYMTPFVSKFPREAFLNYRDLDIGITHNG--KNSYAEGLVYGIKYFKENFNRL  505

Query  1579  VKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             VK+KT VDPDNFFR+EQ+IP  P RK
Sbjct  506   VKVKTAVDPDNFFRNEQTIPVSPSRK  531



>ref|XP_002269462.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=531

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/512 (70%), Positives = 426/512 (83%), Gaps = 3/512 (1%)
 Frame = +1

Query  112   WAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLF  291
             WA         L+CL+ RS  SHPIS V+YTP+N S+SSVL+ YIRNLRFN S T KP  
Sbjct  22    WAASDSVHGAFLQCLSTRSQSSHPISAVLYTPDNSSYSSVLESYIRNLRFNTSATLKPRL  81

Query  292   IVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIE  471
             I+TATH SHI+A+I+C+K+HGLQMK RSGGHDYEGVSYVSDVPFFILDMFN RS++V IE
Sbjct  82    IITATHESHIKAAIICSKKHGLQMKIRSGGHDYEGVSYVSDVPFFILDMFNLRSISVDIE  141

Query  472   DETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDN  651
             DE+AWV+AGATLGE+YY IA KS  HGFPAGVCPTVG GGHF G GYGNMMRKYGL+VDN
Sbjct  142   DESAWVQAGATLGEIYYRIAEKSKTHGFPAGVCPTVGAGGHFSGGGYGNMMRKYGLSVDN  201

Query  652   IIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRT  831
             I+DA+L+DVNGRLL+RKSMGE+LFWAI GGG +S+ V++SY+I LV+VP  VT+F V RT
Sbjct  202   IVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPATVTVFRVART  261

Query  832   YDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLS  1011
              +QN TNIVY +Q+++ K+D +LFIRLT+DVVN ++  GEKT+RATF +LFLG S+ LLS
Sbjct  262   LEQNTTNIVYQWQQVADKVDDDLFIRLTMDVVN-SSRSGEKTVRATFLSLFLGSSERLLS  320

Query  1012  TMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQT  1191
              M+ S PELGL  SDC EM W+ESVLF+T+F  GTPVE LL R PQVL HLKRKSDYL+ 
Sbjct  321   IMNTSLPELGLQSSDCTEMSWVESVLFWTNFAIGTPVEALLDRNPQVLTHLKRKSDYLKE  380

Query  1192  PMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEH  1371
             P+P+ G+E I+KKM+ELQTP LTFNPYGG+MAEI  +A PFPHR+GN+  IQYATNWDE 
Sbjct  381   PIPKAGLEGIWKKMIELQTPALTFNPYGGKMAEISPSATPFPHRAGNLCKIQYATNWDEE  440

Query  1372  GYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLK  1551
             G EAA+ Y+ +TRQLY YMTPFVSK PREAFLNYRDLDLGINHN   + SY EG+ YG+K
Sbjct  441   GSEAAERYINLTRQLYSYMTPFVSKFPREAFLNYRDLDLGINHNG--KNSYLEGRVYGIK  498

Query  1552  YFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             YFK+N+NRLV+IKTKVDP NFFR+EQSIPT P
Sbjct  499   YFKKNFNRLVRIKTKVDPGNFFRNEQSIPTLP  530



>gb|KDP36348.1| hypothetical protein JCGZ_09768 [Jatropha curcas]
Length=533

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/503 (72%), Positives = 423/503 (84%), Gaps = 3/503 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T++ECL   S  S+PIS  IYTP N S+SSVLQ YIRNLRFNES T+KPL IVTA H SH
Sbjct  30    TIIECLLTHSQSSNPISNAIYTPKNTSYSSVLQTYIRNLRFNESTTRKPLLIVTALHESH  89

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QASI+CA++HGLQMK RSGGHDYEG+SYVS VPFFILDMFN R + V +  ETAWVEAG
Sbjct  90    VQASIICARKHGLQMKIRSGGHDYEGISYVSIVPFFILDMFNLRKIEVDVVSETAWVEAG  149

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY I NKSN+HGFPAGVCPTVGVGGHFGG GYGNMMRKYGL+VDNIIDAKLIDV
Sbjct  150   ATLGEVYYNIGNKSNIHGFPAGVCPTVGVGGHFGGGGYGNMMRKYGLSVDNIIDAKLIDV  209

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGRLLDRKSMGE+LFWAITGGG +S+ VV++Y+I +VRVP  VT+F V+RT +QN T+IV
Sbjct  210   NGRLLDRKSMGEDLFWAITGGGGASYGVVIAYKIKIVRVPEIVTVFRVQRTQEQNVTDIV  269

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q+++ K+D +LF+R+T DV+N T   G KTIRAT  ALFLGDS  LLS ++   P+L
Sbjct  270   YQWQQIAPKIDDDLFLRVTFDVINSTQGSG-KTIRATLRALFLGDSTKLLSIINAKLPQL  328

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL QS+C EM W+ESVLF+T F  GTP   LLSR PQVL HLKRKSDY+Q P+PRNG+E 
Sbjct  329   GLIQSECIEMSWLESVLFWTDFSLGTPTTALLSRTPQVLTHLKRKSDYVQEPIPRNGLES  388

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+KKM+ELQ P LTFNPYGG+MAEIP+ AKPFPHR+GN+  IQYATNW+E G EAA  Y+
Sbjct  389   IWKKMIELQVPQLTFNPYGGKMAEIPADAKPFPHRAGNLWKIQYATNWNEDGTEAANRYI  448

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              +TRQLY +MTPFVSKNPR AFLNYRDLDLGINHN G+R SY EG+ YG+KYFK+N+NRL
Sbjct  449   NLTRQLYNFMTPFVSKNPRAAFLNYRDLDLGINHN-GKR-SYLEGRVYGIKYFKDNFNRL  506

Query  1579  VKIKTKVDPDNFFRDEQSIPTFP  1647
             VKIKTKVDP NFFR+EQSIPTFP
Sbjct  507   VKIKTKVDPGNFFRNEQSIPTFP  529



>emb|CAN80091.1| hypothetical protein VITISV_015121 [Vitis vinifera]
Length=531

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/512 (70%), Positives = 426/512 (83%), Gaps = 3/512 (1%)
 Frame = +1

Query  112   WAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLF  291
             WA         L+CL+  S  SHPIS V+YTP+N S+SSVL+ YIRNLRFN S T KP  
Sbjct  22    WAASDSVHGAFLQCLSTHSQSSHPISAVLYTPDNSSYSSVLESYIRNLRFNTSATPKPRL  81

Query  292   IVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIE  471
             I+TATH SHI+A+I+C+K+HGLQMK RSGGHDYEGVSYVSDVPFFILDMFN RS++V IE
Sbjct  82    IITATHESHIKAAIICSKKHGLQMKIRSGGHDYEGVSYVSDVPFFILDMFNLRSISVDIE  141

Query  472   DETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDN  651
             DE+AWV+AGATLGE+YY IA KS  HGFPAGVCPTVG GGHF G GYGNMMRKYGL+VDN
Sbjct  142   DESAWVQAGATLGEIYYRIAEKSKTHGFPAGVCPTVGAGGHFSGGGYGNMMRKYGLSVDN  201

Query  652   IIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRT  831
             I+DA+L+DVNGRLL+RKSMGE+LFWAI GGG +S+ V++SY+I LV+VP  VT+F V RT
Sbjct  202   IVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPATVTVFRVART  261

Query  832   YDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLS  1011
              +QNATNIVY +Q+++ K+D +LFIRLT+DVVN ++  GEKT+RATF +LFLG S+ LLS
Sbjct  262   LEQNATNIVYQWQQVADKVDDDLFIRLTMDVVN-SSRSGEKTVRATFLSLFLGSSERLLS  320

Query  1012  TMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQT  1191
              M+ S PELGL  SDC EM W+ESVLF+T+F  GTPVE LL R PQVL HLKRKSDYL+ 
Sbjct  321   IMNTSLPELGLQSSDCTEMSWVESVLFWTNFAIGTPVEALLDRNPQVLTHLKRKSDYLKE  380

Query  1192  PMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEH  1371
             P+P+ G+E I+KKM+ELQTP LTFNPYGG+MAEI  +A PFPHR+GN+  IQYATNWDE 
Sbjct  381   PIPKAGLEGIWKKMIELQTPALTFNPYGGKMAEISPSATPFPHRAGNLCKIQYATNWDEE  440

Query  1372  GYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLK  1551
             G EAA+ Y+ +TRQLY YMTPFVSK PREAFLNYRDLDLGINHN   + SY EG+ YG+K
Sbjct  441   GSEAAERYINLTRQLYSYMTPFVSKFPREAFLNYRDLDLGINHNG--KNSYLEGRVYGIK  498

Query  1552  YFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             YFK+N+NRLV+IKTKVDP NFFR+EQSIPT P
Sbjct  499   YFKKNFNRLVRIKTKVDPGNFFRNEQSIPTLP  530



>emb|CAN60572.1| hypothetical protein VITISV_000229 [Vitis vinifera]
Length=531

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/512 (70%), Positives = 426/512 (83%), Gaps = 3/512 (1%)
 Frame = +1

Query  112   WAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLF  291
             WA         L+CL+  S  SHPIS V+YTP+N S+SSVL+ YIRNLRFN S T KP  
Sbjct  22    WAASDSVHGAFLQCLSTHSQSSHPISAVLYTPDNSSYSSVLESYIRNLRFNTSTTPKPRL  81

Query  292   IVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIE  471
             I+TATH SHI+A+++C+K+HGLQMK RSGGHDYEGVSYVSDVPFFILDMFN RS++V IE
Sbjct  82    IITATHESHIKAALICSKKHGLQMKIRSGGHDYEGVSYVSDVPFFILDMFNLRSISVDIE  141

Query  472   DETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDN  651
             DE+AWV+AGATLGE+YY IA KS +HGFPAGVCP VG GGHF G GYGNMMRKYGL+VDN
Sbjct  142   DESAWVQAGATLGEIYYRIAEKSKIHGFPAGVCPRVGAGGHFSGGGYGNMMRKYGLSVDN  201

Query  652   IIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRT  831
             I+DA+L+DVNGRLL+RKSMGE+LFWAI GGG +S+ V++SY+I LV+VP  VT+F V RT
Sbjct  202   IVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPDTVTVFRVART  261

Query  832   YDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLS  1011
              +QNATNIVY +Q+++ K+D +LFIRLT+DVVN  +  GEKT+RATF +LFLG S+ LLS
Sbjct  262   LEQNATNIVYQWQQVADKVDGDLFIRLTMDVVN-RSRSGEKTVRATFRSLFLGSSERLLS  320

Query  1012  TMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQT  1191
              M+ S PELGL  SDC EM W+ESVLF+T+F +GTPVE LL R PQVL HLKRKSDYL+ 
Sbjct  321   IMNTSLPELGLQSSDCTEMSWVESVLFWTNFATGTPVEALLDRKPQVLTHLKRKSDYLKE  380

Query  1192  PMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEH  1371
             P+P+ G+E I+KKM+ELQTP L FNPYGG+MAEI  +A PFPHR+GN+  IQYATNWDE 
Sbjct  381   PIPKAGLEGIWKKMIELQTPALAFNPYGGKMAEISPSATPFPHRAGNLCKIQYATNWDEE  440

Query  1372  GYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLK  1551
             G EAA+ Y+ +TRQLY YMTPFVSK+PREAFLNYRDLDLGINHN   + SY EG+ YG+K
Sbjct  441   GSEAAERYINLTRQLYSYMTPFVSKSPREAFLNYRDLDLGINHNG--KNSYLEGRVYGIK  498

Query  1552  YFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             YFK+N+NRLV+IKTKVDP NFFR+EQSIPT P
Sbjct  499   YFKKNFNRLVRIKTKVDPGNFFRNEQSIPTLP  530



>ref|XP_004295451.1| PREDICTED: reticuline oxidase-like protein-like [Fragaria vesca 
subsp. vesca]
Length=534

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/502 (70%), Positives = 430/502 (86%), Gaps = 3/502 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             + CL   S PSHPI P IYTPNN S+SSVL+ YIRNLRFNESYT+KP  I+TA H+SH+Q
Sbjct  34    VSCLLSHSLPSHPIGPAIYTPNNASYSSVLESYIRNLRFNESYTRKPYLIITALHVSHVQ  93

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
               ILCA++H LQMK RSGGHDYEGVSYV++VPFFILD+FN R++NV I+ ETAWV+AGAT
Sbjct  94    QVILCAQKHNLQMKIRSGGHDYEGVSYVAEVPFFILDLFNLRTINVDIKTETAWVQAGAT  153

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY I  KS VHGFPAGVCPTVGVGG F G GYG M+RKYGL+VDNI+DA+++DV+G
Sbjct  154   LGEVYYRIHEKSKVHGFPAGVCPTVGVGGLFSGGGYGVMLRKYGLSVDNIVDAQIVDVHG  213

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             RLLDRKSMGE+LFWAITGGG +SF VV++Y+INLV VP  VT+F V RT +QNAT+IVY 
Sbjct  214   RLLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVPVPETVTVFKVIRTLEQNATDIVYH  273

Query  865   YQRMSHKLDPNLFIRLTVDVVNIT-THPGEKTIRATFNALFLGDSKTLLSTMDESFPELG  1041
             +Q ++HKLD +LFIRLT+DVVN+T +  GEKT+RATF ALFLGDS  LLS M++SFPELG
Sbjct  274   WQYVAHKLDNDLFIRLTMDVVNVTGSQTGEKTLRATFMALFLGDSARLLSVMNKSFPELG  333

Query  1042  LTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
             L QSDC+EM W+ES LF+TSFP+GT ++ LL R PQVL HLKRKSDY++ P+P+ G+++I
Sbjct  334   LKQSDCQEMSWVESTLFWTSFPNGTALDALLRRDPQVLTHLKRKSDYVKQPIPKAGLKWI  393

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
              +KM+ELQTPMLTFNPYGGRMAEI ++AKPFPHR+GN+  +QYATNW+  G EAA+ Y++
Sbjct  394   IQKMIELQTPMLTFNPYGGRMAEIAASAKPFPHRAGNLWKVQYATNWNASGSEAAEKYID  453

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
             +TR+L++YMTPFVSKNPREAF NY+DLD+GINHN   + SYFEG+ YG+KYFKEN+++LV
Sbjct  454   LTRKLFKYMTPFVSKNPREAFFNYKDLDIGINHND--KGSYFEGRVYGVKYFKENFDKLV  511

Query  1582  KIKTKVDPDNFFRDEQSIPTFP  1647
              IKTKVDP NFFR+EQSIPT P
Sbjct  512   LIKTKVDPGNFFRNEQSIPTLP  533



>ref|XP_009803657.1| PREDICTED: reticuline oxidase-like protein [Nicotiana sylvestris]
Length=531

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/507 (71%), Positives = 420/507 (83%), Gaps = 4/507 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T LECL   SNPSHPIS ++Y+PNN SF SVLQ YIRNLRFNES T KPLFI+TA H SH
Sbjct  28    TFLECLKTNSNPSHPISSLVYSPNNSSFPSVLQAYIRNLRFNESTTNKPLFILTALHESH  87

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQA+I+CAK  GLQMK RSGGHDYEG+SY+SDVPFFILDMFNFRS+NV+I+DE+AWVE G
Sbjct  88    IQAAIICAKAQGLQMKIRSGGHDYEGLSYISDVPFFILDMFNFRSINVNIDDESAWVEVG  147

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KSNVHGFPAGVCPTVGVGGH  G GYGNMMRKYGLTVDNI+DAKLIDV
Sbjct  148   ATLGEVYYRIAEKSNVHGFPAGVCPTVGVGGHISGGGYGNMMRKYGLTVDNIVDAKLIDV  207

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GR+LDRK MGE+LFWAI+GGG +SF V+LSY+I LVRVPPKVT+F V R YDQNA  + 
Sbjct  208   QGRILDRKLMGEDLFWAISGGGGASFGVLLSYKIKLVRVPPKVTVFRVPRLYDQNALELA  267

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +QR + K D ++F+RL +DVVN TT P EKTIR +F  LFLGDSK L+S M+E+FPEL
Sbjct  268   YLWQRRADKWDDDMFMRLIIDVVNSTTRPTEKTIRVSFFTLFLGDSKQLVSFMNENFPEL  327

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL Q D  EM W+ESVL+YTSFP   P++ LL R P  + +LKRKSDYL+ PM + G+E+
Sbjct  328   GLQQKDITEMSWVESVLYYTSFPIA-PIDALLRRQPPSVTYLKRKSDYLKKPMSKEGLEY  386

Query  1219  IFKKMVELQTP-MLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
             IFKKM+ELQTP +LTFNPYGG+M+EI  +AKPFPHR+GNIA IQY+TNW+E G EAA HY
Sbjct  387   IFKKMIELQTPTILTFNPYGGKMSEISPSAKPFPHRAGNIAKIQYSTNWNEGGVEAANHY  446

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L +TR LY YMTPFVSK PR AF NYRD+DLG+ HN   + SY EG+ YG+KYF  N+NR
Sbjct  447   LNLTRVLYNYMTPFVSKYPRAAFFNYRDIDLGVTHNG--KFSYLEGRVYGIKYFLGNFNR  504

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             LVKIKTKVDPDNFFR+EQSIP +P RK
Sbjct  505   LVKIKTKVDPDNFFRNEQSIPVYPWRK  531



>ref|XP_002270585.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=531

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/512 (69%), Positives = 425/512 (83%), Gaps = 3/512 (1%)
 Frame = +1

Query  112   WAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLF  291
             WA         L+CL+  S  SHPIS V+YTP+N S+SSVL+ YIRNLRFN S T KP  
Sbjct  22    WAASDSVHGAFLQCLSTHSQSSHPISAVLYTPDNSSYSSVLESYIRNLRFNTSTTPKPRL  81

Query  292   IVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIE  471
             I+TATH SHI+A+++C+K+HGLQMK RSGGHDYEGVSYVSDVPFFILDMFN RS++V IE
Sbjct  82    IITATHESHIKAALICSKKHGLQMKIRSGGHDYEGVSYVSDVPFFILDMFNLRSISVDIE  141

Query  472   DETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDN  651
             DE+AWV+AGATLGE+YY IA KS +HGF AGVCP VG GGHF G GYGNMMRKYGL+VDN
Sbjct  142   DESAWVQAGATLGEIYYRIAEKSKIHGFSAGVCPRVGAGGHFSGGGYGNMMRKYGLSVDN  201

Query  652   IIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRT  831
             I+DA+L+DVNGRLL+RKSMGE+LFWAI GGG +S+ V++SY+I LV+VP  VT+F V RT
Sbjct  202   IVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPDTVTVFRVART  261

Query  832   YDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLS  1011
              +QNATNIVY +Q+++ K+D +LFIRLT+DVVN  +  GEKT+RATF +LFLG S+ LLS
Sbjct  262   LEQNATNIVYQWQQVADKVDGDLFIRLTMDVVN-RSRSGEKTVRATFRSLFLGSSERLLS  320

Query  1012  TMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQT  1191
              M+ S PELGL  SDC EM W+ESVLF+T+F +GTPVE LL R PQVL HLKRKSDYL+ 
Sbjct  321   IMNTSLPELGLQSSDCTEMSWVESVLFWTNFATGTPVEALLDRKPQVLTHLKRKSDYLKE  380

Query  1192  PMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEH  1371
             P+P+ G+E I+KKM+ELQTP L FNPYGG+MAEI  +A PFPHR+GN+  IQYATNWDE 
Sbjct  381   PIPKAGLEGIWKKMIELQTPALAFNPYGGKMAEISPSATPFPHRAGNLCKIQYATNWDEE  440

Query  1372  GYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLK  1551
             G EAA+ Y+ +TRQLY YMTPFVSK+PREAFLNYRDLDLGINHN   + SY EG+ YG+K
Sbjct  441   GSEAAERYINLTRQLYSYMTPFVSKSPREAFLNYRDLDLGINHNG--KNSYLEGRVYGIK  498

Query  1552  YFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             YFK+N+NRLV+IKTKVDP NFFR+EQSIPT P
Sbjct  499   YFKKNFNRLVRIKTKVDPGNFFRNEQSIPTLP  530



>ref|XP_008225674.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=535

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/514 (67%), Positives = 428/514 (83%), Gaps = 1/514 (0%)
 Frame = +1

Query  109   AWAPLCYCA-TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKP  285
             +W    Y A    ++CL + S PSHPI P IYTPNN S+SSVL+ YIRNLRFN S T+KP
Sbjct  21    SWQASAYSAPEKFVQCLLNHSQPSHPIGPAIYTPNNASYSSVLESYIRNLRFNTSSTRKP  80

Query  286   LFIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVS  465
               IVTA H SH+Q S++CA+ H LQMK RSGGHDYEGVSYV++VPFFILDMFN RS+NV 
Sbjct  81    FLIVTALHESHVQLSVICAQVHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRSINVD  140

Query  466   IEDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTV  645
             I+ ETAWV+AGATLGEVYY IA KS +HGFPAGVCPTVGVGGHF G GYGNMMRKYGL+V
Sbjct  141   IKSETAWVQAGATLGEVYYRIAEKSKIHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLSV  200

Query  646   DNIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVR  825
             DN++DA+++DV+GRLLDRK+MGE+LFWAITGGG +SF VV++Y+INLVRVP  VT+F V 
Sbjct  201   DNVVDAQIVDVHGRLLDRKAMGEDLFWAITGGGGASFGVVIAYKINLVRVPEIVTVFRVP  260

Query  826   RTYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTL  1005
             RT +QNAT IVY +Q ++ KLD +LFIRLT+D+VN +     KT+RA+F  +FLGDS+ L
Sbjct  261   RTLEQNATEIVYRWQYVADKLDDDLFIRLTMDIVNGSGGENNKTLRASFIGMFLGDSERL  320

Query  1006  LSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYL  1185
             LS M++SFPELGL QSDC EM W+ES LF+TSFP+GT  E LLSR+PQVL HLKRKSDY+
Sbjct  321   LSVMNKSFPELGLKQSDCMEMSWVESTLFWTSFPNGTAPEALLSRIPQVLTHLKRKSDYV  380

Query  1186  QTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWD  1365
             + P+P+ G+++IF+KM+EL+ PMLTFNPYGGRM EI ++A PFPHR+GN+  +QYATNWD
Sbjct  381   KKPIPKAGLKWIFQKMIELEAPMLTFNPYGGRMGEISASATPFPHRAGNLWKVQYATNWD  440

Query  1366  EHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYG  1545
               G EA+++Y+++TR+L+ YMTPFVSKNPREAF NY+DLD+GINH+   + SY EG+ YG
Sbjct  441   TEGSEASEYYIDLTRKLHMYMTPFVSKNPREAFFNYKDLDIGINHDANGKASYLEGRVYG  500

Query  1546  LKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             +KYFK+N++RLV +KTKVDP NFFR+EQSIPT P
Sbjct  501   IKYFKDNFDRLVHVKTKVDPKNFFRNEQSIPTLP  534



>ref|XP_010655774.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=531

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/512 (69%), Positives = 422/512 (82%), Gaps = 3/512 (1%)
 Frame = +1

Query  112   WAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLF  291
             WA         L+CL+  S  SHPIS  +YTP+N S+SSVL+ YIRNLRFN S T KP  
Sbjct  22    WAASDSVHGAFLQCLSTHSQSSHPISAALYTPDNSSYSSVLESYIRNLRFNTSTTPKPRL  81

Query  292   IVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIE  471
             I+TATH SHIQA+I+C+K+HGLQMK RSGGHD+EGVSYVSDVPFFILDMFN RS++V IE
Sbjct  82    IITATHESHIQAAIICSKKHGLQMKIRSGGHDFEGVSYVSDVPFFILDMFNLRSISVDIE  141

Query  472   DETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDN  651
             DE+AWV+AGATLGE+YY IA KS  HGFPAGVCPTVG GGHF G GYGNMMRKYGL+VDN
Sbjct  142   DESAWVQAGATLGEMYYRIAEKSKTHGFPAGVCPTVGAGGHFSGGGYGNMMRKYGLSVDN  201

Query  652   IIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRT  831
             I+DA+L+DVNGRLL+RKSMGE+LFWAI  GG +S+ V++SY+I LV+VP  VT+F V RT
Sbjct  202   IVDAELVDVNGRLLNRKSMGEDLFWAIIAGGGASYGVIVSYKIKLVQVPATVTVFRVART  261

Query  832   YDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLS  1011
              +QNATNIVY +Q+++ K+D +LFIRLT+DVVN ++  GEKT+RATF +LFLG S+ LLS
Sbjct  262   LEQNATNIVYQWQQVADKVDGDLFIRLTMDVVN-SSRSGEKTVRATFLSLFLGSSERLLS  320

Query  1012  TMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQT  1191
              M+   PELGL  SDC EM W+ESVLF+T F +GTPVE LL R PQVL HLKRKSDYL+ 
Sbjct  321   IMNTRLPELGLQSSDCTEMSWVESVLFWTEFATGTPVEALLDRNPQVLTHLKRKSDYLKE  380

Query  1192  PMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEH  1371
             P+P+ G+E I+KKM+ELQTP L FNPYGG+MAEI  +A PFPHR+GN+  I YATNWDE 
Sbjct  381   PIPKAGLEGIWKKMIELQTPYLVFNPYGGKMAEISPSATPFPHRAGNLCKIMYATNWDEE  440

Query  1372  GYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLK  1551
             G EAA+ Y+ +T++LY YMTPFVSK+PREAFLNYRDLDLG+NHN   + SY EG+ YG+K
Sbjct  441   GSEAAERYINLTQKLYSYMTPFVSKSPREAFLNYRDLDLGVNHNG--KNSYLEGRIYGIK  498

Query  1552  YFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             YFKEN+NRLV+IKTKVDP NFFR+EQSIPT P
Sbjct  499   YFKENFNRLVRIKTKVDPGNFFRNEQSIPTLP  530



>ref|XP_009596049.1| PREDICTED: reticuline oxidase-like protein [Nicotiana tomentosiformis]
Length=533

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/504 (71%), Positives = 418/504 (83%), Gaps = 4/504 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T LECL   SNPS+PIS ++Y+PNN SF +VLQ YIRNLRFNES T KPLFI+TA H SH
Sbjct  29    TFLECLKTNSNPSYPISSLVYSPNNSSFPTVLQAYIRNLRFNESTTTKPLFILTALHESH  88

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQA+I+CAK  GLQMK RSGGHDYEG+SY+SDVPFFILDMFNFRS+NV+I+DE+AWVE G
Sbjct  89    IQAAIVCAKAQGLQMKIRSGGHDYEGLSYISDVPFFILDMFNFRSINVNIDDESAWVEVG  148

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KSNVHGFPAGVCPTVGVGGH  G GYGNMMRKYGLTVDNI+DAKLIDV
Sbjct  149   ATLGEVYYRIAEKSNVHGFPAGVCPTVGVGGHISGGGYGNMMRKYGLTVDNIVDAKLIDV  208

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GR+LDRKSMGE+LFWA+TGGG +S+ V+LSY+I LVRVP KVT+F V R YDQNA  + 
Sbjct  209   QGRILDRKSMGEDLFWAVTGGGGASYGVLLSYKIKLVRVPLKVTVFRVPRFYDQNALELA  268

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +QR + K D ++F+R+ +DVVN TT P EKTIR +F  LFLGDSK L+S M+E+FPEL
Sbjct  269   YLWQRRADKWDDDMFMRMIIDVVNSTTRPTEKTIRVSFFTLFLGDSKQLVSFMNENFPEL  328

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL Q D  EM W+ESVL+YTSFP   P++ LL R P  + +LKRKSDYL+ PM + G+E+
Sbjct  329   GLQQKDITEMSWVESVLYYTSFPIA-PIDALLRRQPPSVTYLKRKSDYLKKPMSKEGLEY  387

Query  1219  IFKKMVELQTPM-LTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
             IFKKM+ELQTP  LTFNPYGG+M+EI  +AKPFPHR+GNIA IQY+TNW+E G EAA HY
Sbjct  388   IFKKMIELQTPTSLTFNPYGGKMSEISPSAKPFPHRAGNIAKIQYSTNWNEGGVEAADHY  447

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L +TR LY+YMTPFVSK PR AF NYRD+DLG+ HN   + SY EG+ YG+KYFK N+NR
Sbjct  448   LNLTRVLYDYMTPFVSKYPRAAFFNYRDIDLGVTHNG--KLSYLEGQVYGIKYFKGNFNR  505

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFP  1647
             LVKIKTKVDPDNFFR+EQ IP +P
Sbjct  506   LVKIKTKVDPDNFFRNEQGIPVYP  529



>ref|XP_002523151.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39182.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=540

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/501 (69%), Positives = 420/501 (84%), Gaps = 1/501 (0%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
              +CL + S PSHPI+  I+ P+N S+SSVLQ YIRNLRFN S T KPL IVTA H SH+Q
Sbjct  38    FQCLLNLSQPSHPITSAIFAPDNASYSSVLQSYIRNLRFNMSSTPKPLLIVTALHESHVQ  97

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             AS++CA +HGLQMK RSGGHDYEGVSYVSDVPFF+LDMFN R+V+V +E ETAWV+AGA 
Sbjct  98    ASVVCAWKHGLQMKIRSGGHDYEGVSYVSDVPFFVLDMFNLRAVDVDVETETAWVQAGAI  157

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY IA KS VHGFPAG+CPTVGVGGH  G GYGNMMRKYGL+ DNIIDA+L+DVNG
Sbjct  158   LGEVYYRIAEKSKVHGFPAGICPTVGVGGHLSGGGYGNMMRKYGLSADNIIDAQLVDVNG  217

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             RLLDRKSMGE+LFWAI GGG +SF VV+SY+IN+VRVP  VT+F V+RT +QNAT+IV  
Sbjct  218   RLLDRKSMGEDLFWAIRGGGGASFGVVISYKINIVRVPEVVTVFRVQRTLEQNATDIVDK  277

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q +++ LD ++FIRLT++VVN T   G KT+RATF  +FLGDS  LL+TM ESFPE+GL
Sbjct  278   WQHVAYNLDDDIFIRLTLEVVNATQGNG-KTVRATFRCMFLGDSARLLATMKESFPEMGL  336

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              QSDC EM W+ESVLF+T F  GTP   LL R P  + +LKRKSDY++ P+PR+G+E ++
Sbjct  337   VQSDCLEMSWLESVLFWTDFAVGTPTTALLRRTPPSITYLKRKSDYVKKPIPRDGLEKLW  396

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             +KMVELQ P L FNPYGG+M EIPS A PFPHR+GN+  IQYATNW+  G EAA HY+++
Sbjct  397   QKMVELQVPSLAFNPYGGKMGEIPSTALPFPHRAGNLWKIQYATNWNVEGTEAANHYIDL  456

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
             TRQLY++MTP+VSK+PREAFLNYRDLDLGINHN G++KSY EG+TYG++YFKEN++RLV+
Sbjct  457   TRQLYDFMTPYVSKDPREAFLNYRDLDLGINHNDGKKKSYLEGRTYGIQYFKENFDRLVQ  516

Query  1585  IKTKVDPDNFFRDEQSIPTFP  1647
             +KTKVDP NFFR+EQSIPTFP
Sbjct  517   VKTKVDPGNFFRNEQSIPTFP  537



>ref|XP_007211543.1| hypothetical protein PRUPE_ppa004021mg [Prunus persica]
 gb|EMJ12742.1| hypothetical protein PRUPE_ppa004021mg [Prunus persica]
Length=535

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/514 (67%), Positives = 427/514 (83%), Gaps = 1/514 (0%)
 Frame = +1

Query  109   AWAPLCYCA-TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKP  285
             +W    Y A    ++CL + S PSHPI P IYTPNN S+SSVL+ YIRNLRFN S T+KP
Sbjct  21    SWQASAYSAPEKFVQCLLNHSQPSHPIGPAIYTPNNASYSSVLESYIRNLRFNTSSTRKP  80

Query  286   LFIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVS  465
               IVTA H SH+Q S++CA+ H LQMK RSGGHDYEGVSYV++VPFFILDMFN RS+ V 
Sbjct  81    FLIVTALHESHVQLSVICAQVHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRSIKVD  140

Query  466   IEDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTV  645
             I+ ETAWV+AGATLGEVYY IA +S +HGFPAGVCPTVGVGGHF G GYGNMMRKYGL+V
Sbjct  141   IKSETAWVQAGATLGEVYYRIAERSKIHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLSV  200

Query  646   DNIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVR  825
             DN++DA+++DV+GRLLDRK+MGE+LFWAITGGG +SF VV++Y+INLVRVP  VT+F V 
Sbjct  201   DNVVDAQIVDVHGRLLDRKAMGEDLFWAITGGGGASFGVVIAYKINLVRVPEIVTVFRVP  260

Query  826   RTYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTL  1005
             RT +QNAT IVY +Q ++ KLD +LFIRLT+D+VN +     KT+RA+F  +FLGDS+ L
Sbjct  261   RTLEQNATEIVYRWQYVADKLDDDLFIRLTMDIVNGSGGENNKTLRASFIGMFLGDSERL  320

Query  1006  LSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYL  1185
             LS M++SFPELGL QSDC EM W+ES LF+TSFP+GT  E LLSR+PQVL HLKRKSDY+
Sbjct  321   LSVMNKSFPELGLKQSDCMEMSWVESTLFWTSFPNGTAPEALLSRIPQVLTHLKRKSDYV  380

Query  1186  QTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWD  1365
             + P+P+ G+++IF+KM+EL+ PMLTFNPYGGRM EI ++A PFPHR+GN+  +QYATNWD
Sbjct  381   KKPIPKAGLKWIFQKMIELEAPMLTFNPYGGRMGEISASATPFPHRAGNLWKVQYATNWD  440

Query  1366  EHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYG  1545
               G EA+++Y+++TR+L+ YMTPFVSKNPREAF NY+DLD+GINHN   + SY EG+ YG
Sbjct  441   TEGSEASEYYIDLTRKLHMYMTPFVSKNPREAFFNYKDLDIGINHNANSKASYLEGRVYG  500

Query  1546  LKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             +KYFK+N++RLV +KTKVDP NFFR+EQSIPT P
Sbjct  501   IKYFKDNFDRLVHVKTKVDPKNFFRNEQSIPTLP  534



>ref|XP_006370773.1| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|ERP67342.1| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=535

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/504 (72%), Positives = 427/504 (85%), Gaps = 2/504 (0%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L CL + S PS+PIS  IYTPNN S+SSVLQ YIRNLRFN S T KPL I+TA H SH+Q
Sbjct  33    LHCLLNHSQPSYPISTAIYTPNNESYSSVLQSYIRNLRFNMSTTPKPLLILTALHESHVQ  92

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+I CA+EH LQMK RSGGHDYEGVSYVSDVPFF+LDMFN RS++V +  ETAW++ GAT
Sbjct  93    AAISCAREHNLQMKIRSGGHDYEGVSYVSDVPFFVLDMFNLRSIDVDVASETAWIQVGAT  152

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY ++ KS  HGFPAGVCPTVGVGGHFGG GYGNMMRKYGL+VDNIIDAK++DVNG
Sbjct  153   LGEVYYRVSEKSKAHGFPAGVCPTVGVGGHFGGGGYGNMMRKYGLSVDNIIDAKMVDVNG  212

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             RLLDRKSMGE+LFWAITGGG SSF VVL+Y+IN+VRVP  VT+F VRRT DQNAT+IV  
Sbjct  213   RLLDRKSMGEDLFWAITGGGGSSFGVVLAYKINIVRVPEVVTVFRVRRTVDQNATDIVEQ  272

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q++++ +D +LFIRLT+DVVN TT  GEKT+R TF ALFLGDS+ LLS  + SFP+LGL
Sbjct  273   WQQVAYNIDDDLFIRLTMDVVNSTTRIGEKTVRTTFRALFLGDSERLLSITNASFPKLGL  332

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              +SDC EM W+ESVLF+T FP GTP + LLSR PQ LVHLKRKSDY+Q P+PR+G+E I+
Sbjct  333   LRSDCIEMSWLESVLFWTDFPLGTPTDALLSRTPQSLVHLKRKSDYVQKPIPRDGLEGIW  392

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             KKM+ELQ P LTFNPYGG+M EIP+  +PFPHR+GN+  IQYATNW+E G E A +Y+++
Sbjct  393   KKMIELQVPQLTFNPYGGKMWEIPATERPFPHRAGNLWKIQYATNWNEGGQEEANYYIDL  452

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
             TRQLY YMTPFVSKNPR+AFLNYRDLDLGINHN   ++SY EG+ YG+KYF+ N+NRLVK
Sbjct  453   TRQLYSYMTPFVSKNPRQAFLNYRDLDLGINHNG--KESYLEGRVYGIKYFQVNFNRLVK  510

Query  1585  IKTKVDPDNFFRDEQSIPTFPGRK  1656
             IKTKVDP NFFR+EQSIPTFP RK
Sbjct  511   IKTKVDPGNFFRNEQSIPTFPYRK  534



>ref|XP_011039280.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=533

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/504 (71%), Positives = 427/504 (85%), Gaps = 2/504 (0%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL + S PS+PIS  IYTPNN S+SSVLQ YIRNLRFN S T KPL I+TA H SH+Q
Sbjct  31    LQCLLNHSQPSYPISTAIYTPNNDSYSSVLQSYIRNLRFNMSTTPKPLLILTALHDSHVQ  90

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             ++I+CA+EH LQMK RSGGHDYEGVSYVSDVPFF+LDMFN RS++V +  ETAW++ GAT
Sbjct  91    SAIICAREHNLQMKIRSGGHDYEGVSYVSDVPFFVLDMFNLRSIDVDVASETAWIQVGAT  150

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY ++ KS  HGFPAGVCPTVGVGGHFGG GYGNMMRKYGL+VDNIIDA ++DVNG
Sbjct  151   LGEVYYRVSEKSKAHGFPAGVCPTVGVGGHFGGGGYGNMMRKYGLSVDNIIDATMVDVNG  210

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             RLLDRKSMGE+LFWAITGGG SSF VVL+Y+I +VRVP  VT+F VRRT DQNAT+IV  
Sbjct  211   RLLDRKSMGEDLFWAITGGGGSSFGVVLAYKIKIVRVPEVVTVFRVRRTVDQNATDIVEQ  270

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q++++ +D +LFIRL++DVVN TT  GEKT+R TF ALFLGDS+ LLS  + SFP+LGL
Sbjct  271   WQQVAYNIDDDLFIRLSMDVVNSTTRIGEKTVRTTFRALFLGDSERLLSITNASFPKLGL  330

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              +SDC EM W+ESVLF+T FP GTP + LLSR PQ LVHLKRKSDY+Q P+PR+G+E I+
Sbjct  331   LRSDCIEMSWLESVLFWTDFPLGTPTDALLSRTPQSLVHLKRKSDYVQKPIPRDGLEGIW  390

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             K M+ELQ P LTFNPYGG+M EIP+  +PFPHR+GN+  IQYATNW+E G E A +Y+++
Sbjct  391   KIMIELQVPQLTFNPYGGKMWEIPATERPFPHRAGNLWKIQYATNWNEGGQEVANYYIDL  450

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
             TRQLY YMTPFVSKNPR+AFLNYRDLDLGINHN   ++SY EG+ YG+KYF+EN+NRLVK
Sbjct  451   TRQLYSYMTPFVSKNPRQAFLNYRDLDLGINHNG--KESYLEGRVYGIKYFQENFNRLVK  508

Query  1585  IKTKVDPDNFFRDEQSIPTFPGRK  1656
             IKTKVDP NFFR+EQSIPTFP RK
Sbjct  509   IKTKVDPGNFFRNEQSIPTFPYRK  532



>emb|CDP12592.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/508 (70%), Positives = 421/508 (83%), Gaps = 13/508 (3%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL   S+P+  IS VIYTPNN SF  VLQ YIRNLRFNES T+KP  I+TA  +SH
Sbjct  31    TFVQCLQKHSSPN--ISAVIYTPNNSSFPKVLQAYIRNLRFNESTTRKPFLILTALDVSH  88

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQA+I+CAK  GLQMK RSGGHDYEGVSY+S+VPFFILD+FN RS++V+IE+ETAWV+ G
Sbjct  89    IQAAIICAKAQGLQMKTRSGGHDYEGVSYISEVPFFILDLFNIRSISVNIEEETAWVQVG  148

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY I  KS VHGFPAGVCPTVGVGGHF G GYGNMMRKYGLTVDNIIDA++IDV
Sbjct  149   ATLGEVYYRIYQKSKVHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLTVDNIIDAQIIDV  208

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGR+LDR +MGE+LFWAITGGGASSF V L+Y+INLVRVPPKVT+F+V RTY+QNAT +V
Sbjct  209   NGRILDRAAMGEDLFWAITGGGASSFGVALAYKINLVRVPPKVTVFNVTRTYEQNATYLV  268

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             + +Q ++ KLD ++FIR+ + VVN       KTIR+ F  LFLGDS  LLS M+ESFPEL
Sbjct  269   HRWQEVADKLDNDIFIRMIIRVVN-------KTIRSEFFTLFLGDSARLLSLMNESFPEL  321

Query  1039  GLTQSDCREMRWIESVLFYTS--FPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             GL Q DC EM W ESV++Y +  FP GTPV  LLSR P  L HLKRKSDYL+ PMP  GI
Sbjct  322   GLRQPDCIEMSWAESVIYYYTPPFPRGTPVHNLLSRHPPELKHLKRKSDYLKKPMPIEGI  381

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             EFIFKKM+ELQTP+LTFNPYGGRMAEIP++AKPFPHR+GNIA IQYAT+WD++G + A+H
Sbjct  382   EFIFKKMIELQTPVLTFNPYGGRMAEIPASAKPFPHRAGNIAKIQYATDWDQNGVQTAEH  441

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             ++ +TR L++YMTPFVSK PREAFLNYRDLD+GI HN   + SY EG  YG+KYFKEN+N
Sbjct  442   FINLTRALHKYMTPFVSKFPREAFLNYRDLDIGITHNG--KNSYAEGLVYGIKYFKENFN  499

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             RLVK+KT VDPDNFFRDEQ+IP  P RK
Sbjct  500   RLVKVKTAVDPDNFFRDEQTIPVSPSRK  527



>ref|XP_006352998.1| PREDICTED: reticuline oxidase-like protein-like [Solanum tuberosum]
Length=533

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/505 (73%), Positives = 425/505 (84%), Gaps = 6/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+CL   SNPS+PIS ++++PNN SF S+LQ YIRNLRFNES T+KPLFI+TA H SH
Sbjct  29    SFLQCLETNSNPSYPISSLVFSPNNSSFPSILQAYIRNLRFNESTTRKPLFILTAQHESH  88

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQASI+CAK  G+QMK RSGGHDYEG+SYVS+VPFFI+DMFNFRS+NVSI+DE+AWVE G
Sbjct  89    IQASIICAKSQGVQMKIRSGGHDYEGLSYVSNVPFFIVDMFNFRSINVSIKDESAWVEVG  148

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KSNVHGFPAGVCPTVGVGGHF GAGYGNMMRKYGLTVDNI DAKLIDV
Sbjct  149   ATLGEVYYRIAEKSNVHGFPAGVCPTVGVGGHFSGAGYGNMMRKYGLTVDNIDDAKLIDV  208

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGR+LDRKSMGE+LFWAITGGG  S+ VVLSY+I LVRVPPKVT+F V R YDQNA ++ 
Sbjct  209   NGRILDRKSMGEDLFWAITGGGGVSYGVVLSYKIKLVRVPPKVTVFRVPRFYDQNALDLA  268

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +QR ++K D +LF+R+ +DVVN TT   EKTIR +F  LFLGDS  LLS +++SFPEL
Sbjct  269   YLWQRRANKWDNDLFMRMIIDVVNSTTRTSEKTIRVSFFTLFLGDSDKLLSLLNQSFPEL  328

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL + DC EM WIESVL+YT+ P  TP++ LLSR P  L +LKRKSDYLQ PM + G+EF
Sbjct  329   GLERKDCIEMSWIESVLYYTNSPI-TPIDALLSRSPP-LSYLKRKSDYLQKPMSKEGLEF  386

Query  1219  IFKKMVELQTP-MLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
             IFKKM+ELQTP +LTFNPYGGRM+EI   AKPFPHR GNIA IQYATNW+E G EA+ HY
Sbjct  387   IFKKMIELQTPTILTFNPYGGRMSEISPLAKPFPHRDGNIAKIQYATNWNEKGVEASNHY  446

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYF-KENYN  1572
             L +TR LY YMTPFVSK+PR AFLNYRD+DLGI HN   + SYFEGK YG+KYF KEN+N
Sbjct  447   LNLTRVLYNYMTPFVSKSPRLAFLNYRDIDLGITHNG--KLSYFEGKVYGIKYFKKENFN  504

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLVKIKTKVDP NFFR+EQSIP +P
Sbjct  505   RLVKIKTKVDPQNFFRNEQSIPVYP  529



>gb|KCW75699.1| hypothetical protein EUGRSUZ_D00073 [Eucalyptus grandis]
Length=536

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/509 (69%), Positives = 422/509 (83%), Gaps = 4/509 (1%)
 Frame = +1

Query  124   CYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTA  303
              +   ++ +CL + S PSHPI+  IYTPN  S+S+VLQ YIRNLRFN S T KP  I+TA
Sbjct  30    AFANESLTQCLINHSQPSHPITSAIYTPNKSSYSNVLQSYIRNLRFNTSDTPKPTLILTA  89

Query  304   THLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVS-DVPFFILDMFNFRSVNVSIEDET  480
              H SH+QA+I+CA++  +QMK RSGGHDYEG+SYVS   PFFILDMFN RSV+V IE E 
Sbjct  90    LHESHVQAAIVCAQKLSVQMKIRSGGHDYEGISYVSISSPFFILDMFNLRSVDVDIEAEM  149

Query  481   AWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIID  660
             AWV+AGATLGEVYYGIA KS VHGFPAGVCPTVGVGGHF G GYGNMMRKYGLTVDNI+D
Sbjct  150   AWVQAGATLGEVYYGIAAKSKVHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLTVDNIVD  209

Query  661   AKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQ  840
             A++I+VNG +LDR+SMGE+LFWAI GGG +SF VVL+Y+INLVRVP  VT+FSV RT++Q
Sbjct  210   ARIINVNGEILDRESMGEDLFWAIRGGGGASFGVVLAYKINLVRVPQTVTVFSVPRTWEQ  269

Query  841   NATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMD  1020
             NAT +VY +++++ +L  +LFIRLT+DVVN  T  GEKTIRATF ALFLGD++ LLS M 
Sbjct  270   NATEVVYKWEQVAPQLHEDLFIRLTMDVVN-GTKAGEKTIRATFIALFLGDAQRLLSLMS  328

Query  1021  ESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMP  1200
              SFPELGL  SDC EM W+ES LF+T+FP GTP + LLSR PQVL HLKRKSDY++  +P
Sbjct  329   NSFPELGLRSSDCIEMSWVESTLFWTNFPIGTPADALLSRTPQVLTHLKRKSDYVKQIIP  388

Query  1201  RNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYE  1380
             ++G+E I+++M+EL+ PMLTFNPYGG+M EIP+   PFPHR+GN+  +QYATNWDE+G E
Sbjct  389   KDGLELIWRRMIELERPMLTFNPYGGKMGEIPATNTPFPHRAGNLWKVQYATNWDENGDE  448

Query  1381  AAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFK  1560
             AA+HY+E+TR+LY YMTPFVSKNPREAFLNYRDLDLGINHN    +SY EG+ YG+KYFK
Sbjct  449   AARHYIELTRKLYRYMTPFVSKNPREAFLNYRDLDLGINHNGD--ESYEEGRVYGVKYFK  506

Query  1561  ENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
              N+NRLV+IKTKVDP NFFR+EQSIP  P
Sbjct  507   GNFNRLVEIKTKVDPGNFFRNEQSIPVLP  535



>ref|XP_011096701.1| PREDICTED: reticuline oxidase-like protein [Sesamum indicum]
Length=530

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/520 (71%), Positives = 431/520 (83%), Gaps = 13/520 (3%)
 Frame = +1

Query  109   AWAPLCYCA-TTVLECLNDR-SNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKK  282
             +WA   Y +    ++CL    S+PS PIS V+YT +N S+SSVLQ YIRNLRFNES T K
Sbjct  20    SWATSNYTSHQAFVQCLETHDSDPSSPISAVLYTRDNSSYSSVLQNYIRNLRFNESTTPK  79

Query  283   PLFIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVP-FFILDMFNFRSVN  459
             P  IVTA H+SHIQA+I+CAK HGLQMK RSGGHDYEG+SY SD P FFILD+FN RS+N
Sbjct  80    PRLIVTALHVSHIQAAIVCAKAHGLQMKIRSGGHDYEGISYWSDDPNFFILDLFNLRSIN  139

Query  460   VSIEDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGL  639
             VSIEDE+AWV+ GATLGEVYY IA KS+ HGFPAGVCPTVGVGGHF G GYGNMMRKYGL
Sbjct  140   VSIEDESAWVQVGATLGEVYYRIAEKSSTHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGL  199

Query  640   TVDNIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFS  819
             +VDNIIDA++IDV+GRLLDRKSMGE+LFWAITGGG SSF VVLSY+I LVRVPP VT+F 
Sbjct  200   SVDNIIDAQIIDVDGRLLDRKSMGEDLFWAITGGGGSSFGVVLSYKIKLVRVPPTVTVFR  259

Query  820   VRRTYDQNATNIVYCYQRMS-HKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDS  996
             VRRTYD+N TN+V+ YQ+++  KL   LFIRLT+DVVN T        R TF ALFLG S
Sbjct  260   VRRTYDENFTNLVHRYQQVAADKLPEELFIRLTLDVVNGTN-------RGTFLALFLGKS  312

Query  997   KTLLSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKS  1176
             + LLS M+ES PELGL Q+DC EM W+ESVL++T+FP+GTP + LLSRVPQVL +LKRKS
Sbjct  313   QELLSVMNESLPELGLDQTDCVEMSWVESVLYWTNFPTGTPADALLSRVPQVLNYLKRKS  372

Query  1177  DYLQTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYAT  1356
             DYL+ P+P+ G+E +F+KMVELQTPMLTFNPYGGRMAEI  +AKPFPHR+GNIA +QYAT
Sbjct  373   DYLKKPVPKQGLELLFRKMVELQTPMLTFNPYGGRMAEISPSAKPFPHRAGNIAKLQYAT  432

Query  1357  NWDEHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGK  1536
             NW+E G EAA  YL +TR+LY+YMTP+VS  PREAFLNYRDLD+GINHN   R SY EG 
Sbjct  433   NWNEEGEEAANRYLNLTRKLYDYMTPYVSMAPREAFLNYRDLDIGINHNG--RNSYLEGA  490

Query  1537  TYGLKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFPGRK  1656
              YG+KY+K+N+NRLVKIKTKVDPDNFFR+EQSIP FP RK
Sbjct  491   VYGVKYYKDNFNRLVKIKTKVDPDNFFRNEQSIPVFPWRK  530



>ref|XP_010051867.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
Length=553

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/509 (69%), Positives = 422/509 (83%), Gaps = 4/509 (1%)
 Frame = +1

Query  124   CYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTA  303
              +   ++ +CL + S PSHPI+  IYTPN  S+S+VLQ YIRNLRFN S T KP  I+TA
Sbjct  47    AFANESLTQCLINHSQPSHPITSAIYTPNKSSYSNVLQSYIRNLRFNTSDTPKPTLILTA  106

Query  304   THLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVS-DVPFFILDMFNFRSVNVSIEDET  480
              H SH+QA+I+CA++  +QMK RSGGHDYEG+SYVS   PFFILDMFN RSV+V IE E 
Sbjct  107   LHESHVQAAIVCAQKLSVQMKIRSGGHDYEGISYVSISSPFFILDMFNLRSVDVDIEAEM  166

Query  481   AWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIID  660
             AWV+AGATLGEVYYGIA KS VHGFPAGVCPTVGVGGHF G GYGNMMRKYGLTVDNI+D
Sbjct  167   AWVQAGATLGEVYYGIAAKSKVHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLTVDNIVD  226

Query  661   AKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQ  840
             A++I+VNG +LDR+SMGE+LFWAI GGG +SF VVL+Y+INLVRVP  VT+FSV RT++Q
Sbjct  227   ARIINVNGEILDRESMGEDLFWAIRGGGGASFGVVLAYKINLVRVPQTVTVFSVPRTWEQ  286

Query  841   NATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMD  1020
             NAT +VY +++++ +L  +LFIRLT+DVVN  T  GEKTIRATF ALFLGD++ LLS M 
Sbjct  287   NATEVVYKWEQVAPQLHEDLFIRLTMDVVN-GTKAGEKTIRATFIALFLGDAQRLLSLMS  345

Query  1021  ESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMP  1200
              SFPELGL  SDC EM W+ES LF+T+FP GTP + LLSR PQVL HLKRKSDY++  +P
Sbjct  346   NSFPELGLRSSDCIEMSWVESTLFWTNFPIGTPADALLSRTPQVLTHLKRKSDYVKQIIP  405

Query  1201  RNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYE  1380
             ++G+E I+++M+EL+ PMLTFNPYGG+M EIP+   PFPHR+GN+  +QYATNWDE+G E
Sbjct  406   KDGLELIWRRMIELERPMLTFNPYGGKMGEIPATNTPFPHRAGNLWKVQYATNWDENGDE  465

Query  1381  AAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFK  1560
             AA+HY+E+TR+LY YMTPFVSKNPREAFLNYRDLDLGINHN    +SY EG+ YG+KYFK
Sbjct  466   AARHYIELTRKLYRYMTPFVSKNPREAFLNYRDLDLGINHNGD--ESYEEGRVYGVKYFK  523

Query  1561  ENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
              N+NRLV+IKTKVDP NFFR+EQSIP  P
Sbjct  524   GNFNRLVEIKTKVDPGNFFRNEQSIPVLP  552



>ref|XP_009362182.1| PREDICTED: reticuline oxidase-like protein [Pyrus x bretschneideri]
Length=540

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/505 (67%), Positives = 420/505 (83%), Gaps = 4/505 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             + CL + S PSHPI+P IY+PNN S+SSVL+ YIRNLRFN S T+KP  I+TA H SH+Q
Sbjct  35    VHCLLNHSKPSHPIAPAIYSPNNASYSSVLESYIRNLRFNTSTTRKPFLILTALHESHVQ  94

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
              S++CA+ H LQMK RSGGHDYEGVSYV++VPFFILDMFN RS++V I+ ETAWV+AGAT
Sbjct  95    ISVVCAQIHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRSIHVDIKSETAWVQAGAT  154

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY IA KS +HGFPAGV PTVGVGGHF G GYGNMMRKYGL+VDNI+DA+L++V+G
Sbjct  155   LGELYYRIAEKSKIHGFPAGVRPTVGVGGHFSGGGYGNMMRKYGLSVDNIVDAQLVNVHG  214

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              LLDRKSMGE+LFWA+TGGG +SF VV++Y+INLVRVP  VT+F V R  +QNAT+IVY 
Sbjct  215   ELLDRKSMGEDLFWAVTGGGGASFGVVIAYKINLVRVPEIVTVFRVSRILEQNATDIVYR  274

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTH----PGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             +Q ++ KLD +LFIRLT+DVVN T+        KT+RA+F A+FLGDS+ LLS M++SFP
Sbjct  275   WQYIADKLDDDLFIRLTMDVVNGTSSNNSGGNNKTLRASFIAMFLGDSERLLSIMNKSFP  334

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL QSDC EM W +SVLF+TSFP+GT  E LLSR PQVL  LKRKSDY++ P+P+ G+
Sbjct  335   ELGLKQSDCAEMSWAQSVLFWTSFPTGTATEALLSRTPQVLTRLKRKSDYVKKPIPKTGL  394

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             ++IF+KM+EL+ PMLTFNPYGG+M+EI ++A PFPHR+GN+  +QYATNWD  G +AA H
Sbjct  395   KWIFQKMIELEAPMLTFNPYGGKMSEISASATPFPHRAGNLWKVQYATNWDILGTKAADH  454

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             Y+E+TR+L+ YMTPFVSKNPREAF NY+DLD+GINHN     SY EG+ YG+KYFK N++
Sbjct  455   YIELTRKLHMYMTPFVSKNPREAFYNYKDLDIGINHNANGISSYLEGRVYGIKYFKHNFD  514

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLV +KTKVDP NFFR+EQSIPT P
Sbjct  515   RLVNVKTKVDPGNFFRNEQSIPTLP  539



>ref|XP_004295450.1| PREDICTED: reticuline oxidase-like protein-like [Fragaria vesca 
subsp. vesca]
Length=724

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/483 (70%), Positives = 415/483 (86%), Gaps = 3/483 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             + CL   S PSHPI P IYTPNN S+SSVL+ YIRNLRFNESYT+KP  I+TA H+SH+Q
Sbjct  34    VSCLLSHSLPSHPIGPAIYTPNNASYSSVLESYIRNLRFNESYTRKPYLIITALHVSHVQ  93

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
              +ILCA++H LQMK RSGGHDYEGVSYV++VPFFILD+FN R++NV I+ ETAWV+AGAT
Sbjct  94    QAILCAQKHNLQMKIRSGGHDYEGVSYVAEVPFFILDLFNLRTINVDIKTETAWVQAGAT  153

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY I  KS VHGFPAGVCPTVGVGGHF G GYGNMMRKYGL+VDNI+DA+++DV+G
Sbjct  154   LGEVYYRIYEKSKVHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLSVDNIVDAQIVDVHG  213

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             RLLDRKSMGE+LFWAITGGG +SF VV++Y+INLV VP  VT+F   RT +QNAT+IVY 
Sbjct  214   RLLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVPVPETVTVFRFIRTLEQNATDIVYR  273

Query  865   YQRMSHKLDPNLFIRLTVDVVNIT-THPGEKTIRATFNALFLGDSKTLLSTMDESFPELG  1041
             +Q ++HKLD +LFIRLT+DVVN+T +  GEKT+RATFNALFLGDS  LLS M++SFPE+G
Sbjct  274   WQYVAHKLDNDLFIRLTMDVVNVTGSQTGEKTLRATFNALFLGDSARLLSVMNKSFPEMG  333

Query  1042  LTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
             L QSDC+EM W+ES LF+TSFP+GT  E LLSRVPQVL HLKRKSDY++ P+P+ G+++I
Sbjct  334   LKQSDCQEMSWVESTLFWTSFPNGTAPEALLSRVPQVLTHLKRKSDYVKQPIPKAGLKWI  393

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
              +KM+ELQTPMLTFNPYGGRMAEI ++AKPFPHR+GN+  +QYATNWD  G EAA+ Y++
Sbjct  394   IQKMIELQTPMLTFNPYGGRMAEIAASAKPFPHRAGNLWKVQYATNWDASGSEAAEKYID  453

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
             +TR+L+EYMTPFVSKNPREAF NY+DLD+GIN+N   + SYFEG+ YG+KYFKEN+++L 
Sbjct  454   LTRKLFEYMTPFVSKNPREAFFNYKDLDIGINNND--KGSYFEGRVYGVKYFKENFDKLW  511

Query  1582  KIK  1590
               K
Sbjct  512   ACK  514



>ref|XP_002267904.2| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=537

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/512 (67%), Positives = 412/512 (80%), Gaps = 3/512 (1%)
 Frame = +1

Query  112   WAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLF  291
             WA         L+CL+  S PSHPIS VIYTP+N S+SSVL+ YIRNLRFN   T KP  
Sbjct  22    WAASDSVHGAFLQCLSSHSQPSHPISAVIYTPDNSSYSSVLESYIRNLRFNTPATPKPCL  81

Query  292   IVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIE  471
             I+TATH SHIQA+++C+K+HGL++K RSGGHDYEG+SYVSD PFFILDMFN RS++V IE
Sbjct  82    IITATHESHIQAAVICSKKHGLEIKIRSGGHDYEGMSYVSDAPFFILDMFNLRSISVDIE  141

Query  472   DETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDN  651
             DE++WV AGAT+GE+YY IA KS   GFP+G+CPTVG GGHF G GYGNMMRKYGL+VDN
Sbjct  142   DESSWVHAGATIGEIYYRIAEKSKTRGFPSGLCPTVGAGGHFSGGGYGNMMRKYGLSVDN  201

Query  652   IIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRT  831
             I+DA+L+DVNGRLL+RKSMGE+LFWAI GGG +S+ V++SY+I LV+VP  VT+F V RT
Sbjct  202   IVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPATVTVFRVART  261

Query  832   YDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLS  1011
              +QNATNIVY +Q+++ K+D +LFIRL +DVVN  +  GEKT+RATF +LFLG S+ LLS
Sbjct  262   LEQNATNIVYKWQQIADKVDEDLFIRLILDVVN-DSRSGEKTVRATFLSLFLGSSERLLS  320

Query  1012  TMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQT  1191
              M+ SFPELGL  SDC EM W ESVLF   F  GTPVE LL+R  +V  H KRKSDYL+ 
Sbjct  321   IMNTSFPELGLQSSDCTEMSWAESVLFSADFAIGTPVEALLNRTRRVQYHFKRKSDYLKE  380

Query  1192  PMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEH  1371
             P+P+ G+E ++KKM+EL+TP L FNPYGG+MAEI  AA PFPHR+GNI  I YATNW E 
Sbjct  381   PIPKAGLEGLWKKMIELETPFLKFNPYGGKMAEISPAATPFPHRAGNICKIMYATNWHEE  440

Query  1372  GYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLK  1551
             G EAA+ YL +TRQL+ YMTPFVSK+PREAFLNYRD DLGINHN   + SY EG+ YG+K
Sbjct  441   GSEAAERYLNLTRQLHSYMTPFVSKSPREAFLNYRDRDLGINHNG--KNSYLEGRVYGIK  498

Query  1552  YFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             YFK+N+NRLV IKTKVDP NFFR+EQSIPT P
Sbjct  499   YFKKNFNRLVHIKTKVDPGNFFRNEQSIPTLP  530



>ref|XP_010054196.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
 gb|KCW75700.1| hypothetical protein EUGRSUZ_D00074 [Eucalyptus grandis]
Length=536

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/509 (67%), Positives = 418/509 (82%), Gaps = 4/509 (1%)
 Frame = +1

Query  124   CYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTA  303
              +   ++ +CL + S PSHPI+  IYTPN  S+S+VLQ YIRNLRFN S T KP  I+TA
Sbjct  30    AFANESLTQCLINHSQPSHPITSAIYTPNKSSYSNVLQSYIRNLRFNTSDTPKPALILTA  89

Query  304   THLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVS-DVPFFILDMFNFRSVNVSIEDET  480
              H SH+QA+I+C ++  +QMK RSGGHDYEG+SYVS   PFFILDMFN R V+V IE ET
Sbjct  90    LHESHVQAAIVCTQKLSVQMKIRSGGHDYEGISYVSISSPFFILDMFNLRLVDVDIEAET  149

Query  481   AWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIID  660
             AWV+AGATLGEVYYGI  KS VHGFPAGVCPT+GVGGHF G GYGNMMRKYGL+VDNI+D
Sbjct  150   AWVQAGATLGEVYYGIGAKSKVHGFPAGVCPTLGVGGHFSGGGYGNMMRKYGLSVDNIVD  209

Query  661   AKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQ  840
             A++I+VNG +LDR+SMGE+LFWAI GGG +SF VVL+Y+INLVRVP  VT+FSV RT+++
Sbjct  210   ARIINVNGEILDRESMGEDLFWAIRGGGGASFGVVLAYKINLVRVPETVTVFSVPRTWER  269

Query  841   NATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMD  1020
             NAT +VY +++++ KL  +LFIRLT+DVVN  T  GEKTIRATF ALFLGD++ LLS M 
Sbjct  270   NATEVVYKWEQVAPKLHEDLFIRLTMDVVN-GTKAGEKTIRATFFALFLGDAQRLLSLMS  328

Query  1021  ESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMP  1200
              SFPELGL  SDC EM W+ES+LF+T+FP GTP   LLSR PQVL HLKRKSDY++  +P
Sbjct  329   NSFPELGLRSSDCIEMSWVESILFWTNFPIGTPANALLSRTPQVLTHLKRKSDYVKQIIP  388

Query  1201  RNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYE  1380
             ++G+E I+++M+EL+ PMLTFNPYGG+M EIP+   PFPHR+GN+  IQYATNWDE G E
Sbjct  389   KDGLELIWRRMIELERPMLTFNPYGGKMGEIPATNTPFPHRAGNLWKIQYATNWDEDGDE  448

Query  1381  AAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFK  1560
             AA+HY+++TR+L+ YMTPFVSKNPREAFLNYR LDLGINHN    +SY EG+ YG+KYFK
Sbjct  449   AARHYIKLTRKLHRYMTPFVSKNPREAFLNYRHLDLGINHNGD--ESYEEGRVYGVKYFK  506

Query  1561  ENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
              N+NRLV+IKTKVDP NFFR+EQSIP  P
Sbjct  507   GNFNRLVEIKTKVDPGNFFRNEQSIPVLP  535



>ref|XP_004233150.1| PREDICTED: reticuline oxidase-like protein [Solanum lycopersicum]
Length=534

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/508 (71%), Positives = 422/508 (83%), Gaps = 6/508 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + LECL   SNP++PIS ++++PNN SF S+LQ YIRNLRFNES T+KPLFI+TA H SH
Sbjct  30    SFLECLEANSNPTYPISSLVFSPNNSSFPSILQAYIRNLRFNESTTRKPLFILTAQHESH  89

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQASI+CAK  G+QMK RSGGHDYEG+SYVS+VPFFI+DMFNFRS+NVSI+DE+AWVE G
Sbjct  90    IQASIVCAKSQGVQMKIRSGGHDYEGLSYVSNVPFFIVDMFNFRSINVSIDDESAWVEVG  149

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KSN++GFPAGVCPTVGVGGHF GAGYGNMMRKYGLTVDNI DAKLIDV
Sbjct  150   ATLGEVYYRIAEKSNIYGFPAGVCPTVGVGGHFSGAGYGNMMRKYGLTVDNIDDAKLIDV  209

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGR+LDRKSMGE+LFWAITGGG  S+ VVLSY+I LVRVPPKVT+F V R YDQNA ++ 
Sbjct  210   NGRILDRKSMGEDLFWAITGGGGVSYGVVLSYKIKLVRVPPKVTVFRVPRFYDQNALDLA  269

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +QR ++  D +LF+R+ +DVVN TT   EKTIR +F  L+LGDS  LLS +++SFPEL
Sbjct  270   YLWQRRANTWDNDLFMRMIIDVVNRTTRTSEKTIRVSFFTLYLGDSNRLLSLLNQSFPEL  329

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL + DC EM WIESVL+YT+ P  TP++ LLSR P  L +LKRKSDYLQ PM + G+EF
Sbjct  330   GLERKDCIEMSWIESVLYYTNSPI-TPIDALLSRSPP-LTYLKRKSDYLQKPMSKEGLEF  387

Query  1219  IFKKMVELQTPM-LTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
             IFKKM+ELQTP  L FNPYGGRM+EI   AKPFPHR GNIA IQY+TNW+E G EA+ HY
Sbjct  388   IFKKMIELQTPTSLVFNPYGGRMSEISPLAKPFPHRDGNIAKIQYSTNWNEKGVEASNHY  447

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYF-KENYN  1572
             L +TR LY YMTPFVSK+PR AFLNYRD+DLG  HN   + SYFEGK YG+KYF KEN+N
Sbjct  448   LNLTRVLYNYMTPFVSKSPRLAFLNYRDIDLGTTHNG--KLSYFEGKVYGIKYFKKENFN  505

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             RLVKIKTKVDP NFFR+EQSIP +P  +
Sbjct  506   RLVKIKTKVDPQNFFRNEQSIPVYPSWR  533



>ref|XP_009362286.1| PREDICTED: reticuline oxidase-like protein [Pyrus x bretschneideri]
Length=569

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/507 (65%), Positives = 422/507 (83%), Gaps = 4/507 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL + S PSHPI+P I+T NN S+SS+L+ YIRNLRFN S T+KP  I+TA H SH
Sbjct  34    TFVDCLLNHSQPSHPIAPAIHTSNNDSYSSILESYIRNLRFNTSTTRKPFLILTALHESH  93

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +Q S++CA+ H  QMK RSGGHD+EG+SYV++ PFFILDMFN RS++V I+ ETAW++AG
Sbjct  94    VQISVVCAQIHNFQMKIRSGGHDFEGLSYVAEFPFFILDMFNLRSIHVDIKSETAWIQAG  153

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY IA KS +HGFPAGVCPTVGVGGHF G GYGNMMRKYGL+VDNI+DA+L++V
Sbjct  154   ATLGELYYRIAEKSKIHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLSVDNIVDAQLVNV  213

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             +G+LLDRKSMGE+LFWAITGGG +SF VV++Y+INLVRVP  VT+F V RT +QNAT+IV
Sbjct  214   HGKLLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVRVPETVTVFKVPRTLEQNATDIV  273

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITT--HPGE--KTIRATFNALFLGDSKTLLSTMDES  1026
             Y +Q ++ KLD +LFIRL +D+VN TT    GE  KT+RA+F A+FLGDS+ LLS MD+S
Sbjct  274   YRWQYIADKLDNDLFIRLIMDIVNGTTSNSSGENNKTLRASFIAMFLGDSERLLSIMDKS  333

Query  1027  FPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             FPELG+ QSDC EM W +SVLF+TSFP+GT  E LLSR PQVL H KRKSDY++ P+P+ 
Sbjct  334   FPELGMKQSDCNEMSWAQSVLFWTSFPTGTATEALLSRTPQVLTHFKRKSDYVKKPIPKA  393

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G+++IF+KM+EL+ P+LTFNP+GG+M+EI ++A PFPHR+GN+ M+QYATNW+  G EA+
Sbjct  394   GLKWIFQKMIELEAPLLTFNPHGGKMSEISASATPFPHRAGNLWMVQYATNWNIQGTEAS  453

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
              HY+++TR+LY YMTPFVSKNPREAF +Y+DLD+G NHN     SY EG+ +G+KYF+ N
Sbjct  454   DHYIDLTRKLYMYMTPFVSKNPREAFYSYKDLDIGTNHNANGIASYLEGRVFGIKYFRHN  513

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             ++RLV +KTKVDP NFFR+EQSIP  P
Sbjct  514   FDRLVNVKTKVDPGNFFRNEQSIPPLP  540



>ref|XP_006468466.1| PREDICTED: reticuline oxidase-like protein-like [Citrus sinensis]
Length=538

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/502 (69%), Positives = 406/502 (81%), Gaps = 4/502 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++CL   S PSHPISP I+TP N SFSSVLQ  IRNLRFN + T KP  I+TA H SHIQ
Sbjct  39    IQCLLSHSQPSHPISPAIFTPQNSSFSSVLQAQIRNLRFNSTSTPKPFLIITALHESHIQ  98

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+I+CA++HGLQMK RSGGHDYEG+SYVS VPFF+LDMFN  SV+V IE ETAWV+ GAT
Sbjct  99    AAIICARKHGLQMKIRSGGHDYEGLSYVSHVPFFVLDMFNLHSVDVDIETETAWVQTGAT  158

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY I+ KS  HGFPAGVCPTVGVGGH GG GYGNMMRKYGLTVDNI+DAKL+DV+G
Sbjct  159   LGEVYYRISEKSKTHGFPAGVCPTVGVGGHIGGGGYGNMMRKYGLTVDNIVDAKLVDVSG  218

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             RLLDRKSMGE+LFWAI GGG +SF VVL+YRI LVRVP  VT+F VR+T +QNAT IVY 
Sbjct  219   RLLDRKSMGEDLFWAIRGGGGASFGVVLAYRIKLVRVPETVTVFQVRKTLEQNATEIVYR  278

Query  865   YQRMSHKLDP-NLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELG  1041
             +Q+++ K  P +LF+RL +DVVN  T  G KT+RA+F +LFLGDS  LLS M+ESFPELG
Sbjct  279   WQQVASKQLPDDLFVRLILDVVN-GTKSGTKTVRASFLSLFLGDSNRLLSIMNESFPELG  337

Query  1042  LTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
             L QSDC E  WI SVLF+T+F    P+  LL+R P  L  LKRKSDY++ P+P+NG+EFI
Sbjct  338   LAQSDCIETSWIRSVLFWTNFQIDDPLNILLNRTPPTLTFLKRKSDYVKQPIPKNGLEFI  397

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             +K+M+EL+TP + FNPYGG+MAEIPS A PFPHR+GN+  IQY TNW+E G +AA  YL 
Sbjct  398   WKRMIELETPQMIFNPYGGKMAEIPSTATPFPHRAGNLWKIQYVTNWNEPGTDAANRYLN  457

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
             +TR+LY YMTPFVSKNPR+AF NYRD+DLGINHN   + S+ E K YG+KYF  N+NRLV
Sbjct  458   LTRKLYGYMTPFVSKNPRQAFFNYRDIDLGINHNG--KASFEEAKAYGIKYFLGNFNRLV  515

Query  1582  KIKTKVDPDNFFRDEQSIPTFP  1647
             KIKTKVDP NFFR+EQSIP  P
Sbjct  516   KIKTKVDPGNFFRNEQSIPVLP  537



>ref|XP_007203267.1| hypothetical protein PRUPE_ppa019803mg [Prunus persica]
 gb|EMJ04466.1| hypothetical protein PRUPE_ppa019803mg [Prunus persica]
Length=535

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/514 (64%), Positives = 419/514 (82%), Gaps = 1/514 (0%)
 Frame = +1

Query  109   AWAPLCYCA-TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKP  285
             +W    Y A    ++CL + S PS+PI P IYTPNN S+SSVL+ Y+RNLRFN S T+KP
Sbjct  21    SWQASAYSAPEKFVQCLLNHSQPSYPIGPAIYTPNNASYSSVLKSYLRNLRFNTSSTRKP  80

Query  286   LFIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVS  465
               IVTA H SH++ S++CA+ H LQMK RSGGHDYEGVSYV++VPFFILDMFN RS+NV 
Sbjct  81    FLIVTALHESHVKLSVICAQVHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRSINVD  140

Query  466   IEDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTV  645
             I+ ETAWV+AGATLGEVYY I+ KS +HGF A V PTVGVGGHF G GYGNMMRKYGLTV
Sbjct  141   IKSETAWVQAGATLGEVYYRISEKSKIHGFSASVEPTVGVGGHFSGGGYGNMMRKYGLTV  200

Query  646   DNIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVR  825
             DN++DA+++DV+GRLLDRK+MGE+LFWAITGGG +SF VV++Y+INLVRVP  VT+F+V 
Sbjct  201   DNVVDAQIVDVHGRLLDRKAMGEDLFWAITGGGGASFGVVIAYKINLVRVPEIVTVFNVT  260

Query  826   RTYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTL  1005
             RT +QNAT IVY +Q ++ KLD +LFIRLT+ +VN +     KT+ A+F ++FLGDS+ L
Sbjct  261   RTLEQNATEIVYRWQYVADKLDDDLFIRLTMVIVNGSGGDNNKTLSASFMSMFLGDSERL  320

Query  1006  LSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYL  1185
             LS M++SFPELGL QSDCREM W+ES +F+  FP GT  E LLSR PQ   H KRKSDY+
Sbjct  321   LSVMNKSFPELGLKQSDCREMSWVESTVFWAPFPYGTSPERLLSRTPQFHKHFKRKSDYV  380

Query  1186  QTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWD  1365
             + P+P+ G+++IF+KM+EL +P L FNPYGGRM EI ++A PFPHR+GN+ M+QYAT+WD
Sbjct  381   KKPIPKAGLKWIFQKMIELVSPALAFNPYGGRMGEISASATPFPHRAGNLWMVQYATDWD  440

Query  1366  EHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYG  1545
             E G EA++H++++TR+L+ +MTPFVSKNPREA+ NY+DLD+GINHN   + SY EG+ YG
Sbjct  441   EEGSEASEHHIDLTRKLHMFMTPFVSKNPREAYFNYKDLDIGINHNANGKASYLEGRVYG  500

Query  1546  LKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             +KYFK+N++RLV +KTKVDP NFFR+EQSIPT P
Sbjct  501   IKYFKDNFDRLVHVKTKVDPSNFFRNEQSIPTLP  534



>ref|XP_009362285.1| PREDICTED: reticuline oxidase-like protein [Pyrus x bretschneideri]
Length=537

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/505 (66%), Positives = 416/505 (82%), Gaps = 4/505 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             + CL + S PSHPI+P IY+PNN S+SSVL+ YIRNLRFN S T+KP  I+TA H SH+Q
Sbjct  32    VHCLLNHSQPSHPIAPAIYSPNNASYSSVLESYIRNLRFNTSTTRKPFLILTALHESHVQ  91

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
              S++CA+ H LQMK RSGGHDYEGVSYV++VPFFILDMFN RS++V I+ ETAW +AGAT
Sbjct  92    ISVVCAQIHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRSIHVDIKSETAWAQAGAT  151

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY IA KS +HGFPAGV PTVGVGGHF G GYGNMMRKYGL+VDNI+DA+L++V+G
Sbjct  152   LGELYYRIAEKSKIHGFPAGVRPTVGVGGHFSGGGYGNMMRKYGLSVDNIVDAQLVNVHG  211

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              LLDRKSMGE+LFWA+TGGG +SF VV++Y+INLVRVP  VT+F+V R  +QNAT+IVY 
Sbjct  212   ELLDRKSMGEDLFWAVTGGGGASFGVVIAYKINLVRVPEIVTVFNVSRILEQNATDIVYR  271

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTH----PGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             +Q ++HKLD +LFIRLT+DV N T+        KT+RA+F A+FL DS+ LLS M++SFP
Sbjct  272   WQYIAHKLDDDLFIRLTMDVRNGTSSNNSGGNNKTLRASFLAMFLRDSERLLSIMNKSFP  331

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL QSDC EM W +SVLF+T FP+GT  E LLSR  Q L HLKRKSDY++ P+P+ G+
Sbjct  332   ELGLKQSDCAEMSWAQSVLFWTKFPTGTATEALLSRKHQALTHLKRKSDYVKKPIPKTGL  391

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
              +IF+KM+EL+ PMLTFNPYGG+M+EI ++A PFPH++GN+  +QYATNWD  G +AA H
Sbjct  392   MWIFQKMIELEAPMLTFNPYGGKMSEISASATPFPHKAGNLWKVQYATNWDILGTKAADH  451

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             Y+E+TR+L+ YMTPFVSKNPREAF +Y+DLD+GINHN     SY EG+ YG+KYFK N++
Sbjct  452   YIELTRKLHMYMTPFVSKNPREAFYSYKDLDIGINHNANGISSYLEGRVYGIKYFKHNFD  511

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLV +KTKV+P NFFR+EQSIPT P
Sbjct  512   RLVNVKTKVNPGNFFRNEQSIPTLP  536



>gb|KEH37087.1| FAD-binding berberine family protein [Medicago truncatula]
Length=537

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/510 (66%), Positives = 417/510 (82%), Gaps = 6/510 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T + CL + S PSHPI+  I+TPNN SFSSVL +Y+RNLRFN S T+KP  I+TA H+SH
Sbjct  29    TFIHCLVNHSQPSHPITSSIFTPNNSSFSSVLNDYVRNLRFNTSTTRKPYLIITALHVSH  88

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQASI+CAK+H LQMK RSGGHDYEGVSYV++VPFFILDMFN RS+ V +E+ETAWV+ G
Sbjct  89    IQASIICAKQHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRSIQVDVENETAWVQTG  148

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             A LGE+YY I  KS VHGFPAGVCPTVGVGGH  G GYGNMMRKYGL+VDNIIDA++IDV
Sbjct  149   AQLGELYYRINEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMMRKYGLSVDNIIDAQIIDV  208

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGRLLDRKSMGE+LFWAI GGG +SF VVLSY+I LV+VP  VT+F +R+T DQNA++IV
Sbjct  209   NGRLLDRKSMGEDLFWAIKGGGGASFGVVLSYKIKLVKVPKIVTVFQIRKTLDQNASDIV  268

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNIT---THPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
             Y +Q ++  +D +LFIRL +DVVN+T   T+ G KTIRATF +LFLGDSKTL+S M+E F
Sbjct  269   YNWQHVAPTIDNDLFIRLIIDVVNVTQNATNNGAKTIRATFISLFLGDSKTLVSLMNEKF  328

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLV-HLKRKSDYLQTPMPRN  1206
             P+LGL +SDC E  W++SVLF+T+    TPVE LL+R PQ LV +LKRKSDY++ P+   
Sbjct  329   PQLGLKESDCIETSWLQSVLFWTNIDITTPVEILLNRKPQSLVNYLKRKSDYVKEPISSK  388

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G+E I+KKM+EL+  +L FNPYGG+MAEI S   PFPHR+GN+  +QY  NW++ G + A
Sbjct  389   GLEGIWKKMIELEDAILYFNPYGGKMAEISSTDTPFPHRAGNLWKVQYQANWNKAGKDVA  448

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
              HY+ +TR+L+ YMTPFVSKNPREAF NY+DLDLGINHN   + SY EG+ YG++YFK+N
Sbjct  449   DHYIGLTRKLHRYMTPFVSKNPREAFFNYKDLDLGINHNG--KNSYAEGRVYGVEYFKDN  506

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             ++RLV+IKTKVDPDNFFR+EQSIPT P RK
Sbjct  507   FDRLVEIKTKVDPDNFFRNEQSIPTLPHRK  536



>ref|XP_006448845.1| hypothetical protein CICLE_v10018073mg [Citrus clementina]
 gb|ESR62085.1| hypothetical protein CICLE_v10018073mg [Citrus clementina]
Length=535

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/503 (68%), Positives = 406/503 (81%), Gaps = 4/503 (1%)
 Frame = +1

Query  142   VLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHI  321
             +++CL   S PSHPISP I+TP N SFSSVLQ  IRNLRFN + T KP  I+TA H SHI
Sbjct  35    LIQCLLSHSQPSHPISPAIFTPQNSSFSSVLQAQIRNLRFNSTSTPKPFLIITALHESHI  94

Query  322   QASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGA  501
             QA+I+CA++HGLQMK RSGGHDYEG+SYVS VPFF+LDMFN  SV+V +E ETAWV+ GA
Sbjct  95    QAAIICARKHGLQMKIRSGGHDYEGLSYVSHVPFFVLDMFNLHSVDVDVETETAWVQTGA  154

Query  502   TLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVN  681
             TLGEVYY I+ KS  HGFPAGVCPTVGVGGH GG GYGNMMRKYGLTVDNI+DAKL+DVN
Sbjct  155   TLGEVYYRISEKSKTHGFPAGVCPTVGVGGHIGGGGYGNMMRKYGLTVDNIVDAKLVDVN  214

Query  682   GRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVY  861
             GRLLDRKSMGE+LFWAI GGG +SF VVL+YRI LVRVP  VT+F VR+T +QNAT IV 
Sbjct  215   GRLLDRKSMGEDLFWAIRGGGGASFGVVLAYRIKLVRVPETVTVFQVRKTLEQNATEIVC  274

Query  862   CYQRMSHKLDP-NLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
              +Q+++ K  P +LF+RL +DVVN  T  G KT+RA+F +LFLGDS  LLS M+ESFPEL
Sbjct  275   RWQQVASKQLPDDLFVRLILDVVN-GTKSGTKTVRASFLSLFLGDSNRLLSIMNESFPEL  333

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL QSDC E  WI SVLF+T+F    P+  LL+R P  L  LKRKSDY++ P+P+NG+EF
Sbjct  334   GLAQSDCIETSWIRSVLFWTNFQIDDPLNILLNRTPPTLTFLKRKSDYVKQPIPKNGLEF  393

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+K+M+EL+TP + FNPYGG+MAEIPS A PFPHR+GN+  IQY TNW+E G +AA  YL
Sbjct  394   IWKRMIELETPQMIFNPYGGKMAEIPSTATPFPHRAGNLWKIQYVTNWNEPGTDAANRYL  453

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              +TR+LY YMTPFVSKNPR+AF NYRD+DLGINHN   + S+ E K YG+KYF  N+NRL
Sbjct  454   NLTRKLYGYMTPFVSKNPRQAFFNYRDIDLGINHNG--KASFEEAKAYGIKYFLGNFNRL  511

Query  1579  VKIKTKVDPDNFFRDEQSIPTFP  1647
             VKIKTKVDP NFFR+EQSIP  P
Sbjct  512   VKIKTKVDPGNFFRNEQSIPVLP  534



>gb|EYU19100.1| hypothetical protein MIMGU_mgv1a004305mg [Erythranthe guttata]
Length=534

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/506 (71%), Positives = 419/506 (83%), Gaps = 11/506 (2%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++CL  +S+PS PIS V+Y  NN S+SSVL+ YIRNLRFNES T KP  I+TA H+SHIQ
Sbjct  38    IQCLKIKSDPSSPISAVLYDENNSSYSSVLETYIRNLRFNESTTPKPRLIITAKHVSHIQ  97

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVP-FFILDMFNFRSVNVSIEDETAWVEAGA  501
             A+I+CAK +G+QMK RSGGHDYEGVSY S VP FFILDMFNFRSVNVSIEDE+AWVE+GA
Sbjct  98    AAIVCAKANGMQMKIRSGGHDYEGVSYWSAVPNFFILDMFNFRSVNVSIEDESAWVESGA  157

Query  502   TLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVN  681
              LGE+YY IA KS+ HGFPAGVCPTVGVGGHF G GYGNMMRKYGL+VDNI+DA++IDVN
Sbjct  158   LLGEIYYRIAEKSSTHGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLSVDNIVDAQMIDVN  217

Query  682   GRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVY  861
             G+LLDRKSMGE+LFWAITGGG SSF VVLSY+I LV VP  VT+F VRRTYD+N + +VY
Sbjct  218   GKLLDRKSMGEDLFWAITGGGGSSFGVVLSYKIKLVSVPKIVTVFRVRRTYDRNLSELVY  277

Query  862   CYQRMS-HKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
              YQ+++  KL   LF+RLT+DVVN T        RATF A+FLG+S+ LLS M+ SFPEL
Sbjct  278   RYQQVAADKLPEELFLRLTLDVVNGTN-------RATFLAMFLGNSQQLLSVMNLSFPEL  330

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL Q+DC EM W+ESVLF+T+FP+GTPV  LLSRVPQ L +LKRKSDYL+ P+P+ G+E 
Sbjct  331   GLNQTDCTEMSWVESVLFWTNFPAGTPVNALLSRVPQSLTYLKRKSDYLKKPIPKQGLEL  390

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             +FKKMVELQTP LTFNPYGGRMAEIPS+ KPFPHR+GNIA +QYATNW+E G EAA  YL
Sbjct  391   LFKKMVELQTPQLTFNPYGGRMAEIPSSEKPFPHRAGNIAKLQYATNWNEDGEEAANRYL  450

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              +T +L+ +MTP+VS  PREAFLNYRDLD+G N N   R SY EG  YG+KYFK+N+NRL
Sbjct  451   NLTAELFAFMTPYVSMAPREAFLNYRDLDIGTNSNG--RNSYIEGAVYGVKYFKDNFNRL  508

Query  1579  VKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             VKIKTKVDP NFFR+EQSIP  P RK
Sbjct  509   VKIKTKVDPRNFFRNEQSIPVLPWRK  534



>ref|XP_008360665.1| PREDICTED: reticuline oxidase-like protein [Malus domestica]
Length=542

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/505 (68%), Positives = 418/505 (83%), Gaps = 4/505 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             + CL + S PSHPI+P IY+PNN S+SSVL+ YI NLRFN S T+KP  I+TA H SH+Q
Sbjct  37    VHCLLNHSQPSHPIAPAIYSPNNASYSSVLESYIXNLRFNTSTTRKPFLILTALHESHVQ  96

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
              S++CA+ H LQMK RSGGHDYEGVSYV+ VPFFILDMFN RS++V I+  TAWV+AGAT
Sbjct  97    ISVVCAQIHNLQMKIRSGGHDYEGVSYVAXVPFFILDMFNLRSIHVDIKSXTAWVQAGAT  156

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEV Y IA KS  HGFPAGV PTVGVGGHF G GYGNMMRKYGL+VDNI+DA+L++V+G
Sbjct  157   LGEVXYRIAEKSKTHGFPAGVXPTVGVGGHFSGGGYGNMMRKYGLSVDNIVDAQLVNVHG  216

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              LLDRKSMGE+LFWAITGGG +SF VV++Y+INLVRVP  VT+F V RT +QNAT+IVY 
Sbjct  217   ELLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVRVPEIVTVFRVSRTLEQNATDIVYR  276

Query  865   YQRMSHKLDPNLFIRLTVDVVNITT--HPGE--KTIRATFNALFLGDSKTLLSTMDESFP  1032
             +Q ++ KLD +LFIRLT+DVVN T+    GE  KT+RA+F A+FLGDS+ LLS M++SFP
Sbjct  277   WQYIADKLDDDLFIRLTMDVVNGTSSNSSGENNKTLRASFIAMFLGDSERLLSIMNKSFP  336

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL QSDC EM W +SVLF+TSFP+GT  E LLSR PQVL  LKRKSDY++ P+P+ G+
Sbjct  337   ELGLKQSDCAEMSWAQSVLFWTSFPTGTSTEALLSRTPQVLTRLKRKSDYVKKPIPKTGL  396

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             ++IF+KM+EL+ PMLTFNPYGG+M+EI ++A PFPHR+GN+  +QYATNWD  G EA+ H
Sbjct  397   KWIFQKMIELEAPMLTFNPYGGKMSEISASATPFPHRAGNLWKVQYATNWDILGTEASDH  456

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             Y+E+TR+L+ YMTPFVSKNPREAF NY+DLD+GINHN     SY EG+ YG+KYFK N++
Sbjct  457   YIELTRKLHMYMTPFVSKNPREAFYNYKDLDIGINHNANGMSSYLEGRVYGIKYFKHNFD  516

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLV +KTKVDP NFFR+EQSIPT P
Sbjct  517   RLVNVKTKVDPGNFFRNEQSIPTLP  541



>ref|XP_006448838.1| hypothetical protein CICLE_v10014838mg [Citrus clementina]
 gb|ESR62078.1| hypothetical protein CICLE_v10014838mg [Citrus clementina]
Length=538

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/502 (68%), Positives = 405/502 (81%), Gaps = 4/502 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++CL   S PSHPISP I+TP N SFSSVLQ  IRNLRFN + T KP  I+TA H SHIQ
Sbjct  39    IQCLLSHSQPSHPISPAIFTPQNSSFSSVLQAQIRNLRFNSTSTPKPFLIITALHESHIQ  98

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+I+CA++HGLQMK RSGGHDYEG+SYVS VPFF+LDMFN  SV+V +E ETAWV+ GAT
Sbjct  99    AAIICARKHGLQMKIRSGGHDYEGLSYVSHVPFFVLDMFNLHSVDVDVETETAWVQTGAT  158

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY I+ KS  HGFPAGVCPTVGVGGH GG GYGNMMRKYGLTVDNI+DAKL+DV+G
Sbjct  159   LGEVYYRISEKSKTHGFPAGVCPTVGVGGHIGGGGYGNMMRKYGLTVDNIVDAKLVDVSG  218

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             RLLDRKSMGE+LFWAI GGG +SF VVL+YRI LVRVP  VT+F VR+T +QNAT IVY 
Sbjct  219   RLLDRKSMGEDLFWAIRGGGGASFGVVLAYRIKLVRVPETVTVFQVRKTLEQNATEIVYR  278

Query  865   YQRMSHKLDP-NLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELG  1041
             +Q+++ K  P +LF+RL +DVVN  T  G KT+RA+F +LFLGDS  LLS M+ESFPELG
Sbjct  279   WQQVASKQLPDDLFVRLILDVVN-GTKSGTKTVRASFLSLFLGDSNRLLSIMNESFPELG  337

Query  1042  LTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
             L QSDC E  WI SVLF+T+F    P+  LL+R P  L  LKRKSDY++ P+P+ G+EFI
Sbjct  338   LAQSDCIETSWIRSVLFWTNFQIDDPLNILLNRTPPTLTFLKRKSDYVKQPIPKKGLEFI  397

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             +K+M+EL+TP + FNPYGG+MAEIPS A PFPHR+GN+  IQY TNW+E G +AA  YL 
Sbjct  398   WKRMIELETPQMIFNPYGGKMAEIPSTATPFPHRAGNLWKIQYVTNWNEPGTDAANRYLN  457

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
             +TR+LY YMTPFVSKNPR+AF NYRD+DLGINHN   + S+ E K YG+KYF  N+NRLV
Sbjct  458   LTRKLYGYMTPFVSKNPRQAFFNYRDIDLGINHNG--KASFEEAKAYGIKYFLGNFNRLV  515

Query  1582  KIKTKVDPDNFFRDEQSIPTFP  1647
             KIKTKVDP NFFR+EQSIP  P
Sbjct  516   KIKTKVDPGNFFRNEQSIPVLP  537



>ref|XP_010674638.1| PREDICTED: reticuline oxidase-like protein [Beta vulgaris subsp. 
vulgaris]
Length=538

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/503 (66%), Positives = 414/503 (82%), Gaps = 3/503 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T++ CLND S PSHPISP IY P N SFS+VLQ YIRNLRFNES T+KPLFI+TATH+SH
Sbjct  38    TLINCLNDHSVPSHPISPQIYAPQNPSFSTVLQSYIRNLRFNESTTRKPLFIITATHVSH  97

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQA+I+CAK+HG++MK RSGGHDYEG+SYVS VPFF++DMFNFRS++V+I++ETAWV+AG
Sbjct  98    IQAAIICAKQHGIEMKVRSGGHDYEGLSYVSIVPFFMVDMFNFRSIDVNIDEETAWVDAG  157

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             +TLGEVYY I N S +H +PAGVCPTVG GGH  GAGYGN+MRKYGLTVDN+IDAK++DV
Sbjct  158   STLGEVYYNIGNNSRIHAYPAGVCPTVGSGGHITGAGYGNLMRKYGLTVDNLIDAKIVDV  217

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGR+LDR +MGE+LFWAI GGG +SF V+LSY+I LVRVP +VT+F V R  +QN T+IV
Sbjct  218   NGRILDRATMGEDLFWAIKGGGGASFCVILSYKIKLVRVPERVTVFRVSRLLEQNLTDIV  277

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
               YQ ++  LD N FIRLT+ V N ++  G  T +ATF  LFLGD+++L+S + E+FP L
Sbjct  278   DQYQHVAPNLDHNAFIRLTLGVTN-SSETGLLTNQATFRCLFLGDTESLISLVHENFPLL  336

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL +SDC EM W+ES+LFY+ +  GTPVE LL R P  + +LKRKSDY++ P+PR G+E 
Sbjct  337   GLEKSDCLEMSWLESILFYSDYSMGTPVETLLDRQPPSVTYLKRKSDYVKKPIPRYGLEG  396

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             ++K MVELQ   LTFNPYGGRMAEI + A PFPHR+GN+  +QYA NW+E G E A++Y+
Sbjct  397   LWKIMVELQPLQLTFNPYGGRMAEIAANATPFPHRAGNLFKLQYAINWNEGGSERAKYYI  456

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             ++TR+L+ YMTPFVSKNPREAFLNYRDLDLGINH   R  SY EGK YG+ YFK+N++RL
Sbjct  457   DLTRKLHAYMTPFVSKNPREAFLNYRDLDLGINHQGSR--SYVEGKKYGVMYFKDNFDRL  514

Query  1579  VKIKTKVDPDNFFRDEQSIPTFP  1647
             VKIK+ VDPDNFFR+EQSIPT P
Sbjct  515   VKIKSMVDPDNFFRNEQSIPTLP  537



>ref|XP_007023039.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY25661.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=575

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/503 (66%), Positives = 410/503 (82%), Gaps = 2/503 (0%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T L+CL D S+PS+PIS  I+TP N S+SSVLQ  IRNLRFNE++T KP  I+TA H SH
Sbjct  71    TFLQCLLDNSHPSYPISEAIFTPQNPSYSSVLQSSIRNLRFNETFTPKPFLILTAKHESH  130

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQA+I+CA++  +QMK RSGGHDYEG+SYV+ VPFF+LDMFN RS++V + +ETAWV+ G
Sbjct  131   IQAAIVCARKDNIQMKIRSGGHDYEGLSYVATVPFFVLDMFNLRSIDVDVANETAWVQTG  190

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY I+ KS  HGFPAGVCPTVGVGGHFGG GYGNMMRKYGL+VDNI+DA  IDV
Sbjct  191   ATLGEVYYRISEKSKTHGFPAGVCPTVGVGGHFGGGGYGNMMRKYGLSVDNIVDAYFIDV  250

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGRL DRKSMGE++FWAI GGGA+SF VVL+Y+I LVRVP  VT+F V +T ++NAT+IV
Sbjct  251   NGRLHDRKSMGEDIFWAIRGGGAASFGVVLAYKIKLVRVPETVTVFRVEKTLEENATDIV  310

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
               +Q ++ KL  +LF+RL +DVVN + + GEKT+RA F +LFLGDS+ LLS M+E FP L
Sbjct  311   DQWQHVADKLPEDLFVRLVLDVVNSSRNTGEKTVRAAFISLFLGDSERLLSIMNERFPAL  370

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GLTQSDC E  W++SVLF+T+ P  T    LL R P  LV LKRKSDY++ P+P+ G+E+
Sbjct  371   GLTQSDCIETSWVQSVLFWTNIPIETETAILLDRTPSSLVFLKRKSDYVKKPIPKAGLEW  430

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             ++K+M+ELQ P L FNPYGGRMAEIPS A PFPHR+GN+  IQY TNW+E G EAA HY+
Sbjct  431   LWKRMIELQVPQLLFNPYGGRMAEIPSTATPFPHRAGNLWKIQYVTNWNEAGTEAADHYI  490

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              +TR+L+ YMT FVSKNPREAFLNYRD+DLG+NHN   R+SY EG+ YG+KYFK N+NRL
Sbjct  491   GLTRKLHGYMTRFVSKNPREAFLNYRDIDLGVNHNG--RQSYMEGRVYGIKYFKGNFNRL  548

Query  1579  VKIKTKVDPDNFFRDEQSIPTFP  1647
             V+IKT+VDP NFFR+EQSIPT P
Sbjct  549   VQIKTRVDPGNFFRNEQSIPTLP  571



>ref|XP_007226571.1| hypothetical protein PRUPE_ppa024148mg [Prunus persica]
 gb|EMJ27770.1| hypothetical protein PRUPE_ppa024148mg [Prunus persica]
Length=542

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/507 (66%), Positives = 417/507 (82%), Gaps = 8/507 (2%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++CL   S PSHPIS  IY PNN S+SSVL+ YIRNLRFN S T KP  I+T  H SH+Q
Sbjct  38    VQCLLSHSQPSHPISEAIYIPNNASYSSVLRSYIRNLRFNTSSTPKPFLIITPLHESHVQ  97

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
              +I+CA++  L MK RSGGHDYEGVSYVSDVPFF+LDMFN RS+++ I  ETAWV+AGAT
Sbjct  98    QAIVCAQKQNLLMKIRSGGHDYEGVSYVSDVPFFLLDMFNLRSIDIDINSETAWVQAGAT  157

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE++Y I  KS +HGFPAGVCPTVGVGGHF GAGYGN+MRKYGL+VDNIIDA+L+DV+G
Sbjct  158   LGELFYRIYEKSKIHGFPAGVCPTVGVGGHFSGAGYGNLMRKYGLSVDNIIDAQLMDVHG  217

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             RLLDRKSMGE+LFWAITGGG +SF VV++Y+INLVRVP  VT+F V RT +QNAT+IVY 
Sbjct  218   RLLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVRVPQTVTVFRVERTLEQNATDIVYR  277

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHP----GE--KTIRATFNALFLGDSKTLLSTMDES  1026
             +Q ++ KLD +LFIRLT++VVNIT  P    GE  KTIRA+F   FLG+S+ LLS M+  
Sbjct  278   WQYVAPKLDTDLFIRLTMEVVNITGGPLSTGGENYKTIRASFIGFFLGNSERLLSVMETG  337

Query  1027  FPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             FPEL L QSDC EM W+ESVLF+TSFP GT  E LLSR PQVLVHLKRKSDY++TP+P+ 
Sbjct  338   FPELSLKQSDCIEMSWVESVLFWTSFPIGTEPEALLSRKPQVLVHLKRKSDYVKTPIPKI  397

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G+ +I++KM+E + P+++FNPYGG+M+EIP +A P PHR+GN+  IQYATNW+  G EA+
Sbjct  398   GLMWIWQKMIEFEVPIMSFNPYGGKMSEIPESATPCPHRAGNLWKIQYATNWEVSGAEAS  457

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
              ++L +T++LY YMTPFVS NPREA+ NY+DLDLGIN+N   + SYFEGK YG++YFK+N
Sbjct  458   DYHLNLTKKLYFYMTPFVSMNPREAYFNYKDLDLGINNNG--KASYFEGKAYGIRYFKDN  515

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             ++RLV+IKT+VDP NFFR+EQSIPT P
Sbjct  516   FDRLVRIKTEVDPGNFFRNEQSIPTLP  542



>gb|KDO48902.1| hypothetical protein CISIN_1g009297mg [Citrus sinensis]
Length=538

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/513 (65%), Positives = 407/513 (79%), Gaps = 2/513 (0%)
 Frame = +1

Query  109   AWAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             +W+       +  +CL + S PSHPI   I+TP N S+SSVLQ YIRNLRFN S T KP+
Sbjct  22    SWSWRVNSHESFHQCLLNNSPPSHPIFQAIHTPQNSSYSSVLQSYIRNLRFNTSSTPKPV  81

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
              IV A H SH+QA+I+CAK+H LQMK RSGGHDYEG+SYVS+VPFFILDMFN RS++V I
Sbjct  82    LIVAAMHESHVQAAIICAKKHNLQMKIRSGGHDYEGLSYVSNVPFFILDMFNLRSIDVDI  141

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
             E ETAWV+AGA LGEV+Y IA KS  HGFPAGVCPTVGVGGHF   GYGNMMRKYGL+VD
Sbjct  142   ESETAWVQAGAILGEVFYRIAEKSKTHGFPAGVCPTVGVGGHFSAGGYGNMMRKYGLSVD  201

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             NI+DAKL+DVNGR+LDR SMGE+LFWAI GGGAS F VVL+Y+INLV VP  VT+F V +
Sbjct  202   NIVDAKLVDVNGRILDRNSMGEDLFWAIRGGGAS-FGVVLAYKINLVPVPETVTVFKVEK  260

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T +Q+AT+ V  +Q ++HKLD  LFIRL +DVVN +T  GE+T+RATF ALFLG S+ LL
Sbjct  261   TLEQDATDAVDKWQHVAHKLDDGLFIRLVLDVVNSSTRTGERTVRATFIALFLGGSERLL  320

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQ  1188
             S  D+ FPELGLT+SDC E+ WI+SV+++ SFP+GTP   LL R P  L  LKRKSDY+ 
Sbjct  321   SITDKGFPELGLTRSDCTELSWIDSVVYWGSFPAGTPASVLLDRTPLTLSSLKRKSDYVT  380

Query  1189  TPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDE  1368
              P+PR G+E ++KKM+EL+ P + FNPYGG+M EIP+ A PFPHR GN+  IQY TNW+E
Sbjct  381   EPIPREGLEGLWKKMIELERPYMNFNPYGGKMHEIPATASPFPHRDGNLWKIQYVTNWNE  440

Query  1369  HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGL  1548
              G +AA +Y+++TRQLY+Y+TPFVSKNPR++FL YRDLDLG N++K     Y EG+ YG+
Sbjct  441   EGVDAANYYIDLTRQLYDYLTPFVSKNPRQSFLAYRDLDLGTNNHK-FETGYSEGRAYGI  499

Query  1549  KYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
              YF EN++RLV+IKTKVDPDNFFR+EQSIP  P
Sbjct  500   NYFLENFDRLVEIKTKVDPDNFFRNEQSIPVLP  532



>ref|XP_008352411.1| PREDICTED: LOW QUALITY PROTEIN: reticuline oxidase-like protein 
[Malus domestica]
Length=524

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/487 (67%), Positives = 403/487 (83%), Gaps = 3/487 (1%)
 Frame = +1

Query  196   IYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQASILCAKEHGLQMKARS  375
             IY+PNN S+SSV   YIRNLRFN S T+KP  I+TA H SH+Q S++CA+ H LQMK RS
Sbjct  11    IYSPNNASYSSVFXSYIRNLRFNTSTTRKPFLILTALHESHVQISVVCAQIHNLQMKIRS  70

Query  376   GGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATLGEVYYGIANKSNVHGF  555
             GGHDYEGVSYV++VPFFILDMFN RS++V I+ ETAWV+ GATLGEVYY IA KS  HGF
Sbjct  71    GGHDYEGVSYVAEVPFFILDMFNLRSIHVDIKSETAWVQTGATLGEVYYRIAEKSKTHGF  130

Query  556   PAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGRLLDRKSMGEELFWAIT  735
             PAGVCPTVGVGGHF G GYGNMMRKYGL+VDNI+DA+L++V+G LLDRK+MGE+LFWAIT
Sbjct  131   PAGVCPTVGVGGHFSGGGYGNMMRKYGLSVDNIVDAQLVNVHGELLDRKTMGEDLFWAIT  190

Query  736   GGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCYQRMSHKLDPNLFIRLT  915
             GGG +SF VV++Y+INLV VP  VT+F V RT ++NAT+IVY +Q ++ KLD +LFIRLT
Sbjct  191   GGGGASFGVVIAYKINLVHVPETVTVFRVPRTLEENATDIVYRWQYIADKLDDDLFIRLT  250

Query  916   VDVVNITTH-PGE--KTIRATFNALFLGDSKTLLSTMDESFPELGLTQSDCREMRWIESV  1086
             +D+VN TT+  GE  KT+RA+F A+FLGDS+ LLS +D+SFPELG+ QSDC EM W +SV
Sbjct  251   MDIVNGTTNCSGENNKTLRASFIAMFLGDSERLLSILDKSFPELGVKQSDCNEMSWAQSV  310

Query  1087  LFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFKKMVELQTPMLTFN  1266
             LF+TSFP+GT  E LLSR PQVL HL RKSDY++ P+P+ G+ +IF+KM+EL+ P +TFN
Sbjct  311   LFWTSFPTGTATEALLSRTPQVLTHLTRKSDYVKKPIPKTGLMWIFQKMIELEAPTMTFN  370

Query  1267  PYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEITRQLYEYMTPFVSK  1446
             PYGG+M+EI + A PFPHR+GN+  IQYATNW+  G EA+ HY+++TR+L+ YMTPFVSK
Sbjct  371   PYGGKMSEISALATPFPHRAGNLWKIQYATNWNIEGTEASDHYIDLTRKLHMYMTPFVSK  430

Query  1447  NPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVKIKTKVDPDNFFRDE  1626
             NPREAF NY+DLD+GINHN     SY EG+ +G+ YF  N++RLV +KTKVDP NFFR+E
Sbjct  431   NPREAFYNYKDLDIGINHNANGMASYLEGRGFGIMYFMHNFDRLVNVKTKVDPGNFFRNE  490

Query  1627  QSIPTFP  1647
             QSIPT P
Sbjct  491   QSIPTLP  497



>ref|XP_004486494.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=547

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/506 (65%), Positives = 414/506 (82%), Gaps = 3/506 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T + CL + S  S+PI+  I+TPNN SFSSVLQ YIRNLRFN S T+KP  I+TA H+SH
Sbjct  44    TFIHCLVNHSQTSYPITSAIFTPNNPSFSSVLQAYIRNLRFNTSTTRKPFLIITALHVSH  103

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQASI+CA++H LQMK RSGGHDYEGVSYV++VPFFILDMFN RS+++ IE+ETAW+++G
Sbjct  104   IQASIICAQKHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRSIDIDIENETAWIQSG  163

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KS +HGFPAGVCPTVGVGGH  G GYGN+MRKYGL+VDN+IDA++IDV
Sbjct  164   ATLGEVYYRIAEKSEIHGFPAGVCPTVGVGGHVSGGGYGNLMRKYGLSVDNVIDAQIIDV  223

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NG+LLDR+ MGE+LFWAI GGG +SF VVLSY+I LV+VP  VT+F VR+T ++NATNIV
Sbjct  224   NGKLLDREEMGEDLFWAIRGGGGASFGVVLSYKIKLVKVPKIVTVFQVRKTLEENATNIV  283

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++  +D +LFIRL +DVVN TT  G KTIRA+F AL+LGDSK+L+S M++SFP+L
Sbjct  284   YNWQHVAPTIDNDLFIRLIMDVVN-TTKNGTKTIRASFIALYLGDSKSLVSLMNKSFPQL  342

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL +SDC E  WI+SVLF+T+      VE LL R PQ L +LKRKSDY++ P+ + G+E 
Sbjct  343   GLKESDCIETSWIKSVLFWTNINLTEKVEILLDRQPQSLNYLKRKSDYVKKPISKKGLEG  402

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+KKM+EL+  +L FNPYGG+MAEI S   PFPHR+GN+  +QY  NW+E G + A + +
Sbjct  403   IWKKMIELEGAILYFNPYGGKMAEISSKETPFPHRAGNLWKVQYQANWNEAGKDVADYNI  462

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              +TR+L++YMTPFVSKNPREAF NY+DLDLGINHN   + SY EG+ YG++YFK+N+NRL
Sbjct  463   NLTRKLHKYMTPFVSKNPREAFFNYKDLDLGINHNG--KDSYIEGRVYGVEYFKDNFNRL  520

Query  1579  VKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             V+IK+KVDPDNFFR+EQSIP  P RK
Sbjct  521   VEIKSKVDPDNFFRNEQSIPILPHRK  546



>ref|XP_002523152.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39183.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=511

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/503 (66%), Positives = 406/503 (81%), Gaps = 4/503 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T  + L + S+PSHPIS  IYTP + S+ S+LQ YIRNLRFN S T KPL I+TA H SH
Sbjct  11    TFHQSLLNFSHPSHPISNAIYTPQHPSYPSILQAYIRNLRFNTSKTPKPLLILTALHESH  70

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA++L AK+HGLQMK RSGGHDYEG SYVSDVPFFILDM+N RS+++ +E+ETAWV+AG
Sbjct  71    VQAAVLAAKKHGLQMKIRSGGHDYEGTSYVSDVPFFILDMYNLRSIDIDLENETAWVQAG  130

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE++YGIA +S   GFPAGVCPTVGVGGH  GAGYGN+MRKYGL+VDN+IDAKL+D 
Sbjct  131   ATLGELFYGIAERSKTRGFPAGVCPTVGVGGHLVGAGYGNLMRKYGLSVDNVIDAKLVDA  190

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GR+LDRKSMGE LFWAI GGGA SF VVL+Y+INLVRVP  VT+F V RT +QNAT+IV
Sbjct  191   EGRILDRKSMGENLFWAIKGGGA-SFGVVLAYKINLVRVPEVVTVFRVERTLEQNATDIV  249

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q  + ++D +LFIRL +DV+      G+KT+R +F ALFLGDS+ LLS M ESFPEL
Sbjct  250   YQWQHAAPEIDEDLFIRLVLDVLK-NDQTGQKTVRGSFIALFLGDSERLLSIMKESFPEL  308

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL +SDC EM W+ESVLF+T++P GTP +  LSR PQ LV+LKRKSDY+Q P+ + G+E 
Sbjct  309   GLLKSDCIEMSWLESVLFWTNYPIGTPTDVCLSREPQTLVYLKRKSDYVQEPISKQGLEG  368

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+KKM+EL+ PM+ FNPYGG+M EI     PFPHR+GN+  IQY  NW + G EAA H+L
Sbjct  369   IWKKMMELEVPMMGFNPYGGKMKEIAETETPFPHRAGNLWKIQYQINWTQEGEEAANHHL  428

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             ++ RQLY+YMTPFVSKNPR AFLNY+DLDLGIN++   ++SY  G  YG+KYFK N+NRL
Sbjct  429   DLARQLYDYMTPFVSKNPRAAFLNYKDLDLGINNHD--KESYKVGSAYGIKYFKNNFNRL  486

Query  1579  VKIKTKVDPDNFFRDEQSIPTFP  1647
             V+IKTK DPDNFFR EQS+PTFP
Sbjct  487   VQIKTKFDPDNFFRHEQSVPTFP  509



>ref|XP_006432918.1| hypothetical protein CICLE_v10000808mg [Citrus clementina]
 ref|XP_006432919.1| hypothetical protein CICLE_v10000808mg [Citrus clementina]
 ref|XP_006471689.1| PREDICTED: reticuline oxidase-like protein-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471690.1| PREDICTED: reticuline oxidase-like protein-like isoform X2 [Citrus 
sinensis]
 ref|XP_006471691.1| PREDICTED: reticuline oxidase-like protein-like isoform X3 [Citrus 
sinensis]
 ref|XP_006471692.1| PREDICTED: reticuline oxidase-like protein-like isoform X4 [Citrus 
sinensis]
 gb|ESR46158.1| hypothetical protein CICLE_v10000808mg [Citrus clementina]
 gb|ESR46159.1| hypothetical protein CICLE_v10000808mg [Citrus clementina]
Length=538

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/500 (65%), Positives = 403/500 (81%), Gaps = 2/500 (0%)
 Frame = +1

Query  148   ECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQA  327
             +CL + S PSHPI   I+TP N S+SSVLQ YIRNLRFN S T KP+ IV A H SH+QA
Sbjct  35    QCLLNNSPPSHPIFQAIHTPQNSSYSSVLQSYIRNLRFNTSSTPKPVLIVAAMHESHVQA  94

Query  328   SILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATL  507
             +I+CAK+H LQMK RSGGHDYEG+SYVS++PFFILDMFN RS++V IE ETAWV+AGA L
Sbjct  95    AIICAKKHNLQMKIRSGGHDYEGLSYVSNIPFFILDMFNLRSIDVDIESETAWVQAGAIL  154

Query  508   GEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGR  687
             GEV+Y IA KS  HGFPAGVCPTVGVGGHF   GYGNMMRKYGL+VDNI+DAKL+DVNGR
Sbjct  155   GEVFYRIAEKSKTHGFPAGVCPTVGVGGHFSAGGYGNMMRKYGLSVDNIVDAKLVDVNGR  214

Query  688   LLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCY  867
             +LDR SMGE+LFWAI GGGAS F VVL+Y+IN+V VP  VT+F V +T +Q+AT+ V  +
Sbjct  215   ILDRNSMGEDLFWAIRGGGAS-FGVVLAYKINIVPVPETVTVFKVEKTLEQDATDAVDKW  273

Query  868   QRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGLT  1047
             Q ++HKLD  LFIRL +DVVN +T  GEKT+RATF ALFLG S+ LL+  DE FPELGLT
Sbjct  274   QHVAHKLDDGLFIRLVLDVVNSSTRTGEKTVRATFIALFLGGSERLLTITDEGFPELGLT  333

Query  1048  QSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFK  1227
             +SDC E+ WI+SV+++ SFP+GTP   LL R P  L  LKRKSDY++ P+PR G+E ++K
Sbjct  334   RSDCTELSWIDSVVYWGSFPAGTPASVLLDRTPLTLSSLKRKSDYVKEPIPREGLEGLWK  393

Query  1228  KMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEIT  1407
             KM+EL+ P + FNPYGG+M E+ +   PFPHR+GN+  IQY TNW+E G +AA +Y+++T
Sbjct  394   KMIELERPYMNFNPYGGKMHEVSATESPFPHRAGNLWKIQYVTNWNEEGVDAANYYIDLT  453

Query  1408  RQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVKI  1587
             RQLY+Y+TPFVSKNPR++FL YRDLDLG N++K     Y EG+ YG+ YF EN++RLV+I
Sbjct  454   RQLYDYLTPFVSKNPRQSFLAYRDLDLGTNNHK-FETGYSEGRAYGINYFLENFDRLVEI  512

Query  1588  KTKVDPDNFFRDEQSIPTFP  1647
             KTKVDPDNFFR+EQSIP  P
Sbjct  513   KTKVDPDNFFRNEQSIPVLP  532



>ref|XP_008222794.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=544

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/508 (66%), Positives = 417/508 (82%), Gaps = 9/508 (2%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGS-FSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHI  321
             ++CL   S PSHPIS  IYTPNN S +SSVL+ YIRNLRFN   T KP  I+T  H SH+
Sbjct  39    VQCLLSHSQPSHPISEAIYTPNNASSYSSVLRSYIRNLRFNTCSTPKPFLIITPLHESHV  98

Query  322   QASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGA  501
             Q +I+CA++  L MK RSGGHDYEGVSYVS+VPFF+LDMFN RS+++ I  ETAWV+AGA
Sbjct  99    QQAIVCAQKQNLLMKIRSGGHDYEGVSYVSEVPFFLLDMFNLRSIDIDISSETAWVQAGA  158

Query  502   TLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVN  681
             TLGE++Y I  KS +HGFPAGVCPTVGVGGHF GAGYGN+MRKYGL+VDNIIDA+L+DV+
Sbjct  159   TLGELFYRIYEKSKIHGFPAGVCPTVGVGGHFSGAGYGNLMRKYGLSVDNIIDAQLMDVH  218

Query  682   GRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVY  861
             GRLLDRKSMGE+LFWAITGGG +SF VV++Y+INLVRVP  VT+F V RT +QNAT+IVY
Sbjct  219   GRLLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVRVPQTVTVFRVERTLEQNATDIVY  278

Query  862   CYQRMSHKLDPNLFIRLTVDVVNITTHP----GE--KTIRATFNALFLGDSKTLLSTMDE  1023
              +Q ++ KLD +LFIRLT++VVNIT  P    GE  KTIRA+F   FLG+S+ LLS M+ 
Sbjct  279   RWQYVAPKLDTDLFIRLTMEVVNITGGPLSTGGENYKTIRASFIGFFLGNSERLLSVMET  338

Query  1024  SFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPR  1203
              FPELGL QSDC EM W+ESVLF+T+F  GT  E LLSR PQVLVHLKRKSDY++TP+P+
Sbjct  339   GFPELGLKQSDCIEMSWVESVLFWTNFSIGTEPEALLSRKPQVLVHLKRKSDYVKTPIPK  398

Query  1204  NGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEA  1383
              G+ +I++KM+E + P+++FNPYGG+M+EIP +A P PHR+GN+  IQYATNW+  G EA
Sbjct  399   IGLMWIWQKMIEFEVPIMSFNPYGGKMSEIPESATPCPHRAGNLWKIQYATNWEVSGAEA  458

Query  1384  AQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKE  1563
             + ++L +TR+LY YMTPFVS NPREA+ NY+DLDLGIN+N   + SYFEG+ YG++YFK+
Sbjct  459   SDYHLNLTRKLYFYMTPFVSMNPREAYFNYKDLDLGINNNG--KASYFEGRAYGIRYFKD  516

Query  1564  NYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             N++RLV+IKT+VDP NFFR+EQSIPT P
Sbjct  517   NFDRLVRIKTEVDPGNFFRNEQSIPTRP  544



>gb|KCW76615.1| hypothetical protein EUGRSUZ_D01003, partial [Eucalyptus grandis]
Length=463

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/470 (70%), Positives = 395/470 (84%), Gaps = 7/470 (1%)
 Frame = +1

Query  196   IYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQASILCAKEHGLQMKARS  375
             IYTPN  S+S+VLQ YIRNLRFN S T KP+ I+TA H SH+QA+I+CA++  +QMK RS
Sbjct  1     IYTPNKSSYSNVLQSYIRNLRFNTSDTPKPILILTALHESHVQAAIVCAQKLSVQMKIRS  60

Query  376   GGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATLGEVYYGIANKSNVHGF  555
             GGHDYEG+SY    PFFILDMFN RSV+V IE ETAWV+AGATLGEVYYGIA KS VHGF
Sbjct  61    GGHDYEGISY----PFFILDMFNLRSVDVDIEAETAWVQAGATLGEVYYGIAAKSKVHGF  116

Query  556   PAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGRLLDRKSMGEELFWAIT  735
             PAGVCPTVGVGGH  G GYGNMMRKYGLTVDN++DA++I+VNG +LDR+SMGE+LFWAI 
Sbjct  117   PAGVCPTVGVGGHLSGGGYGNMMRKYGLTVDNVVDARIINVNGEILDRESMGEDLFWAIR  176

Query  736   GGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCYQRMSHKLDPNLFIRLT  915
             GGG +SF VVL+Y+INLVRVP  VT+FSV RT++QNAT++VY ++ ++ +L  +LFIRLT
Sbjct  177   GGGGASFGVVLAYKINLVRVPETVTVFSVPRTWEQNATDVVYKWEEVAPQLHEDLFIRLT  236

Query  916   VDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGLTQSDCREMRWIESVLFY  1095
             +DVVN  T  GEKTIRATF ALFLGD++ LLS M  SFPELGL  SDC EM W+ES LF+
Sbjct  237   MDVVN-GTKAGEKTIRATFIALFLGDAQRLLSLMSNSFPELGLRSSDCIEMSWVESTLFW  295

Query  1096  TSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFKKMVELQTPMLTFNPYG  1275
             T+FP GTP + LLSR PQVL HLKRKSDY++  +P++G+E I+++M+EL+ PMLTFNPYG
Sbjct  296   TNFPIGTPADALLSRTPQVLTHLKRKSDYVKQIIPKDGLELIWRRMIELERPMLTFNPYG  355

Query  1276  GRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEITRQLYEYMTPFVSKNPR  1455
             G+M EIP+   PFPHR+GN+  +QYATNWDE G EAA+HY+E+TR+LY YMTPFVSKNPR
Sbjct  356   GKMGEIPATNTPFPHRAGNLWKVQYATNWDEDGDEAARHYIELTRKLYRYMTPFVSKNPR  415

Query  1456  EAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVKIKTKVDP  1605
             EAFLNYRDLDLGINHN    +SY EG+ YG+KYFK N+NRLV+IKTKVDP
Sbjct  416   EAFLNYRDLDLGINHNGD--ESYEEGRVYGVKYFKGNFNRLVEIKTKVDP  463



>ref|XP_006377911.1| hypothetical protein POPTR_0011s16160g [Populus trichocarpa]
 gb|ERP55708.1| hypothetical protein POPTR_0011s16160g [Populus trichocarpa]
Length=514

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/513 (65%), Positives = 409/513 (80%), Gaps = 5/513 (1%)
 Frame = +1

Query  109   AWAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             A AP     T  L  L+  S+PS+PIS  IY P+N S+SS+LQ YIRNLRFN S T KPL
Sbjct  2     AAAPELSYETFYLSLLS-HSDPSYPISKAIYNPDNPSYSSILQAYIRNLRFNTSTTPKPL  60

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
             FI+TA H SH+QA++ CAK+HGLQMK RSGGHDYEG SYVSDVPFFILDM N RS++V I
Sbjct  61    FILTALHESHVQAAVFCAKKHGLQMKIRSGGHDYEGTSYVSDVPFFILDMCNLRSIDVDI  120

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
             E+ETAWV+ GATLGEV+Y IA KS+ HGFPAGVCPTVGVGGH  GAGYGN+MRKYGL+VD
Sbjct  121   ENETAWVQTGATLGEVFYSIAEKSSTHGFPAGVCPTVGVGGHLTGAGYGNLMRKYGLSVD  180

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             NI DA L+D  GR+LDRKSMGE+LFWAI GGGA SF VV+SY++NLVRV   VT+F V R
Sbjct  181   NITDAILVDAEGRILDRKSMGEDLFWAIRGGGA-SFGVVVSYKLNLVRVAEVVTVFRVER  239

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T ++NAT+IV+ +Q ++HK+D +LFIRL +DVV   +  GEKT+RA+F   FLGDS+ LL
Sbjct  240   TLEENATDIVFQWQHVAHKIDEDLFIRLLLDVVK-DSPSGEKTVRASFIGFFLGDSERLL  298

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQ  1188
             S   ESFPELGL +SDC E  W+ES+LF+  FP GTP++ +LSR P  LV+LKRKSDY+Q
Sbjct  299   SITAESFPELGLLKSDCIETSWLESILFWADFPVGTPIDVMLSRTPPSLVYLKRKSDYVQ  358

Query  1189  TPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDE  1368
              P+ ++ +E I+KKM+EL+ P + FNPYGG+M+EI +AA PFPHR+GN+  IQY  NW+E
Sbjct  359   EPISKDDLEGIWKKMIELEVPKMGFNPYGGKMSEISAAATPFPHRAGNLWKIQYQINWNE  418

Query  1369  HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGL  1548
              G EA +++L++ RQLY YMTPFVSKNPR AFLNY+DLDLGINH+   + SY EG  YG+
Sbjct  419   EGTEAVEYHLDLARQLYRYMTPFVSKNPRAAFLNYKDLDLGINHHG--KASYIEGSAYGI  476

Query  1549  KYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             KYFK N+ RLV+IKTKVDP NFFR EQS+PTFP
Sbjct  477   KYFKGNFKRLVQIKTKVDPGNFFRHEQSVPTFP  509



>ref|XP_003546286.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
 gb|KHN14295.1| Reticuline oxidase-like protein [Glycine soja]
Length=535

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/506 (65%), Positives = 404/506 (80%), Gaps = 3/506 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T L CL + S PSHPI+  I+TPNN SFSSVL+ YIRNLRFN S T+KP  I+TA H+SH
Sbjct  32    TFLHCLVNHSEPSHPITSAIFTPNNTSFSSVLEAYIRNLRFNTSTTRKPFLIITALHVSH  91

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQASI+CA++H LQMK RSGGHDYEGVSYV++VPFFILDMFN R++ V I  ETAWV+AG
Sbjct  92    IQASIICAQKHNLQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRTIEVDIGTETAWVQAG  151

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KS  H FPAGVC TVGVGGH  G GYGNMMRKYGL+VDN+IDA+++DV
Sbjct  152   ATLGEVYYRIAEKSKTHAFPAGVCHTVGVGGHISGGGYGNMMRKYGLSVDNVIDAQMVDV  211

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GRLLDRKSMGE+LFWAITGGG +SF VVL+Y+I LVRVP  VT+F V RT +QNAT+IV
Sbjct  212   QGRLLDRKSMGEDLFWAITGGGGASFGVVLAYKIKLVRVPEIVTVFQVGRTLEQNATDIV  271

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++  +D +LF+R+ +DVVN  T  G KT+RA F ALFLGDSK+L+S +++ FP+L
Sbjct  272   YNWQHVAPTIDNDLFLRVILDVVN-GTRNGTKTVRARFIALFLGDSKSLVSLLNDKFPQL  330

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL QSDC E  W+ SVLF+ +    + ++ LL R P+ L +LKRKSDY++ P+   G E 
Sbjct  331   GLKQSDCIETSWLRSVLFWDNIDIASSLDILLERQPRSLNYLKRKSDYVKKPISIEGFEG  390

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+KKM+EL+  +  FNPYGGRMAEIPS A PFPHR+GN+  IQY  NW++ G E A HY+
Sbjct  391   IWKKMIELEDTLFQFNPYGGRMAEIPSTASPFPHRAGNLWKIQYQANWNKPGKEVADHYI  450

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              +TR+L+++MTPFVSKNPREAF NY+DLDLGINHN   + SY EG+ YG++YFK+N++RL
Sbjct  451   NLTRKLHKFMTPFVSKNPREAFYNYKDLDLGINHNG--KNSYAEGRVYGVEYFKDNFDRL  508

Query  1579  VKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             V+IKTKVDP NFFR+EQSIPT   RK
Sbjct  509   VQIKTKVDPHNFFRNEQSIPTLSYRK  534



>ref|XP_002299026.2| hypothetical protein POPTR_0001s46680g [Populus trichocarpa]
 gb|EEE83831.2| hypothetical protein POPTR_0001s46680g [Populus trichocarpa]
Length=537

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/515 (67%), Positives = 413/515 (80%), Gaps = 17/515 (3%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL + S  ++PIS  IYTP N S+S VLQ YIRNLRFN S T KPL I+TA H SH+Q
Sbjct  26    LQCLLNHSQLTYPISTAIYTPKNESYSYVLQSYIRNLRFNMSTTPKPLLILTALHESHVQ  85

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+I  A+EH LQMK RSGGHDYEGVSYVSDVPFF+LDMFN RS++V +  ETAW++ GAT
Sbjct  86    AAISYAREHNLQMKIRSGGHDYEGVSYVSDVPFFVLDMFNLRSIDVDVASETAWIQVGAT  145

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY I+ KS  HGFPA V PTVGVGGHFGG GYGNMMRKYGL+VDNIIDAK++DV G
Sbjct  146   LGEVYYRISEKSKAHGFPASVEPTVGVGGHFGGGGYGNMMRKYGLSVDNIIDAKMVDVKG  205

Query  685   RLLDRKSMGEELF--------------WAITGGGASSFAVVLSYRINLVRVPPKVTIFSV  822
             RLLDRKSMGE+LF              WAITGGG SSF VVL+Y+IN+VRVP  VT+F V
Sbjct  206   RLLDRKSMGEDLFWDGDAARVFFDVRHWAITGGGGSSFGVVLAYKINIVRVPEVVTVFLV  265

Query  823   RRTYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKT  1002
             RR  DQNAT+IV  +Q++++ +D +LFIRLT++VVN TT   EKT+R TF ALFLGDS+ 
Sbjct  266   RRNVDQNATDIVEQWQQVAYNIDDDLFIRLTMNVVNSTTRISEKTVRTTFRALFLGDSER  325

Query  1003  LLSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDY  1182
             LLS  + SFP+LGL +SDC EM W+ESVLF+T  P GTP  +LL R P  LVH KRKSDY
Sbjct  326   LLSFTNASFPKLGLLRSDCTEMSWLESVLFWTDPPLGTPT-DLLRRTPPSLVHFKRKSDY  384

Query  1183  LQTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNW  1362
             +Q P+PR+G+E I+KKM+ELQ P LTFNPYGG+M EIP+  +PFPHR+GN+  +QYAT+W
Sbjct  385   VQKPIPRDGLEGIWKKMIELQVPQLTFNPYGGKMWEIPATERPFPHRAGNLWKVQYATDW  444

Query  1363  DEHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTY  1542
             ++ G   A +Y+++TRQLY YMTPFVSKNPR+AFLNYRDLDLGINHN   ++SY EG+ Y
Sbjct  445   NKGGQGKANYYIDLTRQLYSYMTPFVSKNPRQAFLNYRDLDLGINHNG--KESYLEGRVY  502

Query  1543  GLKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             G+KYF+EN+NRLVKIKTKVDP NFFR+EQSIPTFP
Sbjct  503   GIKYFQENFNRLVKIKTKVDPGNFFRNEQSIPTFP  537



>ref|XP_008445642.1| PREDICTED: reticuline oxidase-like protein [Cucumis melo]
Length=532

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/503 (67%), Positives = 415/503 (83%), Gaps = 5/503 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL   S PS+PI+P I+TPNN S+SSVL+ YIRNLRFN S T KP  I+TA H SH++
Sbjct  31    LQCLLRHSPPSYPIAPAIFTPNNASYSSVLETYIRNLRFNTSTTPKPFLILTALHESHVK  90

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDV-PFFILDMFNFRSVNVSIEDETAWVEAGA  501
              +ILCA+ H LQMK RSGGHDYEGVSYVSDV PFF+LDMFN R + V  + ETAWV+ GA
Sbjct  91    VAILCARIHNLQMKIRSGGHDYEGVSYVSDVVPFFVLDMFNLREITVDAKTETAWVQTGA  150

Query  502   TLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVN  681
             TLGEVYY +A K+  +GFPAGVCPTVGVGGHFGG GYGNMMRK+GL+VD IIDAK+IDVN
Sbjct  151   TLGEVYYRVAEKNKSYGFPAGVCPTVGVGGHFGGGGYGNMMRKHGLSVDQIIDAKIIDVN  210

Query  682   GRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNA-TNIV  858
             G+LLDRK+MGE+LFWAI GGG SSF VV++Y+I +VRVP +VT+F V+RT +QN  T IV
Sbjct  211   GKLLDRKAMGEDLFWAIIGGGGSSFGVVVAYKIRMVRVPERVTVFRVQRTLEQNELTEIV  270

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
               +Q+++H +D +LFIR+T DVVN  T   +KT+RATF ALFLGDS  LL  ++ SFP+L
Sbjct  271   DEWQQVAHVIDNDLFIRVTFDVVN-GTDKEKKTLRATFIALFLGDSGRLLFVINNSFPKL  329

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL +SDC EM W++SVLF+T+FP GT VE LLSR PQVL HLKRKSDY++ P+P+ G++ 
Sbjct  330   GLKKSDCIEMSWLQSVLFWTNFPLGTSVEALLSRTPQVLTHLKRKSDYVKAPIPKEGLDK  389

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+KKM+EL+ PM+TFNPYGGRMAEIPS A PFPHR+GN+  IQYATNWDE G   A+H++
Sbjct  390   IWKKMIELEKPMMTFNPYGGRMAEIPSNATPFPHRAGNLWKIQYATNWDEEGKREAKHFI  449

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             ++TR+LY++MTPFVSKNPR AFLNYRDLD+G+NHN   + SY+EG+ YG+KYF+ N+ RL
Sbjct  450   DLTRKLYKFMTPFVSKNPRTAFLNYRDLDIGVNHNG--KNSYYEGRVYGIKYFEGNFERL  507

Query  1579  VKIKTKVDPDNFFRDEQSIPTFP  1647
             VKIKTKVDP NFFR+EQSIP FP
Sbjct  508   VKIKTKVDPHNFFRNEQSIPRFP  530



>ref|XP_004135723.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
 ref|XP_004158100.1| PREDICTED: LOW QUALITY PROTEIN: reticuline oxidase-like protein-like 
[Cucumis sativus]
Length=533

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/503 (67%), Positives = 416/503 (83%), Gaps = 5/503 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
              +CL   S PS+PI+P I+TPNN S+SSVL+ YIRNLRFN S T KP  I+TA H SH++
Sbjct  31    FQCLLRHSPPSYPIAPAIFTPNNASYSSVLETYIRNLRFNTSTTPKPFLILTALHESHVK  90

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDV-PFFILDMFNFRSVNVSIEDETAWVEAGA  501
             A+ILCA+ H LQMK RSGGHDYEGVSYVSDV PFFILDMFN R + V  + +TAWV+ GA
Sbjct  91    AAILCARIHNLQMKIRSGGHDYEGVSYVSDVVPFFILDMFNLREITVDAKTKTAWVQTGA  150

Query  502   TLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVN  681
             TLGEVYY +A  +  +GFPAGVCPTVGVGGHFGG GYGNMMRKYGL+VD IIDAK+IDVN
Sbjct  151   TLGEVYYRVAENNKSYGFPAGVCPTVGVGGHFGGGGYGNMMRKYGLSVDQIIDAKIIDVN  210

Query  682   GRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQN-ATNIV  858
             G+LLDRK+MGE+LFWAI GGG SSF VV++Y+I +V VP  VT+F V+RT +QN  T IV
Sbjct  211   GKLLDRKAMGEDLFWAIIGGGGSSFGVVVAYKIRMVPVPETVTVFRVQRTLEQNDLTEIV  270

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
               +Q+++H +D +LFIR+T DVVN  T+ G+KT+RATF ALFLGDS+ LL  ++ SFP+L
Sbjct  271   DEWQQVAHVIDNDLFIRVTFDVVN-GTNKGKKTLRATFIALFLGDSERLLFVINNSFPKL  329

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL +SDC EM W++SVLF+T+FP GT VE LLSR PQVL HLKRKSDY++TP+P+ G+  
Sbjct  330   GLKKSDCIEMSWLQSVLFWTNFPLGTSVEALLSRTPQVLTHLKRKSDYVKTPIPKEGLNK  389

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+KKM+EL+ PMLTFNPYGGRMAEIPS A PFPHR+GN+  IQYATNW E G + A+H++
Sbjct  390   IWKKMIELEKPMLTFNPYGGRMAEIPSNATPFPHRAGNLWKIQYATNWVEEGNKEAKHFI  449

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             ++TR+LY++MTPFVSKNPR AFLNYRDLD+G+NHN   + SY+EG+ YG+KYF+ N++RL
Sbjct  450   DLTRKLYKFMTPFVSKNPRTAFLNYRDLDIGVNHNG--KNSYYEGRVYGIKYFEGNFDRL  507

Query  1579  VKIKTKVDPDNFFRDEQSIPTFP  1647
             VKIKTKVDP NFFR+EQSIP FP
Sbjct  508   VKIKTKVDPHNFFRNEQSIPRFP  530



>ref|XP_007147438.1| hypothetical protein PHAVU_006G124600g [Phaseolus vulgaris]
 gb|ESW19432.1| hypothetical protein PHAVU_006G124600g [Phaseolus vulgaris]
Length=540

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/507 (65%), Positives = 410/507 (81%), Gaps = 4/507 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T L CL + S PSHPI+  I+TPNN SFSSVL+ Y+RNLRFN S T+KP  IVTA H+SH
Sbjct  36    TFLHCLVNHSEPSHPITSAIFTPNNASFSSVLEAYVRNLRFNTSTTRKPFLIVTALHVSH  95

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQASI+CA+++ LQMK RSGGHDY+G+SYV++VPFFILDMF  R++ V I  ETAWV+AG
Sbjct  96    IQASIICAQKYNLQMKIRSGGHDYDGLSYVAEVPFFILDMFKLRTIEVDIHTETAWVQAG  155

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             AT+GEV+Y IANKS +H FPAG+CPTVG+GGH  G  YGN+MRKYGL+VDNI+DA+++DV
Sbjct  156   ATVGEVFYKIANKSKIHAFPAGICPTVGIGGHLSGGSYGNLMRKYGLSVDNIVDAQMVDV  215

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GRLLDRKSMGE+LFWAITGGG SSF VVL+Y+I LVRVP  VT+F+V+RT +QNAT+IV
Sbjct  216   QGRLLDRKSMGEDLFWAITGGGGSSFGVVLAYKIKLVRVPETVTVFNVQRTLEQNATDIV  275

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++  +D +LFIRL +DVVN  T  G KT+RA+F ALFLGDSK+L+S ++E FP+L
Sbjct  276   YKWQHVAPTIDNDLFIRLVLDVVN-GTKTGTKTVRASFVALFLGDSKSLVSLLNEKFPQL  334

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVH-LKRKSDYLQTPMPRNGIE  1215
             GL QSDC E  W+ SVLF+T+     P+E LL R PQ  V+ LKRKSDY+Q P+ ++G E
Sbjct  335   GLKQSDCIETSWLRSVLFWTNINITAPLEILLDRQPQSPVNFLKRKSDYVQKPISKDGFE  394

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              I+KKM+EL+  +  FNPYGGRMAEIPS A PFPHR+GN+  +QY  NW + G E   HY
Sbjct  395   GIWKKMIELEDTLFQFNPYGGRMAEIPSTATPFPHRAGNLWKLQYQANWRQAGKEVTNHY  454

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             + +TR+L++YMTPFVSKNPREAF NY+DLDLGINHN   +KSY EGK YG++YFK+N++R
Sbjct  455   INLTRKLHKYMTPFVSKNPREAFYNYKDLDLGINHNG--KKSYAEGKVYGVEYFKDNFDR  512

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             LV+IKTKVDP NFFR+EQSIPT P  K
Sbjct  513   LVEIKTKVDPHNFFRNEQSIPTLPYAK  539



>ref|XP_011006011.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=514

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/513 (65%), Positives = 406/513 (79%), Gaps = 5/513 (1%)
 Frame = +1

Query  109   AWAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             A AP     T  L  L+  S+PS+PIS  IY P+N S+SS+LQ YIRNLRFN S T KPL
Sbjct  2     AAAPELSYETFYLTLLS-HSDPSYPISKAIYNPDNPSYSSILQAYIRNLRFNTSTTPKPL  60

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
             FI+TA H SH+QA++  AK+HGLQMK RSGGHDYEG SYVSDVPFFILDM N RS++V I
Sbjct  61    FILTALHESHVQAAVFWAKKHGLQMKIRSGGHDYEGKSYVSDVPFFILDMCNLRSIDVDI  120

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
             E+ETAWV+AGATLGEV+Y IA KS+ HG PAGVCPTVGVGGH  GAGYGN+MRKYGL+VD
Sbjct  121   ENETAWVQAGATLGEVFYSIAEKSSTHGCPAGVCPTVGVGGHLIGAGYGNLMRKYGLSVD  180

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             NI DA L+D  GR+L RKSMGE+LFWAI GGGA SF VV+SY+INLVRV   VT+F V R
Sbjct  181   NITDAILVDAEGRILHRKSMGEDLFWAIRGGGA-SFGVVVSYKINLVRVTEVVTVFRVER  239

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T  +NAT+I+Y +Q ++HK+  +LFIRL +DVV   +  GEKT+RA+F   FLGDS+ LL
Sbjct  240   TLKENATDIMYQWQHVAHKIHEDLFIRLLLDVVK-DSPSGEKTVRASFIGFFLGDSERLL  298

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQ  1188
             S   ESFPELGL +SDC E  W+ES+LF+  FP GTP++ +LSR P  LV+LKRKSDY+Q
Sbjct  299   SITAESFPELGLLKSDCIETSWLESILFWADFPVGTPIDVMLSRTPPSLVYLKRKSDYVQ  358

Query  1189  TPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDE  1368
              P+ ++ +E I+KKM+EL+ P + FNPYGG+M+EI +AA PFPHR+GN+  IQY  NW+E
Sbjct  359   EPISKDDLEAIWKKMMELEVPKMGFNPYGGKMSEISAAATPFPHRAGNLWKIQYQINWNE  418

Query  1369  HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGL  1548
              G EA +++L++ RQLY YMTPFVSKNPR AFLNY+DLDLGINH+   + SY EG+ YG+
Sbjct  419   EGTEAEEYHLDLARQLYRYMTPFVSKNPRAAFLNYKDLDLGINHHG--KTSYIEGRAYGI  476

Query  1549  KYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             KYFK N+ RLV+IKT+VDP NFFR EQS+PTFP
Sbjct  477   KYFKGNFERLVQIKTRVDPGNFFRHEQSVPTFP  509



>ref|XP_003547341.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=541

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/506 (64%), Positives = 403/506 (80%), Gaps = 2/506 (0%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL + S PS+PI+  I+TPNN  FSSVL+ YIRNLRFN S T+KP  IVT +H+SH
Sbjct  35    TFVQCLLNNSEPSYPITSAIFTPNNSLFSSVLEAYIRNLRFNTSTTRKPFLIVTPSHVSH  94

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA+I+CAK+H L MK RSGGHDYEG+SYV+  P FILDMFN RS+ + ++ ETAWVEAG
Sbjct  95    VQAAIVCAKKHKLLMKIRSGGHDYEGLSYVASQPLFILDMFNLRSIEIDMKTETAWVEAG  154

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KS +H FPAGVCPTVGVGGH  G GYGNMMRKYGL+VDN+IDA ++DV
Sbjct  155   ATLGEVYYRIAEKSKIHAFPAGVCPTVGVGGHISGGGYGNMMRKYGLSVDNVIDALMVDV  214

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GRLLDRKSMGE+LFWAITGGG +SF VVL+Y+I LVRVP  VT+F V +T +QNAT+IV
Sbjct  215   QGRLLDRKSMGEDLFWAITGGGGASFGVVLAYKIKLVRVPETVTVFRVPKTLEQNATDIV  274

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++  ++ NLFIRL ++VVN+T +   KTIRATF ALFLGDSK+L+S +++ FP+L
Sbjct  275   YNWQHVAPTINNNLFIRLVLNVVNVTQNE-TKTIRATFVALFLGDSKSLVSLLNDKFPQL  333

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL QSDC E  W+ SVLF+T+     PVE LL+R PQ + +LKRKSDY++  + + G+E 
Sbjct  334   GLKQSDCIETSWLGSVLFWTNINITAPVEVLLNRQPQSVNYLKRKSDYVKKSISKEGLEG  393

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I++KM+EL    L FNPYGGRMAEIPS   PFPHR+GN+  IQY  NW++ G E A HY+
Sbjct  394   IWRKMIELVDTSLNFNPYGGRMAEIPSTTSPFPHRAGNLWKIQYLANWNKPGKEVADHYI  453

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              +TR+L++YMTPFVSKNPR AF NYRDLDLG N+  G + SY +G+ YG+KYFK+N+N+L
Sbjct  454   NLTRKLHKYMTPFVSKNPRGAFFNYRDLDLGSNNYNG-KNSYAKGRVYGVKYFKDNFNKL  512

Query  1579  VKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             V+IKTKVDPDNFFR+EQSIP  P  K
Sbjct  513   VQIKTKVDPDNFFRNEQSIPMLPYHK  538



>gb|KHN14296.1| Reticuline oxidase-like protein [Glycine soja]
Length=541

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/506 (64%), Positives = 403/506 (80%), Gaps = 2/506 (0%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL + S PS+PI+  I+TPNN  FSSVL+ YIRNLRFN S T+KP  IVT +H+SH
Sbjct  35    TFVQCLLNNSEPSYPITSAIFTPNNSLFSSVLEAYIRNLRFNTSTTRKPFLIVTPSHVSH  94

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA+I+CAK+H L MK RSGGHDYEG+SYV+  P FILDMFN RS+ + ++ ETAWVEAG
Sbjct  95    VQAAIVCAKKHKLLMKIRSGGHDYEGLSYVASQPLFILDMFNLRSIEIDMKTETAWVEAG  154

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KS +H FPAGVCPTVGVGGH  G GYGNMMRKYGL+VDN+IDA ++DV
Sbjct  155   ATLGEVYYRIAEKSKIHAFPAGVCPTVGVGGHISGGGYGNMMRKYGLSVDNVIDALMVDV  214

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GRLLDRKSMGE+LFWAITGGG +SF VVL+Y+I LVRVP  VT+F V +T +QNAT+IV
Sbjct  215   QGRLLDRKSMGEDLFWAITGGGGASFGVVLAYKIKLVRVPETVTVFRVPKTLEQNATDIV  274

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++  ++ NLFIRL ++VVN+T +   KTIRATF ALFLGDSK+L+S +++ FP+L
Sbjct  275   YNWQHVAPTINNNLFIRLVLNVVNVTQNE-TKTIRATFVALFLGDSKSLVSLLNDKFPQL  333

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL QSDC E  W+ SVLF+T+     PVE LL+R PQ + +LKRKSDY++  + + G+E 
Sbjct  334   GLKQSDCIETSWLGSVLFWTNINITAPVEVLLNRQPQSVNYLKRKSDYVKKSISKEGLEG  393

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I++KM+EL    L FNPYGGRMAEIPS   PFPHR+GN+  IQY  NW++ G E A HY+
Sbjct  394   IWRKMIELVDTSLNFNPYGGRMAEIPSTTSPFPHRAGNLWKIQYQANWNKPGKEVADHYI  453

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              +TR+L++YMTPFVSKNPR AF NYRDLDLG N+  G + SY +G+ YG+KYFK+N+N+L
Sbjct  454   NLTRKLHKYMTPFVSKNPRGAFFNYRDLDLGSNNYNG-KNSYAKGRVYGVKYFKDNFNKL  512

Query  1579  VKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             V+IKTKVDPDNFFR+EQSIP  P  K
Sbjct  513   VQIKTKVDPDNFFRNEQSIPMLPYHK  538



>gb|EYU43211.1| hypothetical protein MIMGU_mgv1a004698mg [Erythranthe guttata]
Length=514

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/504 (67%), Positives = 405/504 (80%), Gaps = 12/504 (2%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++CL + S   + +  +++TP   SFSS LQ YIRNLRFNES T KP FI+T TH+SHI 
Sbjct  10    IQCLENNSKLFNGVVFLLHTPKTPSFSSSLQTYIRNLRFNESTTGKPRFILTPTHVSHIP  69

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVP-FFILDMFNFRSVNVSIEDETAWVEAGA  501
              +I+CAK HGLQ+K RSGGHD+EG+SYVSD P FFILDMFN RSVNV++ED++AWVEAGA
Sbjct  70    TAIICAKSHGLQIKVRSGGHDFEGLSYVSDSPNFFILDMFNLRSVNVTLEDDSAWVEAGA  129

Query  502   TLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVN  681
             TLG+V+YGIA KSN   FPAGVCPTVGVGGH  G GYGN+MRKYGLTVDN++DAK++DV 
Sbjct  130   TLGQVFYGIAGKSNTRAFPAGVCPTVGVGGHVSGGGYGNLMRKYGLTVDNVVDAKIVDVK  189

Query  682   GRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVY  861
             GR+LDRKSMGE+LFWAITGGG SSF VVLSY+I LVRVP +VT+FSV RTYD+N T+++Y
Sbjct  190   GRILDRKSMGEDLFWAITGGGGSSFGVVLSYKIKLVRVPNRVTVFSVFRTYDENFTHLIY  249

Query  862   CYQRMS-HKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
              YQ+++  +L   LFIRL +DV N     G+   RA F ALFLG+S+ LLS M+  FPEL
Sbjct  250   RYQKVAADELPEKLFIRLILDVAN-----GKN--RARFVALFLGNSENLLSLMNRRFPEL  302

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL Q DC +MRWIESVLF+  FP+GTP+  L+SRVPQVLVH KRKSDYL+ P+P++G+EF
Sbjct  303   GLKQKDCIKMRWIESVLFWADFPTGTPITALVSRVPQVLVHFKRKSDYLKKPIPKSGLEF  362

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             IFKKMVEL+TP+LTFNPYGGRMAEIP  AKPFPHR GNIA IQYA NWDE G EAA +Y+
Sbjct  363   IFKKMVELKTPLLTFNPYGGRMAEIPPEAKPFPHRGGNIAKIQYAANWDEKGIEAANYYI  422

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFE---GKTYGLKYFKENY  1569
              +TR LYEYMTP+VS NPREAFL YRDLD+G N N     +Y+       YG+KYF +N+
Sbjct  423   NLTRMLYEYMTPYVSVNPREAFLCYRDLDIGTNRNAAGNGTYYSEDAAAVYGVKYFMDNF  482

Query  1570  NRLVKIKTKVDPDNFFRDEQSIPT  1641
              RLVKIKTKVDP NFFRDEQSIP 
Sbjct  483   KRLVKIKTKVDPHNFFRDEQSIPV  506



>ref|XP_004486573.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=533

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/506 (63%), Positives = 398/506 (79%), Gaps = 3/506 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL + S PSHPI+  I+TPNN SFSSVLQ YIRNLRFN + T KP  I+TA H+SH
Sbjct  26    TFIQCLVNNSQPSHPITSAIFTPNNSSFSSVLQAYIRNLRFNTTTTPKPFLIITALHVSH  85

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQASI+CA++   QMK RSGGHDYEGVSYV++VPFFILDMFN RS++V +E+ETAW+++G
Sbjct  86    IQASIICAQKQNFQMKIRSGGHDYEGVSYVAEVPFFILDMFNLRSIDVDLENETAWIQSG  145

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KS +HGFPAGVCPTVGVGGH  G GYGN+MRKYG ++DN+IDA++ID 
Sbjct  146   ATLGEVYYTIAEKSEIHGFPAGVCPTVGVGGHVSGGGYGNLMRKYGTSIDNVIDAQIIDA  205

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GRLLDR+ MGE+LFWAI GGG +SF VVLSY+I L++VP  VT+F V RT ++NATNIV
Sbjct  206   KGRLLDREEMGEDLFWAIRGGGGASFGVVLSYKIKLIKVPKIVTVFLVHRTLEENATNIV  265

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++     +LFIRL ++VV      G KTIRA F AL+LGDSK+LLS M+ESFP+L
Sbjct  266   YNWQHVAPTTSDDLFIRLMLEVVK-DAKTGNKTIRAGFVALYLGDSKSLLSLMNESFPQL  324

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL +SDC E  WI+S++F+ +       E LL R PQ +++LKRKSDY++ P+   G+E 
Sbjct  325   GLKESDCIETSWIKSLMFWANINITEKAETLLDRQPQSMIYLKRKSDYVKKPISMEGLEG  384

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I KKM+EL+     FNPYGG+M EI S A  FPHR+GN+  IQY  NW+E G EAA +++
Sbjct  385   IMKKMIELENVTFYFNPYGGKMNEISSNATSFPHRAGNLWKIQYQGNWNEAGIEAASYHI  444

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              +TR+LY YMTPFVS NPREAFLNY+D+DLG+NHN   + SY EGK YG++YFK+N++RL
Sbjct  445   NVTRELYSYMTPFVSNNPREAFLNYKDIDLGVNHNG--KDSYIEGKVYGVQYFKDNFDRL  502

Query  1579  VKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             V+IKTKVDP NFFR+EQSIPT P RK
Sbjct  503   VEIKTKVDPGNFFRNEQSIPTLPNRK  528



>ref|XP_007033584.1| FAD-binding Berberine family protein isoform 1 [Theobroma cacao]
 gb|EOY04510.1| FAD-binding Berberine family protein isoform 1 [Theobroma cacao]
Length=539

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/511 (64%), Positives = 403/511 (79%), Gaps = 3/511 (1%)
 Frame = +1

Query  115   APLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFI  294
             A L     + L+CL + S  SHPIS  IYTP + S+SSVL+ YIRNLRFNE+ T KP  I
Sbjct  24    ATLDLPQESFLQCLLENSLRSHPISAAIYTPQSSSYSSVLESYIRNLRFNETSTPKPFLI  83

Query  295   VTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIED  474
             +TA+H SHIQA++LCAK+   QMK RSGGHDYEG+SYVS VPFFILDMFN RSV+V I +
Sbjct  84    LTASHESHIQAAVLCAKKQDFQMKIRSGGHDYEGLSYVSSVPFFILDMFNLRSVDVDIGN  143

Query  475   ETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNI  654
             ETAWV+ GATLGEVYY IA +SN+HGFPAGVCPTVGVGGH  GAGYGNMMRKYG++ DNI
Sbjct  144   ETAWVQTGATLGEVYYRIAERSNIHGFPAGVCPTVGVGGHLSGAGYGNMMRKYGVSADNI  203

Query  655   IDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTY  834
             IDA+ ID +GRL DRKSMGE+LFWAI GGG +SF V+L+Y+I LVRVP KVT F V +T 
Sbjct  204   IDAQFIDADGRLHDRKSMGEDLFWAIRGGGGASFGVILAYKIMLVRVPQKVTSFQVEKTL  263

Query  835   DQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLST  1014
             ++NAT+ V  +Q ++ KL   LFIRL +DVVN  +  GEKT+RA+F +LFLGDS TLLS 
Sbjct  264   EENATDFVDQWQHVADKLPEELFIRLALDVVN-RSQSGEKTVRASFISLFLGDSDTLLSI  322

Query  1015  MDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTP  1194
             M+E FP+LGL++SDC E  WI SVLF+ + P  T ++ LL R PQ LV LKRKSDY++ P
Sbjct  323   MNERFPKLGLSKSDCVETSWIRSVLFWANIPIETKIDVLLDRTPQTLVSLKRKSDYVKEP  382

Query  1195  MPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHG  1374
             +P+ G+E I+K+M+ELQ P + FNPYGG+MAEIPS   PFPHR+GN+  IQY  NW+E G
Sbjct  383   IPKAGLEGIWKRMIELQVPKMFFNPYGGKMAEIPSTKIPFPHRAGNLWKIQYLANWNESG  442

Query  1375  YEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKY  1554
              EAA H+L +TR+LY+YMTPFVSKNPREA+LNYRD+DLG ++N   +  Y EG+ YG++Y
Sbjct  443   IEAANHHLGLTRKLYDYMTPFVSKNPREAYLNYRDVDLGTSYNG--KPVYSEGRVYGIRY  500

Query  1555  FKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             FK N+ RLV+IK+KVDP NFFR+EQSIP  P
Sbjct  501   FKGNFERLVQIKSKVDPSNFFRNEQSIPVLP  531



>ref|XP_008392313.1| PREDICTED: reticuline oxidase-like protein [Malus domestica]
Length=538

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/505 (65%), Positives = 407/505 (81%), Gaps = 5/505 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             + CL + S  SHPI+P IY+P N S+SSVL+ YI NLRFN S T+KP  I+TA H SH+Q
Sbjct  34    VHCLLNHSQXSHPIAPAIYSPXNASYSSVLEXYIXNLRFNTSTTRKPFLILTALHESHVQ  93

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
              S++CA+ H LQMK RSGGHDYEGVSYV+ VPFFILDMFN RS++V I+ +TAWV+AGAT
Sbjct  94    ISVVCAQIHNLQMKIRSGGHDYEGVSYVAVVPFFILDMFNLRSIHVDIKSKTAWVQAGAT  153

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEV Y IA KS  HGFPAGV PTVGVGGHF G GYGNMMRKYGL+VDNI+DA+L++V+G
Sbjct  154   LGEVSYRIAEKSKTHGFPAGVGPTVGVGGHFSGGGYGNMMRKYGLSVDNIVDAQLVNVHG  213

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              LLDRKSMGE+LFWAITGGG +SF VV++Y+INLVRVP  VT+F V RT +QNAT+IVY 
Sbjct  214   ELLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVRVPEIVTVFKVPRTLEQNATDIVYR  273

Query  865   YQRMSHKLDPNLFIRLTVDVVNITT--HPGE--KTIRATFNALFLGDSKTLLSTMDESFP  1032
             +Q ++ KLD +LFIRLT+ VVN T+    GE  KT  A+F A+FLGDS+ LLS MD+SFP
Sbjct  274   WQYIADKLDDDLFIRLTMGVVNGTSSNSSGENNKTFTASFIAMFLGDSERLLSIMDKSFP  333

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             EL LTQSDC EM W +S+LF++  P+G+  E LL+R  QV    KRKSDY++ P+P+ G+
Sbjct  334   ELRLTQSDCTEMSWAQSMLFWSILPTGSATEALLNRT-QVRRFFKRKSDYVKKPIPKTGL  392

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             ++IFKKM+EL+ P LTFNPYGG+M+EI ++A PFPHR+GN+  +QYAT+WD  G EA+ H
Sbjct  393   KWIFKKMIELEKPRLTFNPYGGKMSEISASATPFPHRAGNLWKVQYATDWDIPGTEASDH  452

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             ++E TR+L+ YMTPFVSKNPREAF NY+DLD+GINHN     SY EG+ YG+KYFK N++
Sbjct  453   HIEFTRKLHMYMTPFVSKNPREAFYNYKDLDIGINHNANGMSSYLEGRVYGIKYFKHNFD  512

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLV +KTKVDP NFFR+EQSIPT P
Sbjct  513   RLVNVKTKVDPGNFFRNEQSIPTLP  537



>ref|XP_008356815.1| PREDICTED: reticuline oxidase-like protein [Malus domestica]
Length=538

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/505 (65%), Positives = 408/505 (81%), Gaps = 5/505 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             + CL + S  SHPI+P IY+P N S+SSVL+ YI+NLRFN S T+KP  I+TA H SH+Q
Sbjct  34    VHCLLNHSQTSHPIAPAIYSPKNASYSSVLEFYIQNLRFNTSTTRKPFLILTALHESHVQ  93

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
              S++CA+ H LQMK RSGGHDYEGVSYV+ VPFFILDMFN RS++V I+ +TAWV+AGAT
Sbjct  94    ISVVCAQIHNLQMKIRSGGHDYEGVSYVAVVPFFILDMFNLRSIHVDIKSKTAWVQAGAT  153

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEV Y IA KS  HGFPAGV PTVGVGGHF G GYGNMMRKYGL+VDNI+DA+L++V+G
Sbjct  154   LGEVSYRIAEKSKTHGFPAGVGPTVGVGGHFSGGGYGNMMRKYGLSVDNIVDAQLVNVHG  213

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              LLDRKSMGE+LFWAITGGG +SF VV++Y+INLVRVP  VT+F V RT +QNAT+IVY 
Sbjct  214   ELLDRKSMGEDLFWAITGGGGASFGVVIAYKINLVRVPEIVTVFKVPRTLEQNATDIVYR  273

Query  865   YQRMSHKLDPNLFIRLTVDVVNITT--HPGE--KTIRATFNALFLGDSKTLLSTMDESFP  1032
             +Q ++ KLD +LFIRLT+ VVN T+    GE  KT  A+F A+FLGDS+ LLS MD+SFP
Sbjct  274   WQYIADKLDDDLFIRLTMGVVNGTSSNSSGENNKTFTASFIAMFLGDSERLLSIMDKSFP  333

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             EL LTQSDC EM W +S+LF++  P+G+  E LL+R  QV    KRKSDY++ P+P+ G+
Sbjct  334   ELRLTQSDCTEMSWAQSMLFWSILPTGSATEALLNRT-QVRRFFKRKSDYVKKPIPKTGL  392

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             ++IFKKM+EL+ P LTFNPYGG+M+EI ++A PFPHR+GN+  +QYAT+WD  G EA+ H
Sbjct  393   KWIFKKMIELEKPRLTFNPYGGKMSEISASATPFPHRAGNLWKVQYATDWDIPGTEASDH  452

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             ++E TR+L+ YMTPFVSKNPREAF NY+DLD+GINHN     SY EG+ YG+KYFK N++
Sbjct  453   HIEFTRKLHMYMTPFVSKNPREAFYNYKDLDIGINHNANGMSSYLEGRVYGIKYFKHNFD  512

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLV +KTKVDP NFFR+EQSIPT P
Sbjct  513   RLVNVKTKVDPGNFFRNEQSIPTLP  537



>ref|XP_010519042.1| PREDICTED: reticuline oxidase-like protein [Tarenaya hassleriana]
Length=524

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/505 (64%), Positives = 400/505 (79%), Gaps = 5/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL   S+ SHPIS  +Y P NGS+S+VL+ YIRNLRFN S T KP  I+ A H SH
Sbjct  23    TFMQCLTAHSSASHPISSAVYFPGNGSYSAVLEAYIRNLRFNTSSTPKPFLIIAAGHESH  82

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAWVE  492
             ++A++ C + H LQMK RSGGHDY+G+SYV  S VPFF+LDMFN RSV+V +E  TAWV+
Sbjct  83    VRAAVFCGRRHNLQMKIRSGGHDYDGLSYVTYSRVPFFVLDMFNLRSVDVDVEKRTAWVQ  142

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
              GATLGEVYY I +KS   GFPAGVCPTVGVGGH  GAGYGNMMRKYGLTVDN++DA+++
Sbjct  143   TGATLGEVYYNIWDKSKTLGFPAGVCPTVGVGGHISGAGYGNMMRKYGLTVDNVVDARMV  202

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             DVNGR+LDRKSMGE+LFWAI+GGG SSF VVLSY+INLV VP  VT+F + RT +QNAT 
Sbjct  203   DVNGRILDRKSMGEDLFWAISGGGGSSFGVVLSYKINLVEVPQNVTVFRISRTLEQNATA  262

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             IV  +Q+++  L   LFIRLT D+VN T   G+KT+RATF +LFLGDS+TL+S M+  FP
Sbjct  263   IVDRWQQVAPHLPDELFIRLTFDIVNSTVTAGQKTVRATFLSLFLGDSETLISIMNRRFP  322

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL +SDC E  WI+SVLF+T+   GTP E LL R  Q L +LKRKSDY+  P+PR G+
Sbjct  323   ELGLVRSDCIETSWIQSVLFWTNIRVGTPEEVLLQR-NQTLTYLKRKSDYVTKPIPRTGL  381

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E +++KM+EL+ PM+TFNPYGGRMAEIPS+A PFPHR+GN+  IQYA NW++        
Sbjct  382   ESLWRKMIELEIPMMTFNPYGGRMAEIPSSATPFPHRAGNLWKIQYAANWNDE--RLTDR  439

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
              +E+TR+LY++MTPFVSKNPR AF NYRD+DLG+N +KG+ +SY EG+ YG+KYF  N++
Sbjct  440   NMELTRRLYDFMTPFVSKNPRRAFYNYRDVDLGVNLHKGKVESYVEGQRYGIKYFAANFD  499

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLVKIKTKVD DNFFR+EQSIP FP
Sbjct  500   RLVKIKTKVDRDNFFRNEQSIPVFP  524



>ref|XP_007147441.1| hypothetical protein PHAVU_006G124800g [Phaseolus vulgaris]
 gb|ESW19435.1| hypothetical protein PHAVU_006G124800g [Phaseolus vulgaris]
Length=523

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/503 (63%), Positives = 386/503 (77%), Gaps = 16/503 (3%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T L CL + S  SHPI+  ++T NN SFSSVLQ  I+NL             +TA H+SH
Sbjct  36    TFLHCLVNHSESSHPIASAVFTANNDSFSSVLQAQIKNL-------------LTALHVSH  82

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QASI+CA++H L MK RSGGHDYEG SYV+  PFF+LDMF  RS+ V I+ ETAWV+AG
Sbjct  83    VQASIICAQKHNLLMKIRSGGHDYEGASYVTSTPFFVLDMFQLRSIEVDIDTETAWVQAG  142

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KS  HGFPAGVCPTVGVGGH  G GYGNMMRKYGLTVDN+IDA+++DV
Sbjct  143   ATLGEVYYRIAEKSKTHGFPAGVCPTVGVGGHISGGGYGNMMRKYGLTVDNVIDAQMVDV  202

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GRLLDRKSMGE+LFWAITGGG SSF V++SY+I LVRVP  +T+F V +T +QNA +I 
Sbjct  203   QGRLLDRKSMGEDLFWAITGGGGSSFGVIISYKIKLVRVPETITVFRVTKTLEQNAIDIA  262

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q+++  +D +LFIR  +DVVN TT+   KT RATF ALFLGDSK+L+S M+E FPEL
Sbjct  263   YKWQQVAPAIDNDLFIRFILDVVNSTTNV-TKTGRATFVALFLGDSKSLVSLMNEKFPEL  321

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL QSDC E  W+ SV+F+       PVE LL R PQ L++LKRKSDY++ P+ + G+E 
Sbjct  322   GLKQSDCIETSWLRSVVFFADINITEPVEILLDRQPQPLIYLKRKSDYVEKPISKEGLEG  381

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+KKM+EL+  +  FNPYGGRMAEIPS A PFPHR+GN+  IQY  +W + G E   HY+
Sbjct  382   IWKKMIELENAVFQFNPYGGRMAEIPSTATPFPHRAGNLWKIQYKADWKQAGKEVTDHYI  441

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              +TR L+EYMTPFVSKNPREAF NY+DLDLGINHN   + +Y EGK YG+KYFK+N+ RL
Sbjct  442   NLTRILHEYMTPFVSKNPREAFYNYKDLDLGINHNG--KNNYVEGKVYGVKYFKDNFKRL  499

Query  1579  VKIKTKVDPDNFFRDEQSIPTFP  1647
             V+IKT++DP NFFRDEQSIPT P
Sbjct  500   VEIKTRIDPHNFFRDEQSIPTLP  522



>gb|AFK34476.1| unknown [Lotus japonicus]
Length=575

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/502 (63%), Positives = 389/502 (77%), Gaps = 2/502 (0%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL + S PSHPI+  I+TPN  SFSSVLQ YIRNLRFN S T+KP  I+T  H+SH
Sbjct  35    TFVQCLVNHSEPSHPIAEAIFTPNTPSFSSVLQAYIRNLRFNTSTTRKPFLILTPLHVSH  94

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA+I+C ++H LQMK RSGGHDYEGVSYV++ PFFILDMFN RS+ V I  ETAWV+AG
Sbjct  95    VQAAIICGQKHNLQMKTRSGGHDYEGVSYVAEDPFFILDMFNLRSIEVDIATETAWVQAG  154

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KS  HGFPAGVCPTVGVGGH  G GYGNMMRKYG +VDN++DA+++D 
Sbjct  155   ATLGEVYYRIAEKSRKHGFPAGVCPTVGVGGHVSGGGYGNMMRKYGTSVDNVVDAQIVDA  214

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GRLLDRKSMGE+LFWAI GGG +SF VVLSY+I LV+VP  VT+F V+R+  QNAT+IV
Sbjct  215   QGRLLDRKSMGEDLFWAIAGGGGASFGVVLSYKIKLVQVPETVTVFQVQRSLQQNATDIV  274

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++     +LFIRL ++VV    H G KT+RATF ALFLGDSKTLLS M E+FP+L
Sbjct  275   YNWQHVAPTTSNDLFIRLILEVVK-DAHEGTKTVRATFIALFLGDSKTLLSLMSETFPQL  333

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL QSDC E  W+ SVLF+ +    TPVE LL R PQ L +LKRKSDY++ P+ + G E 
Sbjct  334   GLRQSDCIETTWLRSVLFWDNIDISTPVEILLERQPQALRYLKRKSDYVKKPISKEGWEG  393

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+ KM+EL+  ++ FNPYGGRM EI  +A P PHR+GN+  IQY  NW++ G   A H++
Sbjct  394   IWNKMIELENGVMFFNPYGGRMDEISPSATPLPHRAGNLWKIQYQANWNQPGEVVANHHI  453

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              + R+LY++MTPFVSKNPR+A+LNY+DLDLG NH+ G   SY EG  YG++Y+ +N+NRL
Sbjct  454   NVIRELYKFMTPFVSKNPRQAYLNYKDLDLGTNHH-GFLSSYSEGSVYGVQYYMDNFNRL  512

Query  1579  VKIKTKVDPDNFFRDEQSIPTF  1644
             V+IKTKVDP NFFR EQSIP  
Sbjct  513   VQIKTKVDPGNFFRSEQSIPVL  534



>gb|KCW76692.1| hypothetical protein EUGRSUZ_D01053 [Eucalyptus grandis]
Length=536

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/510 (62%), Positives = 397/510 (78%), Gaps = 17/510 (3%)
 Frame = +1

Query  124   CYCATTVLECLNDRSNPSHPI-SPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVT  300
              +   T+ +CL   S  SHPI S ++YTP N S+S+VLQ YIRNLRFN S T KP  I+T
Sbjct  41    AFANETLSQCLISHSQASHPITSAILYTPANSSYSTVLQSYIRNLRFNSSDTPKPTLILT  100

Query  301   ATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVS-DVPFFILDMFNFRSVNVSIEDE  477
             A H SH+QA+I+CA++  +QMK RSGGHD+EG+SYVS   PFFILDM NFRSV+V IE E
Sbjct  101   ALHESHVQAAIVCARKLSVQMKIRSGGHDFEGISYVSISSPFFILDMINFRSVDVDIETE  160

Query  478   TAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNII  657
             TAWV+AGA LGEVYYGIA KS VHGFPAGVCP VG+GGH  G GYGNMMRKYGL+VDNI+
Sbjct  161   TAWVQAGAILGEVYYGIAAKSKVHGFPAGVCPMVGIGGHLSGGGYGNMMRKYGLSVDNIV  220

Query  658   DAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYD  837
             DA +I+V G++LDR+SMGE+LFWAI GGG +SF V+L+Y+INLV VP  VT+F ++RT +
Sbjct  221   DACMINVKGKILDRESMGEDLFWAIRGGGGASFGVILAYKINLVHVPEMVTVFRIQRTRE  280

Query  838   QNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTM  1017
             QNAT +VY +++++HKL  +LFIRL +DVV    + GEKT+RA F ALFLGD++ LLS +
Sbjct  281   QNATAVVYQWEQVAHKLHEDLFIRLVMDVV-AGKNTGEKTVRARFIALFLGDAQRLLSMI  339

Query  1018  DESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPM  1197
              + FPELGL  SDC EM W+ES L++ +FP GTPV+ LLSR P+ L+HLKRKSDY++  +
Sbjct  340   SDGFPELGLRSSDCIEMSWVESTLYWMNFPIGTPVDALLSRAPKGLMHLKRKSDYVRHII  399

Query  1198  PRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGY  1377
              ++ +E ++K+M++L+ P+LTFNPYGG+M +IP+   PFPHR+GN            +G 
Sbjct  400   SKDELELLWKRMIDLERPILTFNPYGGKMGKIPTTETPFPHRAGN------------YGR  447

Query  1378  EAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYF  1557
               AQH +E+TR+LY YMTPFVSKNPR AFLNYRDLDLG+NHN    +SY E K YG++YF
Sbjct  448   STAQHNIELTRKLYNYMTPFVSKNPRAAFLNYRDLDLGVNHNGD--ESYEEAKVYGVRYF  505

Query  1558  KENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             K N+NRLVKIKTKVDP NFFR+EQSIP  P
Sbjct  506   KGNFNRLVKIKTKVDPRNFFRNEQSIPVLP  535



>gb|EPS73320.1| hypothetical protein M569_01431, partial [Genlisea aurea]
Length=521

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/501 (66%), Positives = 399/501 (80%), Gaps = 14/501 (3%)
 Frame = +1

Query  151   CLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQAS  330
             CL + S  S  ISP +Y  NN S+S VLQ YIRNLR+NES T KPL IVTA H+SHIQ S
Sbjct  32    CLENYSAGS--ISPFLYQRNNASYSGVLQAYIRNLRYNESTTPKPLLIVTAKHVSHIQGS  89

Query  331   ILCAKEHGLQMKARSGGHDYEGVSYVSDVP-FFILDMFNFRSVNVSIEDETAWVEAGATL  507
             I CA+ HGLQM  RSGGHDYEG+SY S+ P FFILD+FNFRSVNVSI DETAWVE GATL
Sbjct  90    IFCARTHGLQMIIRSGGHDYEGISYWSEHPDFFILDLFNFRSVNVSIADETAWVEVGATL  149

Query  508   GEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGR  687
             GEVYY IA KS VHGFPAGVCPTVGVGGH  G GYGN+MRKYGLTVDN++DA +IDVNG 
Sbjct  150   GEVYYSIAAKSRVHGFPAGVCPTVGVGGHISGGGYGNLMRKYGLTVDNVLDATIIDVNGN  209

Query  688   LLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCY  867
             +L+R SMGE+LFWAITGGG SSF VVLSY+I+LVRVP  VT+FSV RTYD+N T++++ Y
Sbjct  210   ILNRASMGEDLFWAITGGGGSSFGVVLSYKIHLVRVPETVTVFSVPRTYDENFTDLIFRY  269

Query  868   QRMSHK-LDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             Q ++   L P LF+RLT+DVVN T        RATF AL+LG+S  L+S + ++FPELGL
Sbjct  270   QEIAAAVLPPELFVRLTLDVVNGTN-------RATFLALYLGNSSELVSLLGKTFPELGL  322

Query  1045  TQSDCREMRWIESVLFYTSFP-SGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
              Q+DC E  W++SVLF+T+FP + TPV+ LLSRVPQVL HLKRKSDYL+ P+P+  +  +
Sbjct  323   KQADCVETSWVKSVLFWTNFPLASTPVDALLSRVPQVLTHLKRKSDYLKKPIPKQDLNLL  382

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             FKKM++LQ PMLTFNPYGGRMAEI  +AKPFPHR+GN+A +QYA NW+E G EA+   L 
Sbjct  383   FKKMLQLQLPMLTFNPYGGRMAEISPSAKPFPHRAGNLAKLQYAANWNEDGPEASNRNLN  442

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
             +TR+L+E+MTP+VS NPREAF NYRDLD+GIN N   R  Y EG  YG+KYFK+N  RLV
Sbjct  443   LTRELFEFMTPYVSSNPREAFWNYRDLDIGINDNGKNR--YAEGLVYGVKYFKDNIVRLV  500

Query  1582  KIKTKVDPDNFFRDEQSIPTF  1644
              +KTKVDP +FFR+EQSIP+ 
Sbjct  501   NVKTKVDPFDFFRNEQSIPSL  521



>gb|AAL77103.1|AF472609_1 carbohydrate oxidase [Helianthus annuus]
Length=538

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/503 (64%), Positives = 396/503 (79%), Gaps = 7/503 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++CL+DR++PS PI+  +YTP N SF +VLQ YIRNLRFNE+ T KP  I+TA H+SHIQ
Sbjct  38    IQCLHDRADPSFPITGEVYTPGNSSFPTVLQNYIRNLRFNETTTPKPFLIITAEHVSHIQ  97

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDV--PFFILDMFNFRSVNVSIEDETAWVEAG  498
             A+++C K++ L +K RSGGHDYEG+SY+++   PFFI+DMFN RS+NV IE ETAWV+AG
Sbjct  98    AAVVCGKQNRLLLKTRSGGHDYEGLSYLTNTNQPFFIVDMFNLRSINVDIEQETAWVQAG  157

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KSN HGFPAGVCPTVGVGGHF G GYGN+MRKYGL+VDNI+DA++IDV
Sbjct  158   ATLGEVYYRIAEKSNKHGFPAGVCPTVGVGGHFSGGGYGNLMRKYGLSVDNIVDAQIIDV  217

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NG+LLDRKSMGE+LFWAITGGG  SF VVL+Y+I LVRVP  VT+F++ R  +QN + I 
Sbjct  218   NGKLLDRKSMGEDLFWAITGGGGVSFGVVLAYKIKLVRVPEVVTVFTIERREEQNLSTIA  277

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
               + +++ KLD +LF+R+T  V+N T   G KT+RA F  L+LG+S+ L++ +++ FPEL
Sbjct  278   ERWVQVADKLDRDLFLRMTFSVINDTN--GGKTVRAIFPTLYLGNSRNLVTLLNKDFPEL  335

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL +SDC EM W+ESVL+YT FPSGTP   LLSR PQ L   K KSDY+Q P+ +   EF
Sbjct  336   GLQESDCTEMSWVESVLYYTGFPSGTPTTALLSRTPQRLNPFKIKSDYVQNPISKRQFEF  395

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             IF++M EL+  ML FNPYGGRM+EI   AKPFPHRSGNIA IQY  NW++   EA   YL
Sbjct  396   IFERMKELENQMLAFNPYGGRMSEISEFAKPFPHRSGNIAKIQYEVNWEDLSDEAENRYL  455

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKE-NYNR  1575
               TR +Y+YMTPFVSKNPREAFLNYRDLD+GIN +   R +Y EG  YG KYFKE NY R
Sbjct  456   NFTRLMYDYMTPFVSKNPREAFLNYRDLDIGINSHG--RNAYTEGMVYGHKYFKETNYKR  513

Query  1576  LVKIKTKVDPDNFFRDEQSIPTF  1644
             LV +KTKVDPDNFFR+EQSIPT 
Sbjct  514   LVSVKTKVDPDNFFRNEQSIPTL  536



>ref|XP_006448837.1| hypothetical protein CICLE_v10017768mg, partial [Citrus clementina]
 gb|ESR62077.1| hypothetical protein CICLE_v10017768mg, partial [Citrus clementina]
Length=504

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/502 (61%), Positives = 394/502 (78%), Gaps = 6/502 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL+ +S  S  IS  IYT +N SFSSVLQ Y+RNLRF    T KPL IV A H SH+Q
Sbjct  7     LQCLSMQSQSSVAISEAIYTSSNASFSSVLQSYVRNLRFATPTTLKPLVIVAAKHESHVQ  66

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++C+K+ GLQ++ RSGGHDY+G+SYVS+VPF ILDMFN RS+N+S+ DETAWV+AGAT
Sbjct  67    ATVICSKKFGLQIRIRSGGHDYDGLSYVSNVPFVILDMFNLRSINISLTDETAWVQAGAT  126

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             +GEVYY IA  S +HGFPAGVCPT+GVGGHF G GYGNMMRK+GL+VDNI+DA+++DV G
Sbjct  127   VGEVYYKIAEASKIHGFPAGVCPTLGVGGHFSGGGYGNMMRKFGLSVDNIVDAQIVDVQG  186

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+LDRKSMGE+LFWAI GGGA+SF V+LS++I LV+VP  VT+F V +T +Q AT++V  
Sbjct  187   RILDRKSMGEDLFWAIRGGGAASFCVILSWKIKLVQVPETVTVFRVVKTLEQGATDLVAK  246

Query  865   YQRM-SHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELG  1041
             +Q++ + KLD +LFIRL ++ VN  +  GEKT++ +F A+FLG ++ LLS M +SFPELG
Sbjct  247   WQQVAADKLDQDLFIRLIINAVN-GSKDGEKTVKVSFVAMFLGQTEKLLSLMKQSFPELG  305

Query  1042  LTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
             + + DC EMRW+ES LF+ S P+GTPVE LL+R+P+  V LKRKSDY+Q P+P+ G+E I
Sbjct  306   IQKKDCFEMRWVESALFWFSQPTGTPVEVLLNRIPKSQVSLKRKSDYVQEPIPKTGLESI  365

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             +K M+EL    + +NPYGG M+EIP+   PFPHR+GNI  IQY+ NW++ G E    YL 
Sbjct  366   WKLMIELGEVGMQWNPYGGIMSEIPATETPFPHRAGNIFKIQYSANWNQPGIEVTNRYLN  425

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
             +TR  YE MTP+VSKNPREAFLNYRD+D+G N N     +Y EGK YG+KYFK N++RLV
Sbjct  426   LTRTFYEAMTPYVSKNPREAFLNYRDIDIGSNTN----GTYEEGKIYGIKYFKNNFDRLV  481

Query  1582  KIKTKVDPDNFFRDEQSIPTFP  1647
             ++KT VDPDNFF  EQSIP  P
Sbjct  482   RVKTSVDPDNFFTYEQSIPISP  503



>gb|AAL77102.1|AF472608_1 carbohydrate oxidase [Lactuca sativa]
Length=540

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/502 (65%), Positives = 397/502 (79%), Gaps = 7/502 (1%)
 Frame = +1

Query  148   ECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQA  327
             +CLN+R++PS P+S  +YTP+N SF SVLQ YIRNLRFNES T KP+ I+TA H SHIQA
Sbjct  38    QCLNNRADPSFPLSGQLYTPDNSSFPSVLQAYIRNLRFNESTTPKPILIITALHPSHIQA  97

Query  328   SILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAWVEAGA  501
             +++CAK H L MK RSGGHDYEG+SYV  S+ PFF++DMFN RS+NVSIEDETAWV+AGA
Sbjct  98    AVVCAKTHRLLMKTRSGGHDYEGLSYVTNSNQPFFVVDMFNLRSINVSIEDETAWVQAGA  157

Query  502   TLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVN  681
             TLGEVYY IA KSN H FPAGVCPTVGVGGHF G GYGN+M KYGL+VDNI+DA+LIDVN
Sbjct  158   TLGEVYYRIAEKSNSHAFPAGVCPTVGVGGHFSGGGYGNLMGKYGLSVDNIVDAQLIDVN  217

Query  682   GRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVY  861
             G+LL+RKSMGE+LFWAITGGG  SF VV++Y+I LVRVP  VT+F+V+RT +QN + I +
Sbjct  218   GKLLNRKSMGEDLFWAITGGGGVSFGVVVAYKIKLVRVPTTVTVFNVQRTSEQNLSTIAH  277

Query  862   CYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELG  1041
              + +++ KLD +LF+R+T +V+N T   GEKTIR  F  L+LG+S  L++ +++ FPELG
Sbjct  278   RWIQVADKLDNDLFLRMTFNVINNTN--GEKTIRGLFPTLYLGNSTALVALLNKDFPELG  335

Query  1042  LTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
             +  SDC EM WIESVLFYT+FP GTP   LLSR PQ L   K KSDY++  + + G E I
Sbjct  336   VEISDCIEMSWIESVLFYTNFPIGTPTTALLSRTPQRLNPFKIKSDYVKNTISKQGFESI  395

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             F++M EL+  ML FNPYGGRM+EI   AKPFPHRSGNIA IQY  NWDE G EAA  YL 
Sbjct  396   FERMKELENQMLAFNPYGGRMSEISEFAKPFPHRSGNIAKIQYEVNWDELGVEAANRYLN  455

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKE-NYNRL  1578
              TR +Y+YMTPFVSKNPREAFLNYRDLD+G+N +   + +Y EG  YG KYFKE NY RL
Sbjct  456   FTRVMYDYMTPFVSKNPREAFLNYRDLDIGVNSHG--KNAYGEGMVYGHKYFKETNYKRL  513

Query  1579  VKIKTKVDPDNFFRDEQSIPTF  1644
               +KT+VDP NFFR+EQSIPT 
Sbjct  514   TMVKTRVDPSNFFRNEQSIPTL  535



>ref|XP_010667595.1| PREDICTED: reticuline oxidase-like protein [Beta vulgaris subsp. 
vulgaris]
Length=523

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/506 (61%), Positives = 391/506 (77%), Gaps = 4/506 (1%)
 Frame = +1

Query  139   TVLECLNDR-SNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             ++++CL ++ +  S PIS +IYT  N S+S+ L   I NLRF ++ T KPL IVT TH S
Sbjct  18    SLIQCLENKIATSSSPISSLIYTQENPSYSTFLNSRIHNLRFIKATTPKPLVIVTPTHAS  77

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             HIQ +I  AK+ GLQM+ RSGGHDYEG+SYVS+ PFFILD+ N RS++V IE+ETAWV+A
Sbjct  78    HIQGAIQWAKQQGLQMRIRSGGHDYEGLSYVSNAPFFILDLVNLRSIDVDIEEETAWVQA  137

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE+ Y IA KS  HGFP GVCP+VGVGGHF G GYGNMMRKYGLT+DN+IDA+LID
Sbjct  138   GATLGEMCYEIAKKSKTHGFPVGVCPSVGVGGHFSGGGYGNMMRKYGLTIDNVIDAQLID  197

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
              NGR L+RKSMGE+LFWAI GGG +SF V+LSY+I LV VP  VT+F V RT ++NA +I
Sbjct  198   ANGRFLNRKSMGEDLFWAIRGGGGASFGVILSYKIKLVPVPEVVTVFRVSRTMEENAISI  257

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVN--ITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
             V  +Q +S  +D +LF+RLT+DV++     + G+KT+RATF ALFLGDS  L S M + F
Sbjct  258   VLQWQEISSIIDNDLFLRLTMDVIDGGDMINKGKKTVRATFIALFLGDSTRLNSLMRDQF  317

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNG  1209
             P+L L +SDC EM WIESVLF+  +PSG P+E LL R P+ L HL RKSDY++ P+PR G
Sbjct  318   PKLKLQESDCHEMSWIESVLFWADYPSGAPLEVLLQRTPKTLSHLTRKSDYVKKPIPREG  377

Query  1210  IEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQ  1389
             +EFI+ KMVEL+TP LTFNPYGGRM+EI     PFPHR GN+  IQY TNWDE G +  +
Sbjct  378   LEFIWGKMVELETPRLTFNPYGGRMSEISENETPFPHRKGNLYKIQYLTNWDEEGKDKEK  437

Query  1390  HYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENY  1569
             +Y+++TR+LY YMTP+VSK PR+A+ NYRDLDLG+N + G   S+ EG  YG++YFK+NY
Sbjct  438   YYIDLTRKLYIYMTPYVSKYPRQAYFNYRDLDLGVNKHDG-ISSFLEGMKYGIQYFKDNY  496

Query  1570  NRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             + LVKIKT VDPDNFF +EQSIP  P
Sbjct  497   DNLVKIKTIVDPDNFFNNEQSIPALP  522



>gb|KHN44657.1| Reticuline oxidase-like protein [Glycine soja]
Length=565

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/498 (62%), Positives = 387/498 (78%), Gaps = 3/498 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             + CL + S PSHPIS  I+T N+ SFSSVLQ YIRNLRFN S T+KP  IVT  H+SH+Q
Sbjct  33    VHCLVNHSEPSHPISAAIFTQNSSSFSSVLQAYIRNLRFNTSTTRKPFLIVTPFHVSHVQ  92

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             ASI+CAK+H L MK RSGGHDYEGVSYV+  PFFILDMFN RS+ + +E ETAWVEAGA 
Sbjct  93    ASIVCAKKHNLLMKIRSGGHDYEGVSYVASQPFFILDMFNLRSIEIDMESETAWVEAGAM  152

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY IA KS  HGFPAGVCPTVGVGGH  G GYGN+MRKYG +VDN++DA+++D  G
Sbjct  153   LGEVYYRIAEKSKTHGFPAGVCPTVGVGGHISGGGYGNLMRKYGTSVDNVVDAQIVDARG  212

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             RLL+R++MGE+LFWA+ GGG  SF VVL+Y+I LVRVP KVT+F V  T +QNAT+IVY 
Sbjct  213   RLLNRRTMGEDLFWAVRGGGGGSFGVVLAYKIRLVRVPEKVTVFQVGVTLEQNATDIVYN  272

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++  +D +LFIRL ++VVN  T    KT+RATF ALFLGDSK+L+S M++ FP+LGL
Sbjct  273   WQHVAPTIDNDLFIRLILEVVN-GTQTATKTVRATFIALFLGDSKSLVSLMNDKFPQLGL  331

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              QSDC E  W++SVLF+ +    TPVE LL R PQ   +LKRKSDY++ P+ + G E I+
Sbjct  332   KQSDCIETTWLKSVLFWDNIDIATPVEILLERQPQSFKYLKRKSDYVKKPISKEGWEGIW  391

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
              KM+EL+  ++ FNPYGGRMAEIPS    FPHR+GN+  IQY  NW E G E A++++ +
Sbjct  392   NKMIELEKAIMYFNPYGGRMAEIPSTETAFPHRAGNLWKIQYQANWFEAGEEVAEYHINL  451

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
              R+L++YMTPFVS+NPR+AF+ Y+DL+LGINH+      YFEG  YG++YF +N+ RLV+
Sbjct  452   VRELHKYMTPFVSQNPRQAFICYKDLELGINHHGFY--GYFEGSAYGVQYFDDNFKRLVQ  509

Query  1585  IKTKVDPDNFFRDEQSIP  1638
             IKTKVDP NFFR EQSIP
Sbjct  510   IKTKVDPSNFFRTEQSIP  527



>ref|XP_003534791.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=565

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/498 (62%), Positives = 387/498 (78%), Gaps = 3/498 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             + CL + S PSHPIS  I+T N+ SFSSVLQ YIRNLRFN S T+KP  IVT  H+SH+Q
Sbjct  33    VHCLVNHSEPSHPISAAIFTQNSSSFSSVLQAYIRNLRFNTSTTRKPFLIVTPFHVSHVQ  92

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             ASI+CAK+H L MK RSGGHDYEGVSYV+  PFFILDMFN RS+ + +E ETAWVEAGA 
Sbjct  93    ASIVCAKKHNLLMKIRSGGHDYEGVSYVASQPFFILDMFNLRSIEIDMESETAWVEAGAM  152

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY IA KS  HGFPAGVCPTVGVGGH  G GYGN+MRKYG +VDN++DA+++D  G
Sbjct  153   LGEVYYRIAEKSKTHGFPAGVCPTVGVGGHISGGGYGNLMRKYGTSVDNVVDAQIVDARG  212

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             RLL+R++MGE+LFWA+ GGG  SF VVL+Y+I LVRVP KVT+F V  T +QNAT+IVY 
Sbjct  213   RLLNRRTMGEDLFWAVRGGGGGSFGVVLAYKIRLVRVPEKVTVFQVGVTLEQNATDIVYN  272

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++  +D +LFIRL ++VVN  T    KT+RATF ALFLGDSK+L+S M++ FP+LGL
Sbjct  273   WQHVAPTIDNDLFIRLILEVVN-GTQTATKTVRATFIALFLGDSKSLVSLMNDKFPQLGL  331

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              QSDC E  W++SVLF+ +    TPVE LL R PQ   +LKRKSDY++ P+ + G E I+
Sbjct  332   KQSDCIETTWLKSVLFWDNIDIATPVEILLERQPQSFKYLKRKSDYVKKPISKEGWEGIW  391

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
              KM+EL+  ++ FNPYGGRMAEIPS    FPHR+GN+  IQY  NW E G E A++++ +
Sbjct  392   NKMIELEKAIMYFNPYGGRMAEIPSTETAFPHRAGNLWKIQYQANWFEAGEEVAEYHINL  451

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
              R+L++YMTPFVS+NPR+AF+ Y+DL+LGINH+      YFEG  YG++YF +N+ RLV+
Sbjct  452   VRELHKYMTPFVSQNPRQAFICYKDLELGINHHGFY--GYFEGSAYGVQYFDDNFKRLVQ  509

Query  1585  IKTKVDPDNFFRDEQSIP  1638
             IKTKVDP NFFR EQSIP
Sbjct  510   IKTKVDPSNFFRTEQSIP  527



>ref|XP_004486493.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=566

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/500 (61%), Positives = 392/500 (78%), Gaps = 2/500 (0%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++CL + S PS+PI   I+T N+ SF S+LQ YIRNLRFN S T KP  I+T  ++SHI+
Sbjct  26    IQCLVNNSEPSNPIIESIFTQNSPSFPSILQAYIRNLRFNTSTTPKPFLIITPLYVSHIK  85

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             ASI+C ++H  QMK RSGGHDYEGVSYV++VPFF+LDMFN RS+ V IE+ETAW+++GAT
Sbjct  86    ASIICGQKHNFQMKIRSGGHDYEGVSYVAEVPFFMLDMFNLRSIEVDIENETAWIQSGAT  145

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY IA KS +HGFPAGVCPTVGVGGH  G GYGN+MRKYG ++DN+IDA++ID  G
Sbjct  146   LGEVYYRIAEKSEIHGFPAGVCPTVGVGGHVSGGGYGNLMRKYGTSIDNVIDAQIIDAKG  205

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             RLLDR+ MGE+LFWAI GGG ++F VVLSY+I LV VP  VT+F V+RT +QNATNIVY 
Sbjct  206   RLLDREEMGEDLFWAIKGGGGANFGVVLSYKIKLVHVPKIVTVFEVQRTLEQNATNIVYN  265

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++     +LFIRL +DVV      G KTIRA+F AL+LGDSK+L+S M+ESFP+LGL
Sbjct  266   WQHVAPTTSNDLFIRLILDVVK-DAKNGMKTIRASFIALYLGDSKSLVSLMNESFPQLGL  324

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              +SDC E  W++SVLF+ +    TPVE LL R PQ+L +LKRKSDY++ P+   G E I+
Sbjct  325   MESDCIETSWLKSVLFWDNINIDTPVEILLERQPQLLRYLKRKSDYVKEPISIMGFEGIW  384

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             KKM+EL+  ++ FNPYGG+MAEI S   P PHR+GN+  IQY  NW+E G E   +++ +
Sbjct  385   KKMIELEKGVMFFNPYGGKMAEISSNETPLPHRAGNLWKIQYQANWNEAGEEVTFYHINV  444

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
             TR+LY+YMTPFVSKNPR+A+LNY+DLDLGIN + G   S+ +G  YG++YFK+N++RLV+
Sbjct  445   TRELYKYMTPFVSKNPRQAYLNYKDLDLGINQH-GFFSSHSQGSVYGIQYFKDNFHRLVQ  503

Query  1585  IKTKVDPDNFFRDEQSIPTF  1644
             IK+KVDP NFFR+EQSIP  
Sbjct  504   IKSKVDPGNFFRNEQSIPVL  523



>ref|XP_003547339.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
 gb|KHN14297.1| Reticuline oxidase-like protein [Glycine soja]
Length=559

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/499 (61%), Positives = 383/499 (77%), Gaps = 3/499 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             + CL + S PSHPIS  I+T  + SFSSVLQ YIRNLRFN S T KP  IVT   +SH+Q
Sbjct  32    VHCLVNHSEPSHPISAAIFTQKSSSFSSVLQAYIRNLRFNTSTTHKPFLIVTPFQVSHVQ  91

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+I+CAK+H L MK RSGGHDYEGVSYV+  PFFILDMFN RS+ + ++ ETAWV+AGAT
Sbjct  92    AAIVCAKKHSLLMKIRSGGHDYEGVSYVASQPFFILDMFNLRSIEIDMDTETAWVQAGAT  151

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY IA KS  HGFPAGVCPTVGVGGH  G GYGN+MRKYG +VDN++DA ++D  G
Sbjct  152   LGEVYYRIAEKSKTHGFPAGVCPTVGVGGHISGGGYGNLMRKYGTSVDNVVDAHIVDAQG  211

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             RLL+R++MGE+LFWA+ GGG  SF VVL+Y+I LVRVP KVT+F V RT +QNAT+IVY 
Sbjct  212   RLLNRRTMGEDLFWAVRGGGGGSFGVVLAYKIKLVRVPEKVTVFQVGRTLEQNATDIVYN  271

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++  +D +LFIRL ++VVN  T    KT+RATF ALFLGDSK+L+S MDE FP+LGL
Sbjct  272   WQHVAPSIDNDLFIRLILEVVN-GTQTATKTVRATFIALFLGDSKSLVSLMDEKFPQLGL  330

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              Q DC E  W+ SVLF+ +    TPVE LL R PQ   +LKRKSDY++ P+ + G E I+
Sbjct  331   KQFDCIETTWLRSVLFWDNIDIATPVEILLERQPQSFKYLKRKSDYVKKPISKEGWEGIW  390

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
              KM+EL+  ++ FNPYGGRMAEIPS    FPHR+GN+  IQY  NW E G E A++++ +
Sbjct  391   NKMIELEKAIMYFNPYGGRMAEIPSTETAFPHRAGNLWKIQYQANWFEAGEEVAEYHINL  450

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
              R+L++YMTPFVS+NPR+AF+ Y+DL+LGINH+      YFEG  YG++YF +N+ RLV+
Sbjct  451   VRELHKYMTPFVSQNPRQAFICYKDLELGINHHG--YYGYFEGSAYGVQYFDDNFRRLVQ  508

Query  1585  IKTKVDPDNFFRDEQSIPT  1641
             IKT+VDP NFFR EQSIP 
Sbjct  509   IKTRVDPSNFFRTEQSIPV  527



>emb|CAN81650.1| hypothetical protein VITISV_003752 [Vitis vinifera]
Length=532

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/500 (59%), Positives = 386/500 (77%), Gaps = 7/500 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL   S+PS P S ++Y   N S+++VLQ YIRN RFN S T KPL IVT    SH
Sbjct  37    TFIQCLASHSDPSPPASSIVYNQXNSSYTTVLQSYIRNRRFNTSSTPKPLIIVTPLVESH  96

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA+ILC+K  G++MK RSGGHDY+G+SY+SD+PFFILD+FN R+++V+I DETAWV+AG
Sbjct  97    VQAAILCSKNVGMEMKIRSGGHDYDGLSYISDIPFFILDLFNLRAIDVNIGDETAWVQAG  156

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY I  KS +HGFPAGVCPTVG GGH  G GYGNM+RKYGL++D ++DAK++DV
Sbjct  157   ATLGELYYRIWEKSKLHGFPAGVCPTVGAGGHISGGGYGNMLRKYGLSIDQLVDAKIVDV  216

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGR+LDRK+MGE+LFWAI GGGASSF VVL+Y+I LV VP  VT+F V RT DQNAT++V
Sbjct  217   NGRILDRKAMGEDLFWAIRGGGASSFGVVLAYKIKLVAVPETVTVFRVERTLDQNATDLV  276

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++ K+D +LFIR+ +  V +  +   +TIRA+F +LFLGD+  LLS MD+ FP L
Sbjct  277   YKWQLVADKIDNDLFIRVLLQPVTVNKN---RTIRASFVSLFLGDAARLLSVMDKDFPAL  333

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL + DC EM WIESVL++ +F +GT  + LL+R+   +  LKRKSDY+QTP+ ++G+E+
Sbjct  334   GLKKEDCMEMSWIESVLYWANFDNGTSADALLNRISDSVNFLKRKSDYVQTPISKDGLEW  393

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             ++KKM+ +    L FNPYGGRM+EIPS+   FPHR+GNI  IQY+ NW E G EA + Y+
Sbjct  394   MWKKMIAIGKTGLVFNPYGGRMSEIPSSETAFPHRAGNIYKIQYSVNWSEEGEEADKEYM  453

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
                R+LY YMTPFVSK+PR +FLNYRD+D+G+     +  SY EGK YG KYF  N++RL
Sbjct  454   TQIRRLYSYMTPFVSKSPRGSFLNYRDVDIGVT----KTWSYDEGKVYGAKYFMNNFDRL  509

Query  1579  VKIKTKVDPDNFFRDEQSIP  1638
             VK+KT VDP NFFR+EQSIP
Sbjct  510   VKVKTAVDPTNFFRNEQSIP  529



>ref|XP_011006009.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=533

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/501 (60%), Positives = 392/501 (78%), Gaps = 4/501 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+CL + S P++PIS  I+TP N  F++VLQ Y RNLRF    T KPL I+ A H SH
Sbjct  26    SFLQCLTENSQPTNPISDAIHTPENPLFTTVLQSYARNLRFLTLSTPKPLAIIAAKHESH  85

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA+I+C+K+ GLQ++ RSGGHDY+G+SYVSDVPF ILDMFN RS+N+ IEDE+AWV+AG
Sbjct  86    VQATIICSKKLGLQIRIRSGGHDYDGLSYVSDVPFIILDMFNLRSINIDIEDESAWVQAG  145

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KSNVHGFPAGVCPT+GVGGHF G GYGNMMRKYGL+VDNI+DA++IDV
Sbjct  146   ATLGEVYYRIAEKSNVHGFPAGVCPTLGVGGHFSGGGYGNMMRKYGLSVDNIVDAQIIDV  205

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GR+LDRKSMGE+LFWAI GGGA+SF V+LS++I LV VP  VT+FSV RT ++  +++ 
Sbjct  206   RGRILDRKSMGEDLFWAIRGGGAASFGVILSWKIKLVPVPEIVTVFSVDRTLEEGVSDLA  265

Query  859   YCYQRM-SHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             + +Q++ + KLD ++FIRL +  VN T   G+KTI+A+F A+FLG ++ LLS M+ESFPE
Sbjct  266   WKWQQIAADKLDNDIFIRLMLQPVNGTQ--GKKTIQASFVAMFLGRAERLLSVMNESFPE  323

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL   DC E+RWIESVLF+   P GTP+E LL R+P+ + +LKRKSDY++ P+ + G+E
Sbjct  324   LGLQAKDCAEIRWIESVLFWVGMPHGTPIEVLLDRIPKGVNYLKRKSDYVKEPISKEGLE  383

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              I+K M E+    + +NPYGG+M+EI  A   FPHR+GNI  IQY+ NW + G     HY
Sbjct  384   SIWKVMAEVGEVAMLWNPYGGKMSEISEAETAFPHRAGNIFKIQYSVNWKQEGIATTNHY  443

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             + +TR L+E MTP+VSKNPREAFLNYRD+D+G   ++G   ++ E   YG KYFK+N++R
Sbjct  444   VNLTRTLFEAMTPYVSKNPREAFLNYRDIDIGSIGSQG-NGTFQEASVYGHKYFKDNFDR  502

Query  1576  LVKIKTKVDPDNFFRDEQSIP  1638
             LV+IKT+VDPDNFFR EQSIP
Sbjct  503   LVQIKTRVDPDNFFRYEQSIP  523



>ref|XP_002317086.1| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|EEE97698.1| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=534

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/502 (60%), Positives = 391/502 (78%), Gaps = 7/502 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL + S P++PIS  I+TP+N SF++VLQ Y RNLRF    T KPL I+ A H SH+Q
Sbjct  28    LQCLTENSQPTNPISDAIHTPDNPSFTTVLQSYARNLRFLTLSTPKPLAIIAAKHESHVQ  87

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+I+C+K+ GLQ++ RSGGHDY+G+SYVSDV F ILDMFN RS+N+ IEDE+AWV+AGAT
Sbjct  88    ATIICSKKLGLQIRIRSGGHDYDGLSYVSDVAFIILDMFNLRSINIDIEDESAWVQAGAT  147

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY IA KSNVHGFPAGVCPT+GVGGHF G GYGNMMRKYGL+VDNI+DA++IDV G
Sbjct  148   LGEVYYRIAEKSNVHGFPAGVCPTLGVGGHFSGGGYGNMMRKYGLSVDNIVDAQIIDVRG  207

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+LDRKSMGE+LFWAI GGGA+SF V+LS++I LV VP  VT+FSV RT ++  +++ + 
Sbjct  208   RILDRKSMGEDLFWAIRGGGAASFGVILSWKIKLVPVPEIVTVFSVDRTLEEGVSDLAWK  267

Query  865   YQRM-SHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELG  1041
             +Q++ + KLD +LFIRL +  VN  T  G+KTI+A+F A+FLG ++ LLS M+ESFPELG
Sbjct  268   WQQIAADKLDNDLFIRLMLQPVN-GTQEGKKTIQASFVAMFLGRAERLLSVMNESFPELG  326

Query  1042  LTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
             L   DC EMRWIESVL +   P GTP+E LL R+P+ + +LKRKSDY++ P+ + G+E I
Sbjct  327   LQAKDCAEMRWIESVLSWVGMPKGTPIEVLLDRIPKGVSYLKRKSDYVKEPISKEGLESI  386

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             +K M E+    + +NPYGG+M+EI      FPHR+GNI  IQY+ NW + G +   HY+ 
Sbjct  387   WKVMTEVGEVAMLWNPYGGKMSEISETETAFPHRAGNIFKIQYSVNWKQEGIDTTNHYVN  446

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGI--NHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             +TR L+E MTP+VSKNPREAFLNYRD+D+G   +H  G   ++ E   YG KYFK+N++R
Sbjct  447   LTRTLFEAMTPYVSKNPREAFLNYRDIDIGSIGSHGNG---TFQEASVYGHKYFKDNFDR  503

Query  1576  LVKIKTKVDPDNFFRDEQSIPT  1641
             LV+IKT+VDPDNFF  EQSIPT
Sbjct  504   LVQIKTRVDPDNFFGYEQSIPT  525



>ref|XP_007023052.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY25674.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=540

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/499 (60%), Positives = 391/499 (78%), Gaps = 4/499 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++CL  +S  S+PI+  IYTPNN SFSSVL+ Y+RNLRF    T KPL IVTA H SH+Q
Sbjct  39    VQCLCKQSQSSNPIAGAIYTPNNASFSSVLESYVRNLRFMTPETPKPLVIVTALHESHVQ  98

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++C+K  GLQ++ RSGGHDYEG+SYVS VPF ILDMFN R +++++ DE+AWV+AGA+
Sbjct  99    ATVVCSKSVGLQIRIRSGGHDYEGLSYVSSVPFVILDMFNLRGIDINVRDESAWVQAGAS  158

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY IA KS VHGFPAGVCPT+GVGGHF G GYGNMMRKYGL+VDNIIDAK++D +G
Sbjct  159   LGEVYYRIAEKSPVHGFPAGVCPTLGVGGHFTGGGYGNMMRKYGLSVDNIIDAKVVDASG  218

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+LDR SMGE+LFWAI GGGA+SF VVLS++I LV VP  VT+F V +T ++ AT++V  
Sbjct  219   RILDRASMGEDLFWAIRGGGAASFCVVLSWKIKLVPVPETVTVFRVDKTLEEGATDLVVK  278

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q+++ +LD +LFIRL +    I + PG+ TI+A+F A+FLG ++ LL  M+ESFPELGL
Sbjct  279   WQQVADRLDDDLFIRLMLSPEKIGSPPGQNTIQASFVAMFLGQTERLLQLMNESFPELGL  338

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              + DC +MRW+ESVLF+ ++P+ +  + LL R+P+    LKRKSDY+Q P+P+ G+E I+
Sbjct  339   QKKDCIKMRWVESVLFWINYPNVSSTDVLLQRIPKSESFLKRKSDYVQQPIPKAGLEAIW  398

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             K M+E +   + +NPYGG+M+EI   A PFPHR+GNI  IQY +NW + G E A ++L  
Sbjct  399   KVMMEAENVGMNWNPYGGKMSEILPTATPFPHRAGNIFKIQYGSNWKKPGNEVADNFLNW  458

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
             TR+LYE MTP+VSKNPRE+FLNYRD+D+G+N N     +  EG+ YG KYFKEN++RLV 
Sbjct  459   TRKLYEAMTPYVSKNPRESFLNYRDIDIGVNSN----GTLEEGRVYGSKYFKENFDRLVD  514

Query  1585  IKTKVDPDNFFRDEQSIPT  1641
             +KT+VDPDNFF  EQSIPT
Sbjct  515   VKTQVDPDNFFSYEQSIPT  533



>ref|XP_002523155.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39186.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=533

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/514 (58%), Positives = 396/514 (77%), Gaps = 5/514 (1%)
 Frame = +1

Query  100   SIGAWAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTK  279
             SI     + Y     L+CL+D S  S+PIS  I+TPNN SF+SVLQ Y+RNLRF+   T 
Sbjct  15    SISLAKAVTYDHQDFLQCLSDNSQKSNPISDAIFTPNNSSFTSVLQSYVRNLRFSAPSTP  74

Query  280   KPLFIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVN  459
             KP+ I+ A H SH+QA+++C+K  GLQ++ RSGGHDY+G+SYVS+VPF +LDMFN RS+N
Sbjct  75    KPIAIIAAKHDSHVQAAVICSKTLGLQIRIRSGGHDYDGLSYVSEVPFVVLDMFNLRSIN  134

Query  460   VSIEDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGL  639
             ++I DETAWV+AGATLGE+YY IA+KSNVH FPAGVCP++GVGGHF G GYGN+MRKYGL
Sbjct  135   INITDETAWVQAGATLGELYYNIADKSNVHAFPAGVCPSLGVGGHFSGGGYGNLMRKYGL  194

Query  640   TVDNIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFS  819
             +VDNI+DA+++D  GR+LDRKSMGE+LFWAITGGGA+SF V+LS++INLV+VP +VT+F 
Sbjct  195   SVDNIVDAQIVDAKGRILDRKSMGEDLFWAITGGGAASFGVILSWKINLVQVPEQVTVFQ  254

Query  820   VRRTYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSK  999
             V R+ +Q AT++V+ +Q+++ KLD +LFIRL +  VN  T PG+KT+  TF A+FLG +K
Sbjct  255   VVRSVEQGATDLVWKWQQIADKLDHDLFIRLILTPVN-GTEPGKKTVNVTFVAMFLGGTK  313

Query  1000  TLLSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSD  1179
              LLS M+ESFP+LGL + DC EMRWIES + +   P GTP+E LL+R     V+LKRKSD
Sbjct  314   RLLSLMNESFPQLGLQKKDCTEMRWIESTVIWVGMPKGTPIEALLNRPTNASVYLKRKSD  373

Query  1180  YLQTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATN  1359
             Y++ P+ +  +E I+K M E+   M  +NPYGG+M+EI     PFPHR+GN+  IQY+ N
Sbjct  374   YVKEPISKKNLESIWKIMAEVGVSM-QWNPYGGKMSEISETETPFPHRAGNLFKIQYSAN  432

Query  1360  WDEHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKT  1539
             W +   +  + +L  TR L+E MTP+VSKNPREAFLNYRD+D+G   + G   ++ E   
Sbjct  433   WLQD--QTTELFLNSTRTLFEAMTPYVSKNPREAFLNYRDIDIGSIGSSG-NGTFQEASV  489

Query  1540  YGLKYFKENYNRLVKIKTKVDPDNFFRDEQSIPT  1641
             YG+KYFK+N++RLV++KT VDPDNFFR EQSIPT
Sbjct  490   YGVKYFKDNFDRLVRVKTAVDPDNFFRYEQSIPT  523



>ref|XP_010672792.1| PREDICTED: reticuline oxidase-like protein [Beta vulgaris subsp. 
vulgaris]
Length=523

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/507 (61%), Positives = 389/507 (77%), Gaps = 6/507 (1%)
 Frame = +1

Query  139   TVLECLNDR-SNPSHPISPVIYTPN-NGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             +V++CL ++ +  S PIS +IYT + N S+S++L   I NLRF ++ T KPL IVT TH 
Sbjct  18    SVIQCLENKIATSSSPISSLIYTQDQNPSYSTILNSRIHNLRFIKATTPKPLVIVTPTHA  77

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVE  492
             SHI+  I  AK+ GLQM+ RSGGHDYEG+SYVS+ PFFILD+ N RS++V IE+ETAWV+
Sbjct  78    SHIRGVIQWAKQQGLQMRIRSGGHDYEGLSYVSNAPFFILDLVNLRSIDVDIEEETAWVQ  137

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
             AGAT GE+ Y IA KS  HGFP GVCP+VGVGGHF G GYGNMMRKYGLT+DN+IDA+LI
Sbjct  138   AGATFGEMCYEIAKKSKTHGFPVGVCPSVGVGGHFSGGGYGNMMRKYGLTIDNVIDAQLI  197

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             D NGR L+RKSMGE+LFWAI GGG +SF V+LSY+I LV VP  VT+F V RT ++NA +
Sbjct  198   DANGRFLNRKSMGEDLFWAIRGGGGASFGVILSYKIKLVPVPEVVTVFRVSRTMEENAIS  257

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVN--ITTHPGEKTIRATFNALFLGDSKTLLSTMDES  1026
             IV  +Q +S  +D +LF+RLT+DV++     + G+K +RATF ALFLGDS  L S M + 
Sbjct  258   IVLQWQEISSIIDNDLFLRLTMDVIDGGDMINKGKKMVRATFIALFLGDS-MLNSLMRDQ  316

Query  1027  FPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             FP+L L +SDC EM WIESVLF+  +PSG P+E LL R P+ L HL RK DY++ P+PR 
Sbjct  317   FPKLKLQESDCHEMSWIESVLFWADYPSGAPLEVLLQRTPKTLSHLTRKPDYVKKPIPRE  376

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G+EFI+ KMVEL+TP LTFNPYGGRM+EI     PFPHR GN+  IQY TNWDE G +  
Sbjct  377   GLEFIWGKMVELETPRLTFNPYGGRMSEISENETPFPHRKGNLYKIQYLTNWDEEGKDKE  436

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
             ++Y+++TR+LY YMTP+VSK PR+A+ NYRDLDLG+N + G   S+ EG  YG++YFK+N
Sbjct  437   KYYIDLTRKLYIYMTPYVSKYPRQAYFNYRDLDLGVNKHDG-ISSFLEGMKYGIQYFKDN  495

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             Y+ LVKIKT VDPDNFF +EQS+P  P
Sbjct  496   YDNLVKIKTIVDPDNFFNNEQSVPALP  522



>gb|KEH37085.1| reticuline oxidase-like protein [Medicago truncatula]
Length=562

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/500 (60%), Positives = 387/500 (77%), Gaps = 2/500 (0%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++CL + S PS+PI   I+T N+ SF S+LQ YIRNLRFN + T KP  I+T  H+SHIQ
Sbjct  26    IQCLVNNSEPSNPIIESIFTQNSPSFPSILQAYIRNLRFNTTKTPKPFLIITPLHVSHIQ  85

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             ASI+C ++H  QMK RSGGHDYEGVSYVS+VPFFILDMFN RS+ + I  ETAW+++GAT
Sbjct  86    ASIICGQKHNFQMKIRSGGHDYEGVSYVSNVPFFILDMFNLRSIEIDINTETAWIQSGAT  145

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY IA KS  H F AGVCPTVGVGGH  GAGYGN+MRKYG + DN++DA++ID  G
Sbjct  146   LGEVYYRIAEKSKTHAFAAGVCPTVGVGGHVSGAGYGNLMRKYGTSTDNVLDAEIIDSKG  205

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             RLLDRKSMGE+LFWAI GGG ++F VVLSY+I LV+VP  VT+F V+RT +QNA++IVY 
Sbjct  206   RLLDRKSMGEDLFWAIRGGGGANFGVVLSYKIKLVKVPKIVTVFEVQRTLEQNASDIVYN  265

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++     +LFIRL ++VV    + G KTIRATF +LFLGDSKTL+S M+E+FP+LGL
Sbjct  266   WQHVAPTTSNDLFIRLILEVVKDAKN-GAKTIRATFISLFLGDSKTLVSLMNETFPQLGL  324

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              + DC E  W++SV  + +    TP + LL R PQ+L +LKRKSDY++ P+ + G+E I+
Sbjct  325   REQDCIETSWLQSVFLWDNIKIDTPFKILLERQPQLLRYLKRKSDYVKEPISKEGLEGIW  384

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             KKM+EL+  ++ FNPYGG+M EI     P PHR+GN+  IQY  NW+E G E   +++ +
Sbjct  385   KKMIELEKGVMFFNPYGGKMDEISPTETPLPHRAGNLWKIQYQANWNEEGEEVTFYHINV  444

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
             TR+LY+YMTPFVSKNPR+A+LNY+DLDLGINH+ G   SY +G  YG++YFK+N++RLV+
Sbjct  445   TRELYKYMTPFVSKNPRQAYLNYKDLDLGINHH-GFFSSYSQGSVYGIQYFKDNFHRLVE  503

Query  1585  IKTKVDPDNFFRDEQSIPTF  1644
             IKTKVDP NFFR+EQSIP  
Sbjct  504   IKTKVDPSNFFRNEQSIPVL  523



>ref|XP_002270139.2| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=539

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/504 (58%), Positives = 389/504 (77%), Gaps = 3/504 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL++ S PSH  S ++Y   N SF++VL+ YIRN RFN S T KPL IVT +  S 
Sbjct  32    TFVQCLSNHSAPSHQASSIVYAQTNSSFTNVLRSYIRNERFNTSSTPKPLIIVTPSDESQ  91

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA+I+C+++ G+ +K RSGGHDY+G+S VSDVPFFILDMFN RS+NV+I DETAWV+AG
Sbjct  92    VQAAIICSRDIGILLKIRSGGHDYDGLSSVSDVPFFILDMFNLRSINVNITDETAWVQAG  151

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY I  KS VHGFPAGVCPT+GVGGH  G GYGNM+RKYGL++D+I+DA++I+V
Sbjct  152   ATLGELYYRIWEKSRVHGFPAGVCPTLGVGGHLSGGGYGNMLRKYGLSIDHIVDAQIINV  211

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NG +LDRKSMGE+LFWAI GGG +SF V+LSY++ LVRVP  VT+F V +T  QNAT++V
Sbjct  212   NGSILDRKSMGEDLFWAIRGGGGASFGVILSYKVKLVRVPEIVTVFRVEKTLAQNATDLV  271

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPG-EKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             Y +Q ++ K+D +LF+RL +  + + +  G  KT+R TF +LFLGD+  L+S M++ FPE
Sbjct  272   YQWQHITDKIDNDLFMRLLLQPITVKSDNGSSKTVRVTFISLFLGDATRLISVMNKDFPE  331

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL + DC+EM WIESVL++ +F + T V  LL+R  + +   K KSDY+Q PM ++G+E
Sbjct  332   LGLKKEDCKEMSWIESVLYWANFDNRTSVNVLLNRTLESVKFFKAKSDYMQKPMSKDGLE  391

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              ++KKM+EL  P + FN YGGRM+EIP++  PFPHR+GNI  IQY+ NW E G EA + Y
Sbjct  392   GLWKKMIELGKPGMVFNSYGGRMSEIPASETPFPHRAGNIFKIQYSVNWHEEGTEADKKY  451

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             + + R+L+ YMTP VSK+PR ++LNYRD+D+GI+HN   + SY EGK YG+KYF  N++R
Sbjct  452   VNLIRELHSYMTPLVSKSPRGSYLNYRDIDIGISHNG--KDSYQEGKVYGVKYFMNNFDR  509

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFP  1647
             LVK+KT VDP NFFR EQSIP  P
Sbjct  510   LVKVKTAVDPQNFFRYEQSIPPLP  533



>ref|XP_004295439.1| PREDICTED: reticuline oxidase-like protein-like [Fragaria vesca 
subsp. vesca]
Length=534

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/520 (57%), Positives = 390/520 (75%), Gaps = 11/520 (2%)
 Frame = +1

Query  103   IGAWAPLCYCA------TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFN  264
             +G  +P+ Y        TT L+CL++ S  S PIS V+YT  N +FSSVLQ Y+RNLRF+
Sbjct  15    LGVISPVSYATNSSSVETTFLQCLSNHSQSSSPISEVVYTSKNANFSSVLQSYVRNLRFS  74

Query  265   ESYTKKPLFIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFN  444
                T KPL IV A + SH+QA+++CAK  GL+++ RSGGHDYEG+SYVS  PF +LDMFN
Sbjct  75    TPTTPKPLLIVAAKNYSHVQATVVCAKRVGLEIRIRSGGHDYEGLSYVSSKPFIVLDMFN  134

Query  445   FRSVNVSIEDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMM  624
              RS+N+ + DE+AWV++GATLGE+YY I+ KS VHGFPAGVC T+G GGHF G GYGNMM
Sbjct  135   LRSINIDLADESAWVQSGATLGEIYYAISTKSKVHGFPAGVCLTLGAGGHFTGGGYGNMM  194

Query  625   RKYGLTVDNIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPK  804
             RKYGL+VDNI+D ++++VNG +LDRKSMGE+LFWAI GGGA+SF V+L+++I LV+VP K
Sbjct  195   RKYGLSVDNIVDVQIVNVNGEILDRKSMGEDLFWAIRGGGAASFGVILAWKIKLVKVPEK  254

Query  805   VTIFSVRRTYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALF  984
             VT+F V RT +Q AT+IV  +Q+++  +D +LFIR+ +   N  +  GEKTI+ TF +LF
Sbjct  255   VTVFQVDRTLEQGATDIVVQWQKVADNIDNDLFIRVMLAPGN-GSREGEKTIKVTFVSLF  313

Query  985   LGDSKTLLSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHL  1164
             LGDS  LL  +++S P+LGL Q DC EM WIES+LF+  +P+GT ++ LLSRVP  +++L
Sbjct  314   LGDSARLLRLLNQSLPQLGLQQKDCIEMSWIESILFWAGYPNGTSLDVLLSRVPMGMIYL  373

Query  1165  KRKSDYLQTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMI  1344
             KRKSDY+Q P+ +  +E ++K M+E+    + +NPYGG+M+EIP    PFPHR+GNI  I
Sbjct  374   KRKSDYVQEPISKTDMEALWKVMIEIGDGGMLWNPYGGKMSEIPDTETPFPHRAGNIFKI  433

Query  1345  QYATNWDEHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSY  1524
             QY+ NW +   E    YL +T +L+E MTP VSKNPREAFLNYRD+D+G N     +  Y
Sbjct  434   QYSFNWIDGRLETTNRYLNLTTKLHEAMTPHVSKNPREAFLNYRDIDIGTN----TKGDY  489

Query  1525  FEGKTYGLKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTF  1644
              E + YG+KYFK N+ RLV+ KTKVDPDNFFR+EQSIPT 
Sbjct  490   KEAEVYGVKYFKHNFERLVQTKTKVDPDNFFRNEQSIPTL  529



>ref|XP_002523156.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39187.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=510

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/502 (58%), Positives = 390/502 (78%), Gaps = 5/502 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T+L+CL+  S  + PIS V Y P+N  ++S+LQ YIRNLRFN S + KP FIVT TH SH
Sbjct  11    TILQCLSTHSITNPPISEVTYFPSNPKYTSILQSYIRNLRFNSSASPKPFFIVTPTHSSH  70

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQASI+C+K HGL+++ RSGGHD++G+SY+S++PF ILDMFN RSV++ +EDE+AW+E+G
Sbjct  71    IQASIICSKIHGLELRIRSGGHDFDGLSYISNLPFIILDMFNMRSVSIDMEDESAWIESG  130

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA +S VHG+PAGVCPTVGVGGH  G GYGN+MRKYGL+VDN++DA +ID 
Sbjct  131   ATLGEVYYWIAKRSGVHGYPAGVCPTVGVGGHLSGGGYGNLMRKYGLSVDNVVDAVVIDA  190

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             +GR+LDR++MGE+LFWAI GGG +SF V++S++I LV VP  VT+F V +T ++ A++IV
Sbjct  191   DGRVLDREAMGEDLFWAIRGGGGASFGVIVSWKIKLVLVPEIVTVFRVEKTLEEGASDIV  250

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q+++ K+  +LFIR+   V+N     G++T++A FNALFLG+++ L+  MDE FPEL
Sbjct  251   YQWQQVADKIHKDLFIRV---VLNRAVRHGQETVKAKFNALFLGNAERLVGLMDEKFPEL  307

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL   DC+EM WIESVLF++++P GT V+ LL R  Q    LKRKSDY+Q P+ +  +E 
Sbjct  308   GLLHKDCKEMSWIESVLFWSNYPIGTSVDVLLERHSQAEKFLKRKSDYVQEPISKQDLEG  367

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+KKM+EL+   LT NPYGGRM+EIP    PFPHR+GNI  IQYA +W +   EA +  L
Sbjct  368   IWKKMIELKQAALTLNPYGGRMSEIPECETPFPHRAGNIYKIQYAVSWKDASVEAEEQNL  427

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             +I R++Y+YMTPFVSK+PR ++LNYRD+DLG+N      +SY E   +G KYFK N++RL
Sbjct  428   DIIRKMYDYMTPFVSKSPRCSYLNYRDVDLGVNEVGN--ESYEEASRWGYKYFKGNFDRL  485

Query  1579  VKIKTKVDPDNFFRDEQSIPTF  1644
             V++KTKVDP NFFR EQSIP+ 
Sbjct  486   VEVKTKVDPCNFFRYEQSIPSL  507



>ref|XP_007147442.1| hypothetical protein PHAVU_006G125000g [Phaseolus vulgaris]
 gb|ESW19436.1| hypothetical protein PHAVU_006G125000g [Phaseolus vulgaris]
Length=560

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/502 (61%), Positives = 385/502 (77%), Gaps = 3/502 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T + CL + S PS+PIS  I++ N+ SFSSVLQ YIRNLRFN S T KP  IVT  H+SH
Sbjct  31    TFVHCLLNHSEPSYPISAAIFSQNSSSFSSVLQAYIRNLRFNTSTTPKPFLIVTPFHVSH  90

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +Q +++CAK H L MK RSGGHDYEGVSYV+  PFF+LDMFN RS++  +E E AWV+AG
Sbjct  91    VQTAVVCAKRHNLLMKIRSGGHDYEGVSYVASHPFFLLDMFNLRSIDFDMESEVAWVQAG  150

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KS  HGFPAGVCPTVGVGGH  G GYGN+MRKYG  VDN++DA+++D 
Sbjct  151   ATLGEVYYRIAEKSKTHGFPAGVCPTVGVGGHISGGGYGNLMRKYGTAVDNVVDAQIVDA  210

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GRLL+R+SMGE+LFWA+ GGG  SF V+++Y+I LVRVP KVT+F V +T +QNATNIV
Sbjct  211   QGRLLNRRSMGEDLFWAVRGGGGGSFGVIIAYKIKLVRVPEKVTVFKVGKTLEQNATNIV  270

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++  +D NLFIRL ++VVN  T  G KT+RATF ALFLGDSK+L+S M + FPEL
Sbjct  271   YNWQHVAPTIDNNLFIRLILEVVN-GTEVGTKTVRATFIALFLGDSKSLVSLMKDKFPEL  329

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL QSDC E  W++SV+F+ +    TPVE LL R PQ L +LKRKSDY++ P+ + G E 
Sbjct  330   GLKQSDCIETSWLQSVMFWDNIDIATPVEILLERQPQSLKYLKRKSDYVKKPISKEGWEG  389

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+KKM+EL+  ++  NPYGGRM EIPS   P PHR+GN+  IQY  NW E G E AQ+++
Sbjct  390   IWKKMIELEKAVMFLNPYGGRMGEIPSTETPLPHRAGNLWKIQYQGNWYEAGEEVAQYHI  449

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              + R+LY+YMTPFVS+NPR+AF+ Y+DLDLGINH+      YFEG  YG++YF +N+ RL
Sbjct  450   NLLRELYKYMTPFVSQNPRQAFMCYKDLDLGINHHGFL--GYFEGSAYGVQYFNDNFKRL  507

Query  1579  VKIKTKVDPDNFFRDEQSIPTF  1644
             V+IK+KVDP NFFR EQSIP  
Sbjct  508   VEIKSKVDPTNFFRTEQSIPVL  529



>ref|XP_002268606.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=532

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/500 (58%), Positives = 384/500 (77%), Gaps = 7/500 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL   S+PS P S ++Y  +N S+++VLQ YIRN RFN S T KPL IVT    SH
Sbjct  37    TFIQCLASHSDPSPPASSIVYNQSNSSYTTVLQSYIRNRRFNTSSTPKPLIIVTPLVESH  96

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA+ILC+K  G++MK RSGGHDY+G+SY+SD+PFFILD+FN R+++V+I DETAWV+AG
Sbjct  97    VQAAILCSKNVGMEMKIRSGGHDYDGLSYISDIPFFILDLFNLRAIDVNIGDETAWVQAG  156

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY I  KS +HGFPAGV  TVG GGH  G GYG M+RKYGL++D ++DAK++DV
Sbjct  157   ATLGELYYRIWEKSKLHGFPAGVGQTVGAGGHISGGGYGTMLRKYGLSIDQLVDAKIVDV  216

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGR+LDRK+MGE+LFWAI GGG SSF V+L+Y+I LV VP  VT+F V+RT DQNAT++V
Sbjct  217   NGRILDRKAMGEDLFWAIRGGGGSSFGVILAYKIKLVAVPETVTVFRVQRTLDQNATDLV  276

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++ K+D +LFIR+ +  V +  +   +TIRA+F +LFLGD+  LLS MD+ FP L
Sbjct  277   YKWQLVADKIDNDLFIRVLLQPVTVNKN---RTIRASFVSLFLGDAARLLSVMDKDFPAL  333

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL + DC EM WIESVL++ +F +GT  + LL+R    +  LKRKSDY+QTP+ ++G+E+
Sbjct  334   GLKKEDCMEMSWIESVLYWANFDNGTSPDALLNRTSDSVNFLKRKSDYVQTPISKDGLEW  393

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             ++KKM+E+    L FNPYGGRM+EIPS+   FPHR+GNI  IQY+ NW E G EA + Y+
Sbjct  394   MWKKMIEIGKTGLVFNPYGGRMSEIPSSETAFPHRAGNIYKIQYSVNWSEEGEEADKEYM  453

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
                R+LY YMTPFVSK+PR +FLNYRD+D+G+     +  SY EGK YG KYF  N++RL
Sbjct  454   TQIRRLYSYMTPFVSKSPRGSFLNYRDVDIGVT----KTWSYDEGKVYGAKYFMNNFDRL  509

Query  1579  VKIKTKVDPDNFFRDEQSIP  1638
             VK+KT VDP NFFR+EQSIP
Sbjct  510   VKVKTAVDPTNFFRNEQSIP  529



>gb|KDO77595.1| hypothetical protein CISIN_1g040700mg [Citrus sinensis]
Length=512

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/502 (59%), Positives = 385/502 (77%), Gaps = 16/502 (3%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL+ +S  S  IS  IYT +N SFSSVLQ Y+RNLRF    T KPL IV A H SH+Q
Sbjct  25    LQCLSMQSQSSIAISEAIYTSSNASFSSVLQSYVRNLRFATPTTLKPLVIVAAKHESHVQ  84

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++C+K+ GLQ++ RSGGHDY+G+SYVS+VPF ILDMFN RS+N+S+ DETAWV+AGAT
Sbjct  85    ATVICSKKFGLQIRIRSGGHDYDGLSYVSNVPFVILDMFNLRSINISLTDETAWVQAGAT  144

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
                        S +HGFPAGVCPT+GVGGHF G GYGNMMRK+GL+VDNI+DA+++DV G
Sbjct  145   ----------ASKIHGFPAGVCPTLGVGGHFSGGGYGNMMRKFGLSVDNIVDAQIVDVQG  194

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+LDRKSMGE+LFWAI GGGA+SF V+LS++I LV+VP  VT+F V +T +Q AT++V  
Sbjct  195   RILDRKSMGEDLFWAIRGGGAASFCVILSWKIKLVQVPETVTVFRVVKTLEQGATDLVAK  254

Query  865   YQRMS-HKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELG  1041
             +Q+++  KLD +LFIRL ++ VN  +  GEKT++ +F A+FLG ++ LLS M +SFPELG
Sbjct  255   WQQVAADKLDQDLFIRLFINAVN-GSKEGEKTVKVSFVAMFLGQTEKLLSLMKQSFPELG  313

Query  1042  LTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
             + + DC EMRW+ESVLF+   P GTP+E LL+R+P+  V LKRKSDY+Q P+P+ G+E I
Sbjct  314   IQKKDCFEMRWVESVLFWFDQPIGTPLEVLLNRIPKSQVSLKRKSDYVQEPIPKTGLESI  373

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             +K M+EL    + +NPYGG M+EIP+   PFPHR+GNI  IQY+ NW++ G E    YL 
Sbjct  374   WKLMIELGEVGMQWNPYGGIMSEIPATETPFPHRAGNIFKIQYSANWNQPGIEVTNRYLN  433

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
             +TR  YE MTP+VSKNPREAFLNYRD+D+G N N     +Y EGK YG+KYFK N++RLV
Sbjct  434   LTRTFYEAMTPYVSKNPREAFLNYRDIDIGSNTN----GTYEEGKIYGIKYFKNNFDRLV  489

Query  1582  KIKTKVDPDNFFRDEQSIPTFP  1647
             ++KT VDPDNFF  EQSIP  P
Sbjct  490   RVKTSVDPDNFFTYEQSIPISP  511



>ref|XP_007033585.1| FAD-binding Berberine family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY04511.1| FAD-binding Berberine family protein isoform 2, partial [Theobroma 
cacao]
Length=537

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/471 (64%), Positives = 374/471 (79%), Gaps = 3/471 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+CL + S  SHPIS  IYTP + S+SSVL+ YIRNLRFNE+ T KP  I+TA+H SH
Sbjct  32    SFLQCLLENSLRSHPISAAIYTPQSSSYSSVLESYIRNLRFNETSTPKPFLILTASHESH  91

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQA++LCAK+   QMK RSGGHDYEG+SYVS VPFFILDMFN RSV+V I +ETAWV+ G
Sbjct  92    IQAAVLCAKKQDFQMKIRSGGHDYEGLSYVSSVPFFILDMFNLRSVDVDIGNETAWVQTG  151

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA +SN+HGFPAGVCPTVGVGGH  GAGYGNMMRKYG++ DNIIDA+ ID 
Sbjct  152   ATLGEVYYRIAERSNIHGFPAGVCPTVGVGGHLSGAGYGNMMRKYGVSADNIIDAQFIDA  211

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             +GRL DRKSMGE+LFWAI GGG +SF V+L+Y+I LVRVP KVT F V +T ++NAT+ V
Sbjct  212   DGRLHDRKSMGEDLFWAIRGGGGASFGVILAYKIMLVRVPQKVTSFQVEKTLEENATDFV  271

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
               +Q ++ KL   LFIRL +DVVN  +  GEKT+RA+F +LFLGDS TLLS M+E FP+L
Sbjct  272   DQWQHVADKLPEELFIRLALDVVN-RSQSGEKTVRASFISLFLGDSDTLLSIMNERFPKL  330

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL++SDC E  WI SVLF+ + P  T ++ LL R PQ LV LKRKSDY++ P+P+ G+E 
Sbjct  331   GLSKSDCVETSWIRSVLFWANIPIETKIDVLLDRTPQTLVSLKRKSDYVKEPIPKAGLEG  390

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+K+M+ELQ P + FNPYGG+MAEIPS   PFPHR+GN+  IQY  NW+E G EAA H+L
Sbjct  391   IWKRMIELQVPKMFFNPYGGKMAEIPSTKIPFPHRAGNLWKIQYLANWNESGIEAANHHL  450

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLK  1551
              +TR+LY+YMTPFVSKNPREA+LNYRD+DLG ++N   +  Y EG+ YG++
Sbjct  451   GLTRKLYDYMTPFVSKNPREAYLNYRDVDLGTSYNG--KPVYSEGRVYGIR  499



>ref|XP_003631731.2| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=535

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/502 (58%), Positives = 386/502 (77%), Gaps = 3/502 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++CL+  S+P    S ++Y   N SF++VLQ YIRN RFN   T KPL IVT +  S +Q
Sbjct  35    VQCLSKHSSPFDQASSIVYAQTNSSFTNVLQSYIRNQRFNAFSTPKPLIIVTPSDESQVQ  94

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+I+C+++ G+Q++ RSGGHDY+G+SYVSDVPFFILDMFN RS+NV+I DETAWV+AGAT
Sbjct  95    AAIICSRDIGIQLRIRSGGHDYDGLSYVSDVPFFILDMFNLRSINVNITDETAWVQAGAT  154

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY I  KS VHGFPAGVCPTVGVGGH  G GYGNM+R+YGL++D+I+DA++++VNG
Sbjct  155   LGELYYKIWEKSRVHGFPAGVCPTVGVGGHLSGGGYGNMLRRYGLSIDHIVDAQIVNVNG  214

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              +LDRKSMGE+LFWAI GGG +SF V+LSY++ LVRVP  VT+F V +T  QNAT+IVY 
Sbjct  215   YILDRKSMGEDLFWAIRGGGGASFGVILSYKVKLVRVPEIVTVFRVEKTLAQNATDIVYQ  274

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGE-KTIRATFNALFLGDSKTLLSTMDESFPELG  1041
             +Q ++ K+D +LF RL +  + + +  G  KT+R TF +LFLGDS  L+S M++ FPELG
Sbjct  275   WQHITDKIDNDLFTRLLLQPITVKSDNGSAKTVRVTFISLFLGDSTRLISVMNKDFPELG  334

Query  1042  LTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
             L + DC EM WIESVL++ +F +GT V+ LL+R    +  LKRKSDY+Q P+ R+ +E +
Sbjct  335   LKKEDCMEMSWIESVLYWANFDNGTSVDVLLNRTSDSVNFLKRKSDYVQKPISRDDLEGL  394

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             +KK++EL  P + FN YGGRM+EIP++  PFPHR+GNI  IQY+ +W + G EA + ++ 
Sbjct  395   WKKIIELGKPGMVFNSYGGRMSEIPASETPFPHRAGNIFKIQYSVSWHDEGAEADKEHMN  454

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
             + R+LY YMTP VSK PR A+LNYRD+D+GI+HN   + SY EGK YG++YF  N++RLV
Sbjct  455   LIRELYSYMTPLVSKTPRGAYLNYRDVDIGISHNG--KDSYQEGKVYGVQYFMNNFDRLV  512

Query  1582  KIKTKVDPDNFFRDEQSIPTFP  1647
             K+KT VDP NFFR EQSIP  P
Sbjct  513   KVKTAVDPQNFFRYEQSIPPLP  534



>ref|XP_009768974.1| PREDICTED: reticuline oxidase-like protein [Nicotiana sylvestris]
Length=549

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/505 (59%), Positives = 387/505 (77%), Gaps = 4/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + ++CL   S+   PIS  +Y P +  +SSVL   IRNLRFNESYT KP  I+TATH SH
Sbjct  33    SFIQCLKLYSDTLFPISTNLYNPEDALYSSVLSASIRNLRFNESYTPKPRLIITATHESH  92

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA+ILC K HGL+M+ RSGGHDYEG SYVS VPFF+LD+ NFRS+ V+I++ETAWV++G
Sbjct  93    VQAAILCGKSHGLEMRIRSGGHDYEGSSYVSFVPFFVLDLLNFRSIIVNIKEETAWVQSG  152

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             AT+GE+YY IANKS VHGFPAG+CPT GVGGHF G G+GNMMRKYGL+VDNIIDAKL+D 
Sbjct  153   ATVGELYYAIANKSKVHGFPAGMCPTNGVGGHFSGGGFGNMMRKYGLSVDNIIDAKLVDA  212

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GR+L+R+SMGE+LFWAITGGGA+SF VVL+Y+I LV VP  VT+F V +T + N T  V
Sbjct  213   QGRILERESMGEDLFWAITGGGAASFGVVLAYKIKLVPVPQNVTVFQVEKTGEDNITESV  272

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             + +  ++   D ++F  + +DV N       +TIRATF   FLGDS+ L++ M+++FPEL
Sbjct  273   HRWLEIADGFDRDVFFNMILDVANHGVENKNRTIRATFMGFFLGDSERLITLMNDNFPEL  332

Query  1039  GLTQSDCREMRWIESVLFYTSFP--SGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             GL   DC ++ WIESV+++ + P  +GT  E LL+R P  L H K KSDYLQ  +P+ G+
Sbjct  333   GLENQDCHQVSWIESVVYWGNLPINNGTSTEVLLNRTPPELYHSKIKSDYLQRSIPKEGL  392

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
               IFKKMVEL+ P ++F PYGG+M+EI   AKPFPHR+GNIA I Y T+W EHG+EA  +
Sbjct  393   NLIFKKMVELEAPYMSFYPYGGKMSEISPDAKPFPHRAGNIANIMYGTDWTEHGFEAEYY  452

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             Y  +TR+LY++MTPFVSK PREA+LN++D DLGINH+   + SY +GK YG KYFKENY+
Sbjct  453   YSGLTRKLYDFMTPFVSKFPREAYLNFKDFDLGINHHG--QNSYLQGKGYGDKYFKENYD  510

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             +LV+IK++VD +N+F++EQSIP  P
Sbjct  511   KLVEIKSRVDLENYFKNEQSIPLRP  535



>ref|XP_009603937.1| PREDICTED: reticuline oxidase-like protein [Nicotiana tomentosiformis]
Length=549

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/505 (58%), Positives = 387/505 (77%), Gaps = 4/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + ++CL   S+   PIS  +Y P + S+SSVL   IRNLRFNESYT KP  I+TATH SH
Sbjct  33    SFIQCLKLYSDSLFPISTNLYNPEDASYSSVLSASIRNLRFNESYTPKPHLIITATHESH  92

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA+ILC K HG++M+ RSGGHD+EG SYVS VPFF+LD+ NFRS++++I+ ETAWV++G
Sbjct  93    VQAAILCGKSHGVEMRIRSGGHDHEGSSYVSLVPFFVLDLLNFRSIDMNIDKETAWVQSG  152

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             AT+GE+YY IANKS VHGFPAG+CPT+GVGGHF G G+GNMMRKYGL+VDNIIDAKL+D 
Sbjct  153   ATVGELYYAIANKSKVHGFPAGMCPTIGVGGHFSGGGFGNMMRKYGLSVDNIIDAKLVDA  212

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GR+L+R+SMGE+LFWAITGGGA+SF VVL+Y+I LV VP  VT+F V +T + N T  V
Sbjct  213   QGRILERESMGEDLFWAITGGGAASFGVVLAYKIKLVPVPQNVTVFQVEKTGEDNITESV  272

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             + +  ++   D ++F  + ++V N       KTIRATF   FLGDS+ L++ M+E+FPEL
Sbjct  273   HRWLEIADGFDRDVFFNMILNVANRGVENKNKTIRATFMGFFLGDSEKLITLMNETFPEL  332

Query  1039  GLTQSDCREMRWIESVLFYTSFP--SGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
              L   DC ++ WIESV+++ +F   +GT    LL+R P  L H K KSDYLQ  +P+ G+
Sbjct  333   ELQNQDCHQVSWIESVVYWGNFSINNGTSTAVLLNRTPPELYHSKMKSDYLQRSIPKEGL  392

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             + IFKKMVEL+ P + F PYGG+M+EI    KPFPHR+GNIA I Y T+W EHG+EA  +
Sbjct  393   KLIFKKMVELEAPYMFFYPYGGKMSEISPDEKPFPHRAGNIANIMYGTDWTEHGFEAEYY  452

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             Y  +TR+LY++MTPFVSK PR+A+LN++D DLGINH+   + SY +GK YG KYFKENY+
Sbjct  453   YSGLTRKLYDFMTPFVSKFPRQAYLNFKDFDLGINHHG--KNSYLQGKGYGDKYFKENYD  510

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLV+IK++VDP+N+F++EQSIP  P
Sbjct  511   RLVEIKSRVDPENYFKNEQSIPVRP  535



>ref|XP_006307225.1| hypothetical protein CARUB_v10008825mg [Capsella rubella]
 gb|EOA40123.1| hypothetical protein CARUB_v10008825mg [Capsella rubella]
Length=530

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/505 (60%), Positives = 377/505 (75%), Gaps = 6/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T  +CL   S+P HPISP ++   NGS+SSVL+  IRNLRFN S T KP  I+ ATH SH
Sbjct  30    TFTQCLTSNSDPKHPISPTVFFAGNGSYSSVLEATIRNLRFNTSNTPKPFLIIAATHESH  89

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAWVE  492
             +QA++ C K H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV+V +  +TAWV+
Sbjct  90    VQAAVTCGKRHNLQMKIRSGGHDYDGLSYVTYSGKPFFVLDMFNLRSVDVDVASKTAWVQ  149

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
              GA LGEVYY I  KS    +PAG+CPTVGVGGH  G GYGNMMRKYGLTVDN IDAK++
Sbjct  150   TGAILGEVYYYIWEKSKTLAYPAGICPTVGVGGHISGGGYGNMMRKYGLTVDNTIDAKMV  209

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             DVNG +LDRK MGE+LFWAI GGG  SF VVL+Y+INLV VP  VT+F + RT +QNAT 
Sbjct  210   DVNGNILDRKLMGEDLFWAINGGGGGSFGVVLAYKINLVEVPENVTVFRISRTLEQNATE  269

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             IV+ +Q+++ +L   LFIRL +DVVN  T+  +KT+RA+F A+FLGD  TLLS ++  FP
Sbjct  270   IVHRWQQVAPELPDELFIRLVIDVVN-GTNTSQKTVRASFIAMFLGDKTTLLSILNRRFP  328

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL +SDC E  WI+SVLF+T+   G+P   LL R+ Q + +LKRKSDY++ P+ R G+
Sbjct  329   ELGLVRSDCTETSWIQSVLFWTNIQIGSPETVLLQRI-QPVTYLKRKSDYVRKPISRTGL  387

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E I+KKM+EL+ P + FNPYGG M  I S   PFP+R+GN+  IQYA NW E        
Sbjct  388   ESIWKKMIELEIPTMAFNPYGGAMGRISSTVTPFPYRAGNLWKIQYAANWRED--RLTDR  445

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             Y+E+TR+LY++MTPFVSKNPR++F NYRD+DLGIN + G+R SY EGK YG KYF  N+ 
Sbjct  446   YMELTRELYQFMTPFVSKNPRQSFFNYRDVDLGINSHNGKRNSYVEGKRYGEKYFAGNFE  505

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLVKIKT+VD  NFFR+EQSIP  P
Sbjct  506   RLVKIKTRVDSGNFFRNEQSIPVLP  530



>ref|XP_009760106.1| PREDICTED: reticuline oxidase-like protein [Nicotiana sylvestris]
Length=532

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/500 (61%), Positives = 375/500 (75%), Gaps = 4/500 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+CL+  S+PS  I   +YTPNN S+ SVLQ YIRN RFN S T KP  I T    SH
Sbjct  33    SFLQCLSKHSDPSDHILSRVYTPNNSSYKSVLQHYIRNKRFNRSTTLKPDIIFTPLQESH  92

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQ +++C+K+    +K RSGGHDYEG+SYVS++ F +LDM N RSV+V I +ETAWV+AG
Sbjct  93    IQVAVICSKKTDKHLKIRSGGHDYEGISYVSNISFVLLDMSNLRSVDVDIHNETAWVQAG  152

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY I  KS +H FPAG+CPTVGVGGH  G GYGN++RKYGL+VDN+IDA ++DV
Sbjct  153   ATLGELYYRIWEKSKIHAFPAGICPTVGVGGHITGGGYGNLLRKYGLSVDNLIDAHIVDV  212

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             +G++L+R+SMGE+LFWAI+GGG +SF V+ +Y+I LV+VP  VT+F V RT  QNA +IV
Sbjct  213   HGQILNRESMGEDLFWAISGGGGASFGVITAYKIKLVKVPDIVTVFRVVRTLKQNAIDIV  272

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++  +D NLFIRLTV   N     G KTI ATF ALFLGDS+ LLS MD  FP+L
Sbjct  273   YRWQFIADNIDNNLFIRLTVKPTN-DKQKGTKTIAATFVALFLGDSRKLLSVMDRDFPQL  331

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL   DC+EM WIES LF++SFP+GTP + LL+R+P     LKRKSDYLQ P+P++ ++ 
Sbjct  332   GLHIGDCKEMSWIESELFWSSFPNGTPPDALLNRMPGAKF-LKRKSDYLQKPIPKDKLKS  390

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             IF KM+EL    L FNPYGGRM EIP    PFPHR+GNI  IQYA NW+E G EA   +L
Sbjct  391   IFDKMIELGDTELVFNPYGGRMNEIPEWETPFPHRAGNIFKIQYAANWEEEGKEAENFHL  450

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
               TR LY YMTPFVSK+PR AFLNYRDLD+G+NHN   R  Y EG+ YGLKYFK N+N+L
Sbjct  451   NQTRVLYNYMTPFVSKSPRCAFLNYRDLDIGVNHNGNHR--YIEGRVYGLKYFKGNFNKL  508

Query  1579  VKIKTKVDPDNFFRDEQSIP  1638
             VK+KT VD DNFF +EQS P
Sbjct  509   VKVKTLVDHDNFFWNEQSTP  528



>ref|XP_007211821.1| hypothetical protein PRUPE_ppa004317mg [Prunus persica]
 gb|EMJ13020.1| hypothetical protein PRUPE_ppa004317mg [Prunus persica]
Length=517

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/506 (59%), Positives = 384/506 (76%), Gaps = 6/506 (1%)
 Frame = +1

Query  136   TTVLECLNDRSN-PSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             T  L+CL++ S   S PIS V Y PNN S++S+LQ YIRNLRF    T KPLFIVT TH+
Sbjct  10    TFFLQCLSNHSQYSSPPISAVTYFPNNSSYTSILQSYIRNLRFITPTTPKPLFIVTPTHV  69

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVE  492
             SHIQASI C+K H LQ++ RSGGHDY+G+SYVS VPF I+DMF+ RS++V +EDE+AWVE
Sbjct  70    SHIQASIFCSKIHALQVRIRSGGHDYDGLSYVSQVPFIIVDMFSLRSISVKVEDESAWVE  129

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
             +GATLGEVYY +A +S +HGFPAGVCPTVGVGGH  G GYGNMMRKYGL+VDNI+DA+++
Sbjct  130   SGATLGEVYYRVAEQSKIHGFPAGVCPTVGVGGHLSGGGYGNMMRKYGLSVDNILDAQIV  189

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             DVNGRLLDR+SMGE+LFWAI GGG +SF V++S++I LV VP  VT+F V RT +Q AT+
Sbjct  190   DVNGRLLDRESMGEDLFWAIRGGGGASFGVIVSWKIKLVPVPEIVTVFRVERTLEQGATD  249

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             IV+ +Q ++  +  +LFIR    VV  +   G +T++A F ALFLG++K L + MDES P
Sbjct  250   IVHQWQYVADTIHEDLFIRA---VVMQSNKKGHQTVKAKFVALFLGNAKKLHALMDESLP  306

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             +LGL   D  EM WIESVL+++++P GT  + LL R P     LK+KSDY+Q PM ++G+
Sbjct  307   QLGLKHEDYIEMSWIESVLYWSNYPIGTSTDVLLERQPSSEKFLKKKSDYIQEPMSKSGL  366

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E ++KKM+EL+ P+LTFNPYGG+M EI     PFPHR+GN+  IQY+ NW E G EAA  
Sbjct  367   EELWKKMMELRKPVLTFNPYGGKMREISELETPFPHRAGNVYKIQYSVNWKEEGVEAADK  426

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
              L++ R+LYE+MTP+VSK+PR ++LNYRD+DLG N N     SY E   +G KYFK N++
Sbjct  427   NLDLIRRLYEFMTPYVSKSPRCSYLNYRDVDLGTNGNG--NASYSEASVWGTKYFKGNFD  484

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFPG  1650
             RLV++KT VDP NFF  EQSIP+  G
Sbjct  485   RLVQVKTAVDPGNFFSYEQSIPSLTG  510



>ref|XP_002300580.2| hypothetical protein POPTR_0001s47400g [Populus trichocarpa]
 gb|EEE85385.2| hypothetical protein POPTR_0001s47400g [Populus trichocarpa]
Length=534

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/502 (59%), Positives = 386/502 (77%), Gaps = 5/502 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T L+CL+  S  S PIS V Y PNN ++ SVL  YIRNL F    T KPLFIVT TH+SH
Sbjct  27    TFLQCLSTHSLTSTPISEVTYFPNNPNYLSVLNSYIRNLVFTSPTTPKPLFIVTPTHVSH  86

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             I+ASI+C+K HGL+++ RSGGHDY+G+SYVS VPF ++D+FN RSV+V IEDE+AWVE+G
Sbjct  87    IRASIICSKIHGLEVRIRSGGHDYDGLSYVSTVPFIMVDLFNMRSVSVDIEDESAWVESG  146

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KS ++G+PAGVCPTVGVGGH  G GYGN+MRK+GL+VDNI+DA L+D 
Sbjct  147   ATLGEVYYRIAEKSKIYGYPAGVCPTVGVGGHLSGGGYGNLMRKHGLSVDNIVDAVLVDA  206

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NG +LDR++MGE+LFWAI GGG +SF +++S++I LVRVP  VT+F V RT ++ A++IV
Sbjct  207   NGNVLDREAMGEDLFWAIRGGGGASFGIIVSWKIKLVRVPEVVTVFRVERTLEEGASDIV  266

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++ K+D +LFIR+   V+N  T  G+ TI+A FNALFLG+++ L+S MDE FP L
Sbjct  267   YQWQHVADKIDEDLFIRV---VLNPVTRKGQVTIKAKFNALFLGNAQRLVSLMDEQFPGL  323

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL  +DC+EM WIESVLF++++  GT  + LL R      +LKRKSDY+Q P+ +  +E 
Sbjct  324   GLLSTDCKEMSWIESVLFWSNYQIGTSTDVLLERHSTKEKYLKRKSDYVQEPISKTDLEG  383

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+KKM++L+ P+LTFNPYGG+M+EI     PFPHR+GNI  IQYA +W E G EA  H L
Sbjct  384   IWKKMIQLRKPVLTFNPYGGKMSEISELDTPFPHRAGNIYKIQYAASWKEEGAEAVDHNL  443

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             ++ R+LY+YMTPFVSK+PR ++LNYRD+DLGIN       SY +   +G KYFK N++RL
Sbjct  444   DLIRKLYDYMTPFVSKSPRCSYLNYRDIDLGINEIGN--ASYEQASGWGTKYFKGNFDRL  501

Query  1579  VKIKTKVDPDNFFRDEQSIPTF  1644
             V++KT VDP NFFR EQSIP+ 
Sbjct  502   VQVKTTVDPGNFFRYEQSIPSL  523



>gb|EYU19101.1| hypothetical protein MIMGU_mgv1a004329mg [Erythranthe guttata]
Length=532

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/506 (58%), Positives = 382/506 (75%), Gaps = 7/506 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++C      P   IS ++Y+PNN SF+ VL+ YIRN RFN S T KP  IVT T  SH+ 
Sbjct  29    VQCFAGAKIPDAQISSIVYSPNNASFAKVLESYIRNRRFNVSTTPKPSIIVTPTAASHVS  88

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A++LCAK+ G+Q+K RSGGHDYEG+SYVS   F +LDMFNFRS++V++ DETAWV+ GA 
Sbjct  89    AAVLCAKKLGVQLKIRSGGHDYEGISYVSAATFVVLDMFNFRSIDVNMTDETAWVQTGAM  148

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY I  KS VHG+PAGVCPTVGVGGH  GAGYGN++RKYGLTVD+++DA+++D NG
Sbjct  149   LGEVYYRIWQKSKVHGYPAGVCPTVGVGGHISGAGYGNLLRKYGLTVDHVVDAQIVDANG  208

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+L+R++MGE+LFWAI GGG +SFAV+LSY+I LV VPP VT+F + + YD+NAT+ V+ 
Sbjct  209   RVLNRQTMGEDLFWAIRGGGGASFAVILSYQIKLVPVPPTVTVFRIEKAYDENATDAVFQ  268

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             YQ++  K+D +LFIR+ +  +   T   ++++RATF  LFLGDS  LL   D  FP LGL
Sbjct  269   YQQIVDKMDNDLFIRVLLQPI---TKNKKRSVRATFIGLFLGDSSRLLPITDSQFPILGL  325

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              +SDC+EM WI SVLF+ +F + T  + LLSR P  +  LKRKSDY++TP+ ++G+E +F
Sbjct  326   KKSDCQEMPWINSVLFWGNFDNKTSPKALLSRTPDSVNFLKRKSDYVKTPISKSGLESLF  385

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
              KMVE+    L FN YGGRM+EIP++  PFPHR+GN+  IQY+ NW E G  A ++Y++ 
Sbjct  386   AKMVEIGKVGLVFNSYGGRMSEIPASETPFPHRAGNLYKIQYSVNWSEEGEAADKNYMDQ  445

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
              RQL+ +M PFVS NPR+A+LNYRDLD+G   N   + SY EG+ YGLKYFK N++RLVK
Sbjct  446   IRQLFSFMAPFVSSNPRQAYLNYRDLDIGTTDNG--KNSYSEGQVYGLKYFKGNFDRLVK  503

Query  1585  IKTKVDPDNFFRDEQSIPT--FPGRK  1656
             IKT VDPDN FR+EQSIPT  F GR+
Sbjct  504   IKTAVDPDNVFRNEQSIPTLNFQGRR  529



>ref|XP_011039847.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=534

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/502 (58%), Positives = 384/502 (76%), Gaps = 5/502 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T L+CL+  S  S PIS V Y PNN ++ SVL  YIRNL F    T KPLFIV  TH+SH
Sbjct  27    TFLQCLSTHSLTSTPISEVTYFPNNPNYLSVLNSYIRNLVFTSPTTPKPLFIVAPTHVSH  86

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             I+ASI+C+K HGL+++ RSGGHDY+G+SYVS  PF ++D+FN RSV+V IEDE+AWVE+G
Sbjct  87    IRASIICSKIHGLEVRIRSGGHDYDGLSYVSTAPFIMVDLFNMRSVSVDIEDESAWVESG  146

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KS ++G+PAGVCPTVGVGGH  G GYGN+MRK+GL+VDNI+DA L+D 
Sbjct  147   ATLGEVYYRIAEKSKIYGYPAGVCPTVGVGGHLSGGGYGNLMRKHGLSVDNIVDAVLVDA  206

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NG +LDR++MGE+LFWAI GGG +SF +++S++I LVRVP  VT+F V RT ++ A++IV
Sbjct  207   NGNVLDREAMGEDLFWAIRGGGGASFGIIVSWKIKLVRVPEVVTVFRVERTLEEGASDIV  266

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++ K+D +LFIR+   V+N  T  G+ TI+A FNALFLG+++ L+S MDE FP L
Sbjct  267   YQWQHVADKIDEDLFIRV---VLNPVTRKGQVTIKAKFNALFLGNAQRLVSLMDEQFPGL  323

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL  +DC+EM WIESVLF++++  GT  + LL R      +LKRKSDY+Q P+ +  ++ 
Sbjct  324   GLLSTDCKEMSWIESVLFWSNYQIGTSTDVLLERHSTKEKYLKRKSDYVQEPISKTDLQG  383

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+KKM++LQ P+LTFNPYGG+M+EI     PFPHR+GNI  IQYA +W E G EA  H L
Sbjct  384   IWKKMIQLQKPVLTFNPYGGKMSEISELDTPFPHRAGNIYKIQYAASWKEEGAEAVGHNL  443

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             ++ R+LY+YMTPFVSK+PR ++LNYRD+DLGIN       SY +   +G KYFK N++RL
Sbjct  444   DLIRKLYDYMTPFVSKSPRCSYLNYRDIDLGINEIGN--ASYEQASGWGTKYFKGNFDRL  501

Query  1579  VKIKTKVDPDNFFRDEQSIPTF  1644
             V++KT VDP NFFR EQSIP+ 
Sbjct  502   VRVKTTVDPGNFFRYEQSIPSL  523



>emb|CAN80105.1| hypothetical protein VITISV_009716 [Vitis vinifera]
Length=461

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/512 (58%), Positives = 358/512 (70%), Gaps = 73/512 (14%)
 Frame = +1

Query  112   WAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLF  291
             WA         L+CL+  S  SHPIS  +YTP+N S+SSVL+ YIRNLRFN S T KP  
Sbjct  22    WAASDSVHGAFLQCLSTHSQSSHPISAXLYTPDNSSYSSVLESYIRNLRFNTSTTPKPXL  81

Query  292   IVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIE  471
             I+TATH SHIQA+I+C+K+HGLQMK RSGGHD EG SYVS+VPFFILDMFN RS++V IE
Sbjct  82    IITATHESHIQAAIICSKKHGLQMKIRSGGHDXEGXSYVSBVPFFILDMFNLRSISVDIE  141

Query  472   DETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDN  651
             DE+AWV+AGATLGE+YY IA KS  HGFPA                              
Sbjct  142   DESAWVQAGATLGEIYYRIAXKSKTHGFPA------------------------------  171

Query  652   IIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRT  831
                 +L+DVNGRLL+RKSMGE+LFWAI GGG +S+ V++SY+I LV+VP  VT+F V RT
Sbjct  172   ----ELVDVNGRLLNRKSMGEDLFWAIIGGGGASYGVIVSYKIKLVQVPATVTVFRVART  227

Query  832   YDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLS  1011
              +QNATNIVY +Q+++ K+D +LFIRLT+DVVN ++  GEKT+RATF +LFLG S+ LLS
Sbjct  228   LEQNATNIVYQWQQVADKVDGDLFIRLTMDVVN-SSRSGEKTVRATFLSLFLGSSERLLS  286

Query  1012  TMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQT  1191
              M+   PELGL  SDC EM W+ESVLF+T F +GTPVE LL R PQVL HLKRKSDYL+ 
Sbjct  287   IMNTRLPELGLQSSDCTEMSWVESVLFWTEFATGTPVEALLDRNPQVLTHLKRKSDYLKE  346

Query  1192  PMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEH  1371
             P+P+ G+E I+KKM+ELQTP L FNPYGG+MAEI  +A PFPHR+GN+  I         
Sbjct  347   PIPKAGLEGIWKKMIELQTPYLVFNPYGGKMAEISPSATPFPHRAGNLCKII--------  398

Query  1372  GYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLK  1551
                                         EAFLNYRDLDLG NHN   + SY EG+ YG+K
Sbjct  399   ----------------------------EAFLNYRDLDLGXNHNG--KNSYLEGRXYGIK  428

Query  1552  YFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             YFK+N+NRLV+IKTKVDP NFFR+EQSIPT P
Sbjct  429   YFKKNFNRLVRIKTKVDPGNFFRNEQSIPTLP  460



>ref|XP_010648252.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=535

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/502 (57%), Positives = 383/502 (76%), Gaps = 3/502 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++CL+  S+P    S ++Y   N SF++ LQ YIRN RFN   T KPL IVT +  S +Q
Sbjct  35    VQCLSKYSSPFDQASSIVYAQTNSSFTNALQSYIRNQRFNAFSTPKPLIIVTPSDESQVQ  94

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+I+C++  G+Q++ RSGGHDY+G+SYVSDVPFFILDMFN RSVNV+I DETAWV+AGAT
Sbjct  95    AAIICSRRIGIQLRIRSGGHDYDGLSYVSDVPFFILDMFNLRSVNVNITDETAWVQAGAT  154

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY I  KS VHGFPAGVCPTVGVGGH  G GYGNM+R+YGL++D+I+DA++++VNG
Sbjct  155   LGELYYKIWEKSRVHGFPAGVCPTVGVGGHLSGGGYGNMLRRYGLSIDHIVDAQIVNVNG  214

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              +LDRKSMGE+LFWAI GGG +SF V+LSY++ LVRVP  VT+F V +T  QNAT+IVY 
Sbjct  215   YILDRKSMGEDLFWAIRGGGGASFGVILSYKVKLVRVPEIVTVFRVEKTLAQNATDIVYQ  274

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGE-KTIRATFNALFLGDSKTLLSTMDESFPELG  1041
             +Q ++ K+D +LF RL +  + + +  G  KT+R TF +LFLGDS  L+S M++ FPELG
Sbjct  275   WQHITDKIDNDLFTRLLLQPITVKSDNGSAKTVRVTFISLFLGDSTRLISVMNKDFPELG  334

Query  1042  LTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
             L + DC EM WIESVL++ +F +GT V+ LL+R    +  LKRKSDY+Q P+ R+ +E +
Sbjct  335   LKKEDCMEMSWIESVLYWANFDNGTSVDVLLNRTSDSVNFLKRKSDYVQKPISRDDLEGL  394

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             +KK++EL  P + FN YGGRM+EIP++   FPHR+GNI  IQY+ +W + G EA + ++ 
Sbjct  395   WKKIIELGKPGMVFNSYGGRMSEIPASETAFPHRAGNIFKIQYSVSWHDEGAEADKEHMN  454

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
             + R+LY YMTP VSK+PR A+LNYRD+D+GI+HN   + S  EG+ YG++YF  N++RLV
Sbjct  455   LIRELYSYMTPLVSKSPRGAYLNYRDVDIGISHNG--KDSCQEGRVYGVQYFMNNFDRLV  512

Query  1582  KIKTKVDPDNFFRDEQSIPTFP  1647
             K+KT VDP NFFR EQSIP  P
Sbjct  513   KVKTAVDPQNFFRYEQSIPPLP  534



>ref|XP_010051869.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
 gb|KCW75703.1| hypothetical protein EUGRSUZ_D00077 [Eucalyptus grandis]
Length=537

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/514 (57%), Positives = 380/514 (74%), Gaps = 3/514 (1%)
 Frame = +1

Query  109   AWAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             +WA       T L+CL  RS PS  IS ++Y+  N SF+SVL  YIRNLRFN S T KPL
Sbjct  25    SWAASNSVYDTFLQCLTHRSQPSDQISDIVYSQANSSFASVLVSYIRNLRFNSSSTPKPL  84

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
              IVT T  SH+QA++LC+K+ G+ +K RSGGHDYEG+SYVSD  FFILDMFN RS++V I
Sbjct  85    VIVTPTRESHVQAAVLCSKDLGVHLKIRSGGHDYEGISYVSDDAFFILDMFNLRSIDVDI  144

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
             + ETAWV+AGATLGE+YY I  KS VHGFPAGVC TVGVGGH  G GYGNM+RKYGL+VD
Sbjct  145   QKETAWVQAGATLGELYYRIWEKSKVHGFPAGVCRTVGVGGHLSGGGYGNMLRKYGLSVD  204

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             N++DA+++DV GR+LDRK+MGE+LFWAI GGG +SF V+L+Y++ LV VP KVT+F V +
Sbjct  205   NVLDARMVDVQGRILDRKAMGEDLFWAILGGGGASFGVILAYQVKLVPVPEKVTVFRVEK  264

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T DQNAT++VY +Q ++   D  LF+RL +  V   T  G+KT+RA+   LFLG+S  LL
Sbjct  265   TLDQNATDLVYKWQFVAPSTDHGLFMRLLLQPVTSKTQKGQKTLRASVVTLFLGNSDQLL  324

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGT-PVEELLSRVPQVLVHLKRKSDYL  1185
             +  D+  PE+GL + +C E+ WIESVL++  F  GT P  E + R       LKRKSDY+
Sbjct  325   AITDKELPEMGLKKENCTELSWIESVLWWDGFDEGTIPALETMLRRDYPTNFLKRKSDYV  384

Query  1186  QTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWD  1365
             QTP+ +  ++ ++KKM+EL    L FNPYGGRM+EIP++A PFPHR+GN+  IQY+ NW 
Sbjct  385   QTPISKANLDQLWKKMIELGKVGLVFNPYGGRMSEIPASATPFPHRAGNLFKIQYSINWS  444

Query  1366  EHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYG  1545
             E   E  ++YL   R LY Y TPFVSKNPR A+LNYRDLD+G + N   + SY EG+ YG
Sbjct  445   EDDPELEKNYLAQIRSLYNYTTPFVSKNPRSAYLNYRDLDIGTSTNG--KNSYEEGQVYG  502

Query  1546  LKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             +K+F +N++RLVK+KT VDP+NFFR+EQSIP  P
Sbjct  503   VKFFNDNFDRLVKVKTAVDPNNFFRNEQSIPPLP  536



>gb|KCW44231.1| hypothetical protein EUGRSUZ_L02344 [Eucalyptus grandis]
Length=483

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/455 (63%), Positives = 364/455 (80%), Gaps = 3/455 (1%)
 Frame = +1

Query  124   CYCATTVLECLNDRSNPSHPI-SPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVT  300
              +   T+ +CL   S  SHPI S ++YTP N S+S+VLQ YIRNLRFN S T KP  I+T
Sbjct  30    AFANETLSQCLISHSQASHPITSAILYTPANSSYSTVLQSYIRNLRFNSSDTPKPTLILT  89

Query  301   ATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVS-DVPFFILDMFNFRSVNVSIEDE  477
             A H SH+QA+I+CA++  +QMK RSGGHD+EG+SYVS   PFFILDM NFRSV+V IE E
Sbjct  90    ALHESHVQAAIVCARKLSVQMKIRSGGHDFEGISYVSISSPFFILDMINFRSVDVDIETE  149

Query  478   TAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNII  657
             TAWV+AGA LGEVYYGIA KS VHGFPAGVCP VG+GGH  G GYGNMMRKYGL+VDNI+
Sbjct  150   TAWVQAGAILGEVYYGIAAKSKVHGFPAGVCPMVGIGGHLSGGGYGNMMRKYGLSVDNIV  209

Query  658   DAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYD  837
             DA +I+V G++LDR+SMGE+LFWAI GGG +SF V+L+Y+INLV VP  VT+F ++RT +
Sbjct  210   DACMINVKGKILDRESMGEDLFWAIRGGGGASFGVILAYKINLVHVPEMVTVFRIQRTRE  269

Query  838   QNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTM  1017
             QNAT +VY +++++HKL  +LFIRL +DVV    + GEKT+RA F ALFLGD++ LLS +
Sbjct  270   QNATAVVYQWEQVAHKLHEDLFIRLVMDVVA-GKNTGEKTVRARFIALFLGDAQRLLSMI  328

Query  1018  DESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPM  1197
              + FPELGL  SDC EM W+ES L++ +FP GTPV+ LLSR P+ L+HLKRKSDY++  +
Sbjct  329   SDGFPELGLRSSDCIEMSWVESTLYWMNFPIGTPVDALLSRAPKGLMHLKRKSDYVRHII  388

Query  1198  PRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGY  1377
              ++ +E ++K+M++L+ P+LTFNPYGG+M +IP+   PFPHR+GN+  +QYATNW E G+
Sbjct  389   SKDELELLWKRMIDLERPILTFNPYGGKMGKIPTTETPFPHRAGNLWKVQYATNWHEEGH  448

Query  1378  EAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDL  1482
             EAAQH +E+TR+LY YMTPFVSKNPR AFLNYRDL
Sbjct  449   EAAQHNIELTRKLYNYMTPFVSKNPRAAFLNYRDL  483



>ref|XP_010051871.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
 gb|KCW75704.1| hypothetical protein EUGRSUZ_D00078 [Eucalyptus grandis]
Length=538

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/515 (58%), Positives = 383/515 (74%), Gaps = 5/515 (1%)
 Frame = +1

Query  109   AWAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             +WA       T L+CL  R+ PS  IS ++Y+  N SF++VL  Y+RN RFN S T KPL
Sbjct  26    SWAASDSVYDTFLQCLTHRTQPSDHISDIVYSRANSSFANVLVSYVRNRRFNSSSTPKPL  85

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
              IVT    SH+QA++LC+K+ G+ +K RSGGHDYEG+SYVSD  FFILDMFN RS+NV+I
Sbjct  86    VIVTPKQESHVQAAVLCSKDLGIHLKIRSGGHDYEGISYVSDDAFFILDMFNLRSINVNI  145

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
             + ETAWV+AGATLGE+YY I  KS +HGFPAGVCPTVGVGGHF GAGYGNM+RKYGL+VD
Sbjct  146   QKETAWVQAGATLGELYYRIWEKSKLHGFPAGVCPTVGVGGHFSGAGYGNMLRKYGLSVD  205

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             N++DA+++DV GR+LDRK+MGE+LFWAI GGG +SF V+L Y+I LV VP KVT+F V +
Sbjct  206   NVLDARMVDVRGRILDRKAMGEDLFWAIIGGGGASFGVILGYQIKLVPVPEKVTVFRVEK  265

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T DQNAT++VY +Q ++ + D  LF+RL +  V   T  G+KT+RAT   LFLG+S  LL
Sbjct  266   TLDQNATDLVYKWQFVAPRTDHGLFMRLLLQPVTSQTQKGQKTLRATVVTLFLGNSDQLL  325

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGT--PVEELLSRVPQVLVHLKRKSDY  1182
             +  D+  PE+GL + +C E+ WIESVL++  F  GT   +E LLSR       LKRKSDY
Sbjct  326   AITDKELPEMGLKKENCTELSWIESVLWWDGFDEGTIPALETLLSR-DDSTNFLKRKSDY  384

Query  1183  LQTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNW  1362
             +QTP+ +  +++++KKM+EL    L FNPYGGRM+EIPS+A PFPHR+GN+  IQY+ NW
Sbjct  385   VQTPISKANLDWLWKKMIELGKVGLVFNPYGGRMSEIPSSATPFPHRAGNLFKIQYSVNW  444

Query  1363  DEHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTY  1542
              E   E  ++YL   R LY Y TPFVSKNPR  +LNYRDLD+G + +   + SY EG+ Y
Sbjct  445   SEDDPELEKNYLAQIRSLYNYTTPFVSKNPRSTYLNYRDLDIGTSTDG--KNSYEEGQVY  502

Query  1543  GLKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             G+KYF +N+ RLVK+KT VDP+NFFR+EQSIP  P
Sbjct  503   GVKYFNDNFERLVKVKTAVDPNNFFRNEQSIPPLP  537



>ref|XP_010655770.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=535

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/505 (57%), Positives = 387/505 (77%), Gaps = 5/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+CL+  S PS PIS V YTP N S++ VLQ YI+NLRF  S T KP FIV ++H+SH
Sbjct  30    SFLQCLSHLSAPSPPISGVFYTPTNSSYAYVLQSYIQNLRFMSSTTPKPSFIVASSHVSH  89

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA+I+C K HGLQ++ RSGGHDY+G+SYVSDVPF ILDMFN R V+V IE+E AWV++G
Sbjct  90    VQATIICCKIHGLQLRIRSGGHDYDGLSYVSDVPFVILDMFNLREVSVDIENEWAWVQSG  149

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             AT+GE+YY IA KSN++GFPAGVCPTVGVGGHF G GYGNMMRKYGL+VDN++DA+++D 
Sbjct  150   ATMGELYYRIAVKSNLYGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLSVDNVLDAQIVDA  209

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGR+LDR+SMGE+LFWAI GGG +SF V+++++I LV VP  VT+F V RT +Q A +++
Sbjct  210   NGRILDRESMGEDLFWAIRGGGGASFGVIVAWKIRLVPVPETVTVFRVERTLEQGAIDLL  269

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             + +Q ++ K++ +LFIR+ +  V    H   KTI+A F +LFLG+S+ LL+ M ESFPEL
Sbjct  270   HQWQYVADKINEDLFIRVVILPVIRKDH---KTIKAKFVSLFLGNSEKLLALMSESFPEL  326

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             G+  ++C EM W+ES+++++++  GTP+  LL R PQ   +LK+KSDY+Q  + +  ++ 
Sbjct  327   GINGNNCIEMSWVESIVYWSNYVKGTPISVLLDRTPQSRKYLKKKSDYVQASISKADLKG  386

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I   M+ELQ P LTFNPYGGRM+EI  +  PFPHR+GNI  IQY+  W E   EAA H L
Sbjct  387   ILNTMMELQKPALTFNPYGGRMSEISESETPFPHRAGNIYKIQYSVTWKEESMEAADHNL  446

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              + R++Y+YMTP+VS +PR ++LNYRD+DLG+N N     SY E   +G KYFK+N++RL
Sbjct  447   NMIRRIYDYMTPYVSNSPRGSYLNYRDIDLGVNQNGN--VSYEEASIWGTKYFKDNFDRL  504

Query  1579  VKIKTKVDPDNFFRDEQSIPTFPGR  1653
             V++K++VDPDNFFR EQSIP+   R
Sbjct  505   VQVKSRVDPDNFFRYEQSIPSVTNR  529



>ref|XP_011005333.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=532

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/498 (59%), Positives = 370/498 (74%), Gaps = 3/498 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL + S PS+PIS  IYT  N SF SVLQ YI N RF    T KP+ IVTA H SH+Q
Sbjct  34    LQCLPNNSLPSYPISEAIYTTANSSFESVLQTYINNRRFLTPTTPKPIAIVTALHESHVQ  93

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++CAK  GLQ++ RSGGHDYEG+SYVS+VPF ILDMFN RS++V I +ETAWV+AGAT
Sbjct  94    ATVICAKASGLQVRIRSGGHDYEGLSYVSEVPFVILDMFNLRSIDVDIANETAWVQAGAT  153

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY IANKSNVH FPAGVCPTVG GGH  G GYG +MRKYGL+VDNIIDAK++DVNG
Sbjct  154   LGEIYYNIANKSNVHAFPAGVCPTVGAGGHISGGGYGTLMRKYGLSVDNIIDAKVVDVNG  213

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              +LDR++MGE+LFWAI GGG +SFAVVLS+++NLVRVP KVT+F V RT +++AT+I Y 
Sbjct  214   NILDRETMGEDLFWAIRGGGGASFAVVLSWKMNLVRVPEKVTVFKVDRTLEEDATDIFYQ  273

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q++S +LD +LFIR    V N  +  G KTI  +F ALFLG S+ LLS M++SFP+LGL
Sbjct  274   WQQVSTELDKDLFIRAMPQVAN-GSQEGSKTISISFYALFLGQSEALLSMMNKSFPKLGL  332

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              Q DC EMRWIES LF+   P GT ++ LL+R        K KSDY+   +P+  +E I+
Sbjct  333   QQKDCIEMRWIESTLFWFDLPIGTSIDVLLNRPQGAQSFYKNKSDYVNQIVPKEALERIW  392

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             K M++     + +NPYGGRM+EIP  A PFPHRSG +  +QY+ NWDE G EA   Y+ +
Sbjct  393   KMMIKADPMWMQWNPYGGRMSEIPDTATPFPHRSGYLFKLQYSINWDEEGTEATDRYISL  452

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
              R++++ M P+V+  PREAF NYRDLD+G   N   +  +   K YGLKYFK N+ RLVK
Sbjct  453   IREMHDAMAPYVTSYPREAFQNYRDLDIG--SNPSNQTDFERAKVYGLKYFKGNFLRLVK  510

Query  1585  IKTKVDPDNFFRDEQSIP  1638
             IK KVDPDNFF+ EQSIP
Sbjct  511   IKGKVDPDNFFKHEQSIP  528



>emb|CDP12590.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/519 (56%), Positives = 384/519 (74%), Gaps = 10/519 (2%)
 Frame = +1

Query  118   PLCYCATTVL-----ECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKK  282
             P C  A+  +      CL     PS  I  ++Y+P N SFSSVLQ Y+RNLRFN S TKK
Sbjct  19    PFCIAASHSIYDNFAACLTKNGIPSGQIPKILYSPTNTSFSSVLQAYVRNLRFNTSSTKK  78

Query  283   PLFIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNV  462
             P  IVT   + H+QA++LC K  GL++K RSGGHDYEG+SYVSDVPF ILDMFN RS++V
Sbjct  79    PSIIVTPLEIPHVQAAVLCTKGTGLELKIRSGGHDYEGISYVSDVPFIILDMFNLRSIHV  138

Query  463   SIEDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLT  642
              I  ETAWV+AGAT+GE+YY I  KSN +GFPAG+CPT+G+GGH  G GYG M+R++GL+
Sbjct  139   DIPSETAWVQAGATVGELYYRIWEKSNAYGFPAGLCPTLGLGGHISGGGYGAMLRRFGLS  198

Query  643   VDNIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSV  822
             VDN++DA+++DV G++LDRK+MGE+LFWAI GGG +SF VVL+Y++ LV+VP  VT+F+V
Sbjct  199   VDNVLDAQIVDVKGQVLDRKAMGEDLFWAIRGGGGASFGVVLAYKLKLVQVPEIVTVFNV  258

Query  823   RRTYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNIT--THPGEKTIRATFNALFLGDS  996
             +RT  +NAT+I+  +Q ++ K+D  LFIR+ V  +        G+K IR TF AL+LGDS
Sbjct  259   QRTEAENATDILVKWQNVADKIDNGLFIRVLVQPITSKGGKSKGQKIIRLTFIALYLGDS  318

Query  997   KTLLSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKS  1176
             K+L+S M+  FPELGL +SDC+E  WI+S+LF+++F  G   E LL+R   V   LKRKS
Sbjct  319   KSLMSVMNAGFPELGLKKSDCKEGSWIQSMLFWSNFDIGAKPELLLNRTSDV-NFLKRKS  377

Query  1177  DYLQTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYAT  1356
             DY+QTP+P++ +  IFKKMV+L  P L FNPYGGRM+EIP+   PFPHR+G I  IQY+ 
Sbjct  378   DYVQTPIPKDALTSIFKKMVQLGKPGLVFNPYGGRMSEIPANETPFPHRAGIIYKIQYSV  437

Query  1357  NWDEHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGK  1536
             NW++       HY+   R+LY +MTP+VS NPR+AFLNYRDLD+G   N   + SY EG+
Sbjct  438   NWEDGSPNITNHYIAQARELYSFMTPYVSSNPRQAFLNYRDLDIGTTDNG--KNSYSEGE  495

Query  1537  TYGLKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFPGR  1653
              YG KYFK+N++RLVK+KT VDP+NFFR+EQSIPT   R
Sbjct  496   VYGRKYFKDNFDRLVKVKTLVDPENFFRNEQSIPTVSAR  534



>ref|XP_010054197.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
 gb|KCW75702.1| hypothetical protein EUGRSUZ_D00076 [Eucalyptus grandis]
Length=537

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/514 (57%), Positives = 379/514 (74%), Gaps = 3/514 (1%)
 Frame = +1

Query  109   AWAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             +WA       T L+CL+ RS PS  IS +IY+P N SF++VL  Y+RN RFN S T KPL
Sbjct  25    SWAASDSVYDTFLQCLSRRSQPSDHISDIIYSPANSSFANVLTSYLRNRRFNSSSTPKPL  84

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
              IVT    SH+QA+ILC+K+ G+ +K RSGGHDYEG+SYVS   FFILDMFN RS++V I
Sbjct  85    VIVTPKQESHVQAAILCSKDLGVHLKIRSGGHDYEGMSYVSVDAFFILDMFNLRSIDVDI  144

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
             + ETAWV+AGATLGE+YYGI  KS VHGFPAGVC  +G+GGH  G GYGNM+RKYGL+ D
Sbjct  145   QKETAWVQAGATLGELYYGIWKKSKVHGFPAGVCTVLGIGGHLSGGGYGNMLRKYGLSAD  204

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             N++DAK++DV GR+LDRK+MGE+LFWAI GGG +SF V+L+Y+I LV VP KVT+F V R
Sbjct  205   NVLDAKIVDVQGRILDRKAMGEDLFWAILGGGGASFGVILAYQIKLVPVPEKVTVFRVER  264

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T DQNAT++VY +Q ++   D  LF+RL++   +  T  G+ TI A+  AL+LG+S  LL
Sbjct  265   TLDQNATDLVYKWQSVAPSTDSGLFMRLSLLPTSSQTQKGQLTIGASLVALYLGNSDQLL  324

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGT-PVEELLSRVPQVLVHLKRKSDYL  1185
             +  D+ FPE+GL + +C E+ WIESVL++  F +GT P  E L       +  KRKSDY+
Sbjct  325   AITDKEFPEIGLRKENCTEISWIESVLWWIGFDNGTFPAPETLLSRDYPAIFFKRKSDYV  384

Query  1186  QTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWD  1365
             QTP+ +  +E+++KKM+E++   L+ NPYGGRM+EIP++A PFPHR+GN+  IQY  +W 
Sbjct  385   QTPIAKANLEWLWKKMIEVEKVGLSLNPYGGRMSEIPASATPFPHRAGNLFKIQYFIDWK  444

Query  1366  EHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYG  1545
             E   EA + YL    +LY YMTPFVSKNPR AFLNYRDLD+G   N     SY EG+ YG
Sbjct  445   EEDPEAGKKYLAQISRLYSYMTPFVSKNPRSAFLNYRDLDIGATTNG--NNSYEEGRVYG  502

Query  1546  LKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             +KYF +N+ RLVK+KT VDP+NFFR+EQSIPT P
Sbjct  503   VKYFNDNFERLVKVKTAVDPNNFFRNEQSIPTLP  536



>ref|XP_010051873.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
Length=537

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/514 (57%), Positives = 378/514 (74%), Gaps = 3/514 (1%)
 Frame = +1

Query  109   AWAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             +WA       T L+CL  RS PSH IS ++Y+  N SF+SVL  YIRN RFN S T KPL
Sbjct  25    SWAASNSVYDTFLQCLTHRSQPSHQISDIVYSQANSSFASVLVSYIRNRRFNSSSTPKPL  84

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
              IVT T  SH+QA++LC+K+ G+ +K RSGGHDYEG+SYVSD  FFILDMFN RS++V I
Sbjct  85    VIVTPTRESHVQAAVLCSKDLGVHLKIRSGGHDYEGISYVSDDAFFILDMFNLRSIDVDI  144

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
             + ETAWV+AGATLGE+YY I  KS +HGFPAG+C TVGVGGH  G GYGNM+RKYGL+VD
Sbjct  145   QKETAWVQAGATLGELYYRIWEKSKLHGFPAGICRTVGVGGHLSGGGYGNMLRKYGLSVD  204

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             N++DA+++DV GR+LDRK+MGE+LFWAI GGG +SF V+L+Y++NLV VP KVT+F V +
Sbjct  205   NVLDARMVDVQGRILDRKAMGEDLFWAILGGGGASFGVILAYQVNLVPVPEKVTVFRVEK  264

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T DQNAT++VY +Q ++   D  LF+RL +  V   T   +KT+RA+   LFLG+S  LL
Sbjct  265   TLDQNATDLVYKWQFVAPSTDHGLFMRLLLQPVTSKTQKEQKTLRASVVTLFLGNSDQLL  324

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGT-PVEELLSRVPQVLVHLKRKSDYL  1185
             +  D+  PE+GL + +C E+ WIESVL++  F  G  P  E + R       LKRKSDY+
Sbjct  325   AITDKELPEMGLKKENCTELSWIESVLWWDGFDEGNIPALETMLRRDYPTNFLKRKSDYV  384

Query  1186  QTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWD  1365
             QTP+ +  ++ ++KKM+EL    L FNPYGGRM+EIP++A PFPHR+GN+  IQY+ NW 
Sbjct  385   QTPISKANLDQLWKKMIELGKVGLVFNPYGGRMSEIPASATPFPHRAGNLFKIQYSINWS  444

Query  1366  EHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYG  1545
             E   E  ++YL   R LY Y TPFVSKNPR A+LNYRDLD+G + N   + SY EG+ YG
Sbjct  445   EDDPELEKNYLAQIRSLYNYTTPFVSKNPRSAYLNYRDLDIGTSTNG--KNSYEEGQVYG  502

Query  1546  LKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             +KYF +N+ RLVK+KT VDP+NFFR+EQSIP  P
Sbjct  503   VKYFNDNFERLVKVKTAVDPNNFFRNEQSIPPLP  536



>ref|NP_174357.1| FAD-binding Berberine family protein [Arabidopsis thaliana]
 gb|AAD25757.1|AC007060_15 Strong similarity to F19I3.2 gi|3033375 putative berberine bridge 
enzyme from Arabidopsis thaliana BAC gb|AC004238. ESTs 
gb|F19886, gb|Z30784 and gb|Z30785 come from this gene [Arabidopsis 
thaliana]
 gb|AAL31939.1|AF419607_1 At1g30700/T5I8_15 [Arabidopsis thaliana]
 gb|AAM98220.1| putative reticuline oxidase-like protein [Arabidopsis thaliana]
 gb|AAQ56827.1| At1g30700 [Arabidopsis thaliana]
 gb|AEE31262.1| FAD-binding Berberine family protein [Arabidopsis thaliana]
Length=527

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/505 (59%), Positives = 374/505 (74%), Gaps = 6/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T  +CL   S+P HPISP I+   NGS+SSVLQ  IRNLRFN + T KP  I+ ATH SH
Sbjct  27    TFTQCLTSNSDPKHPISPAIFFSGNGSYSSVLQANIRNLRFNTTSTPKPFLIIAATHESH  86

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAWVE  492
             +QA+I C K H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV+V +  +TAWV+
Sbjct  87    VQAAITCGKRHNLQMKIRSGGHDYDGLSYVTYSGKPFFVLDMFNLRSVDVDVASKTAWVQ  146

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
              GA LGEVYY I  KS    +PAG+CPTVGVGGH  G GYGNMMRKYGLTVDN IDA+++
Sbjct  147   TGAILGEVYYYIWEKSKTLAYPAGICPTVGVGGHISGGGYGNMMRKYGLTVDNTIDARMV  206

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             DVNG++LDRK MGE+L+WAI GGG  S+ VVL+Y+INLV VP  VT+F + RT +QNAT+
Sbjct  207   DVNGKILDRKLMGEDLYWAINGGGGGSYGVVLAYKINLVEVPENVTVFRISRTLEQNATD  266

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             I++ +Q+++ KL   LFIR  +DVVN T    +KT+R TF A+FLGD+ TLLS ++  FP
Sbjct  267   IIHRWQQVAPKLPDELFIRTVIDVVNGTVS-SQKTVRTTFIAMFLGDTTTLLSILNRRFP  325

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL +SDC E  WI+SVLF+T+   G+  E LL +  Q + +LKRKSDY++ P+ R G+
Sbjct  326   ELGLVRSDCTETSWIQSVLFWTNIQVGSS-ETLLLQRNQPVNYLKRKSDYVREPISRTGL  384

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E I+KKM+EL+ P + FNPYGG M  I S   PFP+R+GN+  IQY  NW +        
Sbjct  385   ESIWKKMIELEIPTMAFNPYGGEMGRISSTVTPFPYRAGNLWKIQYGANWRDE--TLTDR  442

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             Y+E+TR+LY++MTPFVSKNPR++F NYRD+DLGIN + G+  SY EGK YG KYF  N+ 
Sbjct  443   YMELTRKLYQFMTPFVSKNPRQSFFNYRDVDLGINSHNGKISSYVEGKRYGKKYFAGNFE  502

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLVKIKT+VD  NFFR+EQSIP  P
Sbjct  503   RLVKIKTRVDSGNFFRNEQSIPVLP  527



>ref|XP_002890889.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67148.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=527

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/507 (59%), Positives = 376/507 (74%), Gaps = 6/507 (1%)
 Frame = +1

Query  133   ATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             + T  +CL   S+P HPISP I+   N S+SSVLQ  IRNLRFN S T KP  I+ ATH 
Sbjct  25    SETFTQCLTSNSDPKHPISPAIFFAGNRSYSSVLQANIRNLRFNISSTPKPFLIIAATHE  84

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAW  486
             SH+QA++ C K H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV+V +  +TAW
Sbjct  85    SHVQAAVTCGKRHNLQMKIRSGGHDYDGLSYVTYSRKPFFVLDMFNLRSVDVDVASKTAW  144

Query  487   VEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAK  666
             V+ GA LGEVYY I  KS    +PAG+CPTVGVGGH  G GYGNMMRKYGLTVDN IDA+
Sbjct  145   VQTGAILGEVYYYIWEKSKTLAYPAGICPTVGVGGHISGGGYGNMMRKYGLTVDNTIDAR  204

Query  667   LIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNA  846
             ++DVNG++LDRK MGE+L+WAI GGG  S+ VVL+Y+INLV VP  VT+F + RT +QNA
Sbjct  205   MVDVNGKILDRKLMGEDLYWAINGGGGGSYGVVLAYKINLVEVPENVTVFRISRTLEQNA  264

Query  847   TNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDES  1026
             T IV  +QR++ +L   LFIR  +DVVN +T   +KT+RATF A+FLGD+ TLLS ++  
Sbjct  265   TEIVNRWQRVAPELPDELFIRTVIDVVN-STVSSQKTVRATFIAMFLGDTTTLLSILNRR  323

Query  1027  FPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             FPELGL +SDC E  WI+SVLF+T+   G+  E+LL +  Q + +LKRKSDY++ P+ R 
Sbjct  324   FPELGLVRSDCTETSWIQSVLFWTNIQVGSS-EKLLLQRNQPVNYLKRKSDYVREPISRI  382

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G+E I+KKM+EL+ P + FNPYGG M  I S   PFP+R+GN+  IQYA NW E      
Sbjct  383   GLESIWKKMIELEIPTMAFNPYGGAMGRISSTVTPFPYRAGNLWKIQYAANWRED--RLT  440

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
               Y+E+TR+LY++MTPFVSKNPR++F NYRD+DLGIN + G+  SY EGK YG KYF  N
Sbjct  441   DRYMELTRKLYQFMTPFVSKNPRQSFFNYRDVDLGINSHNGKMSSYVEGKRYGKKYFAGN  500

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             + RLVKIKT+VD  NFFR+EQSIP  P
Sbjct  501   FERLVKIKTRVDRGNFFRNEQSIPVLP  527



>ref|XP_008225665.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=553

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/504 (58%), Positives = 382/504 (76%), Gaps = 6/504 (1%)
 Frame = +1

Query  136   TTVLECLNDRSN-PSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             T  L+CL++ S   S PIS V Y PNN S++S+LQ YIRNLRF    T KPLFIVT TH+
Sbjct  46    TFFLQCLSNHSQYSSPPISAVTYFPNNSSYTSILQSYIRNLRFITPTTPKPLFIVTPTHV  105

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVE  492
             SHIQASI C+K H LQ++ RSGGHDY+G+SYVS VPF I+DMF+ RS++V++EDE+AWVE
Sbjct  106   SHIQASIFCSKIHALQVRIRSGGHDYDGLSYVSQVPFIIVDMFSLRSISVNVEDESAWVE  165

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
             +GATLGEVYY +A +S +HGFPAGVCPTVGVGGH  G GYGNMMRKYGL+VDNI+DA+++
Sbjct  166   SGATLGEVYYRVAEQSKIHGFPAGVCPTVGVGGHLSGGGYGNMMRKYGLSVDNILDAQIV  225

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             DVNGRLLDR+SMGE+LFWAI GGG +SF V++S++I LV VP  VT+F V RT +Q AT+
Sbjct  226   DVNGRLLDRESMGEDLFWAIRGGGGASFGVIVSWKIKLVPVPEIVTVFRVERTLEQGATD  285

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             IV+ +Q ++  +  +LFIR    VV  +   G +T++A F ALFLG+++ L + MDES P
Sbjct  286   IVHQWQYVADTIHEDLFIRA---VVMQSNKKGHQTVKAKFVALFLGNAEKLHALMDESLP  342

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             +LGL   D  E  WIESVL+++++P GT  + LL R P     LK+KSDY+Q PM ++G+
Sbjct  343   QLGLKHEDYIETSWIESVLYWSNYPIGTSADVLLERQPSSEKFLKKKSDYIQEPMSKSGL  402

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E ++KKM+EL+ P+LTFNPYGG+M EI     PFPHR+GN+  IQY+ NW E G E A  
Sbjct  403   EELWKKMMELRKPVLTFNPYGGKMREISELETPFPHRAGNVYKIQYSVNWKEEGVEVADK  462

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
              L++ R+LYE+MTP+VSK+PR ++LNYRD+DLG N N     SY E   +G KYFK N++
Sbjct  463   NLDLIRRLYEFMTPYVSKSPRCSYLNYRDVDLGTNGNG--NASYSEASVWGTKYFKGNFD  520

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTF  1644
             RLV++KT VDP NFF  EQSIP+ 
Sbjct  521   RLVQVKTAVDPGNFFSYEQSIPSL  544



>ref|XP_007023054.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY25676.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=534

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/507 (57%), Positives = 385/507 (76%), Gaps = 5/507 (1%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             +++L+CL++ S  S PIS V Y P N S++S+LQ YIRNLRF  + T KPLFIV  +H S
Sbjct  28    SSILQCLSNHSVTSPPISSVTYFPTNPSYTSILQSYIRNLRFTSATTAKPLFIVVPSHDS  87

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             HIQASI+C K HGL+M+ RSGGHDY+G+SYVS  PF ILDMFN RS+ V +EDE+AWVE+
Sbjct  88    HIQASIICCKIHGLEMRIRSGGHDYDGLSYVSAAPFMILDMFNLRSIIVDMEDESAWVES  147

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE++Y IA KS  HGFPAGVCPTVGVGGHF G GYGNMMRK+GL+ DNI+DAKL+D
Sbjct  148   GATLGELFYRIAEKSKNHGFPAGVCPTVGVGGHFSGGGYGNMMRKHGLSTDNIVDAKLVD  207

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
              NGR+LDR+SMGE+LFWAI GGG +SF V+LS++I +V VP  VT+F + +T +Q AT+I
Sbjct  208   ANGRILDRESMGEDLFWAIRGGGGASFGVILSWKIKVVSVPEIVTVFRIEKTLEQGATDI  267

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             V+ +Q ++ K+D NLFIR+ +  V   T    ++I+A F ALFLG+++ L+S M+ +FPE
Sbjct  268   VHKWQYIADKIDENLFIRVVLLPV---TKKHLQSIKAKFIALFLGNAEKLISLMNGTFPE  324

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL+  +C EM WIESVLF++++P GT +E LL+R PQ   +LK+KSDY+Q P+ +  +E
Sbjct  325   LGLSPENCVEMSWIESVLFWSNYPKGTSLEVLLNRHPQPEKYLKKKSDYVQEPISKKDLE  384

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              I+KKM+EL+ P LT NPYGG+M+EI  +  PFPHR+GNI  IQY+  W E G EA+   
Sbjct  385   GIWKKMIELRRPALTLNPYGGKMSEISESETPFPHRAGNIYKIQYSVTWKEDGAEASDRS  444

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L+   ++Y+YMTP+VSK PR ++LNYRD+D+GIN       SY E K +  KYFK N++R
Sbjct  445   LDQITRIYDYMTPYVSKYPRSSYLNYRDVDIGINEIGN--ASYSEAKVWASKYFKGNFDR  502

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             LV++K+ VDP NFFR EQSIP+    K
Sbjct  503   LVQVKSMVDPGNFFRYEQSIPSLTSWK  529



>ref|XP_006415434.1| hypothetical protein EUTSA_v10007341mg [Eutrema salsugineum]
 gb|ESQ33787.1| hypothetical protein EUTSA_v10007341mg [Eutrema salsugineum]
Length=530

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/505 (58%), Positives = 379/505 (75%), Gaps = 6/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T  +CL   S+P HPIS  ++   N S+S+VL+  IRNLRFN S T KP  I+ ATH SH
Sbjct  30    TFTQCLTSNSDPKHPISSAVFFSGNRSYSTVLEANIRNLRFNTSTTPKPFLIIAATHESH  89

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVS--DVPFFILDMFNFRSVNVSIEDETAWVE  492
             +QA++ C K H LQMK RSGGHDY+G+SYVS    PFF+LDMFN RSV+V    +TAWV+
Sbjct  90    VQAAVTCGKRHSLQMKIRSGGHDYDGLSYVSYSSKPFFVLDMFNLRSVDVDTASKTAWVQ  149

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
              GA LGEVYY I  KS    +PAG+CPTVGVGGH  G GYGNMMRKYGLTVDN IDA+++
Sbjct  150   TGAILGEVYYYIWEKSKTLAYPAGICPTVGVGGHISGGGYGNMMRKYGLTVDNTIDARMV  209

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             DVNG +LDRK MGE+LFWAI GGG  S+ VVL+Y+INLV +P  VT+F + RT +QNAT 
Sbjct  210   DVNGNILDRKMMGEDLFWAINGGGGGSYGVVLAYKINLVEIPENVTVFRISRTLEQNATE  269

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             IV+ +Q+++ +L   LFIR  +DVVN T    +KT+RATF A+F+GD+ TL+S ++  FP
Sbjct  270   IVHRWQQVAPELPDELFIRAFIDVVNGTVL-SKKTVRATFIAMFIGDTSTLMSIINRRFP  328

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL +SDC E  WI+SVLF+T+   GTP + LL R  Q + +LKRKSDY++ P+ + G+
Sbjct  329   ELGLVRSDCTETSWIQSVLFWTNIQFGTPEKALLQR-NQTVNYLKRKSDYVRKPISKTGL  387

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E I++KM+EL+ P +TFNPYGG+MA+IPS A PFP+R+GN+  IQY+ NW E        
Sbjct  388   ESIWRKMIELEIPTMTFNPYGGKMAKIPSTATPFPYRAGNLWKIQYSANWRED--RLTNR  445

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             Y+E+TR+LY++MTPFVSKNPR++F NYRD+DLGIN ++G+ +SY + K+YG KYF  N+ 
Sbjct  446   YMELTRRLYQFMTPFVSKNPRQSFFNYRDVDLGINSHEGKIRSYEQSKSYGKKYFAGNFE  505

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLV IKT+VD  NFFR+EQSIP  P
Sbjct  506   RLVNIKTRVDSGNFFRNEQSIPVLP  530



>ref|XP_011096699.1| PREDICTED: reticuline oxidase-like protein [Sesamum indicum]
Length=532

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/508 (58%), Positives = 381/508 (75%), Gaps = 7/508 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + ++C  +   P   IS ++YTP N SF++VL+ Y+RN RFN S T KP  IVT T  +H
Sbjct  27    SFVQCFTENKIPDSQISSILYTPENPSFTNVLESYVRNRRFNVSTTPKPNIIVTPTSEAH  86

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             + A++LCAK+ G+Q+K RSGGHDYEG+SYVSD  F ILDMFNFRS+NV++EDETAWV++G
Sbjct  87    VSAAVLCAKKLGIQLKIRSGGHDYEGISYVSDTTFVILDMFNFRSINVNMEDETAWVQSG  146

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             A LGE+YY I  KS VHGFPAGVCPTVGVGGH  GAGYGNM+RKYGLTVD++IDA+++D 
Sbjct  147   ALLGELYYRIWEKSKVHGFPAGVCPTVGVGGHISGAGYGNMLRKYGLTVDHVIDAQIVDS  206

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGR+LDR+SMGE+LFWAI GGG +SF V+L+Y+I LV VPP VT+F + ++ D+NA   V
Sbjct  207   NGRVLDRESMGEDLFWAIRGGGGASFGVILAYKIKLVPVPPTVTVFRLEKSVDENAIEAV  266

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             + YQ++  KLD +LFIR+ +  +   T   ++++RATF  LFLGDS  LLS     FP+L
Sbjct  267   FQYQQVVDKLDNDLFIRVLLQPI---TRNKKRSVRATFIGLFLGDSTRLLSITGSEFPKL  323

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
              L +SDC EM WI SVLF+ +F + T    LLSR P  +  LKRKSDY++TP+  +G+E 
Sbjct  324   ELKKSDCHEMSWINSVLFWGNFDNTTSPNVLLSRNPDSVNFLKRKSDYVKTPISISGLES  383

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             +FKKMVE+    + FN YGGRM+EIP +  PFPHR+GNI  IQY+ NW+E   EA   Y+
Sbjct  384   LFKKMVEIGKVGMVFNSYGGRMSEIPESETPFPHRAGNIFKIQYSVNWNEEDEEADNKYV  443

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             +  RQLY +M PFVSKNPREA+LNYRDLD+G  +N   + SY EG+ YG+KYFK N++RL
Sbjct  444   DQIRQLYSFMEPFVSKNPREAYLNYRDLDIGTTNNG--KNSYSEGQVYGVKYFKSNFDRL  501

Query  1579  VKIKTKVDPDNFFRDEQSIPTFP--GRK  1656
             V+IKT VDP+N FR+EQSIP  P  GRK
Sbjct  502   VRIKTTVDPENVFRNEQSIPVQPFRGRK  529



>ref|XP_009115056.1| PREDICTED: reticuline oxidase-like protein [Brassica rapa]
Length=530

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/505 (59%), Positives = 372/505 (74%), Gaps = 6/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T  +CL   S+P HPIS  +    N S+SSVL+ YIRNLRFN S T KPL I+ ATH SH
Sbjct  30    TFTQCLTSNSDPKHPISSAVIFSGNSSYSSVLEAYIRNLRFNTSTTPKPLLIIAATHESH  89

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAWVE  492
             +QA+I C + H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV+V +  +TAWV+
Sbjct  90    VQAAITCGRRHNLQMKIRSGGHDYDGLSYVTYSGKPFFVLDMFNLRSVDVDLASKTAWVQ  149

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
             +GA LGEVYY I  KS    +PAG+CPTVGVGGH  G GYGN+MRKYGLTVDN IDA+++
Sbjct  150   SGAILGEVYYYIWEKSKTLAYPAGICPTVGVGGHISGGGYGNIMRKYGLTVDNTIDARMV  209

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             DVNG +LDRK MGE+L+WAI GGG  SF VVL+Y+INLV VP  VT+F V RT +QNAT 
Sbjct  210   DVNGNILDRKMMGEDLYWAINGGGGGSFGVVLAYKINLVEVPENVTVFRVSRTLEQNATE  269

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             IV+ +Q+++  L   LFIR+ +DVVN T    +KT+RA+F  +FLGD+ TLLS ++   P
Sbjct  270   IVHQWQQVASVLPDELFIRVVIDVVNGTVS-SKKTVRASFVGMFLGDASTLLSILNRRLP  328

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL +SDC E  WI+SVLF+T+   GTP   LL R  Q + +LKRKSDY++ P+ R G+
Sbjct  329   ELGLVRSDCTETSWIQSVLFWTNIRVGTPETVLLQR-NQTVNYLKRKSDYVREPISRTGL  387

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E I+KKM+EL+ P + FNPYGG M  +PS A PFP+R+GN+  IQY  NW E        
Sbjct  388   ESIWKKMIELEIPTMAFNPYGGMMGRVPSTATPFPYRAGNLWKIQYGANWRED--RLTNR  445

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             Y+E+TR+LY +MTPFVSKNPR+++ NYRD+DLGIN + G  +SY EG+ YG KYF  N+ 
Sbjct  446   YMELTRELYRFMTPFVSKNPRQSYFNYRDVDLGINSHDGVVRSYVEGERYGKKYFNGNFE  505

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLVKIKT+VD  NFFR+EQSIP  P
Sbjct  506   RLVKIKTRVDSGNFFRNEQSIPVKP  530



>ref|XP_010460877.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=530

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/507 (58%), Positives = 377/507 (74%), Gaps = 6/507 (1%)
 Frame = +1

Query  133   ATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             + T ++CL  +S+P HPISP ++   N S+SSVL+  IRNLRFN S T KP  I+ ATH 
Sbjct  28    SETFIQCLTSKSDPKHPISPAVFFAGNRSYSSVLEATIRNLRFNTSNTPKPFLIIAATHE  87

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAW  486
             +H+QA++ C K H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV+V    +TAW
Sbjct  88    THVQAAVTCGKRHNLQMKIRSGGHDYDGLSYVTYSGKPFFVLDMFNLRSVDVDTASKTAW  147

Query  487   VEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAK  666
             V+AGA LGEVYY I  KS    +PAG+CPTVGVGGH  G GYGNMMRKYGLTVDN IDA+
Sbjct  148   VQAGAILGEVYYYIWEKSKTLAYPAGICPTVGVGGHISGGGYGNMMRKYGLTVDNTIDAR  207

Query  667   LIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNA  846
             ++DVNG++L+RK MGE+L+WAI GGG  S+ VVL+Y+I LV VP  VT+F + RT +QNA
Sbjct  208   MVDVNGKILNRKLMGEDLYWAINGGGGGSYGVVLAYKIKLVEVPENVTVFRISRTLEQNA  267

Query  847   TNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDES  1026
             T+IV  +Q+++ +L   LFIR  +DVVN T    +KT+RATF A+FLGD+ TLLS ++  
Sbjct  268   TDIVDRWQQVAPELPDELFIRTVIDVVNGTVS-SQKTVRATFIAMFLGDTTTLLSILNRR  326

Query  1027  FPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             FPELGL +SDC E  WI+SVLF+T+   G+  + LL R  Q + +LKRKSDY++ P+ R 
Sbjct  327   FPELGLVRSDCTETSWIQSVLFWTNIQVGSSEKLLLER-KQPVNYLKRKSDYVREPISRT  385

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G+E I+KKM+EL+ P + FNPYGG MA I S   PFP+R+GN+  IQYA NW E      
Sbjct  386   GLESIWKKMIELEIPTMAFNPYGGAMARISSTVTPFPYRAGNLWKIQYAANWRED--RLT  443

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
               Y+E+TR+LY +MTPFVSKNPR++F NYRD+DLGIN + G+  SY EGK YG+KYF  N
Sbjct  444   DRYMELTRELYRFMTPFVSKNPRQSFFNYRDVDLGINSHNGKINSYVEGKRYGMKYFAGN  503

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             + RLVKIKT+VD  NFFR+EQSIP  P
Sbjct  504   FERLVKIKTRVDSGNFFRNEQSIPVLP  530



>ref|XP_002299008.1| hypothetical protein POPTR_0001s46340g [Populus trichocarpa]
 gb|EEE83813.1| hypothetical protein POPTR_0001s46340g [Populus trichocarpa]
Length=526

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/498 (59%), Positives = 368/498 (74%), Gaps = 3/498 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL + S PS+PIS  IYT  N SF SVLQ YI N RF    T KP+ IVTA H SH+Q
Sbjct  28    LQCLPNNSLPSYPISEAIYTTANSSFESVLQTYINNRRFLTPTTPKPIAIVTALHESHVQ  87

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++CAK  GLQ++ RSGGHDYEG+SYVS+VPF ILDMFN RS++V I +ETAWV+AGAT
Sbjct  88    ATVICAKASGLQVRIRSGGHDYEGLSYVSEVPFVILDMFNLRSIDVDIANETAWVQAGAT  147

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY IAN SNVH FPAGVCPTVG GGH  G GYG +MRKYGL+VDNIIDAK++DVNG
Sbjct  148   LGEIYYNIANNSNVHAFPAGVCPTVGAGGHISGGGYGTLMRKYGLSVDNIIDAKVVDVNG  207

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              +LDR++MGE+LFWAI GGG +SFAVVLS+++NLVRVP KVT+F V RT ++ AT+I Y 
Sbjct  208   NILDRETMGEDLFWAIRGGGGASFAVVLSWKMNLVRVPEKVTVFKVDRTLEEGATDIFYQ  267

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q++S +LD +LFIR    V N  +  G KTI  +F ALFLG S+ LLS M++SFP+LGL
Sbjct  268   WQQVSTELDKDLFIRAMPQVAN-GSQEGTKTISISFYALFLGQSEALLSMMNKSFPKLGL  326

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              Q DC EMRWIES LF+   P GT ++ LL+R        K KSDY+   +P+  +E I+
Sbjct  327   QQKDCIEMRWIESTLFWFDLPIGTSIDVLLNRPQGAQSFYKNKSDYVNQIVPKEALERIW  386

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             K M++     + +NPYGGRM+EIP  A PFPHR+G +  +QY+ NWDE G EA + Y+ +
Sbjct  387   KMMIKADPMWMQWNPYGGRMSEIPDTATPFPHRAGYLFKLQYSINWDEEGTEATERYISL  446

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
              R++++ M P+V+  PREAF NYRDLD+G   N   +  +   K YGLKYFK N+ RLVK
Sbjct  447   IREMHDAMAPYVTSYPREAFQNYRDLDIG--SNPSNQTDFERAKVYGLKYFKGNFLRLVK  504

Query  1585  IKTKVDPDNFFRDEQSIP  1638
             IK KVDPDNF + EQSIP
Sbjct  505   IKGKVDPDNFLKHEQSIP  522



>gb|KDP36345.1| hypothetical protein JCGZ_09765 [Jatropha curcas]
Length=524

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/503 (57%), Positives = 384/503 (76%), Gaps = 6/503 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
              +L+CL+  S P  PIS V Y P+N ++ S+LQ YIRNLRFN S T KPLFIVT TH+SH
Sbjct  17    ALLQCLSTHSLPYPPISQVTYFPSNPNYKSILQSYIRNLRFNSSSTPKPLFIVTPTHVSH  76

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDV-PFFILDMFNFRSVNVSIEDETAWVEA  495
             IQASI+C + HGL+M+ RSGGHDY+G+SY+S    F +LDMFN RSV+V+IE+E+AWVE+
Sbjct  77    IQASIICCRFHGLEMRIRSGGHDYDGLSYISKTTSFMLLDMFNMRSVSVNIEEESAWVES  136

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGEVYY IA KSN+H +PAGVCPTVGVGGH  G GYGN+MRK+GL+VD I+DA +ID
Sbjct  137   GATLGEVYYWIATKSNIHAYPAGVCPTVGVGGHLSGGGYGNLMRKFGLSVDKIVDALIID  196

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
              NGR+LDR+ MGE+LFWAI GGG +SF V++S++I LV VP  VTIF + +T ++N  +I
Sbjct  197   FNGRVLDREKMGEDLFWAIRGGGGASFVVIVSWKIKLVLVPEIVTIFRIEKTLEENGLDI  256

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             VY +Q+++ K+D +LFIR+   V+N     G++T++A FNALFLG ++ L+  M++  P+
Sbjct  257   VYNWQKIADKVDDDLFIRV---VLNPVVRKGKETVKAKFNALFLGKAERLVGLMEKELPQ  313

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL+++DC+EM WIESVLF++++P GT ++ LL R  Q    LKRKSDY+Q  + +  + 
Sbjct  314   LGLSRNDCKEMSWIESVLFWSNYPIGTSIDVLLERHCQTERFLKRKSDYVQQAISKQDLA  373

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              IFKK++EL+  +LT NPYGG+MA+I     PFPHR GN+  IQYA NW E G EA +  
Sbjct  374   QIFKKIIELKKVVLTLNPYGGKMAKISEFETPFPHREGNMYKIQYAVNWKEEGVEAEEKN  433

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             LE+ R+LY+YMTPFVSK+PR ++LNYRD+DLG N      ++Y E K +G+KYFK N+ R
Sbjct  434   LELIRKLYDYMTPFVSKSPRCSYLNYRDVDLGTNEIGN--ETYEEAKKWGIKYFKGNFER  491

Query  1576  LVKIKTKVDPDNFFRDEQSIPTF  1644
             LV++KT VDP NFFR EQSIP+ 
Sbjct  492   LVEVKTTVDPFNFFRYEQSIPSL  514



>ref|XP_010478503.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=530

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/507 (58%), Positives = 375/507 (74%), Gaps = 6/507 (1%)
 Frame = +1

Query  133   ATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             + T ++CL  +S+P HPISP ++   N S+SSVL+  IRNLRFN S T KP  I+ ATH 
Sbjct  28    SETFIQCLTSKSDPKHPISPAVFFAGNRSYSSVLEATIRNLRFNTSNTPKPFLIIAATHE  87

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAW  486
             +H+QA++ C K H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV+V    +TAW
Sbjct  88    THVQAAVTCGKRHNLQMKIRSGGHDYDGLSYVTYSGKPFFVLDMFNLRSVDVDTASKTAW  147

Query  487   VEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAK  666
             V+ GA LGEVYY I  KS    +PAG+CPTVGVGGH  G GYGNMMRKYGLTVDN IDA+
Sbjct  148   VQTGAILGEVYYYIWEKSKTLAYPAGICPTVGVGGHISGGGYGNMMRKYGLTVDNTIDAR  207

Query  667   LIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNA  846
             ++DVNG++L+RK MGE+L+WAI GGG  S+ VVL+Y+I LV VP  VT+F + RT +QNA
Sbjct  208   MVDVNGKILNRKLMGEDLYWAINGGGGGSYGVVLAYKIKLVEVPENVTVFRISRTLEQNA  267

Query  847   TNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDES  1026
             T IV  +Q+++ +L   LFIR  +DVVN T    +KT+RATF A+FLGD+ TLLS ++  
Sbjct  268   TEIVDRWQQVAPELPDELFIRTVIDVVNGTVS-SQKTVRATFIAMFLGDTTTLLSILNRR  326

Query  1027  FPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             FPELGL +SDC E  WI+SVLF+T+   G+  + LL R  Q + +LKRKSDY++ P+ R 
Sbjct  327   FPELGLVRSDCTETSWIQSVLFWTNIQVGSSEKLLLER-KQPVNYLKRKSDYVREPISRT  385

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G+E I+KKM+EL+ P + FNPYGG MA I S   PFP+R+GN+  IQYA NW E      
Sbjct  386   GLESIWKKMIELEIPTMAFNPYGGAMARISSTVTPFPYRAGNLWKIQYAANWRED--RLT  443

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
               Y+E+TR+LY +MTPFVSKNPR++F NYRD+DLGIN + G+  SY EGK YG+KYF  N
Sbjct  444   DRYMELTRELYRFMTPFVSKNPRQSFFNYRDVDLGINSHNGKINSYVEGKRYGMKYFAGN  503

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             + RLVKIKT+VD  NFFR+EQSIP  P
Sbjct  504   FERLVKIKTRVDSGNFFRNEQSIPVLP  530



>ref|XP_008439529.1| PREDICTED: LOW QUALITY PROTEIN: reticuline oxidase-like protein 
[Cucumis melo]
Length=546

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/506 (56%), Positives = 376/506 (74%), Gaps = 2/506 (0%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             TT L C    SNPS  +S +++   N S++SVL+ YIRN RFN S   KP+ IVT    S
Sbjct  42    TTFLHCFESNSNPSAGVSAIVFARENASYTSVLRAYIRNARFNTSSAPKPVIIVTPLTES  101

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+Q++++C+K+ G+Q+K RSGGHDYEGVSY+SDV F +LDM N R+V V + D++AWVEA
Sbjct  102   HVQSAVICSKKLGIQLKIRSGGHDYEGVSYISDVEFIVLDMSNLRAVTVDVADQSAWVEA  161

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GA LGEVYY I  KS V G+PAGVCPTVGVGGH  G GYGNM+RKYGL+VD+++DA+++D
Sbjct  162   GAILGEVYYRIWEKSKVLGYPAGVCPTVGVGGHISGGGYGNMLRKYGLSVDHVLDARIVD  221

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             V GR+LD KSMGE+LFWAI GGG +SF VVL+Y+I LV VP  VTIF V RT +QNA ++
Sbjct  222   VKGRILDSKSMGEDLFWAIKGGGGASFGVVLAYKIRLVPVPETVTIFRVERTIEQNAADL  281

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             V  +Q ++   D NLF+RL +  V+     G +TIRAT  ALFLG S+ L+S + + FPE
Sbjct  282   VVRWQEVAPTTDENLFMRLLLQPVSSKIKKGTRTIRATVIALFLGKSEELVSLLKKEFPE  341

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL + +C EM WI+SVL++ +F  GT  E LL R       L+RKSDY+Q P+ R+G++
Sbjct  342   LGLQKENCTEMSWIDSVLWWGNFDIGTSPEALLDRNVDSAGFLRRKSDYVQKPISRDGLD  401

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
             +++KKM+E+    L FNPYGG+M+EI S A PFPHR+GN+  IQY+ NWDE G EA Q +
Sbjct  402   WLYKKMIEIGKTGLVFNPYGGKMSEISSTATPFPHRAGNLYKIQYSVNWDEPGPEADQQF  461

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             ++  R+LY +MTPFV+KNPR++FLNYRDLD+GIN+N   + S+ +GK YG KYF EN+ R
Sbjct  462   VKQIRRLYSFMTPFVTKNPRQSFLNYRDLDIGINNND--KNSFEDGKVYGFKYFGENFER  519

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFPGR  1653
             LVK+KT VDP+NFF +EQSIPT   +
Sbjct  520   LVKVKTAVDPENFFWNEQSIPTLSSK  545



>ref|XP_010667051.1| PREDICTED: reticuline oxidase-like protein [Beta vulgaris subsp. 
vulgaris]
Length=520

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/505 (58%), Positives = 377/505 (75%), Gaps = 5/505 (1%)
 Frame = +1

Query  139   TVLECL-NDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             + ++CL N+ S  S PISP+IYT  N +++++L   I NLRF ++ T KPL IVT TH S
Sbjct  18    SFIQCLENNISTSSSPISPLIYTQKNSNYTTILNSRIHNLRFIKTTTPKPLLIVTPTHAS  77

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             HIQ  I  AK+ GL+M+ RSGGHDYEG+SYVS+VPF +LDMFN RS++V I+ E  WV+A
Sbjct  78    HIQGVIQWAKQQGLEMRIRSGGHDYEGLSYVSNVPFLVLDMFNLRSIDVDIDKEFVWVQA  137

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE+ Y IA KS  HG P G+CP+VGVGG+F G GYG MMRKYGL++DNI+DA+LID
Sbjct  138   GATLGEMCYEIAKKSKTHGSPIGICPSVGVGGNFSGGGYGTMMRKYGLSIDNIVDAELID  197

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
              N RLL+R++MGE+LFWAI GGG +SF V+LSY+I LVRV   VT+F V RT +++  +I
Sbjct  198   ANSRLLNRETMGEDLFWAIRGGGGASFGVILSYKIKLVRVLQVVTVFQVSRTIEESNLDI  257

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             V  +Q +   +D +LF+RL++DV+  T   GEK ++ TF A+FLG SK L+S M + FPE
Sbjct  258   VLQWQEICSSVDNDLFLRLSMDVIGTT--KGEKKVKGTFIAMFLGGSKRLMSLMSDQFPE  315

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSG-TPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             LGL +SDC EM WIESVLF+  +P G TPVE LL R P  L H  RKSDY++ P+PR G 
Sbjct  316   LGLKKSDCHEMSWIESVLFWAKYPIGTTPVEVLLERKPTTLWHQTRKSDYVKEPIPREGF  375

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             EFI KKM+EL TP L F PYGGRM+EI     PFPHR G +  IQY TNWDE G E   +
Sbjct  376   EFILKKMIELGTPSLVFTPYGGRMSEIAENETPFPHRKGTLYKIQYKTNWDEEGREKEIY  435

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             ++++TR+LY +MT +VSK+PR+AF NYRDLDLGIN + G   SY EG  YG+KYFK+N +
Sbjct  436   FIDLTRKLYSFMTSYVSKSPRQAFFNYRDLDLGINKHDG-ISSYLEGMNYGIKYFKDNVD  494

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             +LVKIKT VDP+NFF++EQSIP  P
Sbjct  495   KLVKIKTMVDPNNFFKNEQSIPVLP  519



>ref|XP_010499613.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=530

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/507 (58%), Positives = 374/507 (74%), Gaps = 6/507 (1%)
 Frame = +1

Query  133   ATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             + T ++CL   S+P HPISP ++   N S+SSVL+  IRNLRFN S T KP  I+ ATH 
Sbjct  28    SETFIQCLTSNSDPKHPISPAVFFAGNRSYSSVLEATIRNLRFNTSNTPKPFLIIAATHE  87

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAW  486
             +H+QA++ C K H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV+V    +TAW
Sbjct  88    THVQAAVTCGKRHNLQMKIRSGGHDYDGLSYVTYSGKPFFVLDMFNLRSVDVDTASKTAW  147

Query  487   VEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAK  666
             V+ GA LGEVYY I  KS    +PAG+CPTVGVGGH  G GYGNMMRKYGLT+DN IDA+
Sbjct  148   VQTGAILGEVYYYIWEKSKTLAYPAGICPTVGVGGHISGGGYGNMMRKYGLTIDNTIDAR  207

Query  667   LIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNA  846
             ++DVNG++L+RK MGE+L+WAI GGG  S+ VVL+Y+I LV VP  VT+F + RT +QNA
Sbjct  208   MVDVNGKILNRKLMGEDLYWAINGGGGGSYGVVLAYKIKLVEVPENVTVFRISRTLEQNA  267

Query  847   TNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDES  1026
             T IV  +Q+++ +L   LFIR  +DVVN T    +KT+RATF ALFLGD+ TLLS ++  
Sbjct  268   TEIVDRWQQVAPELPDELFIRTVIDVVNGTVS-SQKTVRATFIALFLGDTTTLLSILNRR  326

Query  1027  FPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             FPELGL +SDC E  WI+SVLF+T+   G+  + LL R  Q + +LKRKSDY++ P+ R 
Sbjct  327   FPELGLVRSDCTETSWIQSVLFWTNIQVGSSEKLLLER-KQPVNYLKRKSDYVREPISRT  385

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G+E I+KKM+EL+ P + FNPYGG MA I S   PFP+R+GN+  IQYA NW E      
Sbjct  386   GLESIWKKMIELEIPTMAFNPYGGAMARISSTVTPFPYRAGNLWKIQYAANWRED--RLT  443

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
               Y+E+TR+LY +MTPFVSKNPR++F NYRD+DLGIN + G+  SY EGK YG+KYF  N
Sbjct  444   DRYMELTRELYRFMTPFVSKNPRQSFFNYRDVDLGINSHNGKINSYVEGKRYGMKYFAGN  503

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             + RLVKIKT+VD  NFFR+EQSIP  P
Sbjct  504   FERLVKIKTRVDSGNFFRNEQSIPVLP  530



>gb|AEK87147.1| berberine bridge enzyme [Hevea brasiliensis]
Length=539

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/515 (55%), Positives = 382/515 (74%), Gaps = 9/515 (2%)
 Frame = +1

Query  130   CATT-------VLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             CA T        L+CL + +NP   IS ++Y+  N S++SVL+ YIRN R N S T KP+
Sbjct  26    CAATDDSVYESFLQCLENNTNPQDQISTLVYSQTNASYTSVLRAYIRNARMNTSTTPKPV  85

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
              I+T   +SH+QA+++C K  G Q+K RSGGHDYEG+SY+SDVPFF+LDMFN RS+++ +
Sbjct  86    IILTPKQISHVQAAVICTKSVGYQLKIRSGGHDYEGISYISDVPFFVLDMFNLRSIDIDV  145

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
             ++E+AW+++GATLGEVYY I  KS  HGFPAG+CPTVGVGGHF G GYGNM+RKYGL VD
Sbjct  146   KNESAWIQSGATLGEVYYRIWEKSKAHGFPAGICPTVGVGGHFSGGGYGNMLRKYGLAVD  205

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             N++DA+++DVNG+LLDRK+MGE+LFWAI GGG  SF V++SY+I+LV VP  VT+F V R
Sbjct  206   NVLDAQIVDVNGKLLDRKAMGEDLFWAIRGGGGGSFGVIISYKISLVPVPETVTVFRVER  265

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T D+NAT+IV+ +Q ++ K D  LF+R+ +  V    +  EKTIRA+  AL+LG++ TL+
Sbjct  266   TLDENATDIVFKWQFVAPKTDNGLFMRMLLQPVTSKKNKTEKTIRASIVALYLGNADTLV  325

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQ  1188
             S + + FPELGL + +C E  WI+SV+++ ++  GT  E LL R P     LKRKSDY+Q
Sbjct  326   SLLGKEFPELGLKKENCNETSWIQSVIWWANYDIGTSPEVLLDRDPDSANFLKRKSDYVQ  385

Query  1189  TPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDE  1368
             TP+ ++ +  I+++M+EL    L FNPYGGRM+EIP+   PFPHR+GN+  +QY+ NW++
Sbjct  386   TPISKDKLNLIWQRMIELGKTGLVFNPYGGRMSEIPATDAPFPHRAGNLFKVQYSVNWED  445

Query  1369  HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGL  1548
              G  A   YL   R+LY YMTPFVSKNPR AFLNYRDLD+G+   +  + SY EG  YG 
Sbjct  446   AGSTAEIEYLTQARKLYSYMTPFVSKNPRSAFLNYRDLDIGV--MEAGKNSYEEGSVYGY  503

Query  1549  KYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFPGR  1653
             KYF  N++RLVK+KT VDP+NFFR+EQSIPT P +
Sbjct  504   KYFNGNFDRLVKVKTAVDPENFFRNEQSIPTLPTK  538



>ref|XP_010051872.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
Length=538

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/515 (57%), Positives = 383/515 (74%), Gaps = 5/515 (1%)
 Frame = +1

Query  109   AWAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             +WA       T L+CL  R+ PS  IS ++Y+  N SF++VL  YIRN  FN S T KPL
Sbjct  26    SWAASDSVYDTFLQCLTHRTRPSDHISDIVYSRANSSFANVLVSYIRNRHFNSSSTPKPL  85

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
              IVT    SH+QA++LC+K+ G+ +K RSGGHDYEG+SYVSD  FFILDMFN RS++V+I
Sbjct  86    VIVTPKQESHVQAAVLCSKDLGIHLKIRSGGHDYEGISYVSDDAFFILDMFNLRSIDVNI  145

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
             + ETAWV+AGATLGE+YY I  KS +HGFPAGV PT+GVGGHF GAGYGNM+RKYGL+VD
Sbjct  146   QKETAWVQAGATLGELYYRIWEKSKLHGFPAGVGPTIGVGGHFSGAGYGNMLRKYGLSVD  205

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             N++DA+++DV GR+LDRK+MGE+LFWAI GGG +SF V+L+Y+I LV VP KVT+F V +
Sbjct  206   NVLDARMVDVRGRILDRKAMGEDLFWAIIGGGGASFGVILAYQIKLVPVPEKVTVFPVEK  265

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T DQNAT++VY +Q ++ + D  LF+RL +  V   T  G+KT+RAT   LFLG+S  LL
Sbjct  266   TLDQNATDLVYKWQFVAPRTDHGLFMRLLLQPVTSQTQKGQKTLRATVVTLFLGNSDQLL  325

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGT--PVEELLSRVPQVLVHLKRKSDY  1182
             +  D+  PE+GL + +C E+ WIESVL++  F  GT   +E LLSR       LKRKSDY
Sbjct  326   AITDKELPEMGLKKENCTELSWIESVLWWDGFDEGTIPALETLLSR-DDSTNFLKRKSDY  384

Query  1183  LQTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNW  1362
             +QTP+ +  +++++KKM+EL    L FNPYGGRM+EI ++A PFPHR+GN+  IQY+ NW
Sbjct  385   VQTPISKANLDWLWKKMIELGKVGLVFNPYGGRMSEILASATPFPHRAGNLFKIQYSVNW  444

Query  1363  DEHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTY  1542
             +E   E  ++YL   R LY Y TPFVSKNPR A+LNYRDLD+G + +   + SY EG+ Y
Sbjct  445   NEDDPELEKNYLAQVRSLYNYTTPFVSKNPRSAYLNYRDLDIGTSTDG--KNSYEEGQVY  502

Query  1543  GLKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             G+KYF +N+ RLVK+KT VDP+NFFR+EQSIP  P
Sbjct  503   GVKYFNDNFERLVKVKTAVDPNNFFRNEQSIPPLP  537



>emb|CDP12591.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/517 (56%), Positives = 380/517 (74%), Gaps = 11/517 (2%)
 Frame = +1

Query  118   PLCYCATTVL-----ECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKK  282
             P C  A+  +      CL     PS  IS ++Y+P N SF+SVLQ ++RNLRFN S T+K
Sbjct  25    PFCVAASDSIYDNFASCLTKNGIPSGQISNILYSPTNTSFNSVLQAHVRNLRFNTSSTRK  84

Query  283   PLFIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNV  462
             P  IV    + H+QA++LC K  GL++K RSGGHDYEG+SYVSDVPF ILDMFN  S+ V
Sbjct  85    PSIIVAPLEIPHVQAAVLCTKGAGLELKIRSGGHDYEGISYVSDVPFIILDMFNLSSITV  144

Query  463   SIEDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLT  642
              I  E+AWV+AGAT+GE+YY I  KSN +GFPAG+CPT+GVGGH  G GYG M+R++GL+
Sbjct  145   DIPSESAWVQAGATVGELYYRIWEKSNAYGFPAGLCPTLGVGGHISGGGYGAMLRRFGLS  204

Query  643   VDNIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSV  822
             VDN++DA+++DV G++LDRK+MGE+LFWAI GGG +SF VVL+Y++ LV+VP  VT+F+V
Sbjct  205   VDNVLDAQIVDVKGQVLDRKAMGEDLFWAIRGGGGASFGVVLAYKLKLVQVPEIVTVFNV  264

Query  823   RRTYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKT  1002
             +RT  +NAT+I+  +Q ++ K+D  LFIR+   +V  +T   +K IR TF AL+LGDS +
Sbjct  265   QRTEAENATDILVQWQNVADKIDNGLFIRV---LVQPSTSESQKIIRLTFIALYLGDSDS  321

Query  1003  LLSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDY  1182
             L+S M+  FP LGL +SDC+E  WI+S+LF+++F  G   E LL+R   V   LKRKSDY
Sbjct  322   LMSVMNAGFPALGLQKSDCKEGSWIQSMLFWSNFDIGAKPELLLNRTSDV-NFLKRKSDY  380

Query  1183  LQTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNW  1362
             +QTP+P++ +  IF KMV+L  P L FNPYGGRM+EIP+   PFPHR+G I  IQY+ NW
Sbjct  381   VQTPIPKDALTSIFNKMVQLGKPGLVFNPYGGRMSEIPANETPFPHRAGIIYKIQYSVNW  440

Query  1363  DEHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTY  1542
             D+        YLE  R+LY + TP+VS NPR+AFLNYRDLD+G   N   + SY EG+ Y
Sbjct  441   DDASPNITNQYLEQARELYSFTTPYVSSNPRQAFLNYRDLDIGTTDNG--KNSYSEGEVY  498

Query  1543  GLKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFPGR  1653
             G KYFK+N++RLVK+KT VDP+NFF++EQSIPT P R
Sbjct  499   GRKYFKDNFDRLVKVKTVVDPENFFKNEQSIPTLPAR  535



>ref|XP_011040560.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=531

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/498 (58%), Positives = 368/498 (74%), Gaps = 3/498 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL + S PS+PIS  IYT  N SF SVL  YI N RF    T KPL IVTA H SH+Q
Sbjct  33    LQCLPNNSLPSYPISEAIYTTANPSFESVLLTYINNRRFLTPTTPKPLAIVTALHESHVQ  92

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++CAK HGLQ++ RSGGHDYEG+SYVS+VPF ILDMFN RS+++ +  ETAWV+AGAT
Sbjct  93    ATVVCAKSHGLQVRIRSGGHDYEGLSYVSEVPFIILDMFNLRSIDIDLASETAWVQAGAT  152

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY IANKSNVH FPAGVCPT+G GGH  G GYG +MRKYGL+VDN+IDAK++DV G
Sbjct  153   LGEIYYNIANKSNVHAFPAGVCPTIGAGGHISGGGYGTLMRKYGLSVDNVIDAKVVDVKG  212

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              +LDR++MGE+LFWAI GGG +SF V+LS++INLVRVP KVT+F V RT ++ AT+I Y 
Sbjct  213   NILDRQTMGEDLFWAIRGGGGASFGVILSWKINLVRVPAKVTVFKVDRTLEEGATDIFYQ  272

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q++S +LD  LFIR    V N +   G KTIR +F  LFLG S TL+S M++ FP+LGL
Sbjct  273   WQQVSTELDKELFIRAMPQVANGSVE-GTKTIRISFYGLFLGQSGTLISMMNKRFPKLGL  331

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              QSDC EMRWIES LF+   P+GT ++ LL+R      + K KSDY+   +P+  +E I+
Sbjct  332   QQSDCIEMRWIESTLFWFDLPNGTSIDVLLNRPRGAQSYFKNKSDYVNHIVPKEALERIW  391

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             K M++ +   + +NP GGRM+EIP  A PFPHR+G +  +QY+ NW E G EA   Y+ +
Sbjct  392   KMMIKAEPMWMQWNPIGGRMSEIPDTATPFPHRAGYLFKLQYSINWSEEGTEATDRYISL  451

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
              R++++ M P+V+K PREAF NYRDLD+G   N   + ++ E K YGLKYFK N+ RLVK
Sbjct  452   IREMHDAMAPYVTKFPREAFQNYRDLDIG--SNPSNQTNFEEAKEYGLKYFKGNFLRLVK  509

Query  1585  IKTKVDPDNFFRDEQSIP  1638
             +K  VDPDNFF+ EQSIP
Sbjct  510   VKGMVDPDNFFKHEQSIP  527



>ref|XP_010499615.1| PREDICTED: reticuline oxidase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010499616.1| PREDICTED: reticuline oxidase-like protein isoform X2 [Camelina 
sativa]
Length=530

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/506 (58%), Positives = 372/506 (74%), Gaps = 7/506 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T  +CL   S+P HPISP +Y   NGS+SSVL+  IRNLRFN S T KP  I+ ATH +H
Sbjct  29    TFTQCLTSNSDPKHPISPAVYFAGNGSYSSVLEATIRNLRFNTSNTPKPFLIIAATHETH  88

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAWVE  492
             +QA++ C K H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV+V    +TAWV+
Sbjct  89    VQAAVTCGKRHNLQMKIRSGGHDYDGLSYVTYSGKPFFVLDMFNLRSVDVDTASKTAWVQ  148

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
              GA LGEVYY I  KS    +PAGVC TVGVGGH  G GYGNMMRKYGL VDN IDA+++
Sbjct  149   TGAILGEVYYYIWEKSKTLAYPAGVCLTVGVGGHISGGGYGNMMRKYGLAVDNTIDARMV  208

Query  673   -DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNAT  849
              DVNG++LDRK MGE+LFWAI GGG  S+ VVL+Y+INLV VP  VT+F + RT +QN T
Sbjct  209   VDVNGKILDRKLMGEDLFWAINGGGGGSYGVVLAYKINLVEVPENVTVFRISRTLEQNVT  268

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
              IV+ +Q+++ +L   L+IR  +DVVN T    +KT+RATF A+FLGD+ TLLS ++  F
Sbjct  269   EIVHRWQQVAPELPDELYIRTIIDVVNGTVS-SQKTVRATFIAMFLGDTTTLLSILNWRF  327

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNG  1209
             PELGL +SDC E  WI+S LF+ +   G+  + LL R+ Q + +LKRKSDY++ P+ R G
Sbjct  328   PELGLVRSDCTETSWIQSALFWINIQVGSSEKLLLQRI-QPVNYLKRKSDYVREPISRTG  386

Query  1210  IEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQ  1389
             +E I+KKM+EL+ P +TF+PYGG M  I S A PFP+R+GN+  IQYA NW E       
Sbjct  387   LESIWKKMIELEIPTMTFSPYGGAMWRISSTATPFPYRAGNLWKIQYAANWRED--RLTD  444

Query  1390  HYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENY  1569
              Y+E+TR+LY +MTPFVSKNPR++F NYRD+DLGIN + G+  SY EGK YG KYF  N+
Sbjct  445   RYIELTRELYRFMTPFVSKNPRQSFFNYRDVDLGINSHNGKINSYIEGKHYGKKYFARNF  504

Query  1570  NRLVKIKTKVDPDNFFRDEQSIPTFP  1647
              RLVKIKT+VD DNFFR+EQSIP  P
Sbjct  505   ERLVKIKTRVDSDNFFRNEQSIPVLP  530



>ref|XP_010460878.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=558

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/513 (57%), Positives = 375/513 (73%), Gaps = 8/513 (2%)
 Frame = +1

Query  115   APLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFI  294
             +PL   + T  +CL   S+  HPISP ++   NGS+SS+L+  IRNLRFN S T KP  I
Sbjct  36    SPLV-SSETFTQCLTLNSDHKHPISPALFFAGNGSYSSILEANIRNLRFNTSNTPKPFLI  94

Query  295   VTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSI  468
             + ATH SH+QA++ C K H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV V +
Sbjct  95    IAATHESHVQAAVTCGKHHNLQMKIRSGGHDYDGLSYVTHSGKPFFVLDMFNLRSVEVDV  154

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
               +TAWV+ GATLGEVYY I  KS    +PAGVCPTVGVGGH  G GYGNMMRKYGLT+D
Sbjct  155   ASKTAWVQTGATLGEVYYHIWEKSKTLAYPAGVCPTVGVGGHISGGGYGNMMRKYGLTID  214

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             N +DA+++DVNG +LDRK MGE+LFWAI GGG SS+ VVL+Y++NLV VP  V +F++ R
Sbjct  215   NTLDARMVDVNGNILDRKLMGEDLFWAINGGG-SSYGVVLAYKLNLVEVPQTVNVFNISR  273

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T +Q+AT IVY +Q+++ +L   LFIRL +DVVN T    +KT+RATF  +FLGD+ TLL
Sbjct  274   TQEQDATEIVYRWQQVAPELPDELFIRLFIDVVNGTVS-SQKTVRATFIGMFLGDTTTLL  332

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQ  1188
             S ++  FPELGL + DC E  W++SV F+T+   G+  + LL R  Q   +LKRKSDY++
Sbjct  333   SILNRRFPELGLVRPDCIETSWVQSVFFWTNIQVGSSEKVLLDR-NQTTNYLKRKSDYVR  391

Query  1189  TPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDE  1368
               + + G+E I KKM+EL+ P + FNPYGG MA I S A PFP+R+GN+  IQYA NW E
Sbjct  392   ERISKTGLESILKKMIELEIPTMAFNPYGGAMARISSTATPFPYRAGNLWKIQYAANWKE  451

Query  1369  HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGL  1548
             +       Y+E+TR+LY++MTPFVSKNPR++F NYRD+DLG N + G+ +SY EG  YG 
Sbjct  452   N--RLTDQYIELTRELYQFMTPFVSKNPRQSFYNYRDVDLGTNVHNGKTRSYVEGNRYGK  509

Query  1549  KYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             KYF  N+ RLVKIKT+VD  NFFR+EQSIP  P
Sbjct  510   KYFAGNFERLVKIKTRVDSANFFRNEQSIPVLP  542



>ref|XP_007159396.1| hypothetical protein PHAVU_002G234800g [Phaseolus vulgaris]
 gb|ESW31390.1| hypothetical protein PHAVU_002G234800g [Phaseolus vulgaris]
Length=531

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/502 (56%), Positives = 375/502 (75%), Gaps = 5/502 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
              +L+CL+  S+PSHPIS V Y PN  S+  +L  YIRNLRF    T+KPLFIV  TH+SH
Sbjct  25    AILQCLSLHSDPSHPISGVTYFPNTPSYIPILHSYIRNLRFTSPSTRKPLFIVAPTHISH  84

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQASI+C K   LQ++ RSGGHDY+G+SYVS  PF I+DMF  RSV V++EDET WV++G
Sbjct  85    IQASIICCKSFQLQIRIRSGGHDYDGLSYVSQSPFAIMDMFAMRSVEVNLEDETVWVDSG  144

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             +T+GE+Y+GIA +S VHGFPAGVC +VGVGGHF G GYGNMMRK+GL+VD+++DA ++D 
Sbjct  145   STIGELYHGIAERSKVHGFPAGVCHSVGVGGHFSGGGYGNMMRKFGLSVDHVLDAVIVDA  204

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GR+LDRK MGE+LFW I GGG +SF V++S+RI LV VP  VT+F V +T +Q AT++V
Sbjct  205   EGRVLDRKKMGEDLFWGIRGGGGASFGVIVSWRIKLVPVPEVVTVFRVLKTLEQGATDVV  264

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             + +Q ++  +  +LFIR+   V++     G+KTIRA FNALFLG+++ LL  M +SFPEL
Sbjct  265   HRWQYVADNIHDDLFIRV---VLSPVKRKGQKTIRAKFNALFLGNAQELLRVMSDSFPEL  321

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL   DC EM WI+SVLF+ +FP GT V+ LL R       LK+KSDY+Q P+ + G+E 
Sbjct  322   GLVGEDCIEMSWIDSVLFWDNFPVGTSVDVLLQRHDTPEKFLKKKSDYVQQPISKTGLEG  381

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             ++ KM+EL+ P+LT NPYGGRM EI     PFPHR+GN+  IQY+ NW E G + A  YL
Sbjct  382   VWNKMMELEKPVLTLNPYGGRMGEISEMEIPFPHRAGNLYKIQYSVNWKEEGEDVANRYL  441

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             ++ R LY+YMTP+VSK+PR ++LNYRD+D+G+N       +Y E + +G KYFK N++RL
Sbjct  442   DLIRMLYDYMTPYVSKSPRSSYLNYRDVDIGVNGPG--NATYAEARVWGEKYFKRNFDRL  499

Query  1579  VKIKTKVDPDNFFRDEQSIPTF  1644
             V++KT+VDP NFFR EQSIP+ 
Sbjct  500   VEVKTRVDPSNFFRYEQSIPSL  521



>ref|XP_011006008.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=535

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/505 (56%), Positives = 383/505 (76%), Gaps = 5/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+CL   +NP   IS ++Y+ +N +++SVL+ YIRN R+N S T KPL IVT T +SH
Sbjct  35    SFLQCLEKNTNPQDKISNLVYSQSNTAYTSVLRAYIRNARYNTSATPKPLVIVTPTQISH  94

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             ++A+++C K+ G Q+K RSGGHDY+G+SY+SD PFFILDMFN R + V I+DE+A V+AG
Sbjct  95    VEATVICTKKVGYQLKIRSGGHDYDGISYISDTPFFILDMFNLRFIEVDIKDESASVQAG  154

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY I   S VHGFPAGVCPTVGVGGH  G GYGNM+RKYGL+VDN++DA+++DV
Sbjct  155   ATLGELYYKIWESSKVHGFPAGVCPTVGVGGHLSGGGYGNMLRKYGLSVDNVLDAQIVDV  214

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NG+LLDRK+MGE+LFWAI GGG  SF V++SY+I LV VP  VT+F V RT DQNAT++V
Sbjct  215   NGKLLDRKAMGEDLFWAIRGGGGGSFGVIISYKIKLVSVPETVTVFRVERTLDQNATDVV  274

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++  +  +LF+R+ +  V   T  G++TIRA+   L+LGDS +L++ + + FPEL
Sbjct  275   YKWQLVAPTISKDLFMRMLLQSV---TRKGKQTIRASIVTLYLGDSDSLVALLGKEFPEL  331

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL + +C E  WI+SVL++ +F  GT  + LL R P     LKRKSDY+Q P+P++G+E+
Sbjct  332   GLKKENCNETSWIQSVLWWANFDLGTSPDVLLDRNPNDANFLKRKSDYVQKPIPKDGLEW  391

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             ++KKM+++    L FNPYGGRM+EIP++A PFPHR+GN+  IQY+ NW E G EA + ++
Sbjct  392   LWKKMIDIGKTGLVFNPYGGRMSEIPASATPFPHRAGNLYKIQYSVNWKEAGKEADKKFM  451

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
                R+L+ YMT FVSKNPR AFLNYRDLD+G+      + S+ +G  YG KYF +N++RL
Sbjct  452   TQIRRLHSYMTSFVSKNPRSAFLNYRDLDIGVMVPD--KDSFEQGSVYGYKYFNDNFDRL  509

Query  1579  VKIKTKVDPDNFFRDEQSIPTFPGR  1653
             VK+KT VDP+NFFR+EQSIPT P +
Sbjct  510   VKVKTAVDPENFFRNEQSIPTLPRK  534



>ref|XP_011085609.1| PREDICTED: reticuline oxidase-like protein [Sesamum indicum]
Length=532

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/509 (58%), Positives = 376/509 (74%), Gaps = 8/509 (2%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+C      P   IS ++Y+PNN SF++VL  YIRN RFN S T KP  I+T T  SH
Sbjct  28    SFLQCFAQNKIPRDQISRILYSPNNPSFTTVLVSYIRNRRFNVSTTPKPSTIITPTVESH  87

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +  S+LC+K+ G+Q+K RSGGHDYEG+SYVSD  F ILDMFNFRS+NVS+ED+TAWV++G
Sbjct  88    VTVSVLCSKQLGVQIKIRSGGHDYEGISYVSDKDFVILDMFNFRSINVSLEDQTAWVQSG  147

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             A LGE+YY I  KSNV GFPAGVCPTVGVGGH  G GYGNM+RKYGLTVD++IDA+++D 
Sbjct  148   ALLGELYYRIWEKSNVLGFPAGVCPTVGVGGHISGGGYGNMLRKYGLTVDHVIDARIVDA  207

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GR+LDRKSMGE+LFWAI GGG +SF V+L+Y+I LV VPP VT+F V R Y++NA   V
Sbjct  208   KGRVLDRKSMGEDLFWAIRGGGGASFGVILAYKIKLVPVPPIVTVFRVERNYNENAVEAV  267

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
               YQ++  K+D +LFIR+ +  + + +    +++RATF  LFLG++  LL   D  FPEL
Sbjct  268   SKYQQVIDKIDNDLFIRVLLQPITVNS---TRSVRATFIGLFLGNADRLLPITDSQFPEL  324

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL + DC EM WI SVL++ +F + T    LL+R P  +  LKRKSDY++TP+ + G+E 
Sbjct  325   GLKKPDCTEMPWINSVLYWANFDNTTSPSVLLNRTPDSVNFLKRKSDYVKTPIAKEGLES  384

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             +F KMVE+    L FN YGG M++IP +A PFPHR+GNI  IQY+ NW E G  A ++Y+
Sbjct  385   LFNKMVEIGKVGLVFNSYGGIMSQIPESATPFPHRAGNIYKIQYSVNWKEEGEAADKNYI  444

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFK-ENYNR  1575
             +  R+LY +MTPFVSK PREA+LNYRDLD+G + N   + SY +GK YGLKYFK  N++R
Sbjct  445   KQIRELYSFMTPFVSKQPREAYLNYRDLDIGTSDNS--KNSYEQGKVYGLKYFKPNNFDR  502

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFP--GRK  1656
             LVKIKT VDPDN FR+EQSIP  P  GRK
Sbjct  503   LVKIKTIVDPDNVFRNEQSIPVLPVGGRK  531



>ref|XP_004504726.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=544

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/502 (57%), Positives = 376/502 (75%), Gaps = 5/502 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T+L+CL+  S PSHPIS V Y PN  S+S +LQ YIRNLRFN S T KPLFIV  TH+SH
Sbjct  39    TLLQCLSLYSEPSHPISEVTYFPNTPSYSPILQSYIRNLRFNSSTTPKPLFIVVPTHVSH  98

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQ+SILC K+  L+++ RSGGHDY+G+SYVS  PF +LD+F  RS+  +++DET WVE+G
Sbjct  99    IQSSILCCKKFDLEIRIRSGGHDYDGLSYVSQNPFIVLDIFLLRSIVFNLKDETLWVESG  158

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             AT+GE+YY IA KS VHGFPAGVCPTVGVGGHF G GYGNMMRK+GL++DN+IDAK++DV
Sbjct  159   ATVGELYYRIAEKSKVHGFPAGVCPTVGVGGHFSGGGYGNMMRKFGLSIDNVIDAKIVDV  218

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             +GR+LDR SMGE+LFWAI GGG +SF V++S++I+LV VP  VT+F V +T +Q A+++V
Sbjct  219   DGRVLDRNSMGEDLFWAIRGGGGASFGVIVSWKISLVPVPEIVTVFRVEKTLEQGASDVV  278

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             + +Q ++ K+   LFIR+   V++     GEKTI+A FNALFLGD+  LL  M E FPEL
Sbjct  279   HQWQYVADKIHDGLFIRV---VISPAKRNGEKTIKAKFNALFLGDANELLDVMTERFPEL  335

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL    C EM WI+SVLF+ ++P GT  + LL R       LKRKSDY+Q P+ + G++ 
Sbjct  336   GLVGEQCIEMSWIDSVLFWYNYPVGTLTDVLLERHSSQEKFLKRKSDYVQGPISKIGLDG  395

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+KKMVEL    LTFNPYGG+M+EI     PFPHR+GNI  IQY+ +W E   + A  YL
Sbjct  396   IWKKMVELGKVSLTFNPYGGKMSEISEEETPFPHRAGNIYKIQYSVSWKEESNDVADQYL  455

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             +  R+LY+YMTP+VS +PR ++LNYRD+D+G+  N G   SY E   +G KYFK N++RL
Sbjct  456   DKIRKLYDYMTPYVSNSPRSSYLNYRDVDIGV--NGGGNVSYEEASIWGNKYFKRNFDRL  513

Query  1579  VKIKTKVDPDNFFRDEQSIPTF  1644
             V++K+ +DP NFFR EQSIP+ 
Sbjct  514   VEVKSAIDPSNFFRYEQSIPSL  535



>ref|XP_002317074.2| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|EEE97686.2| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=531

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/498 (58%), Positives = 366/498 (73%), Gaps = 3/498 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL   S PS+PIS  IYT  N SF SVL  YI N RF    T KPL IVTA H SH+Q
Sbjct  33    LKCLPSNSLPSYPISEAIYTTANPSFESVLLTYINNRRFLTPTTPKPLAIVTALHESHVQ  92

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++CAK HGLQ++ RSGGHDYEG+SYVS+VPF ILDMFN RS+++ +  ETAWV+AGAT
Sbjct  93    ATVVCAKSHGLQVRIRSGGHDYEGLSYVSEVPFVILDMFNLRSIDIDLASETAWVQAGAT  152

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY IANKSNVH FPAGVCPT+G GGH  G GYG +MRKYGL+VDN+IDAK++DV G
Sbjct  153   LGEIYYNIANKSNVHAFPAGVCPTIGAGGHISGGGYGTLMRKYGLSVDNVIDAKVVDVKG  212

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              +LDR++MGE+LFWAI GGG +SF V+LS++INLVRVP KVT+F V RT ++ AT+I Y 
Sbjct  213   NILDRQTMGEDLFWAIRGGGGASFGVILSWKINLVRVPAKVTVFKVDRTLEEGATDIFYQ  272

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q++S +LD  LFIR    V N +   G KTIR +F  LFLG S TL+S M++ FPELGL
Sbjct  273   WQQVSTELDKELFIRAMPQVANGSVE-GTKTIRISFYGLFLGQSGTLISMMNKRFPELGL  331

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              QSDC EMRWIES LF+   P+GT ++ LL+R        K KSDY+   +P+  +E I+
Sbjct  332   QQSDCIEMRWIESTLFWFDLPNGTSIDVLLNRPRGAQSFYKNKSDYVNHIVPKEALERIW  391

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             K M++ +   + +NP GGRM+EIP  A PFPHR+G +  +QY+ NW E G EA   Y+ +
Sbjct  392   KMMIKAEPMWMQWNPIGGRMSEIPDTATPFPHRAGYLFKLQYSINWREEGTEATDRYISL  451

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
              R++++ M P+V+K PREAF NYRDLD+G   +   + ++ E K YGLKYFK N+ RLVK
Sbjct  452   IREMHDAMAPYVTKFPREAFQNYRDLDIG--SSPSNQTNFEEAKEYGLKYFKGNFLRLVK  509

Query  1585  IKTKVDPDNFFRDEQSIP  1638
             +K  VDPDNFF+ EQSIP
Sbjct  510   VKGMVDPDNFFKHEQSIP  527



>ref|XP_007212419.1| hypothetical protein PRUPE_ppa016588mg, partial [Prunus persica]
 gb|EMJ13618.1| hypothetical protein PRUPE_ppa016588mg, partial [Prunus persica]
Length=509

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/507 (55%), Positives = 374/507 (74%), Gaps = 14/507 (3%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL+  S  S+PIS  IYT  + SFSSVLQ Y+RNLRF    T KPL IV A H SH+ 
Sbjct  13    LQCLSKHSQRSNPISEAIYTSKSASFSSVLQSYVRNLRFISPTTPKPLLIVAAKHESHVP  72

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVS--DVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             A+++CAK  GL+++ RSGGHDYEGVSYVS     F +LDMFN RS+N+ + DE+AWV++G
Sbjct  73    ATVICAKSLGLEIRIRSGGHDYEGVSYVSRNTKDFIVLDMFNLRSINIDMADESAWVQSG  132

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             A LGE++Y I+ KS  H FPAGVCP++G GGHF G GYGNMMRKYGL+ DNI+DAK+++V
Sbjct  133   AILGEIFYAISMKSKNHAFPAGVCPSIGAGGHFTGGGYGNMMRKYGLSTDNIVDAKIVNV  192

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NG++LDRK+MGE+LFWAI GGG SSF V+L+++I  VRVP  VT+F V+RT    AT I+
Sbjct  193   NGKILDRKAMGEDLFWAIRGGGGSSFGVILAWKIKFVRVPATVTVFEVKRTLALGATEIL  252

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
               +Q+++ KLD +LFIR  +        P   TI  +F +LFLG+S+ LL  M +SFP+L
Sbjct  253   VKWQQVADKLDHDLFIRAII-------KPANGTIEVSFMSLFLGNSERLLKLMSQSFPQL  305

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEE-LLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             GL ++DC EM WI+SVL++T++ +GT   E LL+RVP+  V LKRKSDY++ P+ +  +E
Sbjct  306   GLQKTDCHEMSWIQSVLYWTNYQNGTTSPEVLLNRVPKGQVFLKRKSDYVKQPISKTDLE  365

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              ++K M+E+    + +NPYGG+M+EIP  A PFPHR+GN+  IQY+ NW E G+E+ + Y
Sbjct  366   ALWKVMIEIGEVTMLWNPYGGKMSEIPETATPFPHRAGNLFKIQYSVNWKEEGFESTKRY  425

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L + ++LY  MTP+VSKNPR AF NYRDLD+G N   G    Y E K YG KYFK N+ R
Sbjct  426   LSLMKKLYVAMTPYVSKNPRMAFYNYRDLDIGTNSKGG----YDEAKVYGTKYFKGNFER  481

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             LV+IKT+VDP+NFFR+EQSIPT P ++
Sbjct  482   LVRIKTEVDPENFFRNEQSIPTLPSKQ  508



>ref|XP_010478504.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=563

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/505 (58%), Positives = 370/505 (73%), Gaps = 6/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T  +CL   S+P HPISP ++   NGS+SSVL+  IRNLRFN S T KP  I+ ATH +H
Sbjct  63    TFTQCLTSNSDPKHPISPAVFFAGNGSYSSVLEATIRNLRFNTSNTPKPFLIIAATHETH  122

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAWVE  492
             +QA++ C K H LQMK RSGGHDY+G+SYV  S  PFFILDMFN RSV+V    +TAWV+
Sbjct  123   VQAAVTCGKRHNLQMKIRSGGHDYDGLSYVTYSGKPFFILDMFNLRSVDVDTASKTAWVQ  182

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
              GA LGEVYY I  KS    +PAGVC TVGVGGH  G GYGNMMRKYGL VDN IDA+++
Sbjct  183   TGAILGEVYYYIWEKSKTLAYPAGVCLTVGVGGHVSGGGYGNMMRKYGLAVDNTIDARMV  242

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             DVNG++LDRK MGE+LFWAI GGG  S+ VVL+Y+INLV VP  VT+F + RT +QNAT 
Sbjct  243   DVNGKILDRKLMGEDLFWAINGGGGGSYGVVLAYKINLVEVPENVTVFRISRTLEQNATE  302

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             IV+ +Q ++ +L   L+IR  +DVVN T    +KT+RATF A+FLGD+ TLLS ++  FP
Sbjct  303   IVHRWQHVAPELPDELYIRTIIDVVNGTVS-SQKTVRATFIAMFLGDTTTLLSILNRRFP  361

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL +SDC E  WI+S LF+ +    +  + LL R+ Q + +LKRKSDY++ P+ R G+
Sbjct  362   ELGLVRSDCTETSWIQSALFWINIQVDSSEKVLLQRI-QPVNYLKRKSDYVREPISRTGL  420

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E I+KKM+EL+ P +TF+PYGG M  I S A PFP+R+GN+  IQYA NW E        
Sbjct  421   ESIWKKMIELEIPTMTFSPYGGAMWRISSTATPFPYRAGNLWKIQYAANWRED--RLTDR  478

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             Y+E+TR+LY +MTPFVSKNPR++F NYRD+DLGIN + G+  SY EGK YG KYF  N+ 
Sbjct  479   YMELTRELYRFMTPFVSKNPRQSFFNYRDVDLGINSHNGKINSYIEGKRYGKKYFAGNFE  538

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLVKIKT+VD  NFFR+EQSIP  P
Sbjct  539   RLVKIKTRVDSGNFFRNEQSIPVLP  563



>ref|XP_002300550.2| hypothetical protein POPTR_0001s46390g [Populus trichocarpa]
 gb|EEE85355.2| hypothetical protein POPTR_0001s46390g [Populus trichocarpa]
Length=532

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/498 (57%), Positives = 374/498 (75%), Gaps = 5/498 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL   S+PSHPIS  IY+  N SF S+LQ  I+N RF    T KPL I+ A H SH+Q
Sbjct  32    LQCLPSHSHPSHPISQAIYSNTNPSFESILQALIKNRRFLTPATPKPLAIIAAVHESHVQ  91

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++CAK +GLQ++ RSGGHDYEG+SYVS VPF ILDMFN RS+++ I  ETAWV++GAT
Sbjct  92    ATVICAKSNGLQIRIRSGGHDYEGLSYVSAVPFVILDMFNLRSIDIDIASETAWVQSGAT  151

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY IA+KSN+HGFPAGVCPTVG+GGHF G G+G MMRKYGL+VDNIIDA+L+DVNG
Sbjct  152   LGELYYNIASKSNIHGFPAGVCPTVGIGGHFSGGGFGTMMRKYGLSVDNIIDAQLVDVNG  211

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              +L+RK+MGE+LFWAI GGGA SF V+LS++I+LV+VPP VT F V RT ++ AT++ Y 
Sbjct  212   NILNRKTMGEDLFWAIRGGGA-SFGVILSWKISLVQVPPTVTAFRVARTLEEGATDVFYK  270

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ K+D +LFIR    VV  ++  G K I  +F  LFLG S  LLS + +SFPELGL
Sbjct  271   WQLVASKIDKDLFIRAMSQVVKGSSG-GSKRISISFIGLFLGQSGALLSLLSKSFPELGL  329

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              Q DC+EMRWIESV+F+ + P+ T    LL+R P      K+KSD+++  +P+N +E I+
Sbjct  330   QQKDCKEMRWIESVVFWANLPNATSTGVLLNR-PNQASFFKKKSDFVKYVIPKNALESIW  388

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             K M++++   + +NPYGGRM EI + A PFPHR+GN+  I+Y+T W E G EA  H+  +
Sbjct  389   KVMIKVEPIWMQWNPYGGRMDEISATATPFPHRAGNLFKIEYSTTWIEEGIEATNHHTSL  448

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
              RQL++ M P+VSK PREAFLNYRDLD+G   N   +  + E K YG KYFK+N+ RLV 
Sbjct  449   LRQLHDAMAPYVSKYPREAFLNYRDLDIG--SNPSNQTIFEEAKVYGSKYFKDNFLRLVT  506

Query  1585  IKTKVDPDNFFRDEQSIP  1638
             +K++VDPDNFF++EQSIP
Sbjct  507   VKSRVDPDNFFKNEQSIP  524



>ref|XP_010435245.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=527

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/508 (57%), Positives = 371/508 (73%), Gaps = 7/508 (1%)
 Frame = +1

Query  133   ATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             + T  +CL   S+P+HPISP ++   N S+SSVL+  IRNLRFN S T KP  I+ ATH 
Sbjct  24    SETFTQCLTSNSDPTHPISPAVFFAGNRSYSSVLEANIRNLRFNTSDTPKPFLIIAATHE  83

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAW  486
             SH+QA++ C + H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV+V +  +TAW
Sbjct  84    SHVQAAVTCGQRHSLQMKIRSGGHDYDGLSYVTYSGEPFFVLDMFNLRSVDVDVASKTAW  143

Query  487   VEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAK  666
             V+ GA LGEVYY I  KSN   +PAG+CPTVGVGGH  G GY NMMRK+GLTVDN IDA+
Sbjct  144   VQTGAVLGEVYYHIWEKSNTLAYPAGICPTVGVGGHISGGGYSNMMRKHGLTVDNTIDAR  203

Query  667   LIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNA  846
             ++DVNG  LDRK MGE+ FWAI GGG  S+ VVL+Y+I+LV VP  VT+FS+ RT +QNA
Sbjct  204   MVDVNGNFLDRKLMGEDHFWAINGGGG-SYGVVLAYKISLVEVPENVTVFSISRTLEQNA  262

Query  847   TNIVYCYQRMSHKLDPNLFIRLTVDVVNITTH-PGEKTIRATFNALFLGDSKTLLSTMDE  1023
             T IV+ +Q ++ +L   LF+R  ++VV +       KTIRATF A+FLGD+ TLLS ++ 
Sbjct  263   TEIVHRWQHVAPELPDELFLRTIIEVVFVNGPVSTRKTIRATFKAMFLGDTTTLLSILNR  322

Query  1024  SFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPR  1203
              FPELGL +SDC E  WI+SVLF+     G+  E+LL +  Q + +LKRKSDY++ P+ R
Sbjct  323   RFPELGLIRSDCTETSWIQSVLFWADMQVGSS-EKLLLQRDQTVTYLKRKSDYVREPISR  381

Query  1204  NGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEA  1383
              G+E I++KM+EL+ P +TF PYGG M +IPS A PFPHR+GN+  IQY ++W+E     
Sbjct  382   TGLESIWRKMIELEIPTMTFTPYGGVMDKIPSTATPFPHRAGNLWKIQYGSDWNEG--RL  439

Query  1384  AQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKE  1563
                Y+++TR+LY++MT FVSKNPR+ F NYRDLDLGIN + G+  SY EGK YG  YF  
Sbjct  440   TNRYMDLTRELYQFMTLFVSKNPRQTFPNYRDLDLGINSHSGKIMSYVEGKRYGTNYFGG  499

Query  1564  NYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             N+ RLVKIKT+VD  NFFR+EQSIP  P
Sbjct  500   NFERLVKIKTRVDSGNFFRNEQSIPVLP  527



>ref|XP_004293693.1| PREDICTED: reticuline oxidase-like protein-like [Fragaria vesca 
subsp. vesca]
Length=516

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/509 (56%), Positives = 381/509 (75%), Gaps = 6/509 (1%)
 Frame = +1

Query  115   APLCYCATTVLECLNDRS-NPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLF  291
             A L     T L+CL++ + +PS  IS V Y P + S++ +L  YIRNLRF    T  P F
Sbjct  2     AALDSIQDTFLQCLSNLTQSPSPSISSVTYFPTDPSYTPILHSYIRNLRFTTPKTPTPSF  61

Query  292   IVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIE  471
             IVT TH+SHIQASILC+K H LQ++ RSGGHDY+G+SY+SDVPF I+DMFN RS+ V+IE
Sbjct  62    IVTPTHVSHIQASILCSKIHNLQVRIRSGGHDYDGLSYISDVPFIIIDMFNLRSITVNIE  121

Query  472   DETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDN  651
             +E+AWVE+GATLGEVYY IA +S +HG+PAGVCPTVGVGGH  G GYGNMMRK+GL+VDN
Sbjct  122   EESAWVESGATLGEVYYRIAEQSKIHGYPAGVCPTVGVGGHLSGGGYGNMMRKHGLSVDN  181

Query  652   IIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRT  831
             I+DA+++DVNGRLLDR+SMGE+LFWAI GGG +SF V++S++I LV+VP  VT+F V RT
Sbjct  182   ILDAQIVDVNGRLLDRESMGEDLFWAIRGGGGASFGVIVSWKIKLVQVPEVVTVFRVERT  241

Query  832   YDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLS  1011
              +Q AT+IV+ +Q + + +D +LFIR+ V  VN  T   ++T++A F AL+LG+++ L +
Sbjct  242   LEQGATDIVHQWQHVGNTIDDDLFIRVVVMPVNRKT---QRTVKAKFVALYLGNAEKLEA  298

Query  1012  TMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQT  1191
              M E FP LGL   D  E+ WIESVL+++++P GT  + LL R+PQ    LK+KSDY+Q 
Sbjct  299   LMGERFPRLGLKHEDYVEIGWIESVLYWSNYPIGTSADVLLERIPQSEKFLKKKSDYIQE  358

Query  1192  PMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEH  1371
             PM +  +E ++ KM EL+ P+LTFNPYGG+M++I     PFPHR+GN+  IQY+ NW E 
Sbjct  359   PMSKASLEGLWNKMRELKKPVLTFNPYGGKMSKISELDTPFPHRAGNVYKIQYSVNWKEE  418

Query  1372  GYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLK  1551
             G EA   +L++ R+LY+YM P+VSK+PR ++LNYRD+DLG N N     SY E   +G  
Sbjct  419   GSEAEDKHLDLIRRLYKYMAPYVSKSPRCSYLNYRDVDLGTNGNGN--VSYSEASVWGTN  476

Query  1552  YFKENYNRLVKIKTKVDPDNFFRDEQSIP  1638
             YFK N+ RLV++KT VDP NFFR EQSIP
Sbjct  477   YFKGNFERLVQVKTAVDPGNFFRYEQSIP  505



>gb|KFK44874.1| hypothetical protein AALP_AA1G313900 [Arabis alpina]
Length=530

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/505 (58%), Positives = 369/505 (73%), Gaps = 6/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T  +CL   S+P HPIS  I+   N S+SSVL+ YIRNLRFN S T KP  I+ ATH SH
Sbjct  30    TFTQCLTTNSDPKHPISSAIFFAGNRSYSSVLEAYIRNLRFNTSTTAKPFLIIAATHESH  89

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAWVE  492
             +QA+++C + H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN R+V+V +  +TAWV+
Sbjct  90    VQAAVICGRRHNLQMKTRSGGHDYDGLSYVTYSGKPFFVLDMFNLRTVDVDVASKTAWVQ  149

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
              GA LGEVYY I  KS    +PAG+CPTVGVGGH  G GYGN+MRKYGLTVDN IDAK++
Sbjct  150   TGAILGEVYYYIWEKSKTLAYPAGICPTVGVGGHVSGGGYGNIMRKYGLTVDNTIDAKMV  209

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             DVNG++LDRKSMGE+L+WAI GGG  S+ VVLSY+I LV VP  VT+F V RT +QNAT 
Sbjct  210   DVNGKILDRKSMGEDLYWAINGGGGGSYGVVLSYKIKLVEVPQNVTVFRVTRTLEQNATE  269

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             IV+ +Q ++ +L   LFIR  + V N T     KT+RA+F  +FLGD+ TLLS +++  P
Sbjct  270   IVHRWQTVAPELPDELFIRTVLSVQNGTVS-STKTVRASFVGMFLGDTTTLLSILNQRLP  328

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL +SD  E  WI+SVLF+T+   G+  E+LL +  Q + +LKRKSDY++ P+ R G+
Sbjct  329   ELGLVRSDITETSWIQSVLFWTNIQVGSS-EKLLLQRNQTVNYLKRKSDYVRKPISRTGL  387

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E I+KKM+EL+ P + FNPYGG MA I S   PFP+R GN+  IQY  NW E        
Sbjct  388   ESIWKKMIELEIPTMAFNPYGGAMARISSTVTPFPYRKGNLWKIQYGANWGED--RLTNR  445

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             YLE+TR+LY +MTPFVSKNPR++F NYRD+DLGIN ++ + KSY +GK YG KYF  N+ 
Sbjct  446   YLELTRELYRFMTPFVSKNPRQSFFNYRDVDLGINSHESKMKSYVDGKRYGKKYFAGNFE  505

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLVKIKT+VD  NFFR+EQSIP  P
Sbjct  506   RLVKIKTRVDSGNFFRNEQSIPVLP  530



>ref|XP_002523158.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39189.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=539

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/506 (57%), Positives = 373/506 (74%), Gaps = 5/506 (1%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             ++ LECL + + P   IS ++YT  N S++SVL+ YIRN R N + T KP  IVT   +S
Sbjct  38    SSFLECLQNNTTPQDQISSLVYTKTNASYTSVLRAYIRNARMNTTATPKPTIIVTPKQIS  97

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+QA+++CAK+ G Q+K RSGGHDYEG+SYVSDVPFF+LDMFN RSV V +++E+AW++A
Sbjct  98    HVQAAVICAKKVGYQLKVRSGGHDYEGISYVSDVPFFVLDMFNLRSVQVDMKNESAWIQA  157

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGEVY+GI   S VHGFPAGVCPTVGVGGHF G GYGNM+RKYGL VDN++DA+++D
Sbjct  158   GATLGEVYHGIWENSKVHGFPAGVCPTVGVGGHFSGGGYGNMLRKYGLAVDNVLDAQIVD  217

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNG+L+DRK+MGE+LFWAI GGG  SF VV+SY+I LV VP  VT+F   R  ++NAT+I
Sbjct  218   VNGKLMDRKAMGEDLFWAIRGGGGGSFGVVISYKIKLVPVPETVTVFRAERLIEENATDI  277

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
              Y +Q ++ K D  LF+RL +  V   T   ++T+R T  +L+LG + +L++ + + FPE
Sbjct  278   AYKWQLVAPKTDNGLFMRLLIQPV---TRNKQQTLRVTIMSLYLGKADSLVALLGKEFPE  334

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL + +C EM WI+SVL++ +F +GT  + LL R       LKRKSDY+Q P+PRN + 
Sbjct  335   LGLKKENCTEMNWIQSVLWWANFDNGTSPDVLLDRHVDSANFLKRKSDYVQKPIPRNALT  394

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              IFK+MVEL    L FNPYGGRM EIPS   PFPHR+GN+  +QY+ NW+E G +   +Y
Sbjct  395   LIFKRMVELGKIGLVFNPYGGRMDEIPSTEVPFPHRAGNLFKMQYSINWNEPGSDLQSNY  454

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L   R LY YMTPFVSKNPR AFLNYRDLD+G+      + SY EG  YG KYF  N++R
Sbjct  455   LSQARNLYSYMTPFVSKNPRSAFLNYRDLDIGV--MTPSKNSYEEGSIYGHKYFNGNFDR  512

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFPGR  1653
             LVK+KT VDP+NFFR+EQSIPT   +
Sbjct  513   LVKVKTAVDPENFFRNEQSIPTLSSK  538



>ref|XP_009362186.1| PREDICTED: reticuline oxidase-like protein isoform X2 [Pyrus 
x bretschneideri]
Length=539

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/503 (57%), Positives = 382/503 (76%), Gaps = 6/503 (1%)
 Frame = +1

Query  139   TVLECLNDRS-NPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T L+CL++ S + S PIS V Y P N S++S+L  YIRNLRF +  T KPLFIV  T+ S
Sbjct  33    TFLQCLSNFSQDSSPPISAVTYFPTNPSYTSILHSYIRNLRFTDPQTSKPLFIVAPTNFS  92

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             HIQASI C+K H LQ++ RSGGHDY+G+SYVS++PF I+DMF+ RS+++ IEDE+AWVE+
Sbjct  93    HIQASIFCSKIHALQVRIRSGGHDYDGLSYVSELPFIIIDMFSLRSISIDIEDESAWVES  152

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGEVYY +A +S +HGFPAGVCPTVGVGGH  G GYGNMMRKYGL+VDNIIDA ++D
Sbjct  153   GATLGEVYYRVAEQSKIHGFPAGVCPTVGVGGHLSGGGYGNMMRKYGLSVDNIIDALIVD  212

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNGR+LDR+SMGE+LFWAI GGG +SF V++S++I LV VP  VT+F V RT +Q AT+I
Sbjct  213   VNGRILDRQSMGEDLFWAIRGGGGASFGVIVSWKIKLVSVPEIVTVFRVERTLEQGATDI  272

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             V+ +Q ++ ++  +LFIR+ V  VN     G +T++A F ALFLG+++ L + MDES P+
Sbjct  273   VHRWQYVADRIHEDLFIRVVVMPVN---KKGHQTVKAKFVALFLGNAERLHALMDESLPQ  329

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL   D  EM WIESVL+++++  GTP + LL R  +    LK+KSDY+Q PM + G+E
Sbjct  330   LGLKDEDYSEMSWIESVLYWSNYAIGTPTDVLLERQEKSKKFLKKKSDYVQEPMSKAGLE  389

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              ++ KM+EL+ P+LTFNPYGG+M+EI     PFPHR+GN+  IQY+ NW E G EAA   
Sbjct  390   GLWNKMMELKKPVLTFNPYGGKMSEISELETPFPHRAGNVYKIQYSVNWKEEGVEAADRN  449

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             +++ R+LYE+MTP+VSK+PR ++LNYRD+DLG N N     SY E + +G KYF  N++R
Sbjct  450   IDLIRRLYEFMTPYVSKSPRCSYLNYRDVDLGTNGNG--NASYSEARVWGRKYFNGNFDR  507

Query  1576  LVKIKTKVDPDNFFRDEQSIPTF  1644
             LV++KT VDP NFF  EQSIP+ 
Sbjct  508   LVQVKTAVDPGNFFSYEQSIPSL  530



>ref|XP_004134553.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
 ref|XP_004162840.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
Length=531

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/502 (56%), Positives = 371/502 (74%), Gaps = 2/502 (0%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             +T L C    SN S  +S +++   N S++SVL+ YIRN RFN S   KP+ IVT    S
Sbjct  27    STFLHCFQSNSNSSAGVSSIVFARENASYTSVLRAYIRNARFNTSSAPKPVIIVTPLTES  86

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+Q++++C+K+ G+Q+K RSGGHDYEGVSY+SDV F ILDM N R+V V + D++AWV A
Sbjct  87    HVQSAVICSKKLGIQLKIRSGGHDYEGVSYISDVEFIILDMSNLRTVTVDVADQSAWVGA  146

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGEVYY I  KS V G+PAGVCPTVGVGGH  G GYGNM+RKYGL VD+++DA+++D
Sbjct  147   GATLGEVYYRIWEKSKVLGYPAGVCPTVGVGGHISGGGYGNMLRKYGLAVDHVLDARIVD  206

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             V GR+LD KSMGE+LFWAI GGG +SF VVL+Y+I LV VP  VTIF V RT +QNA ++
Sbjct  207   VKGRILDSKSMGEDLFWAIKGGGGASFGVVLAYKIRLVPVPETVTIFRVERTIEQNAADL  266

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             V  +Q ++   D NLF+RL +  V+     G +TIRA+  ALFLG S+ L+S + +  PE
Sbjct  267   VVRWQEVAPTTDENLFMRLLLQPVSSKIKKGTRTIRASVVALFLGKSEELVSLLKKELPE  326

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL + +C EM WI+SVL++ +F  GT  E LL R       L+RKSDY+Q P+ R+G+ 
Sbjct  327   LGLQKENCTEMSWIDSVLWWGNFDIGTSPEALLDRNVDSAGFLRRKSDYVQKPISRDGLN  386

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
             +++KKM+E+    L FNPYGG+M+EI S A PFPHR+GN+  IQY+ NW+E G EA Q +
Sbjct  387   WLYKKMIEIGKTGLVFNPYGGKMSEISSTATPFPHRAGNLYKIQYSVNWNEPGPEADQEF  446

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             ++  R+LY +MTPFVSKNPR++FLNYRDLD+GIN+N   + S+ +GK YG KYF EN+ R
Sbjct  447   VKQIRRLYSFMTPFVSKNPRQSFLNYRDLDIGINNND--KNSFEDGKVYGFKYFGENFER  504

Query  1576  LVKIKTKVDPDNFFRDEQSIPT  1641
             LVK+KT VDP+NFF +EQSIPT
Sbjct  505   LVKVKTAVDPENFFWNEQSIPT  526



>ref|XP_009362185.1| PREDICTED: reticuline oxidase-like protein isoform X1 [Pyrus 
x bretschneideri]
Length=551

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/503 (57%), Positives = 382/503 (76%), Gaps = 6/503 (1%)
 Frame = +1

Query  139   TVLECLNDRS-NPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T L+CL++ S + S PIS V Y P N S++S+L  YIRNLRF +  T KPLFIV  T+ S
Sbjct  45    TFLQCLSNFSQDSSPPISAVTYFPTNPSYTSILHSYIRNLRFTDPQTSKPLFIVAPTNFS  104

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             HIQASI C+K H LQ++ RSGGHDY+G+SYVS++PF I+DMF+ RS+++ IEDE+AWVE+
Sbjct  105   HIQASIFCSKIHALQVRIRSGGHDYDGLSYVSELPFIIIDMFSLRSISIDIEDESAWVES  164

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGEVYY +A +S +HGFPAGVCPTVGVGGH  G GYGNMMRKYGL+VDNIIDA ++D
Sbjct  165   GATLGEVYYRVAEQSKIHGFPAGVCPTVGVGGHLSGGGYGNMMRKYGLSVDNIIDALIVD  224

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNGR+LDR+SMGE+LFWAI GGG +SF V++S++I LV VP  VT+F V RT +Q AT+I
Sbjct  225   VNGRILDRQSMGEDLFWAIRGGGGASFGVIVSWKIKLVSVPEIVTVFRVERTLEQGATDI  284

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             V+ +Q ++ ++  +LFIR+ V  VN     G +T++A F ALFLG+++ L + MDES P+
Sbjct  285   VHRWQYVADRIHEDLFIRVVVMPVN---KKGHQTVKAKFVALFLGNAERLHALMDESLPQ  341

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL   D  EM WIESVL+++++  GTP + LL R  +    LK+KSDY+Q PM + G+E
Sbjct  342   LGLKDEDYSEMSWIESVLYWSNYAIGTPTDVLLERQEKSKKFLKKKSDYVQEPMSKAGLE  401

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              ++ KM+EL+ P+LTFNPYGG+M+EI     PFPHR+GN+  IQY+ NW E G EAA   
Sbjct  402   GLWNKMMELKKPVLTFNPYGGKMSEISELETPFPHRAGNVYKIQYSVNWKEEGVEAADRN  461

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             +++ R+LYE+MTP+VSK+PR ++LNYRD+DLG N N     SY E + +G KYF  N++R
Sbjct  462   IDLIRRLYEFMTPYVSKSPRCSYLNYRDVDLGTNGNGN--ASYSEARVWGRKYFNGNFDR  519

Query  1576  LVKIKTKVDPDNFFRDEQSIPTF  1644
             LV++KT VDP NFF  EQSIP+ 
Sbjct  520   LVQVKTAVDPGNFFSYEQSIPSL  542



>gb|KCW75709.1| hypothetical protein EUGRSUZ_D00086, partial [Eucalyptus grandis]
Length=514

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/504 (58%), Positives = 374/504 (74%), Gaps = 5/504 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL  R+ PS  IS ++Y+  N SF +VL  YIRN  FN   T KPL IVT T  SH
Sbjct  13    TFIQCLAHRTQPSDHISDIVYSQANSSFVNVLVSYIRNGHFNLLSTPKPLVIVTPTRESH  72

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA++LC+K+ G+ +K RSGGHD+EG+SYVS+  FFILDMFN RS++V I++ETAWV+AG
Sbjct  73    VQAAVLCSKDLGMHLKIRSGGHDFEGISYVSNDAFFILDMFNLRSIDVDIKEETAWVQAG  132

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY I  KS VHGFPAGVC TVGVGGH  GAGYGNM+RKYGL+VDN++DAK++DV
Sbjct  133   ATLGELYYRIWEKSKVHGFPAGVCATVGVGGHLSGAGYGNMLRKYGLSVDNVLDAKMVDV  192

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GR+LDRK+MGE+LFWAI GGG +SF V+L+Y+I LV VP KVT+F V +T DQNAT++V
Sbjct  193   QGRILDRKAMGEDLFWAIIGGGGASFGVILAYQIKLVPVPEKVTVFRVEKTLDQNATDLV  252

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++   D  LF+RL +  V   T  G KT+RA+   LFLG+S  LL+  +E  PE+
Sbjct  253   YKWQFVAPTTDHGLFMRLVLQPVTSKTQKGHKTLRASVVGLFLGNSDQLLALTEEELPEM  312

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGT--PVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             GL + +C EM WIESVL++  F  GT   +E LLSR        KRKSDY+QTP+ R  +
Sbjct  313   GLKKGNCTEMSWIESVLWWDGFDEGTIPALETLLSRDHSTNFR-KRKSDYVQTPISRANL  371

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             + ++KKM+EL    L FNPYGGRM+EIP++A PFPHR+GN+  IQY  NW +   E  ++
Sbjct  372   DCLWKKMIELGKVGLMFNPYGGRMSEIPASATPFPHRAGNLFKIQYFINWSKDDPELEKN  431

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             YL   R+LY +MTPFVSKNPR A+LNYRDLD+G + N     SY EG+ YG+KYF +N+ 
Sbjct  432   YLAQIRRLYSFMTPFVSKNPRGAYLNYRDLDIGTSTNG--NNSYEEGRVYGVKYFNDNFE  489

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTF  1644
             RLVK+KT VDP++FFR+EQSIPT 
Sbjct  490   RLVKVKTAVDPNDFFRNEQSIPTL  513



>ref|XP_008225664.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=584

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/516 (55%), Positives = 382/516 (74%), Gaps = 4/516 (1%)
 Frame = +1

Query  106   GAWAPLCYCATTVLECLNDRSNPSH--PISPVIYTPNNGSFSSVLQEYIRNLRFNESYTK  279
              +WA         ++CLN ++N S   P++ +++  NN S++SVL+ YIRN RFN++ T 
Sbjct  40    ASWAASGSVYDNFVQCLNTKANSSSSTPLANIVFAQNNPSYTSVLRAYIRNSRFNKTSTP  99

Query  280   KPLFIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVN  459
             KP+ I+T +  SH+QAS+LCAK+ G+Q+K RSGGHDYEGVSY SD  F +LDMFN RS+ 
Sbjct  100   KPVLIITPSAESHVQASVLCAKQLGIQLKIRSGGHDYEGVSYWSDQTFIVLDMFNLRSIA  159

Query  460   VSIEDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGL  639
             V I+D + W +AGATLGE+YY I  KS VHGFPAGVC TVGVGGH  G GYGNM+RKYGL
Sbjct  160   VDIKDGSVWAQAGATLGEMYYRIWEKSKVHGFPAGVCETVGVGGHISGGGYGNMLRKYGL  219

Query  640   TVDNIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFS  819
              VDN+IDA+++DV GRLLDRKSMGE+LFWAI GGG  SF V++SY++ LV VP  VT+F 
Sbjct  220   AVDNVIDAQIVDVQGRLLDRKSMGEDLFWAIKGGGGGSFGVIISYKLKLVSVPEIVTVFR  279

Query  820   VRRTYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSK  999
             V RT ++NAT +V  +Q ++   D  LF+R+ +  V      GEKT+R +  A FLG++ 
Sbjct  280   VERTLEENATAVVLKWQEVAPTTDDGLFMRMLLQPVTSKVKKGEKTVRISILAEFLGNAD  339

Query  1000  TLLSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSD  1179
              L+  + + FPELGL + +C EM WI+SVL++ +F +GT  E LL+R P     LKRKSD
Sbjct  340   QLVLLLGKEFPELGLKKENCMEMSWIDSVLWWANFDNGTKPEALLNRNPNDANFLKRKSD  399

Query  1180  YLQTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATN  1359
             Y+QTP+ ++G+E+++KKM+EL    L FNPYGG+M++I ++  PFPHR+GN+  IQY+ N
Sbjct  400   YVQTPISKDGLEWLWKKMIELGKTGLVFNPYGGKMSQILASETPFPHRAGNLFKIQYSVN  459

Query  1360  WDEHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKT  1539
             W++ G ++ ++YL  +R+LY YMTPFVSKNPR AFLNYRDLD+GIN       SY EGK 
Sbjct  460   WEDAGEDSEKNYLTQSRRLYSYMTPFVSKNPRSAFLNYRDLDIGINTFGD--NSYEEGKV  517

Query  1540  YGLKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             YGLKYF +N++RL+K+KT VDP+NFFR+EQSIPT P
Sbjct  518   YGLKYFNDNFDRLLKVKTAVDPENFFRNEQSIPTLP  553



>ref|XP_010054199.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
Length=530

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/504 (58%), Positives = 374/504 (74%), Gaps = 5/504 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL  R+ PS  IS ++Y+  N SF +VL  YIRN  FN   T KPL IVT T  SH
Sbjct  29    TFIQCLAHRTQPSDHISDIVYSQANSSFVNVLVSYIRNGHFNLLSTPKPLVIVTPTRESH  88

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA++LC+K+ G+ +K RSGGHD+EG+SYVS+  FFILDMFN RS++V I++ETAWV+AG
Sbjct  89    VQAAVLCSKDLGMHLKIRSGGHDFEGISYVSNDAFFILDMFNLRSIDVDIKEETAWVQAG  148

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY I  KS VHGFPAGVC TVGVGGH  GAGYGNM+RKYGL+VDN++DAK++DV
Sbjct  149   ATLGELYYRIWEKSKVHGFPAGVCATVGVGGHLSGAGYGNMLRKYGLSVDNVLDAKMVDV  208

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GR+LDRK+MGE+LFWAI GGG +SF V+L+Y+I LV VP KVT+F V +T DQNAT++V
Sbjct  209   QGRILDRKAMGEDLFWAIIGGGGASFGVILAYQIKLVPVPEKVTVFRVEKTLDQNATDLV  268

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++   D  LF+RL +  V   T  G KT+RA+   LFLG+S  LL+  +E  PE+
Sbjct  269   YKWQFVAPTTDHGLFMRLVLQPVTSKTQKGHKTLRASVVGLFLGNSDQLLALTEEELPEM  328

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGT--PVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             GL + +C EM WIESVL++  F  GT   +E LLSR        KRKSDY+QTP+ R  +
Sbjct  329   GLKKGNCTEMSWIESVLWWDGFDEGTIPALETLLSRDHSTNFR-KRKSDYVQTPISRANL  387

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             + ++KKM+EL    L FNPYGGRM+EIP++A PFPHR+GN+  IQY  NW +   E  ++
Sbjct  388   DCLWKKMIELGKVGLMFNPYGGRMSEIPASATPFPHRAGNLFKIQYFINWSKDDPELEKN  447

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             YL   R+LY +MTPFVSKNPR A+LNYRDLD+G + N     SY EG+ YG+KYF +N+ 
Sbjct  448   YLAQIRRLYSFMTPFVSKNPRGAYLNYRDLDIGTSTNG--NNSYEEGRVYGVKYFNDNFE  505

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTF  1644
             RLVK+KT VDP++FFR+EQSIPT 
Sbjct  506   RLVKVKTAVDPNDFFRNEQSIPTL  529



>ref|XP_002317087.1| hypothetical protein POPTR_0011s16180g [Populus trichocarpa]
 gb|EEE97699.1| hypothetical protein POPTR_0011s16180g [Populus trichocarpa]
Length=535

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/505 (55%), Positives = 383/505 (76%), Gaps = 5/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+CL   +NP   IS ++Y+ +N +++SVL+ YIRN R+N S T KPL IVT T +SH
Sbjct  35    SFLQCLEKNTNPQDKISNLVYSQSNAAYTSVLRAYIRNARYNTSATPKPLVIVTPTEISH  94

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA+++C K+ G Q+K RSGGHDY+G+SY+SD PFFILDMFN RS+ V I+DE+A V+AG
Sbjct  95    VQATVICTKKVGYQLKIRSGGHDYDGISYISDTPFFILDMFNLRSIEVDIKDESACVQAG  154

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY I   S  +GFPAGVCPTVGVGGH  G GYGNM+RKYGL+VDN++DA+++DV
Sbjct  155   ATLGELYYKIWESSKGYGFPAGVCPTVGVGGHLSGGGYGNMLRKYGLSVDNVLDAQIVDV  214

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NG+LLDRK+MGE+LFWAI GGG  SF V++SY+I LV VP  VT+F V RT DQNAT++V
Sbjct  215   NGKLLDRKAMGEDLFWAICGGGGGSFGVIISYKIKLVPVPKTVTVFRVERTLDQNATDVV  274

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++  +  +LF+R+ +  V   T  G++TIRA+   L+LGDS +L++ + + FPEL
Sbjct  275   YKWQFVAPTISNDLFMRMLLQPV---TRKGKQTIRASIVTLYLGDSDSLVALLGKEFPEL  331

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL + +C E  WI+SVL++ ++  GT  + LL R P     LKRKSDY+Q P+P++G+E+
Sbjct  332   GLKKENCNETSWIQSVLWWANYDLGTSPDVLLDRNPNDANFLKRKSDYVQKPIPKDGLEW  391

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             ++KKM+++    L FNPYGGRM+EIP++A PFPHR+GN+  IQY+ NW E G EA + ++
Sbjct  392   LWKKMIDVGKTGLVFNPYGGRMSEIPASATPFPHRAGNLYKIQYSMNWQEAGKEADKKFM  451

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
                R+L+ YMT FVSKNPR AFLNYRDLD+G+      + S+ +G  YG KYF +N++RL
Sbjct  452   TQIRRLHSYMTSFVSKNPRSAFLNYRDLDIGVTV--PNKDSFEQGSVYGYKYFNDNFDRL  509

Query  1579  VKIKTKVDPDNFFRDEQSIPTFPGR  1653
             VK+KT VDP+NFFR+EQSIPT P +
Sbjct  510   VKVKTAVDPENFFRNEQSIPTLPRK  534



>gb|EYU29613.1| hypothetical protein MIMGU_mgv1a004108mg [Erythranthe guttata]
Length=543

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/517 (56%), Positives = 377/517 (73%), Gaps = 17/517 (3%)
 Frame = +1

Query  133   ATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
                +L+CLN  S+PS PIS  +Y P N S+S VLQ YIRNL F+   T KP FIV A H+
Sbjct  27    GVNLLQCLNSNSDPSQPISQALYFPTNSSYSDVLQSYIRNLLFSGPTTPKPQFIVAAAHV  86

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVE  492
             SHIQASI+CAK HGL+M+ RSGGHD+EG SYVS  PFFILDMFN R+++VSIE+ETAWVE
Sbjct  87    SHIQASIICAKSHGLEMRIRSGGHDFEGFSYVSGKPFFILDMFNLRAIHVSIEEETAWVE  146

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
              GATLGE+YY I+ KS+ H FP G CP+VGVGGH    G+GNM+RKYGL  DN++DA L+
Sbjct  147   TGATLGELYYRISEKSSTHAFPGGTCPSVGVGGHITAGGFGNMVRKYGLASDNVVDATLV  206

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNA--  846
             D +GRLLDRKSMGE+LFWA+TGGGA+SF VVL+Y+I LVRVP  V+   ++ T  Q+   
Sbjct  207   DASGRLLDRKSMGEDLFWAVTGGGAASFGVVLAYKIRLVRVPATVSFAVIQITDGQHGNS  266

Query  847   ---------TNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSK  999
                      T+ VY Y +++ KL+  +FI+L  +VV +      K +  TF  LFLG+S+
Sbjct  267   NSNSNSNNFTDTVYKYLQIADKLNDEIFIKLAFNVVKVGR---TKAVNGTFLILFLGNSE  323

Query  1000  TLLSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSD  1179
             +L+  M+E  PELGLT+ +C ++ W+ES++ +T+FP+GTP   LLSR+      LKRKSD
Sbjct  324   SLVDLMNEKLPELGLTKPNCADVSWVESMVRWTAFPAGTPTSILLSRIHPGQARLKRKSD  383

Query  1180  YLQTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATN  1359
             +L+ P+ + G+E IF KM E +TP+L F P+GG M ++ S+AKPFPHR+GNIA+I+ ATN
Sbjct  384   FLKNPISKKGLEIIFNKMKEPETPVLKFFPFGGIMNKVSSSAKPFPHRAGNIALIEIATN  443

Query  1360  WDE-HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGK  1536
             W++  G +   +Y+ ITR+ YE +TPFVSK+ REA+L YRD+DLGIN N G    Y    
Sbjct  444   WNQTEGAQDDDYYMNITRKFYECITPFVSKS-REAYLGYRDIDLGIN-NHGPNSYYEAAA  501

Query  1537  TYGLKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             TYG KY+K N++RLV+IK+K DPD+FFR EQSIP FP
Sbjct  502   TYGFKYYKNNFHRLVQIKSKADPDDFFRYEQSIPIFP  538



>ref|XP_011005328.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
 ref|XP_011005329.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
 ref|XP_011015640.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=532

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/498 (57%), Positives = 372/498 (75%), Gaps = 5/498 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL   S+PSHPIS  IY+  N SF S+LQ  I+N RF    T KPL I+ A H SH+Q
Sbjct  32    LQCLPSHSHPSHPISQAIYSNTNPSFESILQALIKNRRFLTPTTPKPLAIIAAVHESHVQ  91

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++CAK +GLQ++ RSGGHDYEG+SYVS VPF ILDMFN RS+++ I  ETAWV++GAT
Sbjct  92    ATVICAKSNGLQIRIRSGGHDYEGLSYVSAVPFVILDMFNLRSIDIDIASETAWVQSGAT  151

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY I ++SN+HGFPAGVCPTVG+GGHF G G+G MMRKYGL+VDNIIDA+L+DVNG
Sbjct  152   LGELYYNIGSRSNIHGFPAGVCPTVGIGGHFSGGGFGTMMRKYGLSVDNIIDAQLVDVNG  211

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              +L+RK MGE LFWAI GGGA SF V+LS++I+LV+VPP VT F V RT ++ AT++ Y 
Sbjct  212   NILNRKIMGEHLFWAIRGGGA-SFGVILSWKISLVQVPPTVTAFRVDRTLEEGATDVFYK  270

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ KLD +LFIR    VV  ++  G K I  +F  LFLG S  LLS + +SFPELGL
Sbjct  271   WQLVASKLDKDLFIRAMSQVVKGSSE-GSKRISISFIGLFLGQSGALLSLLSKSFPELGL  329

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              Q DC+EMRWIESV+F+ + P+    + LL+R P      K+KSD+++  +P+N +E I+
Sbjct  330   QQKDCKEMRWIESVVFWANLPNAASTDVLLNR-PNQASLFKKKSDFVKYVIPKNALESIW  388

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             K M++++   + +NPYGGRM EI + A PFPHR+GN+  I+Y+T W + G EA  H+  +
Sbjct  389   KVMIKVEPIWMQWNPYGGRMDEISATATPFPHRAGNLFKIEYSTTWIQEGIEATNHHTSL  448

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
              RQL++ MTP+VSK PREAFLNYRDLD+G   N   +  + E K YG KYFK+N+ RLV 
Sbjct  449   LRQLHDAMTPYVSKYPREAFLNYRDLDIG--SNPSNQTIFEEAKVYGSKYFKDNFPRLVT  506

Query  1585  IKTKVDPDNFFRDEQSIP  1638
             +K++VDPDNFF++EQSIP
Sbjct  507   VKSRVDPDNFFKNEQSIP  524



>gb|KGN49482.1| hypothetical protein Csa_6G525670 [Cucumis sativus]
Length=578

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/502 (56%), Positives = 371/502 (74%), Gaps = 2/502 (0%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             +T L C    SN S  +S +++   N S++SVL+ YIRN RFN S   KP+ IVT    S
Sbjct  27    STFLHCFQSNSNSSAGVSSIVFARENASYTSVLRAYIRNARFNTSSAPKPVIIVTPLTES  86

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+Q++++C+K+ G+Q+K RSGGHDYEGVSY+SDV F ILDM N R+V V + D++AWV A
Sbjct  87    HVQSAVICSKKLGIQLKIRSGGHDYEGVSYISDVEFIILDMSNLRTVTVDVADQSAWVGA  146

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGEVYY I  KS V G+PAGVCPTVGVGGH  G GYGNM+RKYGL VD+++DA+++D
Sbjct  147   GATLGEVYYRIWEKSKVLGYPAGVCPTVGVGGHISGGGYGNMLRKYGLAVDHVLDARIVD  206

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             V GR+LD KSMGE+LFWAI GGG +SF VVL+Y+I LV VP  VTIF V RT +QNA ++
Sbjct  207   VKGRILDSKSMGEDLFWAIKGGGGASFGVVLAYKIRLVPVPETVTIFRVERTIEQNAADL  266

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             V  +Q ++   D NLF+RL +  V+     G +TIRA+  ALFLG S+ L+S + +  PE
Sbjct  267   VVRWQEVAPTTDENLFMRLLLQPVSSKIKKGTRTIRASVVALFLGKSEELVSLLKKELPE  326

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL + +C EM WI+SVL++ +F  GT  E LL R       L+RKSDY+Q P+ R+G+ 
Sbjct  327   LGLQKENCTEMSWIDSVLWWGNFDIGTSPEALLDRNVDSAGFLRRKSDYVQKPISRDGLN  386

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
             +++KKM+E+    L FNPYGG+M+EI S A PFPHR+GN+  IQY+ NW+E G EA Q +
Sbjct  387   WLYKKMIEIGKTGLVFNPYGGKMSEISSTATPFPHRAGNLYKIQYSVNWNEPGPEADQEF  446

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             ++  R+LY +MTPFVSKNPR++FLNYRDLD+GIN+N   + S+ +GK YG KYF EN+ R
Sbjct  447   VKQIRRLYSFMTPFVSKNPRQSFLNYRDLDIGINNND--KNSFEDGKVYGFKYFGENFER  504

Query  1576  LVKIKTKVDPDNFFRDEQSIPT  1641
             LVK+KT VDP+NFF +EQSIPT
Sbjct  505   LVKVKTAVDPENFFWNEQSIPT  526



>ref|XP_002523157.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39188.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=539

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/506 (56%), Positives = 374/506 (74%), Gaps = 5/506 (1%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T+ L+CL + + P   IS ++YT  N S++SVL+ YIRN R N + T KP  IVT   +S
Sbjct  38    TSFLQCLQNNTTPQDQISSLVYTKANASYTSVLRAYIRNARMNTTATPKPTIIVTPKQIS  97

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+QA+++CAK+ G Q+K RSGGHDYEG+SYVSDVPFF+LDMFN RSV V +++E+AW++A
Sbjct  98    HVQAAVICAKKVGYQLKVRSGGHDYEGISYVSDVPFFVLDMFNLRSVQVDMKNESAWIQA  157

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGEVY+GI   S VHGFPAG+CPTVGVGGH  G GYGNM+RKYGL VDNI+DA+++D
Sbjct  158   GATLGEVYHGIWENSKVHGFPAGICPTVGVGGHISGGGYGNMLRKYGLAVDNILDAQIVD  217

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNG+L+DRK+MGE+LFWAI GGG  SF VV+SY+I LV VP  VTIF   R  ++NAT+I
Sbjct  218   VNGKLMDRKAMGEDLFWAIRGGGGGSFGVVISYKIKLVPVPETVTIFRAERVIEENATDI  277

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
              Y +Q ++ K D  LF+R+ +  V   T   ++T+R +  +L+LG++ +L++ + + FPE
Sbjct  278   AYKWQLVAPKTDNGLFMRMLMQPV---TRNKQQTLRVSIVSLYLGNADSLVALLGKEFPE  334

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL + +C EM WI+SVL++ +F +GT  + LL R       LKRKSDY+Q P+P+N + 
Sbjct  335   LGLKKENCTEMNWIQSVLWWANFDNGTSPDVLLDRNVDSANFLKRKSDYVQKPIPKNALT  394

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              IFK+M+EL    L FNPYGGRM EIPS   PFPHR+GN+  +QY+ NW+E G +   +Y
Sbjct  395   LIFKRMMELGKIGLVFNPYGGRMDEIPSTEVPFPHRAGNLFKMQYSINWNEPGSDLQSNY  454

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L   R LY YMTPFVSKNPR AFLNYRDLD+G+    G + SY EG  YG KYF  N++R
Sbjct  455   LSQARNLYSYMTPFVSKNPRSAFLNYRDLDIGV-MTPG-KNSYEEGSIYGYKYFNGNFDR  512

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFPGR  1653
             LVK+KT VDP+NFFR+EQSIPT   +
Sbjct  513   LVKVKTAVDPENFFRNEQSIPTLSSK  538



>ref|XP_010098534.1| Reticuline oxidase-like protein [Morus notabilis]
 gb|EXB75194.1| Reticuline oxidase-like protein [Morus notabilis]
Length=547

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/508 (55%), Positives = 368/508 (72%), Gaps = 4/508 (1%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T  L+CL + +NPS  +S  +Y+ +N S++SVL+ YIRN RFN S T KPL IVTA+H S
Sbjct  41    TRFLQCLENHTNPSSQVSNQVYSQSNTSYTSVLRAYIRNARFNSSSTNKPLLIVTASHES  100

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+QA+++CAK  GLQ+K RSGGHDY G+SYVSD PF ILDMF  RS++V + DE+ WVE+
Sbjct  101   HVQAAVICAKSIGLQLKIRSGGHDYAGISYVSDSPFAILDMFQLRSISVDVADESVWVES  160

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE+YY I  KS V GFP GVCPTV +GGH  G GYG M+RKYGL VD ++DAK++D
Sbjct  161   GATLGELYYRIWEKSKVLGFPGGVCPTVAIGGHVSGGGYGQMIRKYGLAVDQVLDAKIVD  220

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQN--AT  849
             VNG +LDRK+MGE+LFWAI GGG +SF V+LSY++ LV VP  VT+F + R YDQN   T
Sbjct  221   VNGNILDRKAMGEDLFWAIRGGGGASFGVILSYKLKLVPVPETVTVFRMERIYDQNQSVT  280

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
             + VY +Q+++   D  LF+R+ +  +       EKTIRAT   +FLG++  L+S +D+ F
Sbjct  281   DFVYEWQKVAPATDDGLFMRMLIQPITSRVRRPEKTIRATIVTMFLGNADQLVSLLDKEF  340

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNG  1209
             P L L + +C EM WI+SVL++ +F +GT  E LL R       L RKSDY+QTP+ ++G
Sbjct  341   PLLELKKENCMEMSWIDSVLWWANFDNGTSPEVLLDRDLDSANFLIRKSDYVQTPISKDG  400

Query  1210  IEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQ  1389
             +E+++K++ EL      FNPYGG+M EI  A  PFPHR+GN+  IQY+ NW+E   E  +
Sbjct  401   LEWLWKRVTELGKTGFVFNPYGGKMNEISPADAPFPHRAGNLYKIQYSVNWEESSPELEK  460

Query  1390  HYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENY  1569
             +Y    R+L+ YMTPFVSKNPR AFLNYRDLD+G+N       SY EGK YG+KYF +N+
Sbjct  461   NYTTQIRRLFSYMTPFVSKNPRRAFLNYRDLDIGVNSFG--ENSYEEGKVYGVKYFSDNF  518

Query  1570  NRLVKIKTKVDPDNFFRDEQSIPTFPGR  1653
             +RLVK+KT VDP+NFFR+EQSIPT   +
Sbjct  519   DRLVKVKTAVDPENFFRNEQSIPTLSSK  546



>ref|XP_010450189.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=530

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/509 (56%), Positives = 371/509 (73%), Gaps = 7/509 (1%)
 Frame = +1

Query  130   CATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATH  309
              + T  +C+   S+P HPISP ++     S+SSVL+  IRNLRFN S T KP  I+ ATH
Sbjct  23    SSETFTQCITSNSDPKHPISPAVFFVGKPSYSSVLEANIRNLRFNTSDTPKPFLIIAATH  82

Query  310   LSHIQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETA  483
              SH+QA++ C + H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV V +  +TA
Sbjct  83    ESHVQAAVTCGQRHNLQMKIRSGGHDYDGLSYVTYSGEPFFVLDMFNLRSVEVDVASKTA  142

Query  484   WVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDA  663
             WV+ GA LGEVYY I  KS+   +PAG+CPTVGVGGH  G GY NMMRK+GLTVDN IDA
Sbjct  143   WVQTGAVLGEVYYHIWEKSSTLAYPAGICPTVGVGGHVSGGGYSNMMRKHGLTVDNTIDA  202

Query  664   KLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQN  843
             +++DVNG+ L+RK MGE+ FWAI GGG  S+ VVL+Y+I+LV VP  VT+FS+ RT +QN
Sbjct  203   RMVDVNGKKLNRKLMGEDHFWAINGGGG-SYGVVLAYKISLVEVPENVTVFSISRTLEQN  261

Query  844   ATNIVYCYQRMSHKLDPNLFIRLTVDVVNIT-THPGEKTIRATFNALFLGDSKTLLSTMD  1020
             AT IV+ +Q ++ +L   LF+R  ++VV +  T   +KT+RATF A+FLGD+ TLLS ++
Sbjct  262   ATEIVHRWQHVAPELPDELFLRTIIEVVFVNGTVSTQKTVRATFKAMFLGDTTTLLSILN  321

Query  1021  ESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMP  1200
               FPELGL +SDC E  WI+SVLF+     G+  E+LL +  Q + +LKRKSDY++ P+ 
Sbjct  322   RRFPELGLIRSDCTETSWIQSVLFWADIQVGSS-EKLLLQRNQTVTYLKRKSDYVREPIS  380

Query  1201  RNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYE  1380
             R G+E I+KKM+EL+ P +TF PYGG M +IPS A PFPHR+GN+  IQY ++W E    
Sbjct  381   RTGLESIWKKMMELEIPTMTFTPYGGVMEKIPSTATPFPHRAGNLWKIQYGSDWSEG--T  438

Query  1381  AAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFK  1560
                 Y+++TR+LY++MTPFVSKNPR+ F NYRDLDLGIN +  +  SYFEGK YG  YF 
Sbjct  439   LTTRYMDLTRELYQFMTPFVSKNPRQTFPNYRDLDLGINSHYEKISSYFEGKRYGESYFG  498

Query  1561  ENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
              N+ RLVKIKT+VD  NFFR+EQSIP  P
Sbjct  499   GNFERLVKIKTRVDSGNFFRNEQSIPVLP  527



>ref|XP_004162850.1| PREDICTED: LOW QUALITY PROTEIN: reticuline oxidase-like protein-like 
[Cucumis sativus]
Length=526

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/501 (57%), Positives = 374/501 (75%), Gaps = 6/501 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+CL+  S P  PIS  I+TPNN SF +VL  YIRNLRF    T KPLFIVTA H SH
Sbjct  31    SFLQCLSTTSQPQFPISDAIFTPNNSSFLTVLDSYIRNLRFQNPTTPKPLFIVTAKHYSH  90

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +Q++++CAK  GLQ++ RSGGHDYEG+SYVS  PF ILD+FN R++NV I  +TAWVE+G
Sbjct  91    VQSTVVCAKRVGLQIRIRSGGHDYEGLSYVSQQPFVILDLFNLRAINVDIPSQTAWVESG  150

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY IA KSN+HGFP GVCPTVG GGHF G GYGN++RK+GLTVDNI+DA++++ 
Sbjct  151   ATLGELYYAIAKKSNLHGFPGGVCPTVGTGGHFSGGGYGNLIRKFGLTVDNILDAQIVNA  210

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             +G++L+R++MGE+LFWAI GGG  SF V+LS++I+LV+VP  VT+F V R  +  AT++V
Sbjct  211   DGKILNRQTMGEDLFWAIRGGGGGSFGVILSWKISLVQVPSTVTVFDVDRKIEDGATDVV  270

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             + +Q++  KLD NLFIRL +   +     G KT +AT  ALFLG  + ++  M+++ P L
Sbjct  271   FEWQQVMDKLDENLFIRLMLH--SSKGENGXKTGKATLVALFLGPVEKVMDIMNQNIPSL  328

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
              L + +C EM WI+SVLF+ +FPSGT  E LLSR      +LKRKSDY++ P+ R G+E 
Sbjct  329   KLQKQECFEMSWIQSVLFWANFPSGTAPEALLSRQMASTPYLKRKSDYVREPISREGVEA  388

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+K +++++   LT+NPYGGRM+EI   A PFPHR+G    IQY++NW E G   A+  +
Sbjct  389   IWKALMDVEEVGLTWNPYGGRMSEISETATPFPHRAGVKFKIQYSSNWKEAGDTEAEEEI  448

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             E++R+LYE MTPFVSKNPREAFLNYRD+D+G      R  S  EG+ YG +YFK N+ RL
Sbjct  449   ELSRKLYEAMTPFVSKNPREAFLNYRDIDIG----SSRTWSLEEGRVYGERYFKGNFERL  504

Query  1579  VKIKTKVDPDNFFRDEQSIPT  1641
             V +KTKVDP NFFR+EQSIPT
Sbjct  505   VNVKTKVDPQNFFRNEQSIPT  525



>ref|XP_006348174.1| PREDICTED: reticuline oxidase-like protein-like [Solanum tuberosum]
Length=529

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/500 (59%), Positives = 370/500 (74%), Gaps = 4/500 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+CL+  S+PS  I   +YTPNN S+ SVLQ YIRN RFN S T KP  I T    SH
Sbjct  30    SFLQCLSKHSHPSDHILSRVYTPNNSSYKSVLQHYIRNQRFNRSTTPKPDIIFTPLQESH  89

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +Q ++ C ++    +K RSGGHDYEG+SYVS++ F +LDM N RS++V I++ETAWV+AG
Sbjct  90    VQVAVTCCRKTDKYLKIRSGGHDYEGISYVSNISFVLLDMSNLRSIDVDIQNETAWVQAG  149

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             A LGE+YY I  KS VH FPAGVCPTVGVGGH  G GYGN++RKYGL+VDN+IDA ++DV
Sbjct  150   ALLGELYYRIWEKSKVHAFPAGVCPTVGVGGHITGGGYGNLLRKYGLSVDNLIDAHIVDV  209

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             +GR+L+R SMGE+LFWAI GG  +SF V+ +Y++ LV+VP  VT+F V RT ++ A +IV
Sbjct  210   HGRILNRGSMGEDLFWAIRGGCGASFGVISAYKLRLVKVPDVVTVFRVVRTLEETAIDIV  269

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++ K+D NLFIRL +  ++     G KTI ATF ALFLGDS+ LLS MD  FP+L
Sbjct  270   YWWQFIAEKIDSNLFIRLALKPID-EKQKGTKTITATFVALFLGDSRELLSIMDRDFPQL  328

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL   DC+EM WIES LF+ SFP+GT  + LL+R P     LKRKSDYLQ P+P++ ++ 
Sbjct  329   GLHIEDCKEMSWIESELFWASFPNGTLPDALLNRKPGAKF-LKRKSDYLQKPIPKDKLKS  387

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             IF KM+EL    L FN YGGRM+EIP    PFPHR+GNI  IQYA NW + G EA   Y+
Sbjct  388   IFDKMIELGDTELVFNQYGGRMSEIPEWETPFPHRAGNIFKIQYAANWGKEGKEAENFYI  447

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
               TR LY YMTPFVSK+PR A+LNYRDLD+G+NHN   R  Y EG+ YGLKYFK+N+N+L
Sbjct  448   NQTRVLYNYMTPFVSKSPRCAYLNYRDLDIGVNHNGNNR--YIEGRVYGLKYFKDNFNKL  505

Query  1579  VKIKTKVDPDNFFRDEQSIP  1638
             VK+KT VDPDNFF +EQSIP
Sbjct  506   VKVKTLVDPDNFFWNEQSIP  525



>ref|XP_010316563.1| PREDICTED: reticuline oxidase-like protein [Solanum lycopersicum]
Length=529

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/500 (58%), Positives = 372/500 (74%), Gaps = 4/500 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+CL++ S PS  I   +YTPNN S+ SVLQ YIRN RFN S T KP  I T    SH
Sbjct  30    SFLQCLSEHSRPSDHILSRVYTPNNSSYKSVLQHYIRNQRFNRSTTPKPDIIFTPLQESH  89

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +Q ++ C ++    +K RSGGHDYEG+SYVS++ F +LDM N  S++V I++ETAWV+AG
Sbjct  90    VQVAVTCCRKTDKYLKIRSGGHDYEGISYVSNISFVLLDMSNLHSIDVDIQNETAWVQAG  149

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             A LGE+YY I  KS VH FPAGVCPTVGVGGH  G GYGN++RKYGL+VDN++DA+++DV
Sbjct  150   ALLGELYYRIWEKSKVHAFPAGVCPTVGVGGHITGGGYGNLLRKYGLSVDNLVDARIVDV  209

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             +GR+L+R+SMGE+LFWAI GGG +SF V+ +Y++ LV+VP  VT+F V RT ++NA +IV
Sbjct  210   HGRILNRESMGEDLFWAIRGGGGASFGVISAYKLRLVKVPDVVTVFRVVRTLEENAIDIV  269

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++ K+D NLFIRL +  ++     G KTI ATF +LFLGDSK LLS M+  FP+L
Sbjct  270   YWWQFIAEKIDSNLFIRLALKPID-EKQKGTKTITATFVSLFLGDSKELLSIMNRDFPQL  328

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL   DC+EM WIES LF+ SFP+GT  + LL+R P     LKRKSDYLQ P+P++ ++ 
Sbjct  329   GLHIEDCKEMSWIESALFWASFPNGTLPDVLLNRKPGAKF-LKRKSDYLQKPIPKDELKS  387

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             +  KM+EL    L FN YGGRM+EIP    PFPHR+GNI  IQYA NW + G EA   YL
Sbjct  388   LLDKMIELGDTELVFNQYGGRMSEIPEWGTPFPHRAGNIFKIQYAANWGKEGNEAENFYL  447

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
               TR LY YMTPFVSK+PR A+LNYRDLD+G+NHN   R  Y EG+ YGLKYFK+N+N+L
Sbjct  448   NQTRVLYNYMTPFVSKSPRCAYLNYRDLDIGVNHNGNNR--YIEGRVYGLKYFKDNFNKL  505

Query  1579  VKIKTKVDPDNFFRDEQSIP  1638
             V++KT VDPDNFF +EQSIP
Sbjct  506   VQVKTFVDPDNFFWNEQSIP  525



>ref|XP_008225669.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=531

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/507 (55%), Positives = 370/507 (73%), Gaps = 14/507 (3%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL+  S  S+PIS  IYT  + SFSSVLQ Y+RNLRF    T KPL IV A H SH+ 
Sbjct  35    LQCLSKHSQRSNPISEAIYTSKSASFSSVLQSYVRNLRFISPTTPKPLLIVAAKHESHVP  94

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVS--DVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             A+++CAK  GL+++ RSGGHDYEGVSYVS     F +LDMFN RS+N+ + DE+AWV++G
Sbjct  95    ATVICAKSLGLEIRIRSGGHDYEGVSYVSRNTKDFIVLDMFNLRSINIDMADESAWVQSG  154

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             A LGE++Y I  KS  H FPAGVCP++G GGHF G GYGNMMRKYGL+ DNI+DAK+++V
Sbjct  155   AILGEIFYAIYMKSKNHAFPAGVCPSIGAGGHFTGGGYGNMMRKYGLSTDNIVDAKIVNV  214

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NG++LDRK+MGE+LFWAI GGG SSF V+LS++I  V VP  VT+F V+RT  Q AT I+
Sbjct  215   NGKILDRKAMGEDLFWAIRGGGGSSFGVILSWKIKFVWVPATVTVFEVKRTLAQGATEIL  274

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
               +Q+++ KLD +LFIR  +        P   TI  +F +LFLG+S+ LL  M +SFP+L
Sbjct  275   VKWQQVADKLDHDLFIRAII-------KPANGTIEVSFMSLFLGNSERLLKLMSQSFPQL  327

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEE-LLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             GL ++DC EM WI+SVL++T++ +GT   E LL+RVP+  V LKRKSDY++ P+ +  +E
Sbjct  328   GLQKTDCHEMSWIQSVLYWTNYQNGTTSPEVLLNRVPKGQVFLKRKSDYVKEPISKTDLE  387

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              ++K M+E+    + +NPYGG+M+EI   A PFPHR+G +  IQY+ NW E G+E+ + Y
Sbjct  388   ALWKVMIEIGEVTMLWNPYGGKMSEILETATPFPHRAGTLFKIQYSVNWKEEGFESTKRY  447

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L + ++LY  MTP VSKNPR AF NYRDLD+G N   G    Y E K YG KYFK N+ R
Sbjct  448   LSLMKKLYVAMTPHVSKNPRMAFYNYRDLDIGTNSKGG----YDEAKVYGTKYFKCNFER  503

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             LV+IKT+VDP+NFFR+EQSIPT P ++
Sbjct  504   LVRIKTEVDPENFFRNEQSIPTLPSKQ  530



>ref|XP_004134894.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
Length=526

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/501 (56%), Positives = 374/501 (75%), Gaps = 6/501 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+CL+  S P  PIS  I+TPNN SF +VL  YIRNLRF    T KPLFIVTA H SH
Sbjct  31    SFLQCLSTTSQPQFPISDAIFTPNNSSFLTVLNSYIRNLRFQNPTTPKPLFIVTAKHYSH  90

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +Q++++CAK  GLQ++ RSGGHDYEG+SYVS  PF ILD+FN R++NV I  +TAWVE+G
Sbjct  91    VQSTVVCAKRVGLQIRIRSGGHDYEGLSYVSQQPFVILDLFNLRAINVDIPSQTAWVESG  150

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY IA KSN+HGFP GVCPTVG GGHF G GYGN++RK+GLTVDNI+DA++++ 
Sbjct  151   ATLGELYYAIAKKSNLHGFPGGVCPTVGTGGHFSGGGYGNLIRKFGLTVDNILDAQIVNA  210

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             +G++L+R++MGE+LFWAI GGG  SF V+LS++I+LV+VP  VT+F V R  +  AT++V
Sbjct  211   DGKILNRQTMGEDLFWAIRGGGGGSFGVILSWKISLVQVPSTVTVFDVDRKIEDGATDVV  270

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             + +Q++  KLD NLFIRL +   +     G+KT +AT  ALFLG  + ++  M+++ P L
Sbjct  271   FEWQQVMDKLDENLFIRLMLH--SSKGENGQKTGKATLVALFLGPVEKVMDIMNQNIPSL  328

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
              L + +C EM WI+SVLF+ +FPSGT  E LLSR      +LKRKSDY++ P+ R G+E 
Sbjct  329   KLQKQECFEMSWIQSVLFWANFPSGTAPEALLSRQMASTPYLKRKSDYVREPISREGVEA  388

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+K +++++   LT+NPYGGRM+EI   A PFPHR+G    IQY++NW E G   A+  +
Sbjct  389   IWKALMDVEEVGLTWNPYGGRMSEISETATPFPHRAGVKFKIQYSSNWKEAGDTEAEEEI  448

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              ++R+LYE MTPFVSKNPREAFLNYRD+D+G      R  S  EG+ YG +YFK N+ RL
Sbjct  449   ALSRKLYEAMTPFVSKNPREAFLNYRDIDIG----SSRTWSLEEGRVYGERYFKGNFERL  504

Query  1579  VKIKTKVDPDNFFRDEQSIPT  1641
             V +KTKVDP NFFR+EQSIPT
Sbjct  505   VNVKTKVDPQNFFRNEQSIPT  525



>ref|XP_009795337.1| PREDICTED: reticuline oxidase-like protein [Nicotiana sylvestris]
Length=559

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/511 (56%), Positives = 367/511 (72%), Gaps = 12/511 (2%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRF-NESYTKKPLFIVTATHLS  315
             + + CL  +S P   IS ++Y+PNN SF+ +LQ Y+RN RF N S T KP+ IVT T  S
Sbjct  41    SFVNCLTTKSIPQSEISKIVYSPNNASFNPILQAYVRNRRFFNSSTTSKPVIIVTPTEES  100

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+ +++LC KE  LQ+K RSGGHDYEG+SY+SDVPF +LDMFN RS+++++ D TAWV+A
Sbjct  101   HVSSAVLCTKETNLQLKIRSGGHDYEGISYISDVPFIMLDMFNLRSISINVNDNTAWVQA  160

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE+YY I  KSNV GFPAGVCPTVGVGGH  G GYGNM+RK+GL+VDN++DA+L+D
Sbjct  161   GATLGELYYNIWTKSNVLGFPAGVCPTVGVGGHLSGGGYGNMLRKFGLSVDNVLDARLVD  220

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNGR+ DRK+MGE+LFWAI GGG +SF V+L+++I LV+VP  VT F V R  DQNAT+ 
Sbjct  221   VNGRIWDRKAMGEDLFWAIKGGGGASFGVILAFQIQLVQVPQTVTYFRVERFLDQNATDA  280

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNI---------TTHPGEKTIRATFNALFLGDSKTLL  1008
             V  +Q + +K+D +LFIRL V  + +              +K+IR TF ALFLGDS  L+
Sbjct  281   VLQWQNVVNKIDNDLFIRLLVQPITVKNKEKKVKGKKKAQQKSIRVTFIALFLGDSSRLI  340

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQ  1188
             S +    P LGLT+ DC EM WI+SVL + +F + T    LL+R    L  LKRKSDY+Q
Sbjct  341   SLVSNELPALGLTKQDCFEMSWIDSVLQWANFDNTTKPIALLNRTGDPLNFLKRKSDYVQ  400

Query  1189  TPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDE  1368
              P+PR+G+E IF+KM+ L    + FNPYGGRMAEI     PFPHR+G +  IQY+ NW+E
Sbjct  401   EPIPRDGLESIFQKMISLGKAGIVFNPYGGRMAEIAEGETPFPHRAGILFKIQYSVNWNE  460

Query  1369  HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGL  1548
              G  A + YL     LY +MTPFVSKNPR+A+LNYRDLD+G N       S  EG+ YG 
Sbjct  461   EGAAAEKEYLTQIGDLYSFMTPFVSKNPRQAYLNYRDLDIGTNDQGPH--SLEEGRVYGT  518

Query  1549  KYFKENYNRLVKIKTKVDPDNFFRDEQSIPT  1641
              YFK N++RLVK+K+ VDP NFFR+EQSIPT
Sbjct  519   MYFKNNFDRLVKVKSAVDPTNFFRNEQSIPT  549



>gb|EYU43212.1| hypothetical protein MIMGU_mgv1a021309mg, partial [Erythranthe 
guttata]
Length=489

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/489 (57%), Positives = 364/489 (74%), Gaps = 5/489 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++CL+D   PS  IS +IYTP N SF++VLQ YIRN RFN S T+KP  I+T T   H+ 
Sbjct  6     VQCLSDNKIPSCQISKIIYTPKNPSFTTVLQSYIRNRRFNVSTTRKPSIIITPTSEIHVS  65

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++CAK+   Q+K RSGGHDYEG+SYVSD  F ILDMFN RS+NVS+ED TAWVE+GA 
Sbjct  66    AAVICAKKLKTQLKIRSGGHDYEGISYVSDTKFVILDMFNLRSINVSVEDRTAWVESGAL  125

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY I   + +  FPAGVCPT+G+GGH  G GYGNM+RKYGL+VD+++DAK++D NG
Sbjct  126   LGELYYRITENTKLLAFPAGVCPTMGIGGHISGGGYGNMIRKYGLSVDHVVDAKIVDANG  185

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+LDRKSMGE+LFWAI GGG +SF VVL+Y++NLV VP  VT+F+V +   QNAT+ V+ 
Sbjct  186   RVLDRKSMGEDLFWAIRGGGGASFGVVLAYKLNLVPVPEDVTVFTVEKEASQNATDAVFQ  245

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             YQ++  K+D +LFIR+ +  V +      +++RATF  +FLG++  LLS     FPELGL
Sbjct  246   YQQIVDKMDKDLFIRVLLQPVTLNK---TRSVRATFIGMFLGNTDRLLSITGSLFPELGL  302

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              +SDCREM WI SV+++ +F + +  E LL+R P  +  LKRKSDY+QTP+ + G+E +F
Sbjct  303   QKSDCREMNWIYSVIYWANFVNTSAPEVLLNRTPDSVNFLKRKSDYVQTPISKPGLEKLF  362

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
              KMVE+    L FN YGG M+EI  +A PFPHR+GN+  IQY+ NW E G EA + Y+  
Sbjct  363   DKMVEIGKVGLVFNSYGGVMSEIDESATPFPHRAGNLFKIQYSVNWKEEGEEADKDYVAQ  422

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
              R+LY +M P+VSKNPR+AFLNYRDLD+GIN N     SY +GK YG KYFK N++RLVK
Sbjct  423   IRELYSFMEPYVSKNPRQAFLNYRDLDIGINDNSN--NSYEQGKIYGEKYFKGNFDRLVK  480

Query  1585  IKTKVDPDN  1611
             IKT+VDPDN
Sbjct  481   IKTRVDPDN  489



>emb|CBI31067.3| unnamed protein product [Vitis vinifera]
Length=547

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/505 (55%), Positives = 378/505 (75%), Gaps = 23/505 (5%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+CL+  S PS PIS V YTP N S++ VLQ YI+NLRF  S T KP FIV ++H+SH
Sbjct  30    SFLQCLSHLSAPSPPISGVFYTPTNSSYAYVLQSYIQNLRFMSSTTPKPSFIVASSHVSH  89

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA+I+C K HGLQ++ RSGGHDY+G+SYVSDVPF ILDMFN R V+V IE+E AWV++G
Sbjct  90    VQATIICCKIHGLQLRIRSGGHDYDGLSYVSDVPFVILDMFNLREVSVDIENEWAWVQSG  149

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             AT+GE+YY IA KSN++GFPAGVCPTVGVGGHF G GYGNMMRKYGL+VDN++DA+++D 
Sbjct  150   ATMGELYYRIAVKSNLYGFPAGVCPTVGVGGHFSGGGYGNMMRKYGLSVDNVLDAQIVDA  209

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGR+LDR+SMGE+LFWAI GGG +SF V+++++I LV VP  VT+F V RT +Q A +++
Sbjct  210   NGRILDRESMGEDLFWAIRGGGGASFGVIVAWKIRLVPVPETVTVFRVERTLEQGAIDLL  269

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             + +Q ++ K++ +LFIR+ +  V    H   KTI+A F +LFLG+S+ LL+ M ESFPEL
Sbjct  270   HQWQYVADKINEDLFIRVVILPVIRKDH---KTIKAKFVSLFLGNSEKLLALMSESFPEL  326

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             G+  ++C EM W+ES+++++++                  +LK+KSDY+Q  + +  ++ 
Sbjct  327   GINGNNCIEMSWVESIVYWSNY------------------YLKKKSDYVQASISKADLKG  368

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I   M+ELQ P LTFNPYGGRM+EI  +  PFPHR+GNI  IQY+  W E   EAA H L
Sbjct  369   ILNTMMELQKPALTFNPYGGRMSEISESETPFPHRAGNIYKIQYSVTWKEESMEAADHNL  428

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
              + R++Y+YMTP+VS +PR ++LNYRD+DLG+N N     SY E   +G KYFK+N++RL
Sbjct  429   NMIRRIYDYMTPYVSNSPRGSYLNYRDIDLGVNQNGN--VSYEEASIWGTKYFKDNFDRL  486

Query  1579  VKIKTKVDPDNFFRDEQSIPTFPGR  1653
             V++K++VDPDNFFR EQSIP+   R
Sbjct  487   VQVKSRVDPDNFFRYEQSIPSVTNR  511



>ref|XP_009795338.1| PREDICTED: reticuline oxidase-like protein [Nicotiana sylvestris]
Length=572

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/511 (56%), Positives = 368/511 (72%), Gaps = 12/511 (2%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRF-NESYTKKPLFIVTATHLS  315
             + + CL  +S P   IS ++Y+PNN SF+ +LQ YIRN RF N S T KP+ IVT T  S
Sbjct  28    SFVNCLTAKSVPQQEISKIVYSPNNPSFNPILQAYIRNRRFFNSSTTSKPVIIVTPTEES  87

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+ +++LC KE  LQ+K RSGGHDYEG+SY+S+VPF +LDMFN RS+++++   TAWV+A
Sbjct  88    HVSSAVLCTKETNLQLKIRSGGHDYEGISYISNVPFIMLDMFNLRSISINVNGNTAWVQA  147

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE+YY I  KSNV GFPAGVCPTVGVGGH  G GYGNM+RK+GL+VDN++DA+L+D
Sbjct  148   GATLGELYYNIWTKSNVLGFPAGVCPTVGVGGHLSGGGYGNMLRKFGLSVDNVLDARLVD  207

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNGR+ DRK+MGE+LFWAI GGG  SF V+L+++I LV+VP  VT F V R  DQNAT+ 
Sbjct  208   VNGRIWDRKAMGEDLFWAIKGGGGPSFGVILAFQIQLVQVPQTVTYFRVERFLDQNATDA  267

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTH---------PGEKTIRATFNALFLGDSKTLL  1008
             V+ +Q ++HK+D +LFIRL +  + +              +KTIRA F  LFLGDS  L+
Sbjct  268   VFQWQNVAHKIDSDLFIRLLLQPITVKRKEKVKEKKNTQQKKTIRAAFLGLFLGDSSRLM  327

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQ  1188
             + + + FP L L + DC EM WI+SVL + SF + T    LL+R   +   LKRKSDY+Q
Sbjct  328   TLVSKEFPALRLQKQDCYEMSWIDSVLRWASFDNTTKPIVLLNRTGDLSNLLKRKSDYVQ  387

Query  1189  TPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDE  1368
              P+PR+G+E IF+KM+ L    + FNPYGGRMAEI     PFPHR+G +  IQY+ NW E
Sbjct  388   EPIPRDGLESIFQKMISLGKAGIVFNPYGGRMAEIREDETPFPHRAGILFKIQYSVNWKE  447

Query  1369  HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGL  1548
              G  A + +L   R LY +MTPFVSKNPR+A+LNYRDLD+G N       S  EG+ YG 
Sbjct  448   EGTAAEKEHLSQIRDLYSFMTPFVSKNPRQAYLNYRDLDIGTNDQGPH--SLEEGRVYGT  505

Query  1549  KYFKENYNRLVKIKTKVDPDNFFRDEQSIPT  1641
             KYFK N++RLVK+K+KVDP NFFR+EQSIPT
Sbjct  506   KYFKNNFDRLVKVKSKVDPSNFFRNEQSIPT  536



>ref|XP_008225758.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=531

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/499 (56%), Positives = 371/499 (74%), Gaps = 5/499 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL  + +   PI  V+YTP N SF SVL   I+N RF+   T KPL IV A H SH+Q
Sbjct  35    LQCLPKQFHSGRPILEVVYTPQNTSFRSVLMARIKNRRFSSPTTPKPLAIVAAKHESHVQ  94

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+I+CAK+HGLQ++ RSGGHDYEG+SYVS VPF +LDMF+F+SV+V+++DE+AWVE+GAT
Sbjct  95    ATIVCAKQHGLQIRIRSGGHDYEGLSYVSHVPFVVLDMFHFQSVDVNVKDESAWVESGAT  154

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LG++YY IA K+ VHGFPAGVCPTVG GGHF G GYGN+MRKYGL++DNI+DAKL+D NG
Sbjct  155   LGKIYYKIAEKTKVHGFPAGVCPTVGAGGHFSGGGYGNLMRKYGLSIDNIVDAKLVDANG  214

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+LDRKSMGE++FWA+ GGG +SF V+LS+++ LVRVP KVT+F+V RT +Q  T+++Y 
Sbjct  215   RILDRKSMGEDIFWALRGGGGASFGVILSWKLKLVRVPEKVTVFNVTRTLEQGVTDVLYK  274

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++  L  +LF+R   ++ N T   G+KT   +F   FLG +  LL  M+E FPELGL
Sbjct  275   WQFVAPVLPKDLFLRARPEIDNNTE--GKKTAEVSFIGHFLGQTDKLLPLMNERFPELGL  332

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              + DC E+ WIESV+F+  FP GTPV  LL++    +   K KSDY++ P+P+  IE++F
Sbjct  333   RRKDCHEVSWIESVVFWDEFPLGTPVTILLNQTGTAIPFFKAKSDYVKKPIPKKVIEYMF  392

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNW-DEHGYEAAQHYLE  1401
             K M+E+      +NPYGGRM+EI ++A P+PHR+GN+ MIQY T+W  + G EA   Y+ 
Sbjct  393   KAMLEIGNIWTEWNPYGGRMSEISASATPYPHRAGNLYMIQYYTSWYQDEGIEATNRYIH  452

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
             +TR+LYE M PFVS+NPREAF NYRDLD+G N +   +      + YG KYFK N+ RLV
Sbjct  453   LTRKLYEKMAPFVSRNPREAFQNYRDLDIGANLDN--QSDLLTARVYGSKYFKGNFERLV  510

Query  1582  KIKTKVDPDNFFRDEQSIP  1638
             ++KT VDP NFF+ EQSIP
Sbjct  511   RVKTVVDPHNFFKHEQSIP  529



>ref|XP_006307149.1| hypothetical protein CARUB_v10008739mg [Capsella rubella]
 gb|EOA40047.1| hypothetical protein CARUB_v10008739mg [Capsella rubella]
Length=558

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/507 (58%), Positives = 372/507 (73%), Gaps = 6/507 (1%)
 Frame = +1

Query  133   ATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             + T  +CL   S+P HPISP ++ P NGS+SSVL+ YIRNLRFN S T KP  I+ ATH 
Sbjct  41    SDTFTQCLTSNSDPKHPISPALFFPGNGSYSSVLEAYIRNLRFNTSNTPKPFLIIAATHE  100

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAW  486
             SH+QA++ C K H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV+V +  +TAW
Sbjct  101   SHVQAAVACGKYHKLQMKIRSGGHDYDGLSYVTRSGKPFFVLDMFNLRSVDVDVASKTAW  160

Query  487   VEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAK  666
             V+ GATLGEVYY I  KS    +PAGVCPTVGVGGH  G GYGN+MRKYGLTVDN +DA+
Sbjct  161   VQTGATLGEVYYYIWEKSKTLAYPAGVCPTVGVGGHVSGGGYGNLMRKYGLTVDNTLDAR  220

Query  667   LIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNA  846
             +++VNG++LDRK MGE+LFWAI GGG SS+ VVL+Y++NLV VP  VT+F+V RT +Q+A
Sbjct  221   MVNVNGKILDRKLMGEDLFWAINGGGGSSYGVVLAYKLNLVDVPETVTVFNVSRTLEQDA  280

Query  847   TNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDES  1026
             T IVY +Q+++ +L   +FIRL +DVVN T    +KT+R  F  +FLGD+ TLLS ++  
Sbjct  281   TEIVYRWQKVAPELPDEVFIRLFIDVVNGTVST-QKTVRVAFICMFLGDATTLLSILNRR  339

Query  1027  FPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
              PELGL +SDC E  W++SV  +T+   GT    LL R  Q   +LKRKSDY++ P+ R 
Sbjct  340   LPELGLVRSDCIETSWVQSVFLWTNMKVGTSERVLLDR-NQTTNYLKRKSDYVREPISRT  398

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G+E I+KKM+EL+ P + FNPYGG M  I S A PFP+R GN+  IQYA NW E      
Sbjct  399   GLESIWKKMIELEIPTMAFNPYGGAMGRISSTATPFPYRFGNLWKIQYAANWRED--RLT  456

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
                +E+ R+LY++MTPFVSKNPR++F NYRD+DLG N + G+ +SY EGK YG KYF  N
Sbjct  457   DRNIELARELYQFMTPFVSKNPRQSFYNYRDVDLGTNPHNGKIRSYVEGKRYGKKYFAGN  516

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             + RLVKIKT+VD  NFFR+EQSIP  P
Sbjct  517   FERLVKIKTRVDSGNFFRNEQSIPVLP  543



>ref|XP_010478500.1| PREDICTED: reticuline oxidase-like protein isoform X1 [Camelina 
sativa]
Length=553

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/501 (58%), Positives = 371/501 (74%), Gaps = 6/501 (1%)
 Frame = +1

Query  133   ATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             + T  +CL   S+  HPISP ++   NGS+SSVL+  IRNLRFN S T KP  I+ ATH 
Sbjct  41    SETFTQCLTSNSDQKHPISPAVFFAGNGSYSSVLESNIRNLRFNTSNTPKPFLIIAATHE  100

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETAW  486
             SH+QA++ C K H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV V +  +TAW
Sbjct  101   SHVQAAVTCGKHHNLQMKIRSGGHDYDGLSYVTHSGKPFFVLDMFNLRSVEVDVASKTAW  160

Query  487   VEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAK  666
             V+ GATLGEVYY I  KS    +PAGVCPTVGVGGH  G GYGNMMRKYGLT+DN +DA+
Sbjct  161   VQTGATLGEVYYHIWEKSKTLAYPAGVCPTVGVGGHISGGGYGNMMRKYGLTIDNTLDAR  220

Query  667   LIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNA  846
             ++DVNG +LDRK MGE+LFWAI GGG SS+ VVL+Y++NLV VP  V +F++ RT +Q+A
Sbjct  221   MVDVNGNILDRKLMGEDLFWAINGGGGSSYGVVLAYKLNLVEVPQTVNVFNISRTQEQDA  280

Query  847   TNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDES  1026
             T IVY +Q+++ +L   LFIRL +DVVN T    +KT+RATF  +FLGD+ TLLS ++  
Sbjct  281   TEIVYRWQQVAPELPDELFIRLFIDVVNGTVS-SQKTVRATFIGMFLGDTTTLLSILNRR  339

Query  1027  FPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             FPELGL +SDC E  W++SV F+T+   G+  + LL R  Q   +LKRKSDY++ P+ R 
Sbjct  340   FPELGLVRSDCIETSWVQSVFFWTNIQVGSSEKVLLDR-NQTTNYLKRKSDYVREPISRT  398

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G+E I+KKM++L+ P + FNPYGG M  IPS A PFP+R+GN+  IQYA NW E+     
Sbjct  399   GLESIWKKMIQLEIPTMAFNPYGGAMGRIPSTATPFPYRAGNLWKIQYAANWKEN--RLT  456

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
               Y+E+TR+LY++MTPFVSKNPR++F NYRD+DLG N + G+ +SY EG  YG KYF  N
Sbjct  457   DRYIELTRELYQFMTPFVSKNPRQSFYNYRDVDLGTNTHNGKIRSYVEGNRYGKKYFSGN  516

Query  1567  YNRLVKIKTKVDPDNFFRDEQ  1629
             + RLVKIKT+VD  NFFR+E+
Sbjct  517   FERLVKIKTRVDSGNFFRNEE  537



>ref|XP_010519037.1| PREDICTED: reticuline oxidase-like protein [Tarenaya hassleriana]
Length=530

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/504 (56%), Positives = 365/504 (72%), Gaps = 10/504 (2%)
 Frame = +1

Query  151   CLNDR----SNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             CLND      +P+ P++ + Y P +  F +VL+ Y+RNLRF    T+KP+ IVTA  +SH
Sbjct  33    CLNDYHYRFGDPNIPVADLTYGPKHPLFLTVLKNYVRNLRFYNDSTRKPVLIVTAGEVSH  92

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +Q +ILCAK  GL+++ RSGGHDY+G+SY SD  F +LDM N RS+      +TAWV AG
Sbjct  93    VQGAILCAKARGLELRIRSGGHDYDGLSYNSDKDFVLLDMSNLRSIEFDPSLDTAWVGAG  152

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY IANKS+V  FPAG+CP +G GGHF G GYG MMRKYGL+VDNI+DA+ IDV
Sbjct  153   ATLGELYYVIANKSDVKAFPAGLCPGLGTGGHFSGGGYGAMMRKYGLSVDNIVDAQFIDV  212

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NG+ LDR SMGE+LFWA+ GGGA+SF VV++++I LV VP KVT+F+V RT +  ATNI+
Sbjct  213   NGKALDRNSMGEDLFWALRGGGAASFGVVMAWKIKLVPVPEKVTVFTVSRTVEDGATNII  272

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
               +Q +S K+D +LFIRLT+ V N T     KT++ TF  +FLG S+ LL  M+  FPEL
Sbjct  273   LKWQEVSDKIDNDLFIRLTLSVTNATKS--GKTVKGTFTGMFLGGSEKLLEVMNSGFPEL  330

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL ++DC EM+WIESVL+  S P  TP   LL R+P+ L++LKRKSDY+Q P+P+ G+E 
Sbjct  331   GLNKTDCTEMKWIESVLYMFSIPKDTPTSVLLERIPKQLIYLKRKSDYVQEPIPKTGLES  390

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             IF+ M E +   + +NPYGGRM+EI     PFPHR+GN  +IQY+ NW E G + A  YL
Sbjct  391   IFEVMAENEKVSMAWNPYGGRMSEISDKETPFPHRAGNKFLIQYSANWFEPGNDIADVYL  450

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
               T +L+E M P+VSKNPREAFLNYRD+D+G N N     +Y EGK YG KYFK N+ RL
Sbjct  451   NQTERLFEAMGPYVSKNPREAFLNYRDIDIGTNAN----STYDEGKVYGTKYFKNNFERL  506

Query  1579  VKIKTKVDPDNFFRDEQSIPTFPG  1650
             V +KT+VDPDN+FR EQSIP   G
Sbjct  507   VSVKTRVDPDNYFRYEQSIPVRSG  530



>gb|KHN44659.1| Reticuline oxidase-like protein [Glycine soja]
Length=428

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/431 (64%), Positives = 343/431 (80%), Gaps = 5/431 (1%)
 Frame = +1

Query  361   MKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATLGEVYYGIANKS  540
             MK RSGGHDYEGVSYVS+VPFFILDMFN RS+ V I+ ETAWV+AGATLGEVYY IA KS
Sbjct  1     MKIRSGGHDYEGVSYVSEVPFFILDMFNLRSIKVEIDTETAWVQAGATLGEVYYRIAEKS  60

Query  541   NVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGRLLDRKSMGEEL  720
               H FPAGVC TVGVGGH  G GYGNMMRKYGL+VDN+IDA+++D  GRLLDRKSMGE+L
Sbjct  61    KTHAFPAGVCHTVGVGGHISGGGYGNMMRKYGLSVDNVIDAQMVDAQGRLLDRKSMGEDL  120

Query  721   FWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCYQRMSHKLDPNL  900
             FWAITGGG +SF V+L+Y+I LVRVP  VT+F V RT +QNAT+IVY +Q ++  +D +L
Sbjct  121   FWAITGGGGASFGVILAYKIKLVRVPETVTVFKVGRTLEQNATDIVYNWQHVAPTIDNDL  180

Query  901   FIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGLTQSDCREMRWIE  1080
             FIR+ ++VVN  T  G KT+RA F ALFLGDSK+L+S + + FP+LGL QSDC E  W+ 
Sbjct  181   FIRVILNVVN-GTQNGTKTVRARFIALFLGDSKSLVSLLSDKFPQLGLKQSDCIETSWLR  239

Query  1081  SVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFKKMVELQTPMLT  1260
             SVLF+ +    + ++ LL R P+ L ++KRKSDY++ P+ + G E I+KKM+EL+  +  
Sbjct  240   SVLFWDNIDIASSLDILLERQPRSLSYMKRKSDYVKKPISKEGFEMIWKKMIELEDTLFL  299

Query  1261  FNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEITRQLYEYMTPFV  1440
             FNPYGGRMAEIPS A PFPHR+GN+  IQY  NW++ G   A HY+ +TR L+++MTPFV
Sbjct  300   FNPYGGRMAEIPSTASPFPHRAGNLWKIQYQANWNKPG--VADHYINLTRNLHKFMTPFV  357

Query  1441  SKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVKIKTKVDPDNFFR  1620
             SKNPREAF NY+DLDLGINHN   + SY EG+ YGL+YFK+N++RLV+IKTKVDP NFFR
Sbjct  358   SKNPREAFYNYKDLDLGINHNG--KNSYAEGRVYGLEYFKDNFDRLVQIKTKVDPHNFFR  415

Query  1621  DEQSIPTFPGR  1653
             +EQSIPT P R
Sbjct  416   NEQSIPTLPYR  426



>ref|XP_008228986.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=570

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/502 (56%), Positives = 373/502 (74%), Gaps = 10/502 (2%)
 Frame = +1

Query  145   LECLNDRSNPSH-PISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHI  321
             L+CLN  +NPS   +S +IY  NN S+SSVL+ YIRN RFN + T KP+ IVT +  SH+
Sbjct  36    LQCLNTNTNPSSTQLSNIIYAENNPSYSSVLRAYIRNSRFNTTSTPKPVLIVTPSASSHV  95

Query  322   QASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGA  501
             QAS++CAK+  +Q++ RSGGHDYEG+SY SD  F +LDMFN R+V V IED + WV+AGA
Sbjct  96    QASVVCAKQLAIQLRIRSGGHDYEGLSYWSDQTFIVLDMFNLRTVTVDIEDSSVWVQAGA  155

Query  502   TLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVN  681
             TLGE+YY I+ KS VHGFPAGVCPTVG+GGH  G GYGNM+RK+GL VDN++DA+++D  
Sbjct  156   TLGELYYRISEKSKVHGFPAGVCPTVGIGGHISGGGYGNMLRKFGLAVDNVLDAQIVDAK  215

Query  682   GRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVY  861
             GRLLDRK+MGE+LFWAI GGG  SF V+++Y++ L+ VP  VT+F   RT ++NAT++V 
Sbjct  216   GRLLDRKAMGEDLFWAIKGGGGGSFGVIVAYKLKLISVPKTVTVFQAARTLEENATDVVS  275

Query  862   CYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELG  1041
              +Q ++   D  LF+RL +        PG  T++AT  A FLG++  L+S + + FPELG
Sbjct  276   RWQEVAPTTDDGLFMRLLL-------QPGSNTVKATIMAEFLGNADQLVSLLGKQFPELG  328

Query  1042  LTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
             L + DC+EM WIESVL++ ++ +GT  + LL R P     LKRKSDY+QTP+ +N +E +
Sbjct  329   LKKDDCKEMSWIESVLWWANYDNGTSPDVLLDRNPDHANFLKRKSDYVQTPISKNRLELV  388

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             +KKM+E+    L FNPYGG M+ IP++A PFPHR+G++  +QY+ +W E G EA ++Y  
Sbjct  389   WKKMIEIGKIGLVFNPYGGMMSRIPASATPFPHRAGSLFKVQYSVSWGEAGAEAEKNYTR  448

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
              TR+L+ +MTPFVSKNPR AFLNYRDLD+G+  NK   +SY +GK YGLKYF +N+ RLV
Sbjct  449   DTRRLFRFMTPFVSKNPRSAFLNYRDLDIGV--NKFGNRSYEQGKVYGLKYFNDNFERLV  506

Query  1582  KIKTKVDPDNFFRDEQSIPTFP  1647
             K+KT VDP NFFR+EQSIP  P
Sbjct  507   KVKTAVDPANFFRNEQSIPPLP  528



>ref|XP_007158997.1| hypothetical protein PHAVU_002G199500g [Phaseolus vulgaris]
 gb|ESW30991.1| hypothetical protein PHAVU_002G199500g [Phaseolus vulgaris]
Length=527

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/506 (55%), Positives = 374/506 (74%), Gaps = 7/506 (1%)
 Frame = +1

Query  130   CATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATH  309
              + T+ +CL+  S+PSHPIS V Y PNN S+  +L+ YIRNLRF+   T KP FIV   H
Sbjct  19    VSDTIPQCLSLHSDPSHPISAVTYFPNNSSYPPILEAYIRNLRFSSPTTPKPSFIVAPNH  78

Query  310   LSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWV  489
             +SHIQASI+C K+ GL+M+ RSGGHDY+G+SYV+  PF ILDMF  RSV V+++D++ WV
Sbjct  79    VSHIQASIICCKKFGLEMRIRSGGHDYDGLSYVAKAPFAILDMFMLRSVKVNVQDQSVWV  138

Query  490   EAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKL  669
             ++G+T+GE+YY IA KS + GFPAGVC TVGVGGHF G GYGNMMR++G++VD+I+DA +
Sbjct  139   DSGSTIGELYYQIAEKSKILGFPAGVCHTVGVGGHFSGGGYGNMMRRFGISVDHIVDALI  198

Query  670   IDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNAT  849
             +D  GR+LDRK MGE+LFWAI GGG +SF V++S++I LV VP  VT+F + +T +Q A+
Sbjct  199   VDAEGRVLDRKGMGEDLFWAIRGGGGASFGVIVSWKIKLVPVPQVVTVFRIEKTLEQGAS  258

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
             +IV+ +Q +++K+   LFIR+   V++  T  G+KTIRA FNALFLG+++ L+  M+ SF
Sbjct  259   DIVHQWQYVANKIHDGLFIRV---VISPVTRMGKKTIRAKFNALFLGNAQELVHVMNASF  315

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNG  1209
             P+LGL    C +M WI+SVLF+ + P GT    LL R       LK+KSDY+Q P+ +  
Sbjct  316   PQLGLVGEQCTQMSWIDSVLFWDNHPVGTSANALLQRHDAPEKFLKKKSDYVQKPISKTD  375

Query  1210  IEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQ  1389
             +E I+KKM+EL+ P+ TFNPYGG+M+EI     PFPHR+GN+  IQY+ NW E G + A 
Sbjct  376   LEGIWKKMMELEKPVFTFNPYGGKMSEISEQETPFPHRAGNLYKIQYSVNWKEKGEDVAN  435

Query  1390  HYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGR-RKSYFEGKTYGLKYFKEN  1566
              YL   R LY+YMTP+VS +PR ++LNYRD+D+G+N   GR   +Y E   +G KYFK N
Sbjct  436   GYLSSIRSLYDYMTPYVSSSPRSSYLNYRDVDIGVN---GRGNATYAEASVWGKKYFKTN  492

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTF  1644
             ++RLVKIKT+VDP NFFR EQSIP+ 
Sbjct  493   FDRLVKIKTRVDPSNFFRYEQSIPSL  518



>ref|XP_004162849.1| PREDICTED: LOW QUALITY PROTEIN: reticuline oxidase-like protein-like 
[Cucumis sativus]
Length=538

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/501 (56%), Positives = 374/501 (75%), Gaps = 6/501 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPIS-PVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T+L CL D S+PS      V + P+N S+S VL  YIRNLRF    T KPLFIVT TH+S
Sbjct  27    TLLHCLFDHSSPSSSPISEVTFFPDNPSYSPVLNSYIRNLRFTSPTTPKPLFIVTPTHVS  86

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+QA++LC + H L+++ RSGGHDY+G+SYVS  PF ILDMFN RSV V IEDE+AWV++
Sbjct  87    HVQATVLCCRIHALEIRIRSGGHDYDGLSYVSASPFVILDMFNLRSVAVDIEDESAWVDS  146

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGEVYY IA KS +HGFPAGVCPTVGVGGH  GAGYGN+MRK+G++VDN++DA ++D
Sbjct  147   GATLGEVYYKIAEKSKIHGFPAGVCPTVGVGGHLSGAGYGNLMRKFGVSVDNVVDALIVD  206

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNGR+LDR++MGE+LFWAI GGG +SF V++S++  LV +P  VT+F   +T ++   +I
Sbjct  207   VNGRVLDRETMGEDLFWAIRGGGGASFGVIVSWKFKLVLLPETVTVFRTEKTIEEGVVDI  266

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             ++ +Q ++  +D NLFIR+ +  VN  T   +KT +A F +LFLG+++ L + M E FPE
Sbjct  267   LHKWQEIADTIDENLFIRVVILPVNXKT---QKTAKAKFVSLFLGNAQKLFALMSERFPE  323

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LG+   DC+EM WIES+LF++++P GTP+  LL R P     LK+KSDY+Q P+ +  +E
Sbjct  324   LGIKDEDCKEMSWIESILFWSNYPIGTPLNVLLERQPNSEKFLKKKSDYVQEPISKADLE  383

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              + +KM+EL+ P LTFNPYGG+M++IP    PFPHR+GN   IQY+  W E G EAA   
Sbjct  384   GMMRKMIELKRPALTFNPYGGKMSQIPETETPFPHRAGNKYKIQYSVTWKEEGDEAAAKN  443

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L+  R+LY+YMTP+VSK+PR A+LNYRD+DLG+N       SY+ G  +G KYFK N++R
Sbjct  444   LKKIRELYKYMTPYVSKSPRSAYLNYRDVDLGVNGIG--NASYWVGSIWGRKYFKGNFDR  501

Query  1576  LVKIKTKVDPDNFFRDEQSIP  1638
             LVK+K+ VDPDNFFR EQSIP
Sbjct  502   LVKVKSMVDPDNFFRYEQSIP  522



>ref|XP_002529891.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF32494.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=524

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/502 (55%), Positives = 367/502 (73%), Gaps = 2/502 (0%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL +   PS PI   IYTPNN SF SVLQ YI+N RF    T KPL IVTA H SH+Q
Sbjct  22    LQCLPNHVEPSKPILEAIYTPNNSSFQSVLQAYIKNRRFLTPSTTKPLAIVTALHESHVQ  81

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++CAK HG+Q++ RSGGHD+EG+SY+SDVPF ILDMFN RS+++ I  ETAWV+AGA 
Sbjct  82    ATVVCAKYHGMQLRIRSGGHDFEGLSYMSDVPFVILDMFNLRSIDIDIASETAWVQAGAI  141

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY IA KS VH FPAG+C T+G GGHF G GYG MMRKYGL+VD+IIDA+++DVNG
Sbjct  142   LGELYYKIAKKSKVHAFPAGICLTLGAGGHFSGGGYGTMMRKYGLSVDHIIDAQIVDVNG  201

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              +LDRKSMGE+LFWAI GGG +SF V+LS++I LVRVP KVTIFSV+RT +Q AT IVY 
Sbjct  202   NILDRKSMGEDLFWAIRGGGGASFGVILSWKIKLVRVPAKVTIFSVQRTLEQGATGIVYK  261

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q+++ K+D  LFIR   +V N      +KT+R TF   FLG +  LL+ M++ FPELGL
Sbjct  262   WQQVAKKIDKELFIRAQPEVQNPRNATEKKTVRVTFIGQFLGQTSKLLTLMNKKFPELGL  321

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              Q DC+++ W++S +F+T+ P  +P E LL+R     +  K KSDY++  + +  +E I+
Sbjct  322   KQEDCKQVSWLQSTMFWTNLPIESPPEVLLNRTIPAELFFKSKSDYVKDVISKKDLEKIW  381

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             K  ++ +  ++ +N YGGRM+EIP  + PFPHR+G +  IQY T W + G EA+  ++ +
Sbjct  382   KMFLKTEGMVMQWNLYGGRMSEIPDTSTPFPHRAGYLFKIQYFTLWFQEGTEASNRHISL  441

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
              R++Y+ M P+VSK+PREAFLNYRDLD+G   N     ++ E + YG KYF+ N+ RL +
Sbjct  442   AREMYDSMAPYVSKDPREAFLNYRDLDIG--SNPSNLTNFEEAEVYGHKYFRNNFRRLTE  499

Query  1585  IKTKVDPDNFFRDEQSIPTFPG  1650
             +K +VDPDNFF++EQSIP  P 
Sbjct  500   VKKRVDPDNFFKNEQSIPPLPA  521



>ref|XP_009362291.1| PREDICTED: reticuline oxidase-like protein [Pyrus x bretschneideri]
Length=532

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/503 (56%), Positives = 369/503 (73%), Gaps = 15/503 (3%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL++ S+ S+PIS  ++TP + SFSS+LQ Y+RNLRF +    KP+ I+ A H SH+Q
Sbjct  35    LQCLSNHSHSSNPISEALFTPKSASFSSILQSYVRNLRFMDPIIPKPMVIIAAKHESHVQ  94

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVS--DVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             A+++CAK  GL+++ RSGGHDYEGVSYVS     F +LDMFN RS+NV + DE+AWV++G
Sbjct  95    ATVICAKTLGLEIRIRSGGHDYEGVSYVSRDAKDFILLDMFNLRSINVDLADESAWVQSG  154

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             A LGE++Y I  KS  H FPAGVCPT+G GGHF G GYGNMMRKYGL+ DNI+DAK+++V
Sbjct  155   AILGEIFYAIFKKSKYHAFPAGVCPTIGAGGHFTGGGYGNMMRKYGLSSDNIVDAKIVNV  214

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NG +LDRKSM E+LFWAI GGG SSF V+L+++I LVRVP  VT+F V++T  + AT+I+
Sbjct  215   NGTILDRKSMREDLFWAIRGGGGSSFGVILAWKIKLVRVPAMVTVFDVKKTLAEGATDIL  274

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
               +Q+++ KLD +LFIR     VN       +TI  +F +LFLG+S  LL  M +S P+L
Sbjct  275   VKWQQVADKLDNDLFIRAVHKPVN-------RTIEVSFVSLFLGNSDRLLKLMSQSLPQL  327

Query  1039  GLTQSDCREMRWIESVLFYTSFPSG-TPVEELLSRVPQV-LVHLKRKSDYLQTPMPRNGI  1212
             GL + DC EM WI+SVLF+  + +G TP + LL+R P    V LKRKSDY++ P+ +  +
Sbjct  328   GLQKKDCIEMSWIQSVLFWADYRNGTTPPDVLLNRFPSSGKVFLKRKSDYVKEPISKTDL  387

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E ++K M+ +   M+ +NPYGG+M+EIP  A PFPHR+GN+  IQY+ NW E G EA + 
Sbjct  388   EALWKVMIGIGEVMMLWNPYGGKMSEIPETATPFPHRAGNLFKIQYSVNWKEEGVEATKK  447

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             YL + R+L+E MTP VSKNPREAF NYRDLD+G N   G    Y E K YG KYFK N+ 
Sbjct  448   YLRLMRKLFEAMTPHVSKNPREAFYNYRDLDVGTNLKGG----YTEAKVYGTKYFKGNFE  503

Query  1573  RLVKIKTKVDPDNFFRDEQSIPT  1641
             RLV+IKT VDPDNFFR+EQSIPT
Sbjct  504   RLVRIKTAVDPDNFFRNEQSIPT  526



>emb|CDP21199.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/498 (58%), Positives = 369/498 (74%), Gaps = 3/498 (1%)
 Frame = +1

Query  151   CLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQAS  330
             CL     PS+ IS ++Y+P+N SFSSVL  Y+RN R N   T+KP  IVT   + HIQA+
Sbjct  33    CLTRNGIPSNQISKILYSPSNSSFSSVLDAYVRNKRLNTPTTRKPSIIVTPLQVQHIQAA  92

Query  331   ILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATLG  510
             ILC K  GLQ+  RSGGHD+EG+SYVSDVPF ILD+FN RS+NV    ETAWV+AGATLG
Sbjct  93    ILCTKGTGLQLNIRSGGHDFEGLSYVSDVPFIILDLFNLRSINVDTATETAWVQAGATLG  152

Query  511   EVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGRL  690
             E+YY I  KSN+ GFPAG+CPTVGVGGH  G GYG+++R+YGLTVDN++DA++IDVNGR+
Sbjct  153   ELYYRIWEKSNILGFPAGLCPTVGVGGHISGGGYGSLLRRYGLTVDNVLDAQIIDVNGRV  212

Query  691   LDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCYQ  870
             LDRK+MGE+LFWAI GGG +SF VVL+YRI LVRVP   T+F+V++T  +NAT+++Y +Q
Sbjct  213   LDRKAMGEDLFWAIRGGGGASFGVVLAYRIRLVRVPEIHTVFNVQKTEAENATDVLYKWQ  272

Query  871   RMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGLTQ  1050
              ++ K+D +LFIR+ V  +      G+K IR TF   FLGD+  L+S M+  FPELGL +
Sbjct  273   NIADKIDNDLFIRVLVQPITGKVK-GQKIIRLTFMGHFLGDANRLISVMNIGFPELGLKR  331

Query  1051  SDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFKK  1230
             SDC E  WI+++L++  +  GT  E LLSR    L+ LKRKSDY+Q P+P++G+  +FKK
Sbjct  332   SDCLETSWIDTMLWWYKYKIGTAKEVLLSRAYDQLIFLKRKSDYVQNPIPKDGLVSLFKK  391

Query  1231  MVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEITR  1410
             MV+L    L FNPYGGRM+EIP    PFPHR+G I  IQY+ NW++        Y+   R
Sbjct  392   MVQLGKTGLVFNPYGGRMSEIPENETPFPHRAGIIFKIQYSVNWEDADPNLINQYVGEAR  451

Query  1411  QLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVKIK  1590
              LY +MTPFVSKNPR+AFLNYRDLD+G   N   + SY EG+ YG+KYFK N++RLVK+K
Sbjct  452   NLYSFMTPFVSKNPRQAFLNYRDLDIGTTDNG--KNSYNEGQVYGVKYFKNNFDRLVKVK  509

Query  1591  TKVDPDNFFRDEQSIPTF  1644
             T VDP NFFR+EQSIPT 
Sbjct  510   TMVDPQNFFRNEQSIPTL  527



>ref|XP_008220339.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=616

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/502 (56%), Positives = 374/502 (75%), Gaps = 10/502 (2%)
 Frame = +1

Query  145   LECLNDRSNPSHP-ISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHI  321
             L+CLN  +NPS   +S +IY  NN S+SSVL+ YIRN RFN + T KP+ IVT +  SH+
Sbjct  72    LQCLNTNTNPSSTQLSNIIYAQNNPSYSSVLRAYIRNSRFNTTSTPKPVLIVTPSAASHV  131

Query  322   QASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGA  501
             QAS++CAK+ G+Q++ RSGGHDYEG+SY SD  F +LDMFN RSV V IED + WV+AGA
Sbjct  132   QASVVCAKQLGIQLRIRSGGHDYEGLSYWSDKTFIVLDMFNLRSVTVDIEDSSVWVQAGA  191

Query  502   TLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVN  681
             TLGE+YY I+ KS VHGFPAGVCPTVG+GGH  G GYGNM+RK+GL VDN++DA+++D  
Sbjct  192   TLGELYYRISEKSKVHGFPAGVCPTVGIGGHISGGGYGNMLRKFGLAVDNVLDAQIVDAK  251

Query  682   GRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVY  861
             GRLLDRK+MGE+LFWAI GGG  SF V+++Y++ LV VP  VT+F   RT ++NAT+ V 
Sbjct  252   GRLLDRKAMGEDLFWAIKGGGGGSFGVIVAYKLKLVSVPETVTVFQAARTLEENATDFVS  311

Query  862   CYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELG  1041
              +Q ++   D  LF+R+ +        PG  T++AT  A FLG++  L+S + + FPELG
Sbjct  312   KWQEVAPTTDDGLFMRMLL-------QPGSNTVKATIIAEFLGNADQLVSLLGKQFPELG  364

Query  1042  LTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
             L + DC+EM WIESVL++ ++ +GT  + LL R P     LKRKSDY+QTP+ ++ +E +
Sbjct  365   LKEEDCKEMSWIESVLWWDNYDNGTSPDVLLDRNPDHANFLKRKSDYVQTPISKSRLELL  424

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             +KKM+E+    L FNPYGG M+ IP++A PFPHR+GN+  +QY+ +W E G EA  +Y  
Sbjct  425   WKKMIEIGKIGLVFNPYGGMMSRIPASATPFPHRAGNLFKVQYSVSWGEAGAEAENNYTT  484

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
              TR+L+ ++TPFVSKNPR AFLNYRDLD+G+  NK   +SY +GK YGLKYF +N++RLV
Sbjct  485   DTRRLFRFLTPFVSKNPRSAFLNYRDLDIGV--NKFGNRSYEQGKVYGLKYFNDNFDRLV  542

Query  1582  KIKTKVDPDNFFRDEQSIPTFP  1647
             K+KT VDP+NFFR+EQSIP  P
Sbjct  543   KVKTAVDPENFFRNEQSIPPNP  564



>ref|XP_011040559.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=530

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/512 (55%), Positives = 374/512 (73%), Gaps = 8/512 (2%)
 Frame = +1

Query  118   PLCYCATTV---LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             PL    T++   L+CL   S+ S+P+S  IY   N SF   L+ Y +  RF  S T KPL
Sbjct  20    PLATSDTSLDRFLKCLPSHSDSSYPVSRAIYRITNSSFEPTLRAYAKASRFLTSTTPKPL  79

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
              I+ ATH SH+QA+++CAK +GLQ++ RSGGHDYEG+SYVS+VPF ILD FN RS+++ +
Sbjct  80    AIIAATHESHVQATVICAKSNGLQIRIRSGGHDYEGLSYVSNVPFVILDTFNLRSIDIDV  139

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
               +TAW+++GAT GE+YY IANKSNV  FPAGVC T+G GGHF G GYG +MRK+GL++D
Sbjct  140   AGKTAWIQSGATTGELYYNIANKSNVLAFPAGVCLTLGAGGHFSGGGYGPLMRKHGLSID  199

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             NI DAK++DVNG++LDRKSMGE+LFWAI GGG +SF V+LS++I+LV VPPKVT F+V +
Sbjct  200   NIFDAKIVDVNGKILDRKSMGEDLFWAIRGGGGASFGVILSWKISLVDVPPKVTTFTVSK  259

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T +Q AT++VY +Q ++ KLD  LFIR+   VV+ ++    KT+R +F  LFLG S  LL
Sbjct  260   TLEQGATDVVYRWQEVASKLDKELFIRVMPRVVDGSSG-SNKTVRVSFIGLFLGPSCKLL  318

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQ  1188
               M  SFPELGL Q DC EM W+ES L++   P+GT +E LL R P      KRKSDY+Q
Sbjct  319   PLMKNSFPELGLQQKDCNEMSWVESTLYWFGLPNGTSIETLLDR-PTRASFFKRKSDYVQ  377

Query  1189  TPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNW-D  1365
               +P+ G+E I+K M++++   + +NPYGGRM EIP+ A  FPHR+GN+  IQY+ +W D
Sbjct  378   KAIPKKGLEKIWKTMIKVERVWMQWNPYGGRMDEIPATATAFPHRAGNLFKIQYSVDWSD  437

Query  1366  EHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYG  1545
             + G EAA HY+++  QLY+ MTP+VS NPREAFLNYRD+D+G   N   + S+ + K YG
Sbjct  438   QEGIEAANHYIDLITQLYDTMTPYVSSNPREAFLNYRDVDIG--SNPSNQTSFEKAKVYG  495

Query  1546  LKYFKENYNRLVKIKTKVDPDNFFRDEQSIPT  1641
              K FK N+ RLVK+K++VDPD+FF+ EQSIP 
Sbjct  496   NKLFKNNFIRLVKVKSRVDPDDFFKYEQSIPA  527



>ref|XP_009362289.1| PREDICTED: reticuline oxidase-like protein [Pyrus x bretschneideri]
Length=528

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/509 (55%), Positives = 371/509 (73%), Gaps = 5/509 (1%)
 Frame = +1

Query  112   WAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLF  291
             WA      T  L+CL  +S P++PI   I+T +N SF SVLQ YIRN RF    T KPL 
Sbjct  23    WATSDPVFTGFLQCLPKQSQPTYPIFEAIFTHDNTSFQSVLQHYIRNSRFLTPTTPKPLA  82

Query  292   IVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIE  471
             IV A H SH+QA+++C K+HGLQ++ RSGGHDYEG+SY S VPF ILDMFN R+++V++ 
Sbjct  83    IVAAKHESHVQATVICVKQHGLQIRLRSGGHDYEGLSYTSAVPFVILDMFNLRAIDVNLA  142

Query  472   DETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDN  651
             +E+AWVE+GATLGE+YY IANKS VHGFPAG C TVG GGHF G GYG MMRKYGLTVDN
Sbjct  143   NESAWVESGATLGELYYEIANKSKVHGFPAGACLTVGAGGHFSGGGYGPMMRKYGLTVDN  202

Query  652   IIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRT  831
             I DAKL++VNG +LDRKSMG++LFWAI GGG +SF V+LS++I L  VP KVT+F+V RT
Sbjct  203   IEDAKLVNVNGTILDRKSMGDDLFWAIRGGGGASFGVILSWKIKLAPVPAKVTVFNVERT  262

Query  832   YDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLS  1011
              +Q AT++ Y +Q ++  L  ++FIR    V+   ++ G+KT++ +F  LFLG S  LL 
Sbjct  263   LEQGATDVAYKWQYVAPTLPDDVFIRAQPLVI---SNKGKKTVKVSFIGLFLGQSDKLLP  319

Query  1012  TMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQT  1191
              M+ESFPELGL Q DC +M WIES +F+ ++P GTP+  LL R        K KSDY++ 
Sbjct  320   LMNESFPELGLQQKDCVQMSWIESTVFWGNYPVGTPINVLLERPNGSGFFFKVKSDYIKE  379

Query  1192  PMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEH  1371
             P+P+ G+EF+++ M+E++  ML +NPYGGRM++   +  PFPHR+GN+ +I Y  +W E 
Sbjct  380   PIPKQGLEFLWQMMLEVEKVMLQWNPYGGRMSQFSESDTPFPHRAGNLFLIHYWIHWSEE  439

Query  1372  GYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLK  1551
             G E A  Y++++R+LYE M PFVSK+PREAF NYRDLD+G   N   + S+   + +G K
Sbjct  440   GSEIANKYIDLSRKLYEGMAPFVSKSPREAFQNYRDLDIGA--NLPNKTSFQTAEVFGRK  497

Query  1552  YFKENYNRLVKIKTKVDPDNFFRDEQSIP  1638
             YF+ N++RLV++KT VDP NFF  EQSIP
Sbjct  498   YFRCNFDRLVRVKTAVDPQNFFNHEQSIP  526



>ref|XP_007217492.1| hypothetical protein PRUPE_ppa026518mg [Prunus persica]
 gb|EMJ18691.1| hypothetical protein PRUPE_ppa026518mg [Prunus persica]
Length=567

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/503 (56%), Positives = 375/503 (75%), Gaps = 11/503 (2%)
 Frame = +1

Query  145   LECLNDRSNPSHP-ISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHI  321
             L+CLN  +NPS   +S +IY  NN S+SSVL+ YIRN RFN + T KP+ IVT +  SH+
Sbjct  32    LQCLNTNTNPSSTQLSNIIYAENNPSYSSVLRAYIRNSRFNTTSTPKPVLIVTPSASSHV  91

Query  322   QASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVS-IEDETAWVEAG  498
             QAS++CAK+ G+Q++ RSGGHDYEG+SY SD  F +LDMFN R+V V  IED + WV+AG
Sbjct  92    QASVVCAKQLGIQLRIRSGGHDYEGLSYWSDQTFIVLDMFNLRTVTVDDIEDSSVWVQAG  151

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY I+ KS VHGFPAG+CPTVG+GGH  G GYGNM+RK+GL VDN++DA+++D 
Sbjct  152   ATLGELYYRISEKSKVHGFPAGICPTVGIGGHISGGGYGNMLRKFGLAVDNVLDAQIVDA  211

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GRLLDRK+MGE+LFWAI GGG  SF V+++Y++ LV VP  VT+F   RT ++NAT IV
Sbjct  212   KGRLLDRKAMGEDLFWAIKGGGGGSFGVIVAYKLKLVPVPETVTVFQAARTLEENATAIV  271

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
               +Q ++   D  LF+RL +        PG  T++AT  A FLG++  L+S + + FPEL
Sbjct  272   SRWQEVAPTTDDGLFMRLLL-------QPGSNTVKATIMAEFLGNADQLVSLLGKQFPEL  324

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL + DC+EM WIESVL++ ++ +GT  + LL R P     LKRKSDY+QTP+ ++ +E 
Sbjct  325   GLKKDDCKEMSWIESVLWWANYDNGTSPDVLLDRNPDHANFLKRKSDYVQTPISKSRLEL  384

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             ++KKM+E+    L FNPYGG M+ IP++A PFPHR+GN+  +QY+ +W E G EA ++Y 
Sbjct  385   VWKKMIEIGKIGLVFNPYGGMMSRIPASATPFPHRAGNLFKVQYSVSWGEAGAEAEKNYT  444

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
               TR+L+ +MTPFVSKNPR AFLNYRDLD+G+  NK   +SY +GK YGLKYF EN++RL
Sbjct  445   TDTRRLFRFMTPFVSKNPRSAFLNYRDLDIGV--NKFGNRSYEQGKVYGLKYFNENFDRL  502

Query  1579  VKIKTKVDPDNFFRDEQSIPTFP  1647
             VK+KT VDP NFFR+EQSIP +P
Sbjct  503   VKVKTAVDPANFFRNEQSIPPYP  525



>ref|XP_008439526.1| PREDICTED: reticuline oxidase-like protein [Cucumis melo]
Length=566

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/482 (57%), Positives = 369/482 (77%), Gaps = 5/482 (1%)
 Frame = +1

Query  193   VIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQASILCAKEHGLQMKAR  372
             V + P+N S+S VL  YIRNLRF    T KPLFIV  TH+SHIQA+ILC + H L+++ R
Sbjct  74    VTFFPDNPSYSPVLNSYIRNLRFASPTTPKPLFIVAPTHVSHIQATILCCRIHALEIRIR  133

Query  373   SGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATLGEVYYGIANKSNVHG  552
             SGGHDY+G+SYVSD PF ILDMFN RSV V IEDE+AWV++GATLGEVYY IA KS +HG
Sbjct  134   SGGHDYDGLSYVSDSPFVILDMFNLRSVAVDIEDESAWVDSGATLGEVYYKIAEKSKIHG  193

Query  553   FPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGRLLDRKSMGEELFWAI  732
             FPAGVCPTVGVGGH  GAGYGN+MRK+G++VDN++DA ++DVNGR+LDR++MGE+LFWAI
Sbjct  194   FPAGVCPTVGVGGHLSGAGYGNLMRKFGVSVDNVVDALIVDVNGRVLDRETMGEDLFWAI  253

Query  733   TGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCYQRMSHKLDPNLFIRL  912
              GGG +SF V++S++  LV +P  VT+F   +T ++   +I++ +Q ++  +D NLFIR+
Sbjct  254   RGGGGASFGVIVSWKFKLVLLPETVTVFRTEKTIEEGVVDILHKWQEIADTIDENLFIRV  313

Query  913   TVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGLTQSDCREMRWIESVLF  1092
              +  VN  T   +KT +A F +LFLG+++ L + M E FPELG+   DC+EM WI+S+LF
Sbjct  314   VILPVNKKT---QKTAKAKFVSLFLGNAQKLFALMSERFPELGIKGEDCKEMSWIDSILF  370

Query  1093  YTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFKKMVELQTPMLTFNPY  1272
             ++++P GTP++ LL R P     LK+KSDY+Q P+ + G+E + +KM+EL+ P LTFNPY
Sbjct  371   WSNYPIGTPLDVLLERQPNSEKFLKKKSDYVQEPISKAGLEGMMRKMIELKRPALTFNPY  430

Query  1273  GGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEITRQLYEYMTPFVSKNP  1452
             GG+M++IP    PFPHR+GN   IQY+  W E G EAA  +LE+ R+LY+YMTP+VSK+P
Sbjct  431   GGKMSQIPETETPFPHRAGNKYKIQYSVTWKEEGDEAAAKHLEMIRELYKYMTPYVSKSP  490

Query  1453  REAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVKIKTKVDPDNFFRDEQS  1632
             R A+LNYRD+DLG+N       SY+EG  +G KYFK N++RLVK+K+ VDPDNFF+ EQS
Sbjct  491   RSAYLNYRDVDLGVNGIG--NASYWEGSIWGRKYFKGNFDRLVKVKSMVDPDNFFKYEQS  548

Query  1633  IP  1638
             IP
Sbjct  549   IP  550



>ref|XP_009354038.1| PREDICTED: reticuline oxidase-like protein [Pyrus x bretschneideri]
Length=531

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/502 (57%), Positives = 371/502 (74%), Gaps = 6/502 (1%)
 Frame = +1

Query  136   TTVLECL-NDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             T  L+CL     N ++PI   IYT  N SF SVL  YIRN R+    T KPL IV A H 
Sbjct  28    TNFLQCLPKQHQNFTYPIFETIYTHKNTSFQSVLLGYIRNSRYATLTTAKPLAIVAAKHK  87

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVE  492
             SH+QA+++CAKEHGLQ++ RSGGHDYEG+SYVSDVPF ILDMFN R++++++ DE+AWV+
Sbjct  88    SHVQATVICAKEHGLQIRIRSGGHDYEGLSYVSDVPFVILDMFNLRAIDINVVDESAWVQ  147

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
             AGATLGE+YY IANKSNVHGFPAGVCPTVG+GGHF G GYG MMRKYGLTVDNI DA+L+
Sbjct  148   AGATLGELYYEIANKSNVHGFPAGVCPTVGIGGHFSGGGYGPMMRKYGLTVDNIEDAQLV  207

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             DV GR+LDRKSMGE+LFWAI GGGA SF V+LS++I L+ VP KVT+F+V+RT +Q+A N
Sbjct  208   DVKGRILDRKSMGEDLFWAIKGGGA-SFGVILSWKIKLLPVPDKVTVFNVKRTPEQDAIN  266

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             ++Y +Q ++ KL  ++FIR    + N T   G+K++  +F  LFLG    L+S ++ESF 
Sbjct  267   VIYRWQYVAPKLPEDIFIRAITRLKNNTE--GKKSVEVSFFGLFLGQRDKLVSLINESFS  324

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL + DC EM W+ES +F+   P GTP+  L SR        K KSDY++ P+P+ GI
Sbjct  325   ELGLQRQDCFEMSWVESTVFWADHPFGTPISVLRSRPQGPPNFFKSKSDYVKEPIPKEGI  384

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E I+K M+++   ++ +NPYGGRMA+IP +  PFPHR+GN+  IQY T W E     ++ 
Sbjct  385   ESIWKAMIKMDKVLMQWNPYGGRMAKIPESETPFPHRAGNLFKIQYVTYWVEESSVTSKI  444

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             +L+  R+LYE MTP+VSK+PREAF NYRDLD+G N N   +  +   + YG KYFK N++
Sbjct  445   HLKFLRKLYEGMTPYVSKSPREAFQNYRDLDIGANLNN--KTEFGTARVYGSKYFKGNFD  502

Query  1573  RLVKIKTKVDPDNFFRDEQSIP  1638
             RLV++KT VDP NFF++EQSIP
Sbjct  503   RLVRVKTMVDPQNFFKNEQSIP  524



>gb|EYU19102.1| hypothetical protein MIMGU_mgv1a022353mg [Erythranthe guttata]
Length=549

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/517 (57%), Positives = 379/517 (73%), Gaps = 19/517 (4%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T ++CL+   N  + I  ++Y PNN SF+SVLQ+YIRN RFN   T+KP  IVT    SH
Sbjct  31    TFVQCLSSNHNTKNQIPNIVYGPNNSSFTSVLQDYIRNPRFNTPATRKPSLIVTPLQESH  90

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +QA+ILC+K+ G+++K RSGGHDYEG+SYVS+VPF ILDMFN RSV+V I+ ETAWV++G
Sbjct  91    VQAAILCSKKIGIELKIRSGGHDYEGISYVSEVPFIILDMFNLRSVSVDIKSETAWVQSG  150

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY I   S VHGFPAGV PTVGVGGH  G GYGNM+RK+GL+VD++IDA+++D 
Sbjct  151   ATLGELYYNIWQNSKVHGFPAGVGPTVGVGGHISGGGYGNMLRKFGLSVDHVIDARIVDA  210

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGR+LDRKSMGE+LFWAI GGG +SF VVL+Y+I LV VPP VT+F V +T ++N T+I 
Sbjct  211   NGRMLDRKSMGEDLFWAIKGGGGASFGVVLAYKIQLVPVPPVVTVFRVAKTLEENVTDIF  270

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTH-----------------PGEKTIRATFNALFL  987
             Y +Q +++K+D NLFIRL V   ++T                   PG+KT+R TF A +L
Sbjct  271   YRWQFVANKIDDNLFIRLLVQPTSLTKKKPNLDMKKKKKPNSGKAPGQKTVRVTFIAQYL  330

Query  988   GDSKTLLSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLK  1167
             G++  LLS M   FPELGLTQ DC E  WI+SVL++ ++ +GT  + LL R        K
Sbjct  331   GNANELLSVMKSQFPELGLTQQDCIETSWIQSVLYWANYNNGTSEKVLLDRKSDSENFFK  390

Query  1168  RKSDYLQTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQ  1347
             RKSDYL+TP+P++G+E ++K ++EL    + FN YGG+M+ I  +  PFPHR+GNI  IQ
Sbjct  391   RKSDYLKTPIPKDGLEGLWKNIIELGKAGMVFNAYGGQMSRIGESETPFPHRNGNIFKIQ  450

Query  1348  YATNWDEHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYF  1527
             Y  NW E G EA + Y+E TR LY YMTP+VSKNPRE++LNYRDLD+G   N   + +Y 
Sbjct  451   YFANWKEQGAEAEKKYIEQTRTLYSYMTPYVSKNPRESYLNYRDLDIGTTSNG--KNTYD  508

Query  1528  EGKTYGLKYFKENYNRLVKIKTKVDPDNFFRDEQSIP  1638
             EGK YG KYFK N++RLVK+KT VDPDNFFR+EQSIP
Sbjct  509   EGKVYGEKYFKGNFDRLVKVKTAVDPDNFFRNEQSIP  545



>ref|XP_011005332.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=530

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/510 (55%), Positives = 373/510 (73%), Gaps = 9/510 (2%)
 Frame = +1

Query  121   LCYCATTV---LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLF  291
             L  C T++   L+CL   S+PS+P+S  IY  +N SF   L+ Y +  RF  S T KPL 
Sbjct  22    LATCETSLDNFLQCLPRHSHPSYPVSRAIYRRSNSSFEPTLRAYAKASRFLTSATPKPLA  81

Query  292   IVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIE  471
             I+ A H SH+QA+++CAK +GLQ++ RSGGHDYEG+SYVS+VPF ILDMFN RS+ + I 
Sbjct  82    IIAAMHESHVQATVICAKRNGLQIRIRSGGHDYEGLSYVSNVPFVILDMFNLRSIEIDIV  141

Query  472   DETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDN  651
              + AW+++GAT+GE+YY IA KSNV  FPAGVC T+G GGH  G GYGNMMRKYGL++DN
Sbjct  142   RKMAWIQSGATIGELYYSIAKKSNVLAFPAGVCFTLGAGGHISGGGYGNMMRKYGLSIDN  201

Query  652   IIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRT  831
             I+DAKL+DVNG++LDRKSMGE+LFWAI G G +SF V+LS++INLV+VPPKVT F+V +T
Sbjct  202   IVDAKLVDVNGKILDRKSMGEDLFWAIRGSGGASFGVILSWKINLVQVPPKVTTFNVAKT  261

Query  832   YDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLS  1011
               + AT++VY +Q ++ KLD  LF+R +  VVN  +  G KTI  +F   FLG S  LL 
Sbjct  262   LKEGATDLVYRWQEVASKLDQELFLRASPQVVNGGSG-GSKTISVSFIGQFLGPSSKLLP  320

Query  1012  TMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQT  1191
              M   FPELGL Q DC EM W+ES L++    SG  ++ LL R P      KRKSDY++T
Sbjct  321   LMKMRFPELGLQQKDCNEMSWVESTLYWFG-RSGRSLDVLLDR-PTQTSFFKRKSDYVKT  378

Query  1192  PMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNW-DE  1368
              +P+ G+E I+K M++++   + +NPYGGRM EIP+ A PFPHR+GN+  IQY+T+W D+
Sbjct  379   VIPKEGLENIWKMMIKVEPIWMQWNPYGGRMDEIPATATPFPHRAGNLFKIQYSTDWSDQ  438

Query  1369  HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGL  1548
              G EA   ++ + RQ+YE MTP+VSKNPREAFLNYRD+D+G   N   + ++ + K YG 
Sbjct  439   EGSEATNRHINLLRQMYEAMTPYVSKNPREAFLNYRDIDIG--SNPSNQTTFEKAKVYGS  496

Query  1549  KYFKENYNRLVKIKTKVDPDNFFRDEQSIP  1638
             K FK+N+ RLVK+K+KVDPDNFF++EQSIP
Sbjct  497   KLFKDNFMRLVKVKSKVDPDNFFKNEQSIP  526



>ref|XP_003532641.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=531

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/508 (54%), Positives = 374/508 (74%), Gaps = 5/508 (1%)
 Frame = +1

Query  121   LCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVT  300
             L   + T+L+CL+  S+PS PIS V Y P N S+  +L+ YIRNLRF+   T KP FIV 
Sbjct  16    LTATSETILQCLSLHSDPSRPISAVTYFPKNPSYPPILEAYIRNLRFSSPTTPKPTFIVA  75

Query  301   ATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDET  480
              TH+SHIQASI+C K   L+++ RSGGHD+EG+SY+S  PF I+DMF  +SV V +ED+T
Sbjct  76    PTHVSHIQASIICCKRFNLEIRTRSGGHDFEGLSYMSQTPFVIVDMFMLKSVEVDVEDQT  135

Query  481   AWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIID  660
             AWV++G+T+GE+YY IA KS V GFPAGVC +VGVGGHF G GYGNMMR++GL+VDN++D
Sbjct  136   AWVDSGSTIGELYYAIAEKSRVLGFPAGVCHSVGVGGHFSGGGYGNMMRRFGLSVDNVLD  195

Query  661   AKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQ  840
             A ++D  GR+LDR +MGE+LFWAI GGG +SF V++S++I LV VP  VT+F + +T +Q
Sbjct  196   ALIVDSEGRVLDRATMGEDLFWAIRGGGGASFGVIVSWKIRLVPVPEVVTVFRIEKTLEQ  255

Query  841   NATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMD  1020
             +A+++V+ +Q ++ K+   LFIR+   V++  T    KTI+A FNALFLG+S+ LLS M+
Sbjct  256   DASDLVFQWQYVADKIHDGLFIRV---VLSPVTRSDRKTIKAKFNALFLGNSQELLSVMN  312

Query  1021  ESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMP  1200
             +SFP+LGL    C +M WI+SVLF+ ++P GT V+ LL R       LK+KSDY+Q P+ 
Sbjct  313   QSFPQLGLVAEQCIQMSWIQSVLFWDNYPVGTSVDVLLQRHATKEKFLKKKSDYVQQPIS  372

Query  1201  RNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYE  1380
             +  +E I+K M+EL+ P+ TFNPYGG+M EI     PFPHR GNI  IQY+ +WDE G +
Sbjct  373   KAALEGIWKMMMELEKPVFTFNPYGGKMGEISEFETPFPHRFGNIFKIQYSVSWDEEGED  432

Query  1381  AAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFK  1560
              A+ YL   R+LY+YMTP+VS +PR ++LNYRD+D+G+N       +Y +   +G KYFK
Sbjct  433   VAKQYLYQIRRLYDYMTPYVSYSPRSSYLNYRDVDIGVNGPGN--ATYAQASVWGRKYFK  490

Query  1561  ENYNRLVKIKTKVDPDNFFRDEQSIPTF  1644
              N++RLV++KTKVDP NFFR EQSIP+ 
Sbjct  491   RNFDRLVQVKTKVDPSNFFRYEQSIPSL  518



>gb|KEH31324.1| reticuline oxidase-like protein [Medicago truncatula]
Length=553

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/499 (56%), Positives = 371/499 (74%), Gaps = 5/499 (1%)
 Frame = +1

Query  148   ECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQA  327
             +CL+  S  S+PIS V Y PN  S+S  L  YIRNLRFN S T KP+FI+T +H+SHIQA
Sbjct  41    QCLSLYSESSNPISEVTYFPNTPSYSPTLNSYIRNLRFNSSTTPKPVFILTPSHISHIQA  100

Query  328   SILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATL  507
             SI+C K+  L+++ RSGGHDY+G+SYVS+ PF +LDMF  RSV + ++DE+ WVE+GAT+
Sbjct  101   SIICCKKFNLEIRIRSGGHDYDGLSYVSEKPFIVLDMFLLRSVVIDLKDESLWVESGATI  160

Query  508   GEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGR  687
             GEVYY I+  S+VHGFPAGVCPTVGVGGHF G GYGNMMRK+GL+VDNI+DAK++DV+GR
Sbjct  161   GEVYYRISEISSVHGFPAGVCPTVGVGGHFSGGGYGNMMRKFGLSVDNILDAKIVDVDGR  220

Query  688   LLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCY  867
             +LDR+SMGE++FWAI GGG +SF V++S++I LV VP  VT+F V +T +Q   +IV+ +
Sbjct  221   VLDRESMGEDVFWAIRGGGGASFGVIVSWKIKLVSVPEIVTVFRVEKTLEQGGGDIVHQW  280

Query  868   QRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGLT  1047
             Q ++ K+   LFIR+   VV+     G+KTI+A FNALFLG++  LL  M+ESFPELGL 
Sbjct  281   QYVADKIHDGLFIRV---VVSPAKRKGKKTIKAKFNALFLGNAYELLDVMNESFPELGLI  337

Query  1048  QSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFK  1227
                C EM WI+SVLF+ ++P GT  + LL R       LKRKSDY+Q P+ + G + I+K
Sbjct  338   GEQCIEMSWIDSVLFWYNYPVGTLTDILLERHSSKEKFLKRKSDYVQKPISKIGFDGIWK  397

Query  1228  KMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEIT  1407
             KM+EL    LTFNPYGG+M EI   A PFPHR+GNI  IQY+ NW E   + A  YL+  
Sbjct  398   KMIELGKVSLTFNPYGGKMGEISEMATPFPHRAGNIYKIQYSVNWKEESNDVANQYLDRI  457

Query  1408  RQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVKI  1587
             R+LY+YMTP+VS +PR +++NYRD+D+G+N +     SY +   +G KYFK N++RLV++
Sbjct  458   RKLYDYMTPYVSDSPRSSYVNYRDVDIGVNGDGDV--SYEKASIWGKKYFKGNFDRLVEV  515

Query  1588  KTKVDPDNFFRDEQSIPTF  1644
             KT +DP NFF+ EQSIP+ 
Sbjct  516   KTAIDPSNFFKYEQSIPSL  534



>ref|XP_002317686.2| hypothetical protein POPTR_0011s15950g, partial [Populus trichocarpa]
 gb|EEE98298.2| hypothetical protein POPTR_0011s15950g, partial [Populus trichocarpa]
Length=541

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/511 (54%), Positives = 375/511 (73%), Gaps = 8/511 (2%)
 Frame = +1

Query  118   PLCYCATTV---LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             PL    T++   L+CL   S+ S+P+S  IY   N SF   L+ Y +  RF  S T KPL
Sbjct  31    PLATSDTSLDRFLKCLPSHSDSSYPVSSAIYRITNSSFEPTLRAYAKASRFLTSTTPKPL  90

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
              I+ ATH SH+QA+++CAK +GLQ++ RSGGHDYEG+SYVS+VPF ILD FN RS+++ +
Sbjct  91    AIIAATHESHVQATVICAKSNGLQIRIRSGGHDYEGLSYVSNVPFVILDTFNLRSIDIDV  150

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
               +TAW+++GAT GE+YY IANKSNV  FPAGVC T+G GGHF G GYG +MRK+GL++D
Sbjct  151   AGKTAWIQSGATTGELYYNIANKSNVLAFPAGVCLTLGAGGHFSGGGYGPLMRKHGLSID  210

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             NI+DAK++DVNG++LDRKSMGE+LFWAI GGG +SF V+LS++INLV VPPKVT F+V +
Sbjct  211   NIVDAKIVDVNGKILDRKSMGEDLFWAIRGGGGASFGVILSWKINLVDVPPKVTTFTVSK  270

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T +Q AT++VY +Q ++ KLD  LFIR+   VV+ ++    KT+  +F  LFLG S  LL
Sbjct  271   TLEQGATDVVYRWQEVASKLDKELFIRVMPRVVDGSSG-SNKTVTVSFIGLFLGPSCKLL  329

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQ  1188
               M  SFPELGL Q DC EM W+ES L++   P+GT +E LL+R P      KRKSDY++
Sbjct  330   PLMKNSFPELGLQQKDCNEMSWVESTLYWFGLPNGTSIETLLNR-PTRASFFKRKSDYVK  388

Query  1189  TPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNW-D  1365
               +P+ G+E I++ M++++   + +NPYGGRM EIP+ A  FPHR+GN+  IQY+ +W D
Sbjct  389   RAIPKKGLEKIWQTMIKVERVWMQWNPYGGRMDEIPATATAFPHRAGNLFKIQYSVDWSD  448

Query  1366  EHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYG  1545
             + G EAA H++++  QLY+ MTP+ S NPREAFLNYRD+D+G   N G + S+ + K YG
Sbjct  449   QEGIEAANHHIDLITQLYDTMTPYASSNPREAFLNYRDVDIG--SNPGNQTSFEKAKVYG  506

Query  1546  LKYFKENYNRLVKIKTKVDPDNFFRDEQSIP  1638
              K FK N+ RLVK+K++VDPD+FF+ EQSIP
Sbjct  507   SKLFKNNFIRLVKVKSRVDPDDFFKYEQSIP  537



>ref|XP_006360316.1| PREDICTED: reticuline oxidase-like protein-like [Solanum tuberosum]
Length=544

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/508 (56%), Positives = 364/508 (72%), Gaps = 8/508 (2%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRF-NESYTKKPLFIVTATHLS  315
             T + CL   S P   IS ++Y+PN+ SF+S+LQ YIRN RF N S T KP+ IVT T  S
Sbjct  32    TFVNCLTINSVPQSEISKIVYSPNDPSFNSILQAYIRNGRFFNSSTTSKPVIIVTPTVES  91

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
              +   ++C K+  LQ+K RSGGHDYEG+SY+SDVPF +LDMFN RS+++   D+TAWV+ 
Sbjct  92    QVAGVVICTKQTNLQLKIRSGGHDYEGISYISDVPFIMLDMFNLRSISIDTNDKTAWVQT  151

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GA LGE+YY I  KS V GFPAGVCPTVGVGGH  G GYGNM+RK+GLTVDN++DA+L+D
Sbjct  152   GAILGELYYNIWKKSEVLGFPAGVCPTVGVGGHVSGGGYGNMLRKFGLTVDNVLDARLVD  211

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQN-ATN  852
             VNGR+LDRKSMGE+LFWAI GGG +SF V+L+++I LV VP  VT F V R  + N  T+
Sbjct  212   VNGRILDRKSMGEDLFWAIKGGGGASFGVILAFQIQLVTVPQIVTYFRVERFIEDNTTTD  271

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHP----GEKTIRATFNALFLGDSKTLLSTMD  1020
              V  +Q ++ K+D +L++RL +  + +          K+IRATF ALFLGDS  L+S + 
Sbjct  272   AVVQWQNVASKIDNDLYMRLLIQPITVKAKAKGAKSTKSIRATFIALFLGDSSRLMSLIS  331

Query  1021  ESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMP  1200
             + FP LGLT+ DC EM WI+SVL + +F S T  E LL+R    L +LKRKSDY+QT +P
Sbjct  332   KEFPLLGLTKQDCLEMSWIDSVLHWANFDSTTKPEALLNRKGDPLNYLKRKSDYVQTSIP  391

Query  1201  RNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYE  1380
             +NG+E IF+KM+ L    + FNPYGGRM EI     PFPHRSG +  IQY+ NW E G  
Sbjct  392   KNGLESIFEKMISLGKAGMVFNPYGGRMGEIAEGETPFPHRSGILFKIQYSVNWHEEGLT  451

Query  1381  AAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFK  1560
             A + YL   R LY +MTP+VSKNPR+A+LNYRDLD+GIN      +S  +G+ YG KYFK
Sbjct  452   AEKDYLSQIRDLYSFMTPYVSKNPRQAYLNYRDLDIGINDQG--PQSLEKGRVYGTKYFK  509

Query  1561  ENYNRLVKIKTKVDPDNFFRDEQSIPTF  1644
              N++RLVK+K+ VDP NFFR+EQSIPT 
Sbjct  510   NNFDRLVKVKSMVDPQNFFRNEQSIPTL  537



>ref|XP_002277310.1| PREDICTED: inactive tetrahydrocannabinolic acid synthase-like 
[Vitis vinifera]
Length=537

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/500 (55%), Positives = 370/500 (74%), Gaps = 6/500 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL   SN S PI+ V+YTP N S+ +VL   I+NLRF  S T KP  IVT  H+SHIQ
Sbjct  34    LQCLTLNSNSSTPITKVLYTPKNSSYETVLDFSIQNLRFTSSCTPKPQIIVTPLHVSHIQ  93

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++C+K++GLQ++ARSGGHDYEG+SYVS+VPF I+D+   RS+NV +ED +AWVEAGAT
Sbjct  94    AAVICSKKYGLQIRARSGGHDYEGLSYVSEVPFIIVDLLELRSINVDVEDGSAWVEAGAT  153

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY IANK+ +HGFPAG+CPTVGVGGH  G GYG ++RKYGL  DNIIDA ++D NG
Sbjct  154   LGEVYYSIANKTAIHGFPAGICPTVGVGGHLSGGGYGTLLRKYGLAADNIIDAYIVDSNG  213

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              LL+R+SMGE+LFWAI GGG +SF +++S++I LV VP  VT+F V RT +Q+A  I+  
Sbjct  214   TLLNRESMGEDLFWAIRGGGGASFGIIVSWKIKLVPVPSTVTVFRVTRTLEQDAEKILLK  273

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q+++ KL  +LFIR+ V  VN  +  GE+TI +T+ +LFLG++  LLS M+ESFPELGL
Sbjct  274   WQQVADKLHEDLFIRVYVQAVN-GSQEGERTISSTYESLFLGNTSGLLSLMNESFPELGL  332

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
                DC E  WIESVL++  F SG P++ LL+R      + K KSD+L+ P+P  G++ I+
Sbjct  333   AADDCNETSWIESVLYFAGF-SGQPLDVLLNRSQTSKNYFKNKSDFLKEPIPETGLQGIW  391

Query  1225  KKMVELQ--TPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             K   +++  T ++  +PYGGRM EIP    PFPHR G++  IQY   W E G + ++ ++
Sbjct  392   KLFYQVKNATALMIISPYGGRMNEIPETETPFPHRKGSLYSIQYVVAWLEEGKKVSKRHI  451

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             +  R+L++YM P+VSK+PR A+LNYRDLDLG   NK    SY +   +GLKY+K N+NRL
Sbjct  452   DWARKLHKYMAPYVSKSPRAAYLNYRDLDLG--RNKNGNTSYAQASIWGLKYYKINFNRL  509

Query  1579  VKIKTKVDPDNFFRDEQSIP  1638
             V++KTKVDP NFFR+EQSIP
Sbjct  510   VQVKTKVDPSNFFRNEQSIP  529



>ref|XP_010042218.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
Length=552

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/489 (56%), Positives = 352/489 (72%), Gaps = 2/489 (0%)
 Frame = +1

Query  187   SPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQASILCAKEHGLQMK  366
             S +++ P N SF ++L   IRN RF  S T KPL I+T +  SH+Q+++LCA+  G +++
Sbjct  57    SQILHAPTNSSFPTLLGSLIRNRRFGTSSTPKPLLILTPSQPSHVQSAVLCARRTGTEVR  116

Query  367   ARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATLGEVYYGIANKSNV  546
              RSGGHD+EG SYVS  PF ILDMFNFRSV+V +E ETAWV +GAT+GE+YY I  KS +
Sbjct  117   IRSGGHDFEGTSYVSRAPFLILDMFNFRSVDVDVERETAWVGSGATIGELYYRIWEKSGL  176

Query  547   HGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGRLLDRKSMGEELFW  726
             +GF AGVCPTVGVGGH  G GYGNM+RKYGL  DN++DA+++DV GR+LDR SMGE+LFW
Sbjct  177   YGFNAGVCPTVGVGGHLSGGGYGNMLRKYGLASDNVVDAQIVDVEGRVLDRSSMGEDLFW  236

Query  727   AITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCYQRMSHKLDPNLFI  906
             AI GGG +SF V+L YR+ LV VP  VT+F V +T  +NAT +VY +Q  + + D +LF+
Sbjct  237   AIRGGGGASFGVILGYRVKLVPVPNVVTVFRVAKTIQENATELVYQWQNAAPRTDNDLFM  296

Query  907   RLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGLTQSDCREMRWIESV  1086
             RL +  V+     G KT+ A+  ALFLG++  L+S ++E FPELGL + DC EM WIES 
Sbjct  297   RLLLQPVSSKIQKGAKTVNASVLALFLGNADRLVSLVNEEFPELGLKKEDCAEMSWIESA  356

Query  1087  LFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFKKMVELQTPMLTFN  1266
             L++  F SGT VE LL R+P+ +  LKRKSDY+Q PM R  +E ++ KM+EL      FN
Sbjct  357   LWWGDFDSGTAVEALLDRMPKSVNFLKRKSDYVQQPMSREELELLWDKMIELGKVGFVFN  416

Query  1267  PYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEITRQLYEYMTPFVSK  1446
             PYGG+M EIP +  PFPHR+GN+  IQY+ +W E G EA Q  L   R+LY +MTP+VSK
Sbjct  417   PYGGKMGEIPMSDAPFPHRAGNLFKIQYSISWSEDGIEAEQSNLAEIRELYNFMTPYVSK  476

Query  1447  NPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVKIKTKVDPDNFFRDE  1626
              PR AFLNYRDLD+GI  N     SY EG  YG+KYF EN+ RLVK+KT VDP NFFR+E
Sbjct  477   KPRRAFLNYRDLDIGITDNG--ENSYREGTVYGVKYFAENFKRLVKVKTAVDPQNFFRNE  534

Query  1627  QSIPTFPGR  1653
             QSIP  P +
Sbjct  535   QSIPVLPSK  543



>ref|XP_010657063.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Vitis vinifera]
Length=545

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/512 (54%), Positives = 368/512 (72%), Gaps = 3/512 (1%)
 Frame = +1

Query  109   AWAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             +WA         L+CL+  SN + PIS V+YTP N S+S++L+  I NLRF+ S T KPL
Sbjct  31    SWATSSSIHENFLQCLSLNSNHTTPISNVLYTPKNLSYSAILESTIENLRFSSSATPKPL  90

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
              I+T  H+SHIQA+++C+K++G+ ++ RSGGHDYEG+SYVS++PF I+D+   RS+N+SI
Sbjct  91    LILTPLHVSHIQAAVICSKKYGMNIRVRSGGHDYEGLSYVSEIPFIIIDLVELRSINISI  150

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
             ED TAWVEAGAT+GEVYY IA KS  +GFPAG CPTVGVGGHF G GYG +MRKYGL+ D
Sbjct  151   EDGTAWVEAGATVGEVYYRIAQKSRTYGFPAGSCPTVGVGGHFSGGGYGTLMRKYGLSAD  210

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             NIIDA ++  +GR+L+R+SMGE+LFWAI GGG +SF ++LS++I LV VPP VT+F+V R
Sbjct  211   NIIDAYIVVSDGRVLNRESMGEDLFWAIRGGGGASFGIILSWKIKLVPVPPIVTVFTVGR  270

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T +Q A  +   +Q++  +L  ++FI  T   V+  +  GE+TI  +F +LFLG++  LL
Sbjct  271   TLEQGALKVFLKWQQVGSRLQEDIFIGATFGAVS-GSQEGERTIEVSFKSLFLGNTSQLL  329

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQ  1188
             S M +SFPELGL   DC EM WIESVL+YT   SG PV  LL+R+PQ   + K KSDY+Q
Sbjct  330   SLMKKSFPELGLEAKDCLEMSWIESVLYYTDL-SGEPVNVLLNRIPQFKNYFKAKSDYVQ  388

Query  1189  TPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDE  1368
              P+   G++ ++K + + +  ++  +PYGGRM EI     PFPHR GN+  IQY  +WDE
Sbjct  389   EPISETGLQGVWKMLYQEEAGIMILSPYGGRMNEISETEVPFPHRKGNLYKIQYLVSWDE  448

Query  1369  HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGL  1548
              G   +Q  +   R+LY YM P+VSK PR A+LNYRDLDLGIN  KG   SY +   +G+
Sbjct  449   EGDRVSQKRINWIRKLYAYMAPYVSKFPRAAYLNYRDLDLGINKLKG-NTSYAQASIWGI  507

Query  1549  KYFKENYNRLVKIKTKVDPDNFFRDEQSIPTF  1644
             KYF  N+NRLV +KTKVDP NFFR+EQSIP+ 
Sbjct  508   KYFSCNFNRLVHVKTKVDPSNFFRNEQSIPSL  539



>ref|XP_002299010.2| hypothetical protein POPTR_0001s46360g [Populus trichocarpa]
 gb|EEE83815.2| hypothetical protein POPTR_0001s46360g [Populus trichocarpa]
Length=530

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/510 (55%), Positives = 372/510 (73%), Gaps = 9/510 (2%)
 Frame = +1

Query  121   LCYCATTV---LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLF  291
             L  C T++   L+CL   S+PS+P+S  +Y  +N SF    + Y +  RF  S T KPL 
Sbjct  22    LATCDTSLDNFLQCLPSHSHPSYPVSRAVYRRSNSSFEPTFRAYAKASRFLTSATPKPLA  81

Query  292   IVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIE  471
             I+ A H SH+QA+++CAK +GLQ++ RSGGHDYEG+SYVS+VPF ILDMFN RS+++ I 
Sbjct  82    IIAAMHESHVQATVICAKSNGLQIRIRSGGHDYEGLSYVSNVPFVILDMFNLRSIDIDIV  141

Query  472   DETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDN  651
              +TAW+++GAT+GE+YY IA KSNV  FPAGVC T+G GGH  G GYGNMMRKYGL++DN
Sbjct  142   RKTAWIQSGATIGELYYNIAKKSNVFAFPAGVCFTLGAGGHISGGGYGNMMRKYGLSIDN  201

Query  652   IIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRT  831
             I+DAKL+DVNG++LDRKSMGE+LFWAI G G +SF V+LS++INLV+VPPKVT F+V +T
Sbjct  202   IVDAKLVDVNGKILDRKSMGEDLFWAIRGSGGASFGVILSWKINLVQVPPKVTTFNVAKT  261

Query  832   YDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLS  1011
               + AT++VY +Q ++ KLD  LFIR +  VVN  +  G KTI  +F   FLG S  LL 
Sbjct  262   LKEGATDLVYRWQEVASKLDQELFIRASPQVVNGGSG-GSKTISVSFIGQFLGPSSKLLP  320

Query  1012  TMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQT  1191
              M   FPELGL Q DC EM W+ES L++    SG  ++ LL R P      KRKSDY++ 
Sbjct  321   LMKRRFPELGLQQKDCNEMSWVESTLYWFG-RSGRSLDVLLDR-PTETSFFKRKSDYVKN  378

Query  1192  PMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNW-DE  1368
              +P+ G+E I+K M++++   + +NPYGGRM EIP+ A PFPHR+GN+  IQY+T+W D+
Sbjct  379   VIPKEGLENIWKMMIKVEPVWMQWNPYGGRMDEIPATATPFPHRAGNLFKIQYSTDWSDQ  438

Query  1369  HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGL  1548
              G EA   ++ + RQ+YE MTP+VSK+PREAFLNYRD+D+G   N   + ++   K YG 
Sbjct  439   EGSEATNRHINLLRQMYEAMTPYVSKDPREAFLNYRDIDIG--SNPSNQTNFENAKVYGS  496

Query  1549  KYFKENYNRLVKIKTKVDPDNFFRDEQSIP  1638
             K FK+N+ RLVK+K+KVDPDNFF++EQSIP
Sbjct  497   KLFKDNFMRLVKVKSKVDPDNFFKNEQSIP  526



>ref|XP_003524102.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=582

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/507 (54%), Positives = 370/507 (73%), Gaps = 4/507 (1%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T+ LECL + +     +S +++   N SFSSVLQ YIRN RFN + T KPL +VT +   
Sbjct  42    TSFLECLTNYTKAQDQVSNIVFAQTNASFSSVLQAYIRNARFNTTSTPKPLLVVTPSEDP  101

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+Q +++CAK  G+Q+K RSGGHDYEG+SYVSD PF ILDMF+FR++ V +E+E A V+A
Sbjct  102   HVQGAVICAKSIGIQLKIRSGGHDYEGISYVSDQPFIILDMFHFRNITVDVENEVAVVQA  161

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGEVYY I  KS VHGFPAGVCPTVGVGGH  G GYGNM+RK+GL+VD+++DAK++D
Sbjct  162   GATLGEVYYRIWEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMLRKHGLSVDHVVDAKIVD  221

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQN--AT  849
             V GR+LD++SMGE+LFWAI GGG +SF V+LSY + L+ VP  VT+F + ++ DQN  AT
Sbjct  222   VKGRILDKESMGEDLFWAIRGGGGASFGVILSYTVKLIPVPEVVTVFRIAKSLDQNESAT  281

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
              +V  +Q+++   D  LF+RL +  V+     G++TIRAT  ALFLG +  +++ M + F
Sbjct  282   ELVLQWQQVAPHTDHRLFMRLLLQPVSSKVVKGQRTIRATVMALFLGGADEVVTLMGKEF  341

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNG  1209
             P LGL++ +C E+ WI+SVL++++F + T  + LL R       LKRKSDY+Q P+ + G
Sbjct  342   PALGLSKENCTELSWIDSVLWWSNFDNTTKPDALLDRDLNSASFLKRKSDYVQNPISKKG  401

Query  1210  IEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQ  1389
             +E I++KM+EL      FNPYGG+M+E+ S A PFPHR+GN+  IQY+ NWD+ G E  +
Sbjct  402   LEGIWEKMIELGKTGFVFNPYGGKMSEVSSDATPFPHRAGNLFKIQYSVNWDDPGVELEK  461

Query  1390  HYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENY  1569
             ++    + LY YMTPFVS +PR AFLNYRDLD+G N     + SY EG  YG+KYF +N+
Sbjct  462   NFTSQAKMLYSYMTPFVSSDPRSAFLNYRDLDIGTNSFG--KNSYEEGAVYGVKYFNDNF  519

Query  1570  NRLVKIKTKVDPDNFFRDEQSIPTFPG  1650
              RLVKIKT+VDP+NFFR+EQSIP  PG
Sbjct  520   KRLVKIKTEVDPENFFRNEQSIPIHPG  546



>ref|XP_010440562.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=520

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/508 (56%), Positives = 364/508 (72%), Gaps = 12/508 (2%)
 Frame = +1

Query  130   CATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATH  309
              + T  +C+   S+P HPISP ++   N S+SSVL+  IRNLRFN S T KP  I+ A H
Sbjct  23    SSETFTQCITSNSDPKHPISPAVFFAENPSYSSVLEANIRNLRFNTSDTPKPFLIIAAKH  82

Query  310   LSHIQASILCAKEHGLQMKARSGGHDYEGVSYV--SDVPFFILDMFNFRSVNVSIEDETA  483
              SH+QA + C + H LQMK RSGGHDY+G+SYV  S  PFF+LDMFN RSV+V +  +TA
Sbjct  83    ESHVQAGVTCDQRHNLQMKIRSGGHDYDGLSYVTYSGEPFFVLDMFNLRSVDVDVASKTA  142

Query  484   WVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDA  663
             WV+ GA LGEVYY I  KSN   +PAG+CPTVGVGGH  G GY NMMRK+GLTVDN IDA
Sbjct  143   WVQTGAVLGEVYYHIWEKSNTLAYPAGICPTVGVGGHISGGGYSNMMRKHGLTVDNTIDA  202

Query  664   KLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQN  843
             +++DVNG+ LDRK MGE+ FWAI  GG  SF VVL+Y+IN++ VP  VT+FS+ RT +QN
Sbjct  203   RMVDVNGKFLDRKLMGEDHFWAINEGGG-SFGVVLAYKINIIEVPENVTVFSISRTLEQN  261

Query  844   ATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDE  1023
             AT IV+ +Q+++ +L   LF+RL +DVVN T    +KT+RATF A+FLG++ TLLS ++ 
Sbjct  262   ATKIVHRWQQVAPELTDELFLRLIIDVVNGTVST-QKTVRATFKAMFLGNTTTLLSILNR  320

Query  1024  SFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPR  1203
               PELGL +SD  E  WI+SVLF+     G+  E+LL +  Q + +LKRKSDY++ P+ R
Sbjct  321   RSPELGLIRSDGTETSWIQSVLFWADMQMGSS-EKLLLQRNQTVTYLKRKSDYVREPISR  379

Query  1204  NGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEA  1383
              G+E I++K+     P +TF PYGG M +IPS A PFPHR+GN+  IQY ++W E     
Sbjct  380   TGLESIWRKI-----PTMTFTPYGGVMDKIPSTATPFPHRAGNLWKIQYGSDWSEG--RL  432

Query  1384  AQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKE  1563
                Y+++TR+LY++MTPFVSKNPR+ F NYRDLDLGIN + G+  SY EGK YG   F  
Sbjct  433   TNRYMDLTRELYQFMTPFVSKNPRQTFPNYRDLDLGINSHNGKIMSYVEGKRYGKNCFAG  492

Query  1564  NYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             N+ RLVK KT+VD  NFFR+EQSIP  P
Sbjct  493   NFERLVKSKTRVDSGNFFRNEQSIPVLP  520



>gb|KHN39155.1| Reticuline oxidase-like protein [Glycine soja]
Length=527

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/508 (53%), Positives = 373/508 (73%), Gaps = 5/508 (1%)
 Frame = +1

Query  121   LCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVT  300
             L   + T+L+CL+  S+PS PIS V Y P N S+  +L+ YIRNLR +   T KP FIV 
Sbjct  16    LTATSETILQCLSLHSDPSRPISAVTYFPKNPSYPPILEAYIRNLRLSSPTTPKPTFIVA  75

Query  301   ATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDET  480
              TH+SHIQASI+C K   L+++ RSGGHD+EG+SY+S  PF I+DMF  +SV V +ED+T
Sbjct  76    PTHVSHIQASIICCKRFNLEIRTRSGGHDFEGLSYMSQTPFVIVDMFMLKSVEVDVEDQT  135

Query  481   AWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIID  660
             AWV++G+T+GE+YY IA KS V GFPAGVC +VGVGGHF G GYGNMMR++GL+VDN++D
Sbjct  136   AWVDSGSTIGELYYAIAEKSRVLGFPAGVCHSVGVGGHFSGGGYGNMMRRFGLSVDNVLD  195

Query  661   AKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQ  840
             A ++D  GR+LD+ +MGE+LFWAI GGG +SF V++S++I LV VP  VT+F + +T +Q
Sbjct  196   ALIVDSEGRVLDKATMGEDLFWAIRGGGGASFGVIVSWKIRLVPVPEVVTVFRIEKTLEQ  255

Query  841   NATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMD  1020
             +A+++V+ +Q ++ K+   LFIR+   V++  T    KTI+A FNALFLG+S+ LLS M+
Sbjct  256   DASDLVFQWQYVADKIHDGLFIRV---VLSPVTRSDRKTIKAKFNALFLGNSQELLSVMN  312

Query  1021  ESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMP  1200
             +SFP+LGL    C +M WI+SVLF+ ++P GT V+ LL R       LK+KSDY+Q P+ 
Sbjct  313   QSFPQLGLVAEQCIQMSWIQSVLFWDNYPVGTSVDVLLQRHATKEKFLKKKSDYVQQPIS  372

Query  1201  RNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYE  1380
             +  +E I+K M+EL+ P+ TFNPYGG+M EI     PFPHR GNI  IQY+ +WDE G +
Sbjct  373   KAALEGIWKMMMELEKPVFTFNPYGGKMGEISEFETPFPHRFGNIFKIQYSVSWDEEGED  432

Query  1381  AAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFK  1560
              A+ YL   R+LY+YMTP+VS +PR ++LNYRD+D+G+N       +Y +   +G KYFK
Sbjct  433   VAKQYLYQIRRLYDYMTPYVSYSPRSSYLNYRDVDIGVNGPGN--ATYAQASVWGRKYFK  490

Query  1561  ENYNRLVKIKTKVDPDNFFRDEQSIPTF  1644
              N++RLV++KTKVDP NFFR EQSIP+ 
Sbjct  491   RNFDRLVQVKTKVDPSNFFRYEQSIPSL  518



>ref|XP_006306380.1| hypothetical protein CARUB_v10012287mg [Capsella rubella]
 gb|EOA39278.1| hypothetical protein CARUB_v10012287mg [Capsella rubella]
Length=531

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/506 (55%), Positives = 371/506 (73%), Gaps = 18/506 (4%)
 Frame = +1

Query  148   ECLND--RSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHI  321
             +CL D   SNP  PI   IYT  N  F ++L  Y+RNLR+  + T+KP+ IV A  +SHI
Sbjct  34    QCLTDFKPSNPKSPIQNFIYTQQNPKFLTILNNYVRNLRYFNNTTRKPVAIVAAADVSHI  93

Query  322   QASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGA  501
             QA+I CAK+  LQ++ RSGGHDY+G+SYVS V F +LDMFN RS+ +  + +TAWVE+GA
Sbjct  94    QATITCAKKLALQLRIRSGGHDYDGMSYVSTVDFVVLDMFNLRSIKIDHKLDTAWVESGA  153

Query  502   TLGEVYYGIANKSN-VHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
              LGE++YG+ANKSN + GFPAG+CP +G GGHF G GYGNMMRKYGL++DNIIDAK++DV
Sbjct  154   ILGEIFYGVANKSNDLRGFPAGICPGLGAGGHFSGGGYGNMMRKYGLSIDNIIDAKIVDV  213

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQ---NAT  849
              GR+LDR SMGE+LFWAI GGGA+SF VVL+++I LV VP KVT+F+V    ++   N T
Sbjct  214   KGRVLDRSSMGEDLFWAIRGGGAASFCVVLAWKIKLVPVPAKVTVFNVETVGNRGSVNTT  273

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
              +V  +Q ++ K+D +LFIRLT+   N       KT++A+F  ++LG+S  LL TM+  F
Sbjct  274   ELVAKWQEIADKIDNDLFIRLTLSSSN-------KTVKASFMGMYLGNSLKLLKTMNAQF  326

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGT-PVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             PELGL +++C EM+WIESVLF+   P GT P   +L+R+PQ  ++LKRKSDY+Q P+ R 
Sbjct  327   PELGLKKTECIEMKWIESVLFWLGIPPGTAPTSSMLNRIPQKQIYLKRKSDYVQKPISRT  386

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G++ IFK ++E +   + +NPYGGRM+EIPS   PFPHR+GN+  IQYA NW   G   A
Sbjct  387   GLDAIFKVLLENENVTMAWNPYGGRMSEIPSTKTPFPHRAGNMFKIQYAANWFVPGEAVA  446

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
             +  L  T +++E M+P+VSKNPREAF NYRD+D+G + N     +Y EGK YG+KYFK N
Sbjct  447   KDCLSQTERVFEAMSPYVSKNPREAFFNYRDVDIGTSMN----STYKEGKVYGMKYFKNN  502

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTF  1644
             + +LVK+K++VDPDNFFR EQSIP  
Sbjct  503   FEKLVKVKSRVDPDNFFRYEQSIPVL  528



>ref|XP_009630062.1| PREDICTED: reticuline oxidase-like protein [Nicotiana tomentosiformis]
Length=559

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/511 (55%), Positives = 365/511 (71%), Gaps = 12/511 (2%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRF-NESYTKKPLFIVTATHLS  315
             + + CL  +S P   IS ++Y+P+N SF+ +LQ Y+RN RF N S T KP+ IVT T  S
Sbjct  41    SFVNCLTTKSIPQSEISKIVYSPSNASFNPILQAYVRNRRFFNSSTTSKPVIIVTPTEES  100

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+ +++LC KE  LQ+  RSGGHDYEG+SY+SDVPF +LDMFN RS+++++ D TAWV+A
Sbjct  101   HVSSAVLCTKETNLQLNIRSGGHDYEGISYISDVPFIMLDMFNLRSISINVNDNTAWVQA  160

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE+YY I  KSNV GFPAGVCPTVGVGGH  G GYGNM+RK+GL+VD+++DA+L+D
Sbjct  161   GATLGELYYNIWTKSNVLGFPAGVCPTVGVGGHVSGGGYGNMLRKFGLSVDHVLDARLVD  220

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNGR+LDRK+MGE+LFWAI GGG +SF V+L+++I LV+VP  VT F V R  +QNAT+ 
Sbjct  221   VNGRILDRKAMGEDLFWAIKGGGGASFGVILAFQIQLVQVPQTVTYFRVERFLNQNATDA  280

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNI---------TTHPGEKTIRATFNALFLGDSKTLL  1008
             V  +Q + +K+D +LFIRL V  + +              +K+IR TF ALFLGDS  L+
Sbjct  281   VLQWQNVVNKIDNDLFIRLLVQPITVKNKEKKVKGKKKAQQKSIRVTFIALFLGDSSRLI  340

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQ  1188
             S +    P LGLT+ DC EM WI+SVL + +F + T    LL+R    L  LKRKSDY+Q
Sbjct  341   SLVSNELPALGLTKQDCFEMNWIDSVLQWANFDNTTKPIALLNRTGDPLNFLKRKSDYVQ  400

Query  1189  TPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDE  1368
              P+PR  +E IF+KM+ L    L FNPYGGRMAEIP    PFPHR+G +  +QY+ NW+E
Sbjct  401   EPIPRGRLESIFQKMISLGKAGLVFNPYGGRMAEIPEGETPFPHRAGILFKMQYSVNWNE  460

Query  1369  HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGL  1548
              G  A + YL   R LY +MTPFVSKNPR+A+LNYRDLD+G N       S  E + YG 
Sbjct  461   EGAAAEKEYLTQIRDLYSFMTPFVSKNPRQAYLNYRDLDIGTNDQGPH--SLEEARVYGT  518

Query  1549  KYFKENYNRLVKIKTKVDPDNFFRDEQSIPT  1641
              YFK N++RLVK+K+ VD  NFFR+EQSIPT
Sbjct  519   MYFKNNFDRLVKVKSAVDSTNFFRNEQSIPT  549



>ref|XP_006587985.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=482

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/430 (63%), Positives = 334/430 (78%), Gaps = 1/430 (0%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T L CL + S P HPI+P I+TPNN SFSSVL+ YIRNLRFN S T+KP  I++A H+SH
Sbjct  36    TFLHCLVNHSEPFHPITPAIFTPNNTSFSSVLEAYIRNLRFNTSTTRKPFLIISALHVSH  95

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             IQASI+CA+ H LQMK RSGGHDYEGVSYVS+VPFFILDMFN RS+ V I+ ETAWV+AG
Sbjct  96    IQASIICAQNHNLQMKIRSGGHDYEGVSYVSEVPFFILDMFNLRSIKVEIDTETAWVQAG  155

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGEVYY IA KS  H FPAGVC TVGVGGH  G GYGNMMRKYGL+VDN+IDA+++D 
Sbjct  156   ATLGEVYYRIAEKSKTHAFPAGVCHTVGVGGHISGGGYGNMMRKYGLSVDNVIDAQMVDA  215

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
              GRLLDRKSMGE+LFWAITGGG +SF V+L+Y+I LVRVP  VT+F V RT +QNAT+IV
Sbjct  216   QGRLLDRKSMGEDLFWAITGGGGASFGVILAYKIKLVRVPETVTVFKVGRTLEQNATDIV  275

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPEL  1038
             Y +Q ++  +D +LFIR+ ++VVN  T  G KT+RA F ALFLGDSK+L+S + + FP+L
Sbjct  276   YNWQHVAPTIDSDLFIRVILNVVN-GTQNGTKTVRARFIALFLGDSKSLVSLLSDKFPQL  334

Query  1039  GLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEF  1218
             GL QSDC E  W+ SVLF+ +    + ++ LL R P+ L ++KRKSDY++ P+ + G E 
Sbjct  335   GLKQSDCIETSWLRSVLFWDNIDIASSLDILLERQPRSLSYMKRKSDYVKKPISKEGFEM  394

Query  1219  IFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             I+KKM+EL+  +  FNPYGGRMAEIPS A PFPHR+GN+  IQY  NW++ G E A HY+
Sbjct  395   IWKKMIELEDTLFLFNPYGGRMAEIPSTASPFPHRAGNLWKIQYQANWNKPGKEVADHYI  454

Query  1399  EITRQLYEYM  1428
              +TR   E +
Sbjct  455   NLTRTSQEVL  464



>ref|XP_008227084.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=530

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/499 (55%), Positives = 370/499 (74%), Gaps = 5/499 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL    +P+H I   IYTP N SF SVL  +I N R++ + T KPL I+ A + SH+Q
Sbjct  34    LQCLTKYPHPAHTIQGSIYTPQNSSFQSVLVAHINNRRYSTAATPKPLAIIAAKNESHVQ  93

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A++LCAK HGLQ+K RSGGHD+EG+SY SDVPF ILDMFN  S++V++ DE+AWV +GAT
Sbjct  94    ATVLCAKHHGLQIKIRSGGHDFEGLSYTSDVPFVILDMFNINSIDVNVADESAWVHSGAT  153

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY IA K+NV+GFPAG+CPTVG GGHF G GYG MMRKYGL++DNI+DAKL+  NG
Sbjct  154   LGEVYYAIAAKTNVYGFPAGICPTVGAGGHFSGGGYGFMMRKYGLSIDNIVDAKLVTANG  213

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+LDRKSMGE+LFWAI GGG +SF V+LS+++ LV VPPKVT+F++ RT ++  T++VY 
Sbjct  214   RILDRKSMGEDLFWAIRGGGGASFGVILSWKLKLVPVPPKVTVFNLTRTIEEGVTDLVYK  273

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ KL   +F+R    V NI T  G KT+  +F   FLG S  +++ ++ESFPELGL
Sbjct  274   WQTVAPKLPKEVFLRAQPQVKNIDTK-GNKTVGVSFIGHFLGTSDKVVALLNESFPELGL  332

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              + +C E+ W+ES +F+   P GTP+E LLS+  +     K KSDY++ P+P++  + I+
Sbjct  333   QRKNCYEVSWVESTVFWAESPIGTPIEILLSKPTEPETFYKGKSDYVKEPIPKHVFDSIW  392

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             KKM+E++   L +NPYGGRM+EI  +A P+PHR+GN+    Y ++W + G EA   Y+ +
Sbjct  393   KKMIEIEHIWLDWNPYGGRMSEISESATPYPHRAGNLFFALYYSSWYDEGTEATNKYVRL  452

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKT-YGLKYFKENYNRLV  1581
             TR+LY+ MTP+VSKNPREAF NYRDLD+G N +    K+ FE  T YG KYFK N++RLV
Sbjct  453   TRELYDMMTPYVSKNPREAFQNYRDLDIGANQD---NKTNFETATLYGRKYFKGNFDRLV  509

Query  1582  KIKTKVDPDNFFRDEQSIP  1638
             ++KT VDP NFF+ +QSIP
Sbjct  510   RVKTMVDPHNFFKHKQSIP  528



>ref|XP_004504723.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=540

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/506 (53%), Positives = 366/506 (72%), Gaps = 2/506 (0%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
              T L+CL   +     +S ++Y   N S++S+ + ++RN RFN   T KPL IVT  H +
Sbjct  36    VTFLQCLKSHTTQPDQVSNIVYAQTNASYTSIFEAFVRNARFNTPSTTKPLLIVTPLHEN  95

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
              +QA+I+C+K  GL +K RSGGHD+EG+SY+S+VPF ILDMFNF+++ V I++E A ++ 
Sbjct  96    QVQATIVCSKTIGLHLKIRSGGHDFEGISYISEVPFVILDMFNFQNITVDIQNEIAVIQT  155

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GA+LG+VYY I  KS VHGFPAGVC TVGVGGH  G GYGNMMRK+GL++DN++DAK++D
Sbjct  156   GASLGQVYYRIWEKSKVHGFPAGVCSTVGVGGHLSGGGYGNMMRKFGLSIDNVVDAKIVD  215

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNGR+LD+ SMGE+LFWAI GGG +SF V+LSY + LV VP KV +F V +T DQNAT++
Sbjct  216   VNGRVLDKNSMGEDLFWAIRGGGGASFGVILSYTVKLVSVPEKVAVFQVDKTLDQNATDL  275

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             V+ +Q+++   D  LF+RL +  V+  T  G+KTIRA+F ALFLG +  L++ +++ FP 
Sbjct  276   VFQWQQVAPHTDDRLFMRLVLQPVSSKTLKGQKTIRASFQALFLGGADELVTLLEKEFPL  335

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL +  C+EM WIESV ++ +F  G+ +  LL R    +   KRKSDY+Q+P+P++G++
Sbjct  336   LGLKKETCKEMSWIESVFWWANFNDGSSLNALLERNHYKVHSSKRKSDYVQSPIPKDGLK  395

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
             +I KKMVEL    L FNPYGG+M E+   A PFPHR+G +  IQY  +W+E G +  +  
Sbjct  396   WILKKMVELGKVELVFNPYGGKMNEVAFDATPFPHRAGYLYKIQYTVSWEEKGDDVEKSL  455

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L   R LY YMTPFVSKNPR A++NYRDLD+GIN +   +  Y +G  Y +KYF +N+ R
Sbjct  456   LSQIRMLYSYMTPFVSKNPRSAYVNYRDLDIGINRHG--KDDYNDGVVYSIKYFNKNFER  513

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFPGR  1653
             LV +KTKVDP+NFF +EQSIPT P +
Sbjct  514   LVNVKTKVDPENFFWNEQSIPTLPNK  539



>ref|XP_010053029.1| PREDICTED: reticuline oxidase-like protein isoform X2 [Eucalyptus 
grandis]
Length=559

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/485 (56%), Positives = 350/485 (72%), Gaps = 2/485 (0%)
 Frame = +1

Query  193   VIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQASILCAKEHGLQMKAR  372
             +++ P N SF ++L   IRN RF  S T KPL I+T +  SH+Q+++LCA+  G +++ R
Sbjct  59    ILHAPTNSSFPTLLGSLIRNRRFGTSSTPKPLLILTPSQPSHVQSAVLCARRTGTEVRIR  118

Query  373   SGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATLGEVYYGIANKSNVHG  552
             SGGHD+EG SYVS  PF ILDMFNFRSV+V +E ETAWV +GAT+GE+YY I  KS ++G
Sbjct  119   SGGHDFEGTSYVSRAPFLILDMFNFRSVDVDVERETAWVGSGATVGELYYRIWEKSGLYG  178

Query  553   FPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGRLLDRKSMGEELFWAI  732
             F AGVCPTVGVGGH  G GYGNM+RKYGL  DN++DA+++DV GR+LDR SMGE+LFWAI
Sbjct  179   FNAGVCPTVGVGGHLSGGGYGNMLRKYGLASDNVVDAQIVDVEGRVLDRSSMGEDLFWAI  238

Query  733   TGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCYQRMSHKLDPNLFIRL  912
              GGG +SF V+L YR+ LV VP  VT+F V +T ++NAT +VY +Q ++ + D +LF+RL
Sbjct  239   RGGGGASFGVILGYRVKLVPVPNVVTVFRVAKTIEENATELVYQWQNIAPRTDNDLFMRL  298

Query  913   TVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGLTQSDCREMRWIESVLF  1092
              +  V+     G KT+ A+  ALFLG++  L+S + E FPELGL + DC EM WIES L+
Sbjct  299   LLQPVSSKIQKGAKTVNASVLALFLGNADRLVSLISEEFPELGLKKEDCAEMSWIESALW  358

Query  1093  YTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFKKMVELQTPMLTFNPY  1272
             +  F SG  V+ LL R+P+ +  LKRKSDY+Q PM R  +E ++ +M+EL      FNPY
Sbjct  359   WGDFDSGVAVKALLDRMPKSVNFLKRKSDYVQQPMSREELELLWDRMIELGKVGFVFNPY  418

Query  1273  GGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEITRQLYEYMTPFVSKNP  1452
             GG+M EIP +  PFPHR+GN+  IQY+ +W E G EA Q YL   R+LY +MTP+VSK P
Sbjct  419   GGKMGEIPVSDAPFPHRAGNLFKIQYSISWSEDGIEAEQSYLAKIRELYNFMTPYVSKKP  478

Query  1453  REAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVKIKTKVDPDNFFRDEQS  1632
             R AFLNYRD D+GI  N     SY EG  YG+KYF EN+ RLVK+KT VDP NFFR+EQS
Sbjct  479   RRAFLNYRDFDIGITDNG--ENSYREGTVYGVKYFAENFKRLVKVKTAVDPQNFFRNEQS  536

Query  1633  IPTFP  1647
             IP  P
Sbjct  537   IPVLP  541



>ref|XP_011039281.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=566

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/502 (55%), Positives = 382/502 (76%), Gaps = 6/502 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL   +NP   IS ++Y+ ++ S++SVL+ YIRN R+N S T KPL IVT T +SH+Q
Sbjct  37    LQCLQSNTNPQDEISKLVYSQSSTSYTSVLRAYIRNARYNTSATPKPLVIVTPTQISHVQ  96

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++C K+ G Q+K RSGGHDY+G+SYVSD+PFF+LDMFN RS+ V++ DE+A V+AGAT
Sbjct  97    ATVICTKKVGYQLKIRSGGHDYDGISYVSDMPFFVLDMFNLRSIEVNVNDESATVQAGAT  156

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY I   S VHGFPAG+CPTVGVGGH  GAGYGNM+RKYGL+VDN++DA+++DVNG
Sbjct  157   LGELYYKIWESSKVHGFPAGICPTVGVGGHLSGAGYGNMLRKYGLSVDNVVDAEIVDVNG  216

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             +LLDRK+MGE+LFWAI GGG  SF V++SY+I LV VP  VT+F V RT DQNAT++VY 
Sbjct  217   KLLDRKAMGEDLFWAIRGGGGGSFGVIISYKIKLVSVPETVTVFRVERTLDQNATDVVYK  276

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ +   +LF+R+ +  V   T  G +TIRA+   L+LG+S +L++ + + FPELGL
Sbjct  277   WQLVAPQTSNDLFMRMLLQPV---TRNGNQTIRASIVTLYLGNSDSLVALLGKEFPELGL  333

Query  1045  TQSDCREMRWIESVLFYTSFPS-GTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
              + DC E  WI+SV+++    + G   + LL R P     LKRKSDY+Q P+ ++G+E++
Sbjct  334   KKEDCIETSWIQSVMWWDESQNLGKSPDVLLDRNPNDANFLKRKSDYVQNPISKDGLEWL  393

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             +KKM+E+    L FNPYGGRM +IP++  PFPHR+GN+  +QY+ NW+E G EA ++++ 
Sbjct  394   WKKMIEVGKTGLVFNPYGGRMNQIPASETPFPHRAGNLFKVQYSVNWEEAGSEADKNFMT  453

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
               R+LY YMTPFVSKNPR A+LNYRDLD+G+   +  + S+ +G  YG KYF +N++RLV
Sbjct  454   QIRRLYSYMTPFVSKNPRSAYLNYRDLDIGV--MEAGKDSFEQGSVYGYKYFNDNFDRLV  511

Query  1582  KIKTKVDPDNFFRDEQSIPTFP  1647
             K+KT VDP+NFFR+EQSIPT P
Sbjct  512   KVKTAVDPENFFRNEQSIPTLP  533



>ref|XP_008358604.1| PREDICTED: reticuline oxidase-like protein [Malus domestica]
Length=532

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/503 (56%), Positives = 368/503 (73%), Gaps = 7/503 (1%)
 Frame = +1

Query  136   TTVLECL-NDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             T  L+CL     N ++PI   IYT  N SF SVL  YIRN R++   T  PL IV A H 
Sbjct  28    TNFLQCLPKQHQNFTYPIFETIYTHKNTSFQSVLLGYIRNSRYSTLTTPXPLAIVAAKHK  87

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVE  492
             SH+QA+++CAKEHGLQ++ RSGGHDYEG+SY SDVPF ILDMFN R++++++ DE+AWV+
Sbjct  88    SHVQATVICAKEHGLQIRIRSGGHDYEGLSYXSDVPFVILDMFNLRAIDINVVDESAWVQ  147

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
             AGAT+GE+YY IANKS VHGFPAG CPTVG+GGHF G GYG MMRKYGLTVDNI DA+L+
Sbjct  148   AGATVGELYYEIANKSKVHGFPAGACPTVGIGGHFSGGGYGPMMRKYGLTVDNIEDAQLV  207

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             DV GR+LDRKSMGE+LFWAI GGG +SF V+LS++I L+ VP KVT+F+V+RT +Q+A N
Sbjct  208   DVKGRILDRKSMGEDLFWAIKGGGGASFGVILSWKIKLLPVPDKVTVFNVKRTPEQDAIN  267

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             ++Y +Q +  KL  ++FIR    + N T   G+KT+  +F  LFLG    L+S ++ESF 
Sbjct  268   VIYRWQYVVPKLPEDIFIRAITRLKNNTE--GKKTVEVSFFGLFLGQRDKLVSLINESFS  325

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL + DC EM W+ES +F+ + P GTP+  L SR        K KSDY++ P+P+ GI
Sbjct  326   ELGLQRQDCFEMSWVESTVFWANHPFGTPISVLRSRPQGPPNFFKSKSDYVKEPIPKEGI  385

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E I+K M+E+   ++ +NPYGGRMA+IP +  PFPHR+GN+  IQY T W E     +  
Sbjct  386   ESIWKAMIEMDKVLMQWNPYGGRMAKIPESETPFPHRAGNLFKIQYVTYWVEESSVTSNI  445

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGIN-HNKGRRKSYFEGKTYGLKYFKENY  1569
             +L+   +LYE MTP+VSK+PREAF NYRDLD+G N HNK +   +   + YG KYFK N+
Sbjct  446   HLKFLEKLYEGMTPYVSKSPREAFQNYRDLDIGANLHNKTK---FGTARVYGSKYFKGNF  502

Query  1570  NRLVKIKTKVDPDNFFRDEQSIP  1638
             +RLV++KT VDP NFF++EQSIP
Sbjct  503   DRLVRVKTMVDPQNFFKNEQSIP  525



>gb|KCW77269.1| hypothetical protein EUGRSUZ_D01626, partial [Eucalyptus grandis]
Length=562

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/485 (56%), Positives = 350/485 (72%), Gaps = 2/485 (0%)
 Frame = +1

Query  193   VIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQASILCAKEHGLQMKAR  372
             +++ P N SF ++L   IRN RF  S T KPL I+T +  SH+Q+++LCA+  G +++ R
Sbjct  58    ILHAPTNSSFPTLLGSLIRNRRFGTSSTPKPLLILTPSQPSHVQSAVLCARRTGTEVRIR  117

Query  373   SGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATLGEVYYGIANKSNVHG  552
             SGGHD+EG SYVS  PF ILDMFNFRSV+V +E ETAWV +GAT+GE+YY I  KS ++G
Sbjct  118   SGGHDFEGTSYVSRAPFLILDMFNFRSVDVDVERETAWVGSGATVGELYYRIWEKSGLYG  177

Query  553   FPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGRLLDRKSMGEELFWAI  732
             F AGVCPTVGVGGH  G GYGNM+RKYGL  DN++DA+++DV GR+LDR SMGE+LFWAI
Sbjct  178   FNAGVCPTVGVGGHLSGGGYGNMLRKYGLASDNVVDAQIVDVEGRVLDRSSMGEDLFWAI  237

Query  733   TGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCYQRMSHKLDPNLFIRL  912
              GGG +SF V+L YR+ LV VP  VT+F V +T ++NAT +VY +Q ++ + D +LF+RL
Sbjct  238   RGGGGASFGVILGYRVKLVPVPNVVTVFRVAKTIEENATELVYQWQNIAPRTDNDLFMRL  297

Query  913   TVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGLTQSDCREMRWIESVLF  1092
              +  V+     G KT+ A+  ALFLG++  L+S + E FPELGL + DC EM WIES L+
Sbjct  298   LLQPVSSKIQKGAKTVNASVLALFLGNADRLVSLISEEFPELGLKKEDCAEMSWIESALW  357

Query  1093  YTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFKKMVELQTPMLTFNPY  1272
             +  F SG  V+ LL R+P+ +  LKRKSDY+Q PM R  +E ++ +M+EL      FNPY
Sbjct  358   WGDFDSGVAVKALLDRMPKSVNFLKRKSDYVQQPMSREELELLWDRMIELGKVGFVFNPY  417

Query  1273  GGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEITRQLYEYMTPFVSKNP  1452
             GG+M EIP +  PFPHR+GN+  IQY+ +W E G EA Q YL   R+LY +MTP+VSK P
Sbjct  418   GGKMGEIPVSDAPFPHRAGNLFKIQYSISWSEDGIEAEQSYLAKIRELYNFMTPYVSKKP  477

Query  1453  REAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVKIKTKVDPDNFFRDEQS  1632
             R AFLNYRD D+GI  N     SY EG  YG+KYF EN+ RLVK+KT VDP NFFR+EQS
Sbjct  478   RRAFLNYRDFDIGITDNG--ENSYREGTVYGVKYFAENFKRLVKVKTAVDPQNFFRNEQS  535

Query  1633  IPTFP  1647
             IP  P
Sbjct  536   IPVLP  540



>ref|XP_007213528.1| hypothetical protein PRUPE_ppa019761mg [Prunus persica]
 gb|EMJ14727.1| hypothetical protein PRUPE_ppa019761mg [Prunus persica]
Length=525

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/499 (56%), Positives = 364/499 (73%), Gaps = 6/499 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL  +S P++PI   IYT  N SF SVL  YIRN R++   T KPL IV   H SH+ 
Sbjct  30    LQCLPQKSEPTYPIFDAIYTTENSSFQSVLLGYIRNRRYSTPTTPKPLAIVAVKHESHVI  89

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++CAK+HGLQ++ RSGGHDYEG+SYVS VPF ILDMFN RS+ +++ DE+AWV+AGAT
Sbjct  90    ATVICAKQHGLQIRIRSGGHDYEGLSYVSHVPFVILDMFNMRSIEINVTDESAWVQAGAT  149

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
              GE+YY IANKS VHGFPAG C ++G GGHF G GYG MMRKYGL+VDNI DAK++DV+G
Sbjct  150   TGELYYEIANKSKVHGFPAGACLSLGTGGHFSGGGYGYMMRKYGLSVDNIEDAKVVDVDG  209

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              +LDRKSMGE+ FWAI GGG +SF V+LS++I LV VP KVT+F+V+RT +Q AT+I+Y 
Sbjct  210   IILDRKSMGEDSFWAIRGGGGASFGVILSWKIKLVAVPAKVTVFNVKRTLEQGATDIIYK  269

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ KL  ++FIR    V N T   G KT+  +F   FLG S  LLS M+ESFPELGL
Sbjct  270   WQFVAPKLPQDIFIRAMPQVKNNTE--GNKTVEVSFIGHFLGQSGKLLSLMNESFPELGL  327

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              Q DC EM W+ES +F+  +P GTP++ LL R  +  +  K KSDY++ P+ + GIE I+
Sbjct  328   QQKDCFEMSWVESTVFWADYPVGTPLKVLLDRPKEPTMFFKVKSDYVKEPISKQGIESIW  387

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             + ++ ++   + +NPYGGRM+EI  +  PFPHR+GNI  IQY   W E G +    Y+++
Sbjct  388   QILLGIEKVWMQWNPYGGRMSEISESETPFPHRAGNIFAIQYWLFWVEQGADTTNKYIDL  447

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFE-GKTYGLKYFKENYNRLV  1581
             +R+LYE MTPFVSK+PREAF NYRDLD+G N +   R   FE  K YG KYFK N+N+LV
Sbjct  448   SRKLYEGMTPFVSKSPREAFQNYRDLDIGANLDNQTR---FETAKVYGSKYFKGNFNKLV  504

Query  1582  KIKTKVDPDNFFRDEQSIP  1638
             ++KT +D  NFFR EQSIP
Sbjct  505   RVKTVMDRQNFFRHEQSIP  523



>ref|NP_174358.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana]
 gb|AAD25758.1|AC007060_16 Strong similarity to F19I3.2 gi|3033375 putative berberine bridge 
enzyme from Arabidopsis thaliana BAC gb|AC004238 [Arabidopsis 
thaliana]
 gb|ACE62892.1| At1g30710 [Arabidopsis thaliana]
 gb|AEE31263.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana]
Length=531

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/506 (55%), Positives = 369/506 (73%), Gaps = 18/506 (4%)
 Frame = +1

Query  148   ECLND--RSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHI  321
             +C+ D   SNP  PI   IYT  + +F ++L  Y+RNLR+  + T+KP+ IV A  ++HI
Sbjct  34    QCVTDFKPSNPKSPIQNYIYTQRSPNFLTILNNYVRNLRYFNNMTRKPVAIVAAADVTHI  93

Query  322   QASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGA  501
             QA+I CAK+ GLQ++ RSGGHDY+G+SY+S + F +LDMFN RS+N+  + +TAWV++GA
Sbjct  94    QATITCAKKLGLQLRIRSGGHDYDGMSYLSTIDFVVLDMFNLRSINIDPKLDTAWVQSGA  153

Query  502   TLGEVYYGIANKSN-VHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             TLGE+YYG+ANKSN + GFPAG+CP +G GGHF G GYGNMMRKYGL++DNIIDAK++D 
Sbjct  154   TLGEIYYGVANKSNDLRGFPAGICPGLGAGGHFSGGGYGNMMRKYGLSIDNIIDAKIVDA  213

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVR---RTYDQNAT  849
              GR+LDR SMGE+LFWA+ GGGA+SF VVL+++I LV VP KVT+F++     T   N T
Sbjct  214   KGRVLDRSSMGEDLFWALRGGGAASFCVVLAWKIKLVPVPAKVTVFNIETFGNTGSVNTT  273

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
              +V  +Q ++ K+D +LFIRLT+   N       KT++A+F  ++LG+S  LL  M+  F
Sbjct  274   ELVAKWQEIADKIDNDLFIRLTLGSSN-------KTVKASFMGMYLGNSSNLLEIMNAKF  326

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGT-PVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             PELGL + +C EM+WIESVLF+   P GT P   +L+R+PQ  ++LKRKSDY+Q P+ R 
Sbjct  327   PELGLIKRECIEMKWIESVLFWLGIPPGTAPTTSMLNRIPQKQIYLKRKSDYVQKPISRT  386

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G+E IFK M E +   + FNPYGGRM+EIPS    FPHR+GN+  IQYA NW   G   A
Sbjct  387   GLESIFKIMTENENVTMAFNPYGGRMSEIPSTETAFPHRAGNMFKIQYAANWFVPGEAVA  446

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
             +  L  T +L+E M+P+VSKNPREAFLNYRD+D+G    K    +Y EGK YG KYFK+N
Sbjct  447   KDCLSQTERLFEAMSPYVSKNPREAFLNYRDVDIG----KSLNSTYEEGKVYGFKYFKDN  502

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTF  1644
             + +LVKIK++VDPDNFFR EQSIP  
Sbjct  503   FEKLVKIKSRVDPDNFFRYEQSIPVL  528



>ref|XP_004134895.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
Length=538

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/501 (56%), Positives = 374/501 (75%), Gaps = 6/501 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPIS-PVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T+L CL D S+PS      V + P+N S+S VL  YIRNLRF    T KPLFIVT TH+S
Sbjct  27    TLLHCLFDHSSPSSSPISEVTFFPDNPSYSPVLNSYIRNLRFTSPTTPKPLFIVTPTHVS  86

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+QA++LC + H L+++ RSGGHDY+G+SYVS  PF ILDMFN RSV V IEDE+AWV++
Sbjct  87    HVQATVLCCRIHALEIRIRSGGHDYDGLSYVSASPFVILDMFNLRSVAVDIEDESAWVDS  146

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGEVYY IA KS +HGFPAGVCPTVGVGGH  GAGYGN+MRK+G++VDN++DA ++D
Sbjct  147   GATLGEVYYKIAEKSKIHGFPAGVCPTVGVGGHLSGAGYGNLMRKFGVSVDNVVDALIVD  206

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNGR+LDR++MGE+LFWAI GGG +SF V++S++  LV +P  VT+F   +T ++   +I
Sbjct  207   VNGRVLDRETMGEDLFWAIRGGGGASFGVIVSWKFKLVLLPETVTVFRTEKTIEEGVVDI  266

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             ++ +Q ++  +D NLFIR+ +  VN  T   +KT +A F +LFLG+++ L + M E FPE
Sbjct  267   LHKWQEIADTIDENLFIRVVILPVNKKT---QKTAKAKFVSLFLGNAQKLFALMSERFPE  323

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LG+   DC+EM WIES+LF++++P GTP+  LL R P     LK+KSDY+Q P+ +  +E
Sbjct  324   LGIKDEDCKEMSWIESILFWSNYPIGTPLNVLLERQPNSEKFLKKKSDYVQEPISKADLE  383

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              + +KM+EL+ P LTFNPYGG+M++IP    PFPHR+GN   IQY+  W E G EAA   
Sbjct  384   GMMRKMIELKRPALTFNPYGGKMSQIPETETPFPHRAGNKYKIQYSVTWKEEGDEAAAKN  443

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L+  R+LY+YMTP+VSK+PR A+LNYRD+DLG+N       SY+ G  +G KYFK N++R
Sbjct  444   LKKIRELYKYMTPYVSKSPRSAYLNYRDVDLGVNGIG--NASYWVGSIWGRKYFKGNFDR  501

Query  1576  LVKIKTKVDPDNFFRDEQSIP  1638
             LVK+K+ VDPDNFFR EQSIP
Sbjct  502   LVKVKSMVDPDNFFRYEQSIP  522



>gb|KCW75706.1| hypothetical protein EUGRSUZ_D00082 [Eucalyptus grandis]
Length=520

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/515 (55%), Positives = 372/515 (72%), Gaps = 23/515 (4%)
 Frame = +1

Query  109   AWAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             +WA       T L+CL  R+ PS  IS ++Y+  N SF++                  PL
Sbjct  26    SWAASDSVYDTFLQCLTHRTRPSDHISDIVYSRANSSFAN------------------PL  67

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
              IVT    SH+QA++LC+K+ G+ +K RSGGHDYEG+SYVSD  FFILDMFN RS++V+I
Sbjct  68    VIVTPKQESHVQAAVLCSKDLGIHLKIRSGGHDYEGISYVSDDAFFILDMFNLRSIDVNI  127

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
             + ETAWV+AGATLGE+YY I  KS +HGFPAGV PT+GVGGHF GAGYGNM+RKYGL+VD
Sbjct  128   QKETAWVQAGATLGELYYRIWEKSKLHGFPAGVGPTIGVGGHFSGAGYGNMLRKYGLSVD  187

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             N++DA+++DV GR+LDRK+MGE+LFWAI GGG +SF V+L+Y+I LV VP KVT+F V +
Sbjct  188   NVLDARMVDVRGRILDRKAMGEDLFWAIIGGGGASFGVILAYQIKLVPVPEKVTVFPVEK  247

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T DQNAT++VY +Q ++ + D  LF+RL +  V   T  G+KT+RAT   LFLG+S  LL
Sbjct  248   TLDQNATDLVYKWQFVAPRTDHGLFMRLLLQPVTSQTQKGQKTLRATVVTLFLGNSDQLL  307

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGT--PVEELLSRVPQVLVHLKRKSDY  1182
             +  D+  PE+GL + +C E+ WIESVL++  F  GT   +E LLSR       LKRKSDY
Sbjct  308   AITDKELPEMGLKKENCTELSWIESVLWWDGFDEGTIPALETLLSR-DDSTNFLKRKSDY  366

Query  1183  LQTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNW  1362
             +QTP+ +  +++++KKM+EL    L FNPYGGRM+EI ++A PFPHR+GN+  IQY+ NW
Sbjct  367   VQTPISKANLDWLWKKMIELGKVGLVFNPYGGRMSEILASATPFPHRAGNLFKIQYSVNW  426

Query  1363  DEHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTY  1542
             +E   E  ++YL   R LY Y TPFVSKNPR A+LNYRDLD+G + +   + SY EG+ Y
Sbjct  427   NEDDPELEKNYLAQVRSLYNYTTPFVSKNPRSAYLNYRDLDIGTSTDG--KNSYEEGQVY  484

Query  1543  GLKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             G+KYF +N+ RLVK+KT VDP+NFFR+EQSIP  P
Sbjct  485   GVKYFNDNFERLVKVKTAVDPNNFFRNEQSIPPLP  519



>ref|XP_010053028.1| PREDICTED: reticuline oxidase-like protein isoform X1 [Eucalyptus 
grandis]
Length=578

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/485 (56%), Positives = 350/485 (72%), Gaps = 2/485 (0%)
 Frame = +1

Query  193   VIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQASILCAKEHGLQMKAR  372
             +++ P N SF ++L   IRN RF  S T KPL I+T +  SH+Q+++LCA+  G +++ R
Sbjct  59    ILHAPTNSSFPTLLGSLIRNRRFGTSSTPKPLLILTPSQPSHVQSAVLCARRTGTEVRIR  118

Query  373   SGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATLGEVYYGIANKSNVHG  552
             SGGHD+EG SYVS  PF ILDMFNFRSV+V +E ETAWV +GAT+GE+YY I  KS ++G
Sbjct  119   SGGHDFEGTSYVSRAPFLILDMFNFRSVDVDVERETAWVGSGATVGELYYRIWEKSGLYG  178

Query  553   FPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGRLLDRKSMGEELFWAI  732
             F AGVCPTVGVGGH  G GYGNM+RKYGL  DN++DA+++DV GR+LDR SMGE+LFWAI
Sbjct  179   FNAGVCPTVGVGGHLSGGGYGNMLRKYGLASDNVVDAQIVDVEGRVLDRSSMGEDLFWAI  238

Query  733   TGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCYQRMSHKLDPNLFIRL  912
              GGG +SF V+L YR+ LV VP  VT+F V +T ++NAT +VY +Q ++ + D +LF+RL
Sbjct  239   RGGGGASFGVILGYRVKLVPVPNVVTVFRVAKTIEENATELVYQWQNIAPRTDNDLFMRL  298

Query  913   TVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGLTQSDCREMRWIESVLF  1092
              +  V+     G KT+ A+  ALFLG++  L+S + E FPELGL + DC EM WIES L+
Sbjct  299   LLQPVSSKIQKGAKTVNASVLALFLGNADRLVSLISEEFPELGLKKEDCAEMSWIESALW  358

Query  1093  YTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFKKMVELQTPMLTFNPY  1272
             +  F SG  V+ LL R+P+ +  LKRKSDY+Q PM R  +E ++ +M+EL      FNPY
Sbjct  359   WGDFDSGVAVKALLDRMPKSVNFLKRKSDYVQQPMSREELELLWDRMIELGKVGFVFNPY  418

Query  1273  GGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEITRQLYEYMTPFVSKNP  1452
             GG+M EIP +  PFPHR+GN+  IQY+ +W E G EA Q YL   R+LY +MTP+VSK P
Sbjct  419   GGKMGEIPVSDAPFPHRAGNLFKIQYSISWSEDGIEAEQSYLAKIRELYNFMTPYVSKKP  478

Query  1453  REAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVKIKTKVDPDNFFRDEQS  1632
             R AFLNYRD D+GI  N     SY EG  YG+KYF EN+ RLVK+KT VDP NFFR+EQS
Sbjct  479   RRAFLNYRDFDIGITDNG--ENSYREGTVYGVKYFAENFKRLVKVKTAVDPQNFFRNEQS  536

Query  1633  IPTFP  1647
             IP  P
Sbjct  537   IPVLP  541



>ref|XP_010053030.1| PREDICTED: reticuline oxidase-like protein isoform X3 [Eucalyptus 
grandis]
Length=548

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/487 (55%), Positives = 351/487 (72%), Gaps = 2/487 (0%)
 Frame = +1

Query  193   VIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQASILCAKEHGLQMKAR  372
             +++ P N SF ++L   IRN RF  S T KPL I+T +  SH+Q+++LCA+  G +++ R
Sbjct  59    ILHAPTNSSFPTLLGSLIRNRRFGTSSTPKPLLILTPSQPSHVQSAVLCARRTGTEVRIR  118

Query  373   SGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATLGEVYYGIANKSNVHG  552
             SGGHD+EG SYVS  PF ILDMFNFRSV+V +E ETAWV +GAT+GE+YY I  KS ++G
Sbjct  119   SGGHDFEGTSYVSRAPFLILDMFNFRSVDVDVERETAWVGSGATVGELYYRIWEKSGLYG  178

Query  553   FPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGRLLDRKSMGEELFWAI  732
             F AGVCPTVGVGGH  G GYGNM+RKYGL  DN++DA+++DV GR+LDR SMGE+LFWAI
Sbjct  179   FNAGVCPTVGVGGHLSGGGYGNMLRKYGLASDNVVDAQIVDVEGRVLDRSSMGEDLFWAI  238

Query  733   TGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCYQRMSHKLDPNLFIRL  912
              GGG +SF V+L YR+ LV VP  VT+F V +T ++NAT +VY +Q ++ + D +LF+RL
Sbjct  239   RGGGGASFGVILGYRVKLVPVPNVVTVFRVAKTIEENATELVYQWQNIAPRTDNDLFMRL  298

Query  913   TVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGLTQSDCREMRWIESVLF  1092
              +  V+     G KT+ A+  ALFLG++  L+S + E FPELGL + DC EM WIES L+
Sbjct  299   LLQPVSSKIQKGAKTVNASVLALFLGNADRLVSLISEEFPELGLKKEDCAEMSWIESALW  358

Query  1093  YTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFKKMVELQTPMLTFNPY  1272
             +  F SG  V+ LL R+P+ +  LKRKSDY+Q PM R  +E ++ +M+EL      FNPY
Sbjct  359   WGDFDSGVAVKALLDRMPKSVNFLKRKSDYVQQPMSREELELLWDRMIELGKVGFVFNPY  418

Query  1273  GGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEITRQLYEYMTPFVSKNP  1452
             GG+M EIP +  PFPHR+GN+  IQY+ +W E G EA Q YL   R+LY +MTP+VSK P
Sbjct  419   GGKMGEIPVSDAPFPHRAGNLFKIQYSISWSEDGIEAEQSYLAKIRELYNFMTPYVSKKP  478

Query  1453  REAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVKIKTKVDPDNFFRDEQS  1632
             R AFLNYRD D+GI  N     SY EG  YG+KYF EN+ RLVK+KT VDP NFFR+EQS
Sbjct  479   RRAFLNYRDFDIGITDNG--ENSYREGTVYGVKYFAENFKRLVKVKTAVDPQNFFRNEQS  536

Query  1633  IPTFPGR  1653
             IP  P +
Sbjct  537   IPVLPSK  543



>ref|XP_008225671.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=524

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/502 (56%), Positives = 363/502 (72%), Gaps = 6/502 (1%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T  L+CL  +  P++PI   IYT  N SF SVL  YIRN R++   T KPL IVTA H S
Sbjct  26    TGFLQCLPKQPQPAYPIFEAIYTHENTSFQSVLLGYIRNSRYSTLATPKPLAIVTALHES  85

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+QA+++CAK+HGLQ++ RSGGHDYEG+SYVSDVPF ILDMFN RS+++ + DE+AWV+A
Sbjct  86    HVQATVICAKQHGLQIRTRSGGHDYEGLSYVSDVPFIILDMFNLRSIDIDVADESAWVQA  145

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GAT+GE+YY IANKS VHGFPAG CPTVG+GGHF G GYG MMRKYGLTVDNI DAKL++
Sbjct  146   GATIGELYYEIANKSKVHGFPAGACPTVGIGGHFSGGGYGPMMRKYGLTVDNIEDAKLVN  205

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNG +LDR SMGE+LFWAI GGG +SF V+LS++I L+ VP  VT+F+V+RT+++ A N+
Sbjct  206   VNGTILDRNSMGEDLFWAIRGGGGASFGVILSWKIRLLPVPANVTVFNVKRTWEKGALNV  265

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             +Y +Q ++ KL   +FIR    + N T   G+KT+  +F  LFLG    L+  M+ESFPE
Sbjct  266   IYKWQYVAPKLLDEIFIRAITRLKNSTE--GKKTVEVSFVGLFLGQRDKLVPLMNESFPE  323

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL   DC EM W+ES LF+   P GTPV  LL+R        K KSDY++ P+P+ GIE
Sbjct  324   LGLQLKDCFEMSWVESTLFWADQPIGTPVNFLLNRPQGPPNFFKSKSDYVKEPIPKQGIE  383

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              I++ M+++   ++ +NPYGGRM+ IP    PFPHR GN+ +IQY T W E G E  + +
Sbjct  384   SIWQMMLKMDKVLMQWNPYGGRMSVIPEWETPFPHRDGNLFLIQYVTYWVEEGAETLKQH  443

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFE-GKTYGLKYFKENYN  1572
             L   R+LYE  T +VSK+PREAF NYRDLD+G N    +  + FE  K YG KYFK N +
Sbjct  444   LGFVRKLYEGTTLYVSKSPREAFQNYRDLDIGANR---QNHTEFETAKVYGSKYFKGNLD  500

Query  1573  RLVKIKTKVDPDNFFRDEQSIP  1638
             RLV++K  VDP NFF++EQSIP
Sbjct  501   RLVRVKVMVDPYNFFKNEQSIP  522



>ref|XP_007158995.1| hypothetical protein PHAVU_002G199300g [Phaseolus vulgaris]
 gb|ESW30989.1| hypothetical protein PHAVU_002G199300g [Phaseolus vulgaris]
Length=573

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/507 (55%), Positives = 361/507 (71%), Gaps = 4/507 (1%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T+ L+CL + +     +S +++   N SFSSVLQ YIRN RFN + T KPL +VT     
Sbjct  33    TSFLQCLTNYTKSQDHVSDIVFAQTNSSFSSVLQAYIRNARFNTTSTPKPLLVVTPLEEP  92

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+Q +++C+K  G+Q+K RSGGHD+EG+SYVSD PF ILDMF FR++ V +++E A V+A
Sbjct  93    HVQGAVICSKNIGIQLKIRSGGHDFEGISYVSDQPFIILDMFQFRNITVDVQNEIAVVQA  152

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGEVYY I  KS VHGFPAGVCPTVGVGGH  G GYGNM+RK+GL VD++IDAK++D
Sbjct  153   GATLGEVYYRIWEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMLRKHGLAVDHVIDAKIVD  212

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQN--AT  849
             V GR+LD+K MGE+LFWAI GGG +SF V+LSY I LV VP  VT++ V ++ D+N  AT
Sbjct  213   VKGRILDKKGMGEDLFWAIRGGGGASFGVILSYTIKLVPVPEVVTVYRVAKSLDKNESAT  272

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
               V  +Q+++   D  LF+RL +  V+     G+KTIRAT  ALFLG +  ++  M + F
Sbjct  273   EFVLQWQQVAPHTDDRLFMRLLLQPVSSKVVKGQKTIRATVVALFLGGADEVVKLMGKEF  332

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNG  1209
             P LGL++ +C EM WI+SVL++ +F + T  + LL R       LKRKSDY+Q P+ + G
Sbjct  333   PTLGLSKQNCTEMNWIDSVLWWANFDNITKPDALLDRNVNSASFLKRKSDYVQKPISKEG  392

Query  1210  IEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQ  1389
             +E I+KKMVEL      FNPYGG+M+E+ S A PFPHR+GN+  IQY+ NWDE G E   
Sbjct  393   LEGIWKKMVELGKTGFVFNPYGGKMSEVSSDATPFPHRAGNLFKIQYSVNWDEPGVELEN  452

Query  1390  HYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENY  1569
             ++    R LY YMTPFVS NPR AFLNYRDLD+G N       SY EG  YG+KYF +N+
Sbjct  453   NFTRQARMLYSYMTPFVSSNPRSAFLNYRDLDIGTNSFG--NNSYKEGAVYGVKYFNDNF  510

Query  1570  NRLVKIKTKVDPDNFFRDEQSIPTFPG  1650
             +RLVKIK+ VDP+NFFR+EQSIPT  G
Sbjct  511   DRLVKIKSAVDPENFFRNEQSIPTHTG  537



>ref|XP_009362288.1| PREDICTED: reticuline oxidase-like protein [Pyrus x bretschneideri]
Length=530

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/498 (54%), Positives = 366/498 (73%), Gaps = 4/498 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL  +S P++ I   IYT +N SF SVLQ YIRN RF+   T KPL IVTA   SH+Q
Sbjct  35    LQCLPKQSQPTYQIFDAIYTRDNTSFQSVLQHYIRNRRFSTPTTPKPLAIVTAKRESHVQ  94

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++CA +HGLQ++ RSGGHDYEG+SYVSDVPF ILD+ N R++++ + D++AWV+AGAT
Sbjct  95    ATVICANQHGLQIRIRSGGHDYEGLSYVSDVPFVILDLLNLRAIDIKVADKSAWVQAGAT  154

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             +GE+YY IANKS VHGFPAG C ++G GGHF G GYG +MRKYGLTVDNI DAKL++VNG
Sbjct  155   IGELYYEIANKSKVHGFPAGACLSLGTGGHFSGGGYGYLMRKYGLTVDNIEDAKLVNVNG  214

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              +L+RKSMGE+LFWAI GGG +SF V+LS+++ LV VP KVT+F+++RT +Q AT+++Y 
Sbjct  215   TILNRKSMGEDLFWAIRGGGGASFGVILSWKVKLVPVPAKVTVFNIQRTLEQGATDVIYK  274

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ KL  ++FIR    V N T   G KT+  +F   FLG +  LL  ++  FPELGL
Sbjct  275   WQYIAPKLPKDIFIRAMPQVKNTTN--GTKTVEVSFIGHFLGQTDNLLQLLNARFPELGL  332

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              ++DC EM W+ES +F+  FP GTP++ LL R        K KSDY++ P+P+ GIE I+
Sbjct  333   QRNDCFEMSWLESTIFWADFPVGTPIDVLLDRPNGPAAFFKVKSDYVKEPIPKQGIESIW  392

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             K +++++   + +NPYGGRM+EI  +  PFPHR+GN+ +IQY T W E G E  + Y+ +
Sbjct  393   KIILKIEKVWMQWNPYGGRMSEISESETPFPHRAGNLFLIQYWTFWGEEGAETTKKYVGL  452

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
             +R+LYE  TPFVSK+PRE F NYRD+D+G N +   + ++   K YG KYFK N+ RLV+
Sbjct  453   SRKLYEGTTPFVSKSPRETFQNYRDIDIGANLDN--QTNFETAKIYGRKYFKGNFERLVR  510

Query  1585  IKTKVDPDNFFRDEQSIP  1638
             +KT VDP NFF+ EQSIP
Sbjct  511   VKTAVDPQNFFKHEQSIP  528



>gb|KDO77596.1| hypothetical protein CISIN_1g015646mg [Citrus sinensis]
Length=403

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/405 (68%), Positives = 327/405 (81%), Gaps = 4/405 (1%)
 Frame = +1

Query  436   MFNFRSVNVSIEDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagyg  615
             MFN  SV+V IE ETAWV+ GATLGEVYY I+ KS  HGFPAGVCPTVGVGGH GG GYG
Sbjct  1     MFNLHSVDVDIETETAWVQTGATLGEVYYRISEKSKTHGFPAGVCPTVGVGGHIGGGGYG  60

Query  616   NMMRKYGLTVDNIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRV  795
             NMMRKYGLTVDNI+DAKL+DV+GRLLDRKSMGE+LFWAI GGG +SF VVL+YRI LVRV
Sbjct  61    NMMRKYGLTVDNIVDAKLVDVSGRLLDRKSMGEDLFWAIRGGGGASFGVVLAYRIKLVRV  120

Query  796   PPKVTIFSVRRTYDQNATNIVYCYQRMSHKLDPN-LFIRLTVDVVNITTHPGEKTIRATF  972
             P  VT+F VR+T +QNAT IVY +Q+++ K  P+ LF+RL +DVVN  T  G KT+RA+F
Sbjct  121   PETVTVFQVRKTLEQNATEIVYRWQQVASKQLPDDLFVRLILDVVN-GTKSGTKTVRASF  179

Query  973   NALFLGDSKTLLSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQV  1152
              +LFLGDS  LLS M+ESFPELGL QSDC E  WI SVLF+T+F    P+  LL+R P  
Sbjct  180   LSLFLGDSNRLLSIMNESFPELGLAQSDCIETSWIRSVLFWTNFQIDDPLNILLNRTPPT  239

Query  1153  LVHLKRKSDYLQTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGN  1332
             L  LKRKSDY++ P+P+NG+EFI+K+M+EL+TP + FNPYGG+MAEIPS A PFPHR+GN
Sbjct  240   LTFLKRKSDYVKQPIPKNGLEFIWKRMIELETPQMIFNPYGGKMAEIPSTATPFPHRAGN  299

Query  1333  IAMIQYATNWDEHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGR  1512
             +  IQY TNW+E G +AA  YL +TR+LY YMTPFVSKNPR+AF NYRD+DLGINHN   
Sbjct  300   LWKIQYVTNWNEPGTDAANRYLNLTRKLYGYMTPFVSKNPRQAFFNYRDIDLGINHNG--  357

Query  1513  RKSYFEGKTYGLKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFP  1647
             + S+ E K YG+KYF  N+NRLVKIKTKVDP NFFR+EQSIP  P
Sbjct  358   KASFEEAKAYGIKYFLGNFNRLVKIKTKVDPGNFFRNEQSIPVLP  402



>ref|XP_006370482.1| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|ERP67051.1| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=527

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/513 (53%), Positives = 382/513 (74%), Gaps = 8/513 (2%)
 Frame = +1

Query  112   WAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLF  291
             W    +   + L+CL+  S  SH IS +IYTP N S+SS+LQ  I+NLRFN S T KPL 
Sbjct  14    WVTSAHTHESFLQCLD--SQNSHSISKLIYTPINSSYSSILQFSIQNLRFNTSSTPKPLV  71

Query  292   IVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIE  471
             IVT T++SHIQA+I+C+++HG+Q++ RSGGHDYEG+SYVS   F ++D+ N R++NV+ E
Sbjct  72    IVTPTNISHIQAAIICSQKHGMQIRIRSGGHDYEGLSYVSTFSFVVIDLINLRTINVNAE  131

Query  472   DETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDN  651
             ++TAWV++G T+GEVYY IA KS    FPA VCPTVGVGGHF G GYG +MRKYGL  D+
Sbjct  132   NKTAWVQSGVTIGEVYYRIAEKSRTLAFPASVCPTVGVGGHFSGGGYGMLMRKYGLAADH  191

Query  652   IIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRT  831
             IIDA+L+DV GR+LDR+SMGE+LFWAI GGG ++F VV++++I+LV  PP VT+F+V+RT
Sbjct  192   IIDAQLVDVKGRILDRESMGEDLFWAIRGGGGNTFGVVIAWKISLVSAPPTVTVFNVQRT  251

Query  832   YDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEK--TIRATFNALFLGDSKTL  1005
              +QNA+ +V+ +Q ++ KL  +LFIR+ ++ VN +T  G+   TI+A+FN+LFLG    L
Sbjct  252   LEQNASKLVHRWQFVADKLHEDLFIRIILNRVN-STEEGKSNTTIQASFNSLFLGGIDRL  310

Query  1006  LSTMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYL  1185
             L  + +SFPELGL + DC EM WI+SVL++  FPS + ++ LL R P    + K KSDY+
Sbjct  311   LPLIQDSFPELGLVKEDCIEMSWIQSVLYFDGFPSNSSLDVLLDRTPSTRRNFKAKSDYV  370

Query  1186  QTPMPRNGIEFIFKKMV--ELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATN  1359
             + P+P  G+E I+++    ++ TP+L F+PYGG+M+EI  ++ PFPHR+GNI  IQ+   
Sbjct  371   KEPIPELGLEGIWERFFDKDINTPILIFSPYGGKMSEISESSIPFPHRAGNIYKIQHLIY  430

Query  1360  WDEHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKT  1539
             WDE G  A + ++   R+LY Y+ P+VSK PR A++NYRDLD+GIN++ G   SY +   
Sbjct  431   WDEEGIVATKRHISWIRRLYSYLAPYVSKTPRAAYVNYRDLDIGINNHAG-NTSYRQASI  489

Query  1540  YGLKYFKENYNRLVKIKTKVDPDNFFRDEQSIP  1638
             +GLKYFK N++RLV++KT VDP NFFR+EQSIP
Sbjct  490   WGLKYFKNNFDRLVRVKTAVDPANFFRNEQSIP  522



>ref|XP_008439528.1| PREDICTED: reticuline oxidase-like protein [Cucumis melo]
Length=556

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/505 (53%), Positives = 367/505 (73%), Gaps = 5/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             T L CL + S+P+   S +++ P N S+SS+L+ YIRN RFN S T KP FI+T  H SH
Sbjct  27    TFLRCLQNHSDPNQLTSNIVFDPTNISYSSLLRAYIRNARFNTSSTPKPTFIITPLHESH  86

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSY--VSDVPFFILDMFNFRSVNVSIEDETAWVE  492
             +Q +++CAK   L ++ RSGGHD+EG+SY  VS  PF ++DMFN RS+ V ++  +AWV+
Sbjct  87    LQFTLICAKSSALHIRIRSGGHDFEGLSYASVSPSPFILIDMFNLRSIAVDLQSRSAWVQ  146

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
             AGATLGE+YY I  +S +HGFPAGVCPTVGVGGH  G GYGNM+RK+GL+VD+++DA+++
Sbjct  147   AGATLGELYYRIWEQSKLHGFPAGVCPTVGVGGHISGGGYGNMLRKFGLSVDHVVDARIV  206

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             D NGR++DRK MGE+LFWAI GGG +SF V+L+Y+I LV VP  VT+F ++RT + N T+
Sbjct  207   DANGRIVDRKMMGEDLFWAIRGGGGASFGVILAYKIQLVPVPETVTVFRLQRTLEDNGTD  266

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             +VY +Q ++   D +LF+RL +    I + P +KT+RA+   LFLG +  LLS +   FP
Sbjct  267   MVYRWQHIAPNTDSDLFMRLLLQ--PIYSKP-KKTVRASVYTLFLGRADRLLSILKRDFP  323

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL + DC EM WIESV+++ ++  GT +  LL R P +    KRKSDY+QTP+ ++G+
Sbjct  324   ELGLKKEDCIEMGWIESVIWWANYEHGTSLRVLLGRSPGLAHFQKRKSDYVQTPISKDGL  383

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E ++KK++EL    L FNPYGG+M EI +    FP R+GN+  IQY+ +W E G EA + 
Sbjct  384   ELLWKKLMELDKTELVFNPYGGKMNEISALDTAFPRRAGNLFKIQYSVSWKEQGIEAEKS  443

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             ++   + LY ++TP+VSKNPR A+ NYRDLD+G NHN     S+ EGK YG+KYFKEN+ 
Sbjct  444   HVNQLQLLYNFLTPYVSKNPRTAYFNYRDLDIGTNHNYDAANSFEEGKVYGIKYFKENFE  503

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLV++KT VDP NFFRDEQSIP FP
Sbjct  504   RLVRVKTAVDPQNFFRDEQSIPAFP  528



>ref|XP_003531233.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
 gb|KHN47960.1| Reticuline oxidase-like protein [Glycine soja]
Length=535

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/506 (55%), Positives = 372/506 (74%), Gaps = 9/506 (2%)
 Frame = +1

Query  139   TVLECLNDRSNPS--HPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             ++L+CL+  S+PS  +PIS V Y PN+ S+  +L  YIRNLRF+ S T KP FIV  TH+
Sbjct  26    SILQCLSLYSDPSLPNPISAVTYFPNSPSYPPILDSYIRNLRFSSSTTPKPSFIVAPTHV  85

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDE--TAW  486
             SHIQASI+C K   L+++ RSGGHDY+G+SYVS+ PF ILDMF  RSV V+++D+  TAW
Sbjct  86    SHIQASIICCKSFNLEIRIRSGGHDYDGLSYVSEAPFVILDMFMLRSVKVNLDDDDDTAW  145

Query  487   VEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAK  666
             V++G+T+GE+Y+ IA +S +H FPAGVC +VGVGGHF G GYGNMMR +GL+VD+++DA 
Sbjct  146   VDSGSTIGELYHAIAERSKIHAFPAGVCHSVGVGGHFSGGGYGNMMRMFGLSVDHVLDAI  205

Query  667   LIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNA  846
             ++D  GR+LDRK MGE+LFWAI GGG +SF VV+S++I LV VP  VT+F V RT +Q A
Sbjct  206   IVDAQGRVLDRKLMGEDLFWAIRGGGGASFGVVVSWKIRLVPVPEVVTVFRVERTLEQGA  265

Query  847   TNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDES  1026
             T++V+ +Q ++ KL   LFIR+ +  V      G KTIRA FNALFLG+S+ LL  M++S
Sbjct  266   TDVVHKWQYVADKLHDGLFIRVVLSSVK---RKGVKTIRAKFNALFLGNSQELLGVMNKS  322

Query  1027  FPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             FPELGL    C EM WI+SVLF+ ++P GT V+ LL R      +LK+KSDY+Q P+ + 
Sbjct  323   FPELGLVAEQCIEMSWIDSVLFWDNYPVGTSVDVLLQRHNTQEKYLKKKSDYVQQPISKT  382

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G+E I+ KM+EL+ P L  NPYGG+M EI     PFPHR+GNI  IQY+  W E G + A
Sbjct  383   GLEGIWNKMMELEKPALALNPYGGKMGEISEVETPFPHRAGNIYKIQYSVTWKEEGEDVA  442

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
               YL+  R+LY+YMTP+VS +PR +++NYRD+D+G+N       SY E + +G KYFK N
Sbjct  443   NRYLDRIRRLYDYMTPYVSSSPRSSYINYRDVDIGVNGPGN--ASYAEARVWGEKYFKRN  500

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTF  1644
             Y+RLV++KTKVDP NFFR EQSIP+ 
Sbjct  501   YDRLVEVKTKVDPSNFFRYEQSIPSL  526



>gb|KHN39153.1| Reticuline oxidase-like protein [Glycine soja]
Length=577

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/506 (54%), Positives = 366/506 (72%), Gaps = 4/506 (1%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T+ L+CL + +     +S +++   N SFSSVLQ YIRN RFN + T KPL +VT +   
Sbjct  37    TSFLQCLTNYTKSPDQVSNIVFAQTNASFSSVLQAYIRNARFNTTSTPKPLLVVTPSEEP  96

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+Q +++CAK   +Q+K RSGGHDYEG+SYVSD PF ILDMF+FR++ V IE+E A V+A
Sbjct  97    HVQGAVICAKSIAIQLKIRSGGHDYEGISYVSDQPFIILDMFHFRNITVDIENEVAVVQA  156

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE+YY I  KS VHGFPAGVCPTVGVGGH  G GYGNM+RK+GL+VD+++DAK++D
Sbjct  157   GATLGELYYRIWEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMLRKHGLSVDHVVDAKIVD  216

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQN--AT  849
               GR+LD++SMGE+LFWAI GGG +SF V+LSY + LV VP  V++F + ++ DQN  AT
Sbjct  217   AKGRILDKESMGEDLFWAIRGGGGASFGVILSYNVKLVPVPEVVSVFRIAKSLDQNESAT  276

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
              +V  +Q+++   D  LF+RL +  V+     G++TIRAT  ALFLG +  + + M + F
Sbjct  277   ELVLQWQQVAPHTDHRLFMRLLLQPVSSKVVKGQRTIRATVMALFLGGADEVATLMGKEF  336

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNG  1209
             P LGL++ +C E+ WI+SVL++ +F + T  + L+ R       LKRKSDY+Q P+P+ G
Sbjct  337   PALGLSKENCTELSWIDSVLWWGNFDNTTKPDALIDRDLNSASFLKRKSDYVQKPIPKKG  396

Query  1210  IEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQ  1389
             +E I++KM+EL      FNPYGG+M+E+ S A PFPHR+GN+  IQY+ NWD+ G E   
Sbjct  397   LEGIWEKMIELGKTGFVFNPYGGKMSEVSSDATPFPHRAGNLFKIQYSVNWDDPGVELEN  456

Query  1390  HYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENY  1569
             ++    R LY YMTPFVS +PR AFLNYRDLD+GIN     + SY EG  YG+KYF +N+
Sbjct  457   NFTSQARMLYSYMTPFVSSSPRSAFLNYRDLDIGINSFG--KNSYAEGAVYGVKYFNDNF  514

Query  1570  NRLVKIKTKVDPDNFFRDEQSIPTFP  1647
              RLVKIKT+VDP+NFFR+EQSIP  P
Sbjct  515   ERLVKIKTEVDPENFFRNEQSIPVHP  540



>ref|XP_004504724.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=539

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/506 (54%), Positives = 361/506 (71%), Gaps = 2/506 (0%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T+ + CL +++  S   S  +++  N SFSSVLQ YIRN R N + T KPL I+T    S
Sbjct  36    TSFIHCLTNQTKSSDQFSNTLFSQTNASFSSVLQAYIRNARLNTTSTPKPLLIITPLQES  95

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+Q+++ C+K  G+Q+K RSGGHD+EG+SYVS+ PF ILDMF FR+++V I++E A V++
Sbjct  96    HVQSTVFCSKTIGIQLKIRSGGHDFEGLSYVSNQPFIILDMFQFRNISVDIQNEVAVVQS  155

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE YY I  KS VHGFP+GVCPTVGVGGHF G GYGNMMR++GL++DNIIDAK++D
Sbjct  156   GATLGEFYYRIWEKSKVHGFPSGVCPTVGVGGHFSGGGYGNMMREFGLSIDNIIDAKIVD  215

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNGR+LD+ +MGE+ FWAI GGG SSF V+LSY + LV VP  VT+F V +  DQNAT +
Sbjct  216   VNGRILDKNTMGEDFFWAIRGGGGSSFGVILSYTVKLVLVPEVVTVFRVAKNLDQNATEL  275

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             V+ +Q+++   D  LF+RL +  V+     GE T+RAT  ALFLG +  +++ + + FP 
Sbjct  276   VFQWQQVAPHTDDRLFMRLLLQPVSSKVVKGEITVRATVMALFLGGADEIVTLLGKEFPS  335

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL +  C EM WI+SVL++ SF + +  + LL R        KRKSDY+Q P+P++G+E
Sbjct  336   LGLNKEKCSEMSWIDSVLWWASFGNDSKPDVLLDRKIDSAKFFKRKSDYVQDPIPKDGLE  395

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              I+KK++EL    L FNPYGG+M  IPS A  FPHR GN+  IQY+ NW+E G +   ++
Sbjct  396   GIWKKVIELGKVGLVFNPYGGKMNLIPSNATAFPHREGNLFKIQYSVNWEEPGIDVENNF  455

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
                 R LY YMTPFVS NPR AFLNYRDLD+GIN       SY +G  YG KYF  N+ R
Sbjct  456   TNQARMLYNYMTPFVSNNPRRAFLNYRDLDIGINDFG--NSSYEQGVVYGAKYFNNNFER  513

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFPGR  1653
             LVKIKT VDP+NFFR+EQSIPT PG+
Sbjct  514   LVKIKTVVDPENFFRNEQSIPTHPGK  539



>ref|XP_002300558.2| hypothetical protein POPTR_0001s46690g [Populus trichocarpa]
 gb|EEE85363.2| hypothetical protein POPTR_0001s46690g [Populus trichocarpa]
Length=566

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/502 (55%), Positives = 382/502 (76%), Gaps = 6/502 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL   +NP   IS ++Y+ ++ S++SVL+ YIRN R+N S T KP+ IVT T +SH+Q
Sbjct  37    LQCLESNTNPQDEISKLVYSQSSTSYTSVLRAYIRNARYNTSATPKPVVIVTPTQISHVQ  96

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++C K+ G Q+K RSGGHDY+G+SYVSD+PFF+LDMFN RS+ V++ DE+A V+AGAT
Sbjct  97    ATVICTKKVGYQLKIRSGGHDYDGISYVSDMPFFVLDMFNLRSIEVNVNDESATVQAGAT  156

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY I   S VHGFPAGVCPTVGVGGH  GAGYGNM+RKYGL+VDN++DA+++DVNG
Sbjct  157   LGELYYKIWESSKVHGFPAGVCPTVGVGGHLSGAGYGNMLRKYGLSVDNVVDAEIVDVNG  216

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             +LLDRK+MGE+LFWAI GGG  SF V++SY+I LV VP  VT+F V RT +QNAT++VY 
Sbjct  217   KLLDRKAMGEDLFWAIRGGGGGSFGVIISYKIKLVSVPETVTVFRVERTLEQNATDVVYK  276

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ +   +LF+R+ +  V   T  G +TIRA+   L+LG+S +L++ + + FPELGL
Sbjct  277   WQLVAPQTSNDLFMRMLLQPV---TRNGNQTIRASIVTLYLGNSDSLVALLGKEFPELGL  333

Query  1045  TQSDCREMRWIESVLFYTSFPS-GTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
              + DC E  WI+SV+++    + G   + LL R P     LKRKSDY+Q P+ ++G+E++
Sbjct  334   KKEDCNETSWIQSVMWWDESQNLGKSPDVLLDRNPNDANFLKRKSDYVQNPISKDGLEWL  393

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             +KKM+E+    L FNPYGGRM EIP++  PFPHR+GN+  +QY+ NW+E G EA ++++ 
Sbjct  394   WKKMIEVGKTGLVFNPYGGRMNEIPASETPFPHRAGNLFKVQYSVNWEEAGSEADKNFMT  453

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
               R+L+ YMTPFVSKNPR ++LNYRDLD+G+   +  + S+ +G  YG KYF +N++RLV
Sbjct  454   QIRRLHSYMTPFVSKNPRSSYLNYRDLDIGV--MEAGKDSFEQGSVYGYKYFNDNFDRLV  511

Query  1582  KIKTKVDPDNFFRDEQSIPTFP  1647
             K+KT VDP+NFFR+EQSIPT P
Sbjct  512   KVKTAVDPENFFRNEQSIPTLP  533



>ref|XP_007222484.1| hypothetical protein PRUPE_ppa004103mg [Prunus persica]
 gb|EMJ23683.1| hypothetical protein PRUPE_ppa004103mg [Prunus persica]
Length=530

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/499 (54%), Positives = 370/499 (74%), Gaps = 5/499 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL    +P+H I   IYTP N SF SVL  +I N R++ + T KPL I+ A + SH+Q
Sbjct  34    LQCLTKYPHPAHTIQESIYTPQNSSFQSVLVAHINNRRYSTAATPKPLAIIAAKNESHVQ  93

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A++LCAK HGLQ+K RSGGHD+EG+SY SDVPF ILDMFN  S++V++ D++AWV +GAT
Sbjct  94    ATVLCAKHHGLQIKIRSGGHDFEGLSYTSDVPFVILDMFNINSIDVNVADKSAWVHSGAT  153

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY I  K+NV+GFPAG+CPTVG GGHF G GYG +MRKYGL+VDNI+DA+L+  NG
Sbjct  154   LGEVYYAIGTKTNVYGFPAGICPTVGAGGHFSGGGYGFLMRKYGLSVDNIVDARLVTANG  213

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+LDRKSMGE+LFWAI GGG +SF V+LS+++ LV VPPKVT+F++ +T ++  T++VY 
Sbjct  214   RILDRKSMGEDLFWAIRGGGGASFGVILSWKLKLVPVPPKVTVFNLTKTIEEGVTDLVYK  273

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ +L  ++F+R    V NI T  G KT+  +F   FLG S  +++ ++ESFPELGL
Sbjct  274   WQTLAPQLPKDVFLRAQPQVKNIDTK-GNKTVGVSFIGHFLGTSDKVVALLNESFPELGL  332

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              + DC E+ W+ES +F+   P GTP+E LLS+  +     K KSDY++ P+P++  + I+
Sbjct  333   QRKDCYEVSWVESTVFWAESPIGTPIEILLSKPTEPETFYKGKSDYVKEPIPKHVFDSIW  392

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             KKM+E++   L +NPYGGRM+EI  +A P+PHR+GN+    Y ++W + G EA   Y+ +
Sbjct  393   KKMIEIEHIWLDWNPYGGRMSEISESATPYPHRAGNLFFALYYSSWYDEGIEATNKYVRL  452

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKT-YGLKYFKENYNRLV  1581
             TR+LY+ MTP+VSKNPREAF NYRDLD+G N +    K+ FE  T YG KYFK N++RLV
Sbjct  453   TRELYDMMTPYVSKNPREAFQNYRDLDIGANQD---NKTTFETATLYGRKYFKGNFDRLV  509

Query  1582  KIKTKVDPDNFFRDEQSIP  1638
             ++KT VDP NFF+ +QSIP
Sbjct  510   RVKTMVDPHNFFKHKQSIP  528



>ref|XP_006468347.1| PREDICTED: reticuline oxidase-like protein-like isoform X2 [Citrus 
sinensis]
Length=554

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/507 (54%), Positives = 369/507 (73%), Gaps = 6/507 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPS-HPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             + L+CL  ++N S   IS ++ T  N S++SVL+ YIRN RFN S T KP  I+T    +
Sbjct  41    SFLQCLTQQTNSSDQQISNIVVTQTNSSYASVLRAYIRNARFNLSSTLKPTVIITPLQEA  100

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+ A+++C+K+ G Q+K RSGGHDYEG+SY+SD PFFILDMFN RS++V ++DE+AWVEA
Sbjct  101   HVSAAVICSKQVGFQLKIRSGGHDYEGLSYISDRPFFILDMFNLRSIDVDVKDESAWVEA  160

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE+YY I  KS +HG+PAGVCPTVGVGGH  G GYGNM+RK+GL+ DN++DAK++D
Sbjct  161   GATLGELYYRIWQKSKLHGYPAGVCPTVGVGGHLSGGGYGNMLRKFGLSTDNVVDAKIVD  220

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             V GR+LDRK+MGE+LFWAI GGG +SF VVL+Y+I LV VP  VT+F   R   +NAT++
Sbjct  221   VRGRILDRKAMGEDLFWAIRGGGGASFGVVLAYKIKLVPVPETVTVFRAERLLAENATDV  280

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             VY +Q ++   D NLF+R+ +  V     P   T+RA+  AL+LG + +L++ + + FPE
Sbjct  281   VYKWQLVAPATDDNLFMRMLLQPVTRNKKP---TVRASIVALYLGGADSLVTLLAKDFPE  337

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL + +  EM WI+SVL++ +F +GT    LL R       LKRKSDY+Q P+P+  + 
Sbjct  338   LGLKKENVMEMSWIQSVLWWANFDNGTSPNVLLDRDLNSADFLKRKSDYVQKPIPKYSLN  397

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              ++K+M+EL    L FNPYGG+MAEIP++   FPHR+GN+  IQY+ +W + G E  +  
Sbjct  398   LLWKQMMELGKIGLVFNPYGGKMAEIPASETAFPHRAGNLFKIQYSISWSDPGTEIEEDR  457

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L     LY +MTPFVSK+PR A+LNYRD+D+GINH+     SY EGK YG KYF  N++R
Sbjct  458   LSQATSLYSFMTPFVSKSPRSAYLNYRDVDIGINHHG--EDSYAEGKVYGEKYFNGNFDR  515

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             LVK+KT VDP+NFFR+EQSIPT P ++
Sbjct  516   LVKVKTMVDPENFFRNEQSIPTQPRQR  542



>ref|XP_004231557.1| PREDICTED: reticuline oxidase-like protein [Solanum lycopersicum]
Length=541

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/507 (56%), Positives = 363/507 (72%), Gaps = 7/507 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRF-NESYTKKPLFIVTATHLS  315
             T ++CL   S P   IS ++YTPNN SF+S+LQ YIRN RF N S T KP+ IVT T  S
Sbjct  28    TFVDCLTKNSIPQSEISKIVYTPNNLSFNSILQAYIRNGRFFNSSTTSKPVIIVTPTVES  87

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
              +   ++C K+  LQ+K RSGGHDYEG+SY+SDVPF +LDMFN RS+++    +TAWV+A
Sbjct  88    QVAGVVVCTKQLNLQLKIRSGGHDYEGISYISDVPFIMLDMFNLRSISIDTNGKTAWVQA  147

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GA LGEVYY I  KS V G+PAGVCPTVGVGGH  G GYGNM+RK+GLTVDN++DA+L+D
Sbjct  148   GAILGEVYYNIWRKSPVLGYPAGVCPTVGVGGHVSGGGYGNMLRKFGLTVDNLLDARLVD  207

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR-TYDQNATN  852
             VNGR+LDRK+MGE+LFWAI GGG +SF V+L+++I LV +P  VT F V R   D   T+
Sbjct  208   VNGRILDRKAMGEDLFWAIKGGGGASFGVILAFQIQLVTLPQTVTYFRVERFIQDTTTTD  267

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNI----TTHPGEKTIRATFNALFLGDSKTLLSTMD  1020
              V  +Q ++ K+D +L+IRL +  + +          K+IRATF ALFLGDS  L+S + 
Sbjct  268   AVVQWQNVASKIDNDLYIRLLIQPITVKSKSKGAKSSKSIRATFVALFLGDSTRLMSLIS  327

Query  1021  ESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMP  1200
             + FP LGL + DC EM WI+SVL + +F + T  E LL+R    L HLKRKSDY+QTP+P
Sbjct  328   KQFPLLGLKKQDCVEMSWIDSVLQWANFDNTTKPEALLNRKGDPLTHLKRKSDYVQTPIP  387

Query  1201  RNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYE  1380
             +  +E IF KM+ L    + FNPYGGRM EI     PFPHR+G +  IQY+ NW E G  
Sbjct  388   KKELESIFAKMISLGKAGMVFNPYGGRMGEIAEGETPFPHRAGILFKIQYSMNWHEEGLT  447

Query  1381  AAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFK  1560
             A + YL   R LY +MTP+VSKNPR+A+LNYRDLD+GIN ++  + S  +G+ YG KYF 
Sbjct  448   AEKEYLSQIRDLYSFMTPYVSKNPRQAYLNYRDLDIGIN-DQVSQHSLEKGRVYGTKYFN  506

Query  1561  ENYNRLVKIKTKVDPDNFFRDEQSIPT  1641
             +N++RLVK+KT VDP NFFR+EQSIPT
Sbjct  507   KNFDRLVKVKTMVDPQNFFRNEQSIPT  533



>ref|XP_003532642.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=577

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/506 (54%), Positives = 365/506 (72%), Gaps = 4/506 (1%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T+ L+CL + +     +S +++   N SFSSVLQ YIRN RFN + T KPL +VT +   
Sbjct  37    TSFLQCLTNYTKSPDQVSNIVFAQTNASFSSVLQAYIRNARFNTTSTPKPLLVVTPSEEP  96

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+Q +++CAK   +Q+K RSGGHDYEG+SYVSD PF ILDMF+FR++ V IE+E A V+A
Sbjct  97    HVQGAVICAKSIAIQLKIRSGGHDYEGISYVSDQPFIILDMFHFRNITVDIENEVAVVQA  156

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE+YY I  KS VHGFPAGVCPTVGVGGH  G GYGNM+RK+GL+VD+++DAK++D
Sbjct  157   GATLGELYYRIWEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMLRKHGLSVDHVVDAKIVD  216

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQN--AT  849
               GR+LD++SMGE+LFWAI GGG +SF V+LSY + LV VP  V++F + ++ DQN  AT
Sbjct  217   AKGRILDKESMGEDLFWAIRGGGGASFGVILSYNVKLVPVPEVVSVFRIAKSLDQNESAT  276

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
              +V  +Q+++   D  LF+RL +  V+     G++TIRAT  ALFLG +  + + M + F
Sbjct  277   ELVLQWQQVAPHTDDRLFMRLLLQPVSSKVVKGQRTIRATVMALFLGGADEVATLMGKEF  336

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNG  1209
             P LGL++ +C E+ WI+SVL++ +F + T  + LL R       LKRKSDY+Q P+P+ G
Sbjct  337   PALGLSKENCTELSWIDSVLWWGNFDNTTKPDALLDRDLNSASFLKRKSDYVQKPIPKKG  396

Query  1210  IEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQ  1389
             +E I++KM+EL      FNPYGG+M+E+ S A PFPHR+GN+  IQY+ NWD+ G E   
Sbjct  397   LEGIWEKMIELGKTGFVFNPYGGKMSEVSSDATPFPHRAGNLFKIQYSVNWDDPGVELEN  456

Query  1390  HYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENY  1569
             ++    R LY YMTPFVS +PR AFLNYRDLD+G N     + SY EG  YG+KYF +N+
Sbjct  457   NFTSQARMLYSYMTPFVSSSPRSAFLNYRDLDIGTNSFG--KNSYAEGAVYGVKYFNDNF  514

Query  1570  NRLVKIKTKVDPDNFFRDEQSIPTFP  1647
              RLVKIKT+VDP+NFFR+EQSIP  P
Sbjct  515   ERLVKIKTEVDPENFFRNEQSIPVHP  540



>ref|XP_002890890.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67149.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=531

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/506 (55%), Positives = 370/506 (73%), Gaps = 18/506 (4%)
 Frame = +1

Query  148   ECLND--RSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHI  321
             +CL D   SNP  PI   IYT  + +F ++L  Y+RNLR+  + T+KP+ IV A  ++HI
Sbjct  34    QCLADFKPSNPKSPIQNFIYTQQSPNFLTILNNYVRNLRYFNNTTRKPVAIVAAADVTHI  93

Query  322   QASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGA  501
             QA+I CAK  GLQ++ RSGGHDY+G+SY+S + F +LDMFN RS+N+  + +TAWV++GA
Sbjct  94    QATITCAKNLGLQLRIRSGGHDYDGMSYLSTIDFVVLDMFNLRSINIDPKLDTAWVQSGA  153

Query  502   TLGEVYYGIANKSN-VHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             TLGE+YYG+ANKSN + GFPAG+CP +G GGHF G GYGNMMRKYGL++DNIIDAK++D 
Sbjct  154   TLGEIYYGVANKSNDLRGFPAGICPGLGAGGHFSGGGYGNMMRKYGLSIDNIIDAKIVDA  213

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI-  855
              GR+LDR SMGE+LFWA+ GGGA+SF VVL+++I LV VP KVT+F+V    ++ + NI 
Sbjct  214   KGRVLDRSSMGEDLFWALRGGGAASFCVVLAWKIKLVPVPTKVTVFNVETVGNRGSVNIT  273

Query  856   --VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
               V  +Q ++ K+D +LFIRLT+   N       KT++A+F  ++LG+S  LL  M+  F
Sbjct  274   ELVTKWQEIADKIDNDLFIRLTLGSSN-------KTVKASFMGMYLGNSSKLLEIMNAKF  326

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGT-PVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             PELGL +++C EM+WIESVLF+   P GT P   +L+R+PQ  ++LKRKSDY+Q P+ R 
Sbjct  327   PELGLNKTECIEMKWIESVLFWLGIPPGTAPTTSMLNRIPQKQIYLKRKSDYVQKPISRT  386

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G+E IFK + E +   + FNPYGGRM+EIPS    FPHR+GN+  IQYA NW   G   A
Sbjct  387   GLESIFKVLTENENVTMAFNPYGGRMSEIPSTETAFPHRAGNMFKIQYAANWFVPGEAVA  446

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
             +  L  T +++E M+P+VSKNPREAFLNYRD+D+G    K    +Y EGK YG+KYFK+N
Sbjct  447   KDCLSQTERVFEAMSPYVSKNPREAFLNYRDVDIG----KSLNSTYEEGKVYGVKYFKDN  502

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTF  1644
             + +LV IK++VDPDNFFR EQSIP  
Sbjct  503   FEKLVNIKSRVDPDNFFRYEQSIPVL  528



>ref|XP_007212391.1| hypothetical protein PRUPE_ppa016294mg [Prunus persica]
 gb|EMJ13590.1| hypothetical protein PRUPE_ppa016294mg [Prunus persica]
Length=530

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/499 (54%), Positives = 370/499 (74%), Gaps = 5/499 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL    +P+H I   IYTP N SF SVL  +I N R++ + T KPL I+ A + SH+Q
Sbjct  34    LQCLTKYPHPAHTIQESIYTPQNSSFQSVLVAHINNRRYSTAATPKPLAIIAAKNESHVQ  93

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A++LCAK HGLQ+K RSGGHD+EG+SY SDVPF ILDMFN  S++V++ D++AWV +GAT
Sbjct  94    ATVLCAKHHGLQIKIRSGGHDFEGLSYTSDVPFVILDMFNINSIDVNVADKSAWVHSGAT  153

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY I  K+NV+GFPAG+CPTVG GGHF G GYG +MRKYGL+VDNI+DA+L+  NG
Sbjct  154   LGEVYYAIGTKTNVYGFPAGICPTVGAGGHFSGGGYGFLMRKYGLSVDNIVDARLVTANG  213

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+LDRKSMGE+LFWAI GGG +SF V+LS+++ LV VPPKVT+F++ +T ++  T++VY 
Sbjct  214   RILDRKSMGEDLFWAIRGGGGASFGVILSWKLKLVPVPPKVTVFNLTKTIEEGVTDLVYK  273

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ +L  ++F+R    V NI T  G KT+  +F   FLG S  +++ ++ESFPELGL
Sbjct  274   WQTLAPQLPKDVFLRAQPQVKNIDTK-GNKTVGVSFIGHFLGTSDKVVALLNESFPELGL  332

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              + DC E+ W+ES +F+   P GTP+E LLS+  +     K KSDY++ P+P++  + I+
Sbjct  333   QRKDCYEVSWVESTVFWAESPIGTPIEILLSKPTEPETFYKGKSDYVKEPIPKHVFDSIW  392

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             KKM+E++   L +NPYGGRM+EI  +A P+PHR+GN+    Y ++W + G EA   Y+ +
Sbjct  393   KKMIEIEHIWLDWNPYGGRMSEISESATPYPHRAGNLFFALYYSSWYDEGIEATNKYVRL  452

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKT-YGLKYFKENYNRLV  1581
             TR+LY+ MTP+VSKNPREAF NYRDLD+G N +    K+ FE  T YG KYFK N++RLV
Sbjct  453   TRELYDMMTPYVSKNPREAFQNYRDLDIGSNQD---NKTNFETATLYGRKYFKGNFDRLV  509

Query  1582  KIKTKVDPDNFFRDEQSIP  1638
             ++KT VDP NFF+ +QSIP
Sbjct  510   RVKTMVDPHNFFKHKQSIP  528



>ref|XP_002299028.2| hypothetical protein POPTR_0001s46690g [Populus trichocarpa]
 gb|EEE83833.2| hypothetical protein POPTR_0001s46690g [Populus trichocarpa]
Length=584

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/502 (55%), Positives = 382/502 (76%), Gaps = 6/502 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL   +NP   IS ++Y+ ++ S++SVL+ YIRN R+N S T KP+ IVT T +SH+Q
Sbjct  37    LQCLESNTNPQDEISKLVYSQSSTSYTSVLRAYIRNARYNTSATPKPVVIVTPTQISHVQ  96

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++C K+ G Q+K RSGGHDY+G+SYVSD+PFF+LDMFN RS+ V++ DE+A V+AGAT
Sbjct  97    ATVICTKKVGYQLKIRSGGHDYDGISYVSDMPFFVLDMFNLRSIEVNVNDESATVQAGAT  156

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY I   S VHGFPAGVCPTVGVGGH  GAGYGNM+RKYGL+VDN++DA+++DVNG
Sbjct  157   LGELYYKIWESSKVHGFPAGVCPTVGVGGHLSGAGYGNMLRKYGLSVDNVVDAEIVDVNG  216

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             +LLDRK+MGE+LFWAI GGG  SF V++SY+I LV VP  VT+F V RT +QNAT++VY 
Sbjct  217   KLLDRKAMGEDLFWAIRGGGGGSFGVIISYKIKLVSVPETVTVFRVERTLEQNATDVVYK  276

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ +   +LF+R+ +  V   T  G +TIRA+   L+LG+S +L++ + + FPELGL
Sbjct  277   WQLVAPQTSNDLFMRMLLQPV---TRNGNQTIRASIVTLYLGNSDSLVALLGKEFPELGL  333

Query  1045  TQSDCREMRWIESVLFYTSFPS-GTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
              + DC E  WI+SV+++    + G   + LL R P     LKRKSDY+Q P+ ++G+E++
Sbjct  334   KKEDCNETSWIQSVMWWDESQNLGKSPDVLLDRNPNDANFLKRKSDYVQNPISKDGLEWL  393

Query  1222  FKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             +KKM+E+    L FNPYGGRM EIP++  PFPHR+GN+  +QY+ NW+E G EA ++++ 
Sbjct  394   WKKMIEVGKTGLVFNPYGGRMNEIPASETPFPHRAGNLFKVQYSVNWEEAGSEADKNFMT  453

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
               R+L+ YMTPFVSKNPR ++LNYRDLD+G+   +  + S+ +G  YG KYF +N++RLV
Sbjct  454   QIRRLHSYMTPFVSKNPRSSYLNYRDLDIGV--MEAGKDSFEQGSVYGYKYFNDNFDRLV  511

Query  1582  KIKTKVDPDNFFRDEQSIPTFP  1647
             K+KT VDP+NFFR+EQSIPT P
Sbjct  512   KVKTAVDPENFFRNEQSIPTLP  533



>emb|CDY50727.1| BnaA05g35540D [Brassica napus]
Length=531

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/506 (55%), Positives = 368/506 (73%), Gaps = 18/506 (4%)
 Frame = +1

Query  148   ECLND--RSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHI  321
             +C  D   SNP+ PI    YT  + SF ++L  Y+RNLR+  + T+KP+ I+ A  ++HI
Sbjct  34    QCTTDFKPSNPNFPIQNFTYTQQDPSFLTILNNYVRNLRYFNNTTRKPVAIIAAADVTHI  93

Query  322   QASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGA  501
             QA+I CAK   LQ++ RSGGHDY+G+SY+S V F +LDMFN RS+    + +TAWV++GA
Sbjct  94    QATITCAKRLSLQLRIRSGGHDYDGMSYLSTVEFVVLDMFNLRSIEFDPKLDTAWVQSGA  153

Query  502   TLGEVYYGIANKSN-VHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             TLGE+YYG+ANKSN + GFPAG+CP +G GGHF G GYGNMMRKYGL++DNIIDAK++D 
Sbjct  154   TLGEIYYGVANKSNDLRGFPAGICPGLGAGGHFSGGGYGNMMRKYGLSIDNIIDAKIVDA  213

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQ---NAT  849
              GR+LDR SMGE+LFWA+ GGGA+SF VVL+++I LV VP KVT+F+V    ++   N T
Sbjct  214   KGRVLDRSSMGEDLFWALRGGGAASFCVVLAWKIKLVPVPGKVTVFNVETVGNRGGVNTT  273

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
              +V  +Q ++ K+D NLFIRLT+   N       KT++A+F  +FLGDS  LL TM+  F
Sbjct  274   ELVLKWQEIADKIDNNLFIRLTLSTSN-------KTVKASFMGMFLGDSTKLLETMNTDF  326

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGT-PVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             P LGL +++C EM+WIESVLF+ S P GT P   +L+R+PQ  ++LKRKSDY+Q P+ R 
Sbjct  327   PALGLNKTECLEMKWIESVLFWLSIPPGTAPTSVMLNRIPQKQIYLKRKSDYVQKPISRT  386

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G++ IFK ++E +   + +NPYGGRM+EIPS    FPHR+GN+  IQYA NW   G   A
Sbjct  387   GLDAIFKVLLENENVTMAWNPYGGRMSEIPSTETAFPHRAGNMFKIQYAANWLVQGEAVA  446

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
                L  T +++E M+P+VSKNPREAFLNYRD+D+G + N     +Y EGK YG+KYFK N
Sbjct  447   NECLSQTERVFEAMSPYVSKNPREAFLNYRDVDIGTSLN----STYEEGKVYGVKYFKNN  502

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTF  1644
             + RLVK+K++VDPDNFFR EQSIP  
Sbjct  503   FERLVKVKSRVDPDNFFRYEQSIPVL  528



>gb|KDP36342.1| hypothetical protein JCGZ_09762 [Jatropha curcas]
Length=541

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/507 (53%), Positives = 367/507 (72%), Gaps = 4/507 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSH  318
             + L+CL + ++P   ++ ++YT  N +++SVLQ YIRN R N+S T KP  I+T   +SH
Sbjct  36    SFLQCLQNNTDPKDQVTDLVYTKTNEAYTSVLQSYIRNARLNKSTTPKPSIILTPKQVSH  95

Query  319   IQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAG  498
             +Q+ ++C K+ G Q+K RSGGHDYEG+SY+SD P+FILDMFN RS+NV I++ +AWVE+G
Sbjct  96    VQSFVICTKKVGYQLKIRSGGHDYEGISYISDSPYFILDMFNLRSINVDIKNNSAWVESG  155

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY I   S VHGFPAG+CPTVGVGGH  G GYGNM+R YGL VDN++DA ++DV
Sbjct  156   ATLGELYYRIWETSKVHGFPAGICPTVGVGGHISGGGYGNMLRTYGLAVDNVVDAVMVDV  215

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNAT--N  852
             NG++LDRK MGE+LFWAI GGG  SF V++SY++ LV VP  V++F V++  D++ T  +
Sbjct  216   NGKVLDRKQMGEDLFWAIRGGGGGSFGVIISYKVQLVSVPEIVSVFRVQKYIDEDKTTVD  275

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             +VY YQ ++  +D  LF+R+ V   +   + G+KTI  T NAL+LG++ +++S + +  P
Sbjct  276   LVYKYQSVAPTIDNGLFMRMLVQPSSSKINKGQKTISITVNALYLGNADSVVSLLSKELP  335

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL + +C EM WI+SVL++ +F + T    LL R       LKRKSDY+Q P+  +G+
Sbjct  336   ELGLMKENCSEMSWIDSVLWWANFDNATSPNALLDRKLNSANFLKRKSDYVQNPISIDGL  395

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
               IF KM+EL    L FNPYGG+MAEIP+   PFPHR+GN+  +QY+ NW+E G  A   
Sbjct  396   NSIFTKMIELGKTGLVFNPYGGKMAEIPATDAPFPHRAGNLYKVQYSVNWEEAGDAAESE  455

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             YL   R+LY +MTPFVS NPR AFLNYRDLD+GI   +  + S+ EG  YG KYF  N++
Sbjct  456   YLGQIRELYSFMTPFVSNNPRSAFLNYRDLDIGI--MEPGKNSFEEGSVYGFKYFNGNFD  513

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFPGR  1653
             RLVK+KT VDP+NFFR+EQSIPT P +
Sbjct  514   RLVKVKTAVDPENFFRNEQSIPTLPSK  540



>ref|XP_007212998.1| hypothetical protein PRUPE_ppa022785mg [Prunus persica]
 gb|EMJ14197.1| hypothetical protein PRUPE_ppa022785mg [Prunus persica]
Length=527

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/500 (53%), Positives = 366/500 (73%), Gaps = 4/500 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL   S+ +HPI   IYTP+N SF SVL  +I N R++   T KPL I+TA H SH+Q
Sbjct  32    LQCLTIHSH-AHPIQEAIYTPHNASFQSVLLLHINNRRYSTPTTPKPLAIITAKHESHVQ  90

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A++LCAK+HGLQ+K RSGGHD+EG+SY SD+PF ILDMFN  S++V++ D TAWV +GAT
Sbjct  91    ATVLCAKQHGLQLKIRSGGHDFEGLSYTSDIPFVILDMFNINSIDVNLADNTAWVHSGAT  150

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY I  K+NV+GFPAG+CPTVG GGH  G GYG MMRKYGL+VDN++DAK++ V G
Sbjct  151   LGEVYYAIGTKTNVYGFPAGLCPTVGAGGHISGGGYGVMMRKYGLSVDNVVDAKIVTVKG  210

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             ++LDRKSMGE+LFWAI GGG +SF V+LS+++ LV VP KVT+F+V +T ++ AT++VY 
Sbjct  211   QILDRKSMGEDLFWAIRGGGGASFGVILSWKLKLVPVPSKVTVFNVTKTIEEGATDLVYK  270

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ +L  +LF+R    V NI T  G+KT+  +F   FLG S  +++ + E FPELGL
Sbjct  271   WQTVAPELPEDLFLRAMPQVKNIDTK-GKKTVAVSFIGQFLGQSDEVVALLTERFPELGL  329

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              ++DC E+RW+E+ +F+   P GTP++ LL +  +     K K+DY++ P+P+  IE ++
Sbjct  330   QRTDCHEVRWVEATVFWAENPIGTPIDVLLDKPIEPATFYKGKADYMKEPLPKYVIEALW  389

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             KKM+E++   +  NPYGGRM+EIP +A P+PHR+GN+    Y ++W + G E    Y+ +
Sbjct  390   KKMIEIENIWVDMNPYGGRMSEIPESATPYPHRAGNLFFALYYSSWYDEGTETTDKYVRL  449

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
             TR+LY+ MTP+VSK+PR+AF NYRDLD+G N +   R        YG KYFK N+ RLV+
Sbjct  450   TRELYDMMTPYVSKSPRQAFQNYRDLDIGANQDNQTRLRV--ATVYGSKYFKGNFARLVR  507

Query  1585  IKTKVDPDNFFRDEQSIPTF  1644
             +KT VDP NFFR +QSIP F
Sbjct  508   VKTAVDPHNFFRHKQSIPPF  527



>ref|XP_006468346.1| PREDICTED: reticuline oxidase-like protein-like isoform X1 [Citrus 
sinensis]
 gb|KDO75192.1| hypothetical protein CISIN_1g043104mg [Citrus sinensis]
Length=570

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/504 (54%), Positives = 367/504 (73%), Gaps = 6/504 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPS-HPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             + L+CL  ++N S   IS ++ T  N S++SVL+ YIRN RFN S T KP  I+T    +
Sbjct  41    SFLQCLTQQTNSSDQQISNIVVTQTNSSYASVLRAYIRNARFNLSSTLKPTVIITPLQEA  100

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+ A+++C+K+ G Q+K RSGGHDYEG+SY+SD PFFILDMFN RS++V ++DE+AWVEA
Sbjct  101   HVSAAVICSKQVGFQLKIRSGGHDYEGLSYISDRPFFILDMFNLRSIDVDVKDESAWVEA  160

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE+YY I  KS +HG+PAGVCPTVGVGGH  G GYGNM+RK+GL+ DN++DAK++D
Sbjct  161   GATLGELYYRIWQKSKLHGYPAGVCPTVGVGGHLSGGGYGNMLRKFGLSTDNVVDAKIVD  220

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             V GR+LDRK+MGE+LFWAI GGG +SF VVL+Y+I LV VP  VT+F   R   +NAT++
Sbjct  221   VRGRILDRKAMGEDLFWAIRGGGGASFGVVLAYKIKLVPVPETVTVFRAERLLAENATDV  280

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             VY +Q ++   D NLF+R+ +  V     P   T+RA+  AL+LG + +L++ + + FPE
Sbjct  281   VYKWQLVAPATDDNLFMRMLLQPVTRNKKP---TVRASIVALYLGGADSLVTLLAKDFPE  337

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL + +  EM WI+SVL++ +F +GT    LL R       LKRKSDY+Q P+P+  + 
Sbjct  338   LGLKKENVMEMSWIQSVLWWANFDNGTSPNVLLDRDLNSADFLKRKSDYVQKPIPKYSLN  397

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              ++K+M+EL    L FNPYGG+MAEIP++   FPHR+GN+  IQY+ +W + G E  +  
Sbjct  398   LLWKQMMELGKIGLVFNPYGGKMAEIPASETAFPHRAGNLFKIQYSISWSDPGTEIEEDR  457

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L     LY +MTPFVSK+PR A+LNYRD+D+GINH+     SY EGK YG KYF  N++R
Sbjct  458   LSQATSLYSFMTPFVSKSPRSAYLNYRDVDIGINHHG--EDSYAEGKVYGEKYFNGNFDR  515

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFP  1647
             LVK+KT VDP+NFFR+EQSIPT P
Sbjct  516   LVKVKTMVDPENFFRNEQSIPTQP  539



>ref|XP_003594610.1| Reticuline oxidase-like protein [Medicago truncatula]
 gb|AES64861.1| FAD-binding berberine family protein [Medicago truncatula]
Length=542

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/516 (54%), Positives = 366/516 (71%), Gaps = 6/516 (1%)
 Frame = +1

Query  115   APLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFI  294
             AP     TT L CL  ++N    IS ++++  N SFS VL+ YIRN RFN + T KPL I
Sbjct  29    APTESLYTTFLHCLT-QNNTDPTISNIVFSQTNTSFSIVLKNYIRNARFNTTSTTKPLLI  87

Query  295   VTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIED  474
             VT    SH+Q++++CAK+  +Q+K RSGGHDYEG+SYV+  PF ILDMFN R++NV I++
Sbjct  88    VTPKQPSHVQSTVICAKQVNIQIKIRSGGHDYEGISYVNQSPFIILDMFNLRTINVDIKN  147

Query  475   ETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNI  654
             E A+V+ GATLGEVYY I  KS VHGFPAGVCPTVGVGGHF G GYG M+RKYGL+VDNI
Sbjct  148   EVAYVQGGATLGEVYYRIYEKSKVHGFPAGVCPTVGVGGHFSGGGYGTMLRKYGLSVDNI  207

Query  655   IDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTY  834
             IDA+++DV GRLL+RKSMGE+LFWAI GGG +SF VVLSY + LV VP  VT+F + +T 
Sbjct  208   IDAEIVDVKGRLLNRKSMGEDLFWAILGGGGASFGVVLSYTVKLVAVPETVTVFRIEKTL  267

Query  835   DQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLST  1014
             +QNAT++V  +Q+++   D  LF+RL +  +      G KTIRA+  A+FLG ++ L+  
Sbjct  268   EQNATDLVVQWQQVAPTTDNRLFMRLLLQPITSKVVKGTKTIRASVVAMFLGRAEELVGI  327

Query  1015  MDESFPELGLTQSDCREMRWIESVLFYT---SFPSGTPVEELLSRVPQVLVHLKRKSDYL  1185
             + + FP LGL ++DC E+ WI SV++Y     F  G   E LL R        KRKSDY+
Sbjct  328   LGKQFPLLGLKKTDCIELSWINSVIWYNDADDFNKGAKPESLLDRNLNSAAFGKRKSDYV  387

Query  1186  QTPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWD  1365
             Q  + ++ +E I+KKM+EL      FNPYGG+MAEIP+ A PFPHR+GN+  IQ++ NW+
Sbjct  388   QKAISKDDLEGIWKKMIELGKVGFVFNPYGGKMAEIPADATPFPHRAGNLFKIQFSVNWN  447

Query  1366  EHGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYG  1545
             +    A   +L   + LY YMTP+VSKNPR A++NYRDLD+GIN     + SY EG+ YG
Sbjct  448   DPAPNATVGFLNQAKVLYSYMTPYVSKNPRSAYINYRDLDIGINSFG--KNSYEEGEVYG  505

Query  1546  LKYFKENYNRLVKIKTKVDPDNFFRDEQSIPTFPGR  1653
              KYF  N++RLVKIKT VDPDNFFR+EQSIP  PG+
Sbjct  506   TKYFNNNFDRLVKIKTAVDPDNFFRNEQSIPVLPGK  541



>ref|XP_011085610.1| PREDICTED: reticuline oxidase-like protein [Sesamum indicum]
Length=532

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/506 (54%), Positives = 369/506 (73%), Gaps = 13/506 (3%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL+ R  P   ++ + YTP + +++SVLQEYIRN RFN S T KP  I+T    S +Q
Sbjct  32    LDCLSSRKIPPQQLANITYTPKSTNYTSVLQEYIRNSRFNTSTTPKPTLILTPFLESQVQ  91

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVS--DVPFFILDMFNFRSVNVSIEDETAWVEAG  498
               + CAK  G+Q+K RSGGHDYEG+SY S  + PF +LD+FN RS+++++EDETAWVEAG
Sbjct  92    DIVTCAKISGIQLKIRSGGHDYEGLSYTSKSNNPFIVLDLFNLRSIDINLEDETAWVEAG  151

Query  499   ATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             ATLGE+YY I  KS VH FPAGVC T+G+GGHF G GYGN+MRK+GL+VDN++DAK++D 
Sbjct  152   ATLGELYYSIWQKSKVHAFPAGVCTTLGIGGHFSGGGYGNLMRKFGLSVDNVVDAKIVDA  211

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIV  858
             NGR+LDRK+MGE+LFWAI GGGA+SF VVL+++INL+RVPP+VT+F V +T ++NAT++V
Sbjct  212   NGRILDRKAMGEDLFWAIRGGGAASFGVVLAFKINLIRVPPEVTVFRVTKTLEENATDLV  271

Query  859   YCYQRMSHKLDPNLFIRLTVDVVNITTHPGEK---TIRATFNALFLGDSKTLLSTMDESF  1029
             + +Q ++ K D +LF+R     V + T+ GEK   ++RA+F ALFLGD+  L++ +   F
Sbjct  272   HRWQYIADKFDKDLFVR-----VFLQTYAGEKNKTSVRASFIALFLGDANKLVALIKSGF  326

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNG  1209
             PELGL + +C+E+ WI SVL++  +P GTP   LL R        K KSDY++TP+P++G
Sbjct  327   PELGLKKEECKEISWIRSVLYFADYPEGTPETALLVRKSAFPSASKMKSDYVKTPIPKDG  386

Query  1210  IEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQ  1389
             +     +M       + FNPYGGRM EIP A  PFPHR+GNI  IQY   W+E G  A +
Sbjct  387   LREALNRMAASGNIWMQFNPYGGRMGEIPEAEIPFPHRAGNIFKIQYLVIWNEAGGAAVE  446

Query  1390  HY-LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
                +E   + Y++MTP+VSKNPREAFLNYRD+++G   N G   +Y + K YG+KYFK N
Sbjct  447   KSNIENLSKFYQFMTPYVSKNPREAFLNYRDINIGSTDNGG--DAYEKAKVYGIKYFKGN  504

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTF  1644
             ++RLV++KTKVDP N FR+EQSIPT 
Sbjct  505   FDRLVQVKTKVDPTNLFRNEQSIPTL  530



>ref|XP_009102690.1| PREDICTED: reticuline oxidase-like protein [Brassica rapa]
Length=531

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/506 (55%), Positives = 367/506 (73%), Gaps = 18/506 (4%)
 Frame = +1

Query  148   ECLND--RSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHI  321
             +C  D   SNP+ PI    YT  + SF ++L  Y+RNLR+  + T+KP+ IV A  ++HI
Sbjct  34    QCTTDFKPSNPNFPIQNFTYTQQDPSFLTILNNYVRNLRYFNNTTRKPVAIVAAADVTHI  93

Query  322   QASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGA  501
             QA+I CAK   LQ++ RSGGHDY+G+SY+S V F +LDMFN RS+    + +TAWV++GA
Sbjct  94    QATITCAKRLSLQLRIRSGGHDYDGMSYLSTVEFVVLDMFNLRSIEFDPKLDTAWVQSGA  153

Query  502   TLGEVYYGIANKSN-VHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             TLGE+YYG+ANKSN + GFPAG+CP +G GGHF G GYGNMMRKYGL++DNIIDAK++D 
Sbjct  154   TLGEIYYGVANKSNDLRGFPAGICPGLGAGGHFSGGGYGNMMRKYGLSIDNIIDAKIVDA  213

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQ---NAT  849
              GR+LDR SMGE+LFWA+ GGGA+SF VVL+++I LV VP KVT+F+V    ++   N T
Sbjct  214   KGRVLDRSSMGEDLFWALRGGGAASFCVVLAWKIKLVPVPGKVTVFNVETVGNRGGVNTT  273

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
              +V  +Q ++ K D NLFIRLT+   N       KT++A+F  +FLGDS  LL  M+  F
Sbjct  274   ELVLKWQEIADKTDDNLFIRLTLSTSN-------KTVKASFMGMFLGDSAKLLEIMNTDF  326

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGT-PVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             PELGL +S+C EM+WIESVLF+ S P GT P   +L+R+PQ  ++LKRKSDY+Q P+ R 
Sbjct  327   PELGLNKSECLEMKWIESVLFWLSIPPGTAPTSVILNRIPQKQIYLKRKSDYVQKPISRT  386

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G++ IFK ++E +   + +NPYGGRM+EIPS    FPHR+GN+  IQYA NW   G   A
Sbjct  387   GLDAIFKVLLENENVTMAWNPYGGRMSEIPSTETAFPHRAGNMFKIQYAANWFVQGEAVA  446

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
                L  T +++E M+P+VS+NPREAFLNYRD+D+G + N     +Y EGK YG+KYFK N
Sbjct  447   NECLSQTERVFEAMSPYVSENPREAFLNYRDVDIGTSLN----STYEEGKVYGVKYFKNN  502

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTF  1644
             + RLVK+K++VDPDNFFR EQSIP  
Sbjct  503   FERLVKVKSRVDPDNFFRYEQSIPVL  528



>ref|XP_010685243.1| PREDICTED: reticuline oxidase-like protein [Beta vulgaris subsp. 
vulgaris]
Length=533

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/506 (55%), Positives = 369/506 (73%), Gaps = 16/506 (3%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL  RS PSHPIS  IY P+N SF +VLQ Y+R+ RFN S T KPL IVTA  +SH+Q
Sbjct  38    LKCLPTRSTPSHPISNAIYIPSNSSFLNVLQNYVRDSRFNTSSTPKPLAIVTALDVSHVQ  97

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++CAK + +Q++ RSGGHD+EG+SY+S+ PF ILDMFN RS+++ I +E A ++AGAT
Sbjct  98    ATVICAKTNSVQIRIRSGGHDFEGLSYISNDPFIILDMFNLRSIDIDIPNEIASIQAGAT  157

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY IA KSN+H FPAGVC T+G GGHF G GYGNM+R+YGL++DNIIDA+++D NG
Sbjct  158   LGELYYKIAQKSNIHAFPAGVCFTLGAGGHFSGGGYGNMLRQYGLSIDNIIDAQVVDANG  217

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+L+RKSMGE+LFWAI GGG +SF V+LS++INLVRVP  VT+F+V++T ++ ATNIV  
Sbjct  218   RILNRKSMGEDLFWAIRGGGGASFCVILSWKINLVRVPNIVTVFNVQKTLEEGATNIVLQ  277

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q+++  +D  LFIR+   V+      G+KT++ +F   +LG + TLLS M +SFP L L
Sbjct  278   WQQIASTIDRKLFIRVQPQVIQ---QGGKKTVQVSFIGQYLGRTNTLLSLMKKSFPLLSL  334

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVP-QVLVHLKRKSDYLQTPMPRNGIEFI  1221
                DC EM WIE+ LF+   P GTP+E LL R P     + K KSD+++ P+PR G+E I
Sbjct  335   QAQDCFEMPWIETTLFWNGNPKGTPIEVLLQRTPTSSHSYGKHKSDFVKKPIPREGLEMI  394

Query  1222  FKKMVELQ----TPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQ  1389
             ++KM+E Q      +L +NPYGGRM EI + A  FPHR+GN+  +QY T W +   EA +
Sbjct  395   WRKMIEAQILDNILLLQWNPYGGRMNEIEANATAFPHRAGNLFKMQYITLWQDDSAEATR  454

Query  1390  HYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENY  1569
               LE TR+L++  TPFVSKNPREAFLNYRD+D+G N+ KG          +   +FK+N 
Sbjct  455   RNLEATRKLHDAFTPFVSKNPREAFLNYRDIDVG-NNQKG-------SLVFASDFFKDNV  506

Query  1570  NRLVKIKTKVDPDNFFRDEQSIPTFP  1647
              RL+++K KVDP NFFR EQSIP FP
Sbjct  507   KRLLQVKAKVDPSNFFRYEQSIPVFP  532



>ref|XP_006448860.1| hypothetical protein CICLE_v10014748mg [Citrus clementina]
 gb|ESR62100.1| hypothetical protein CICLE_v10014748mg [Citrus clementina]
Length=570

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/504 (54%), Positives = 366/504 (73%), Gaps = 6/504 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPS-HPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             + L+CL  ++N S   IS ++ T  N S++SVL+ YIRN RFN S T KP  I+T    S
Sbjct  41    SFLQCLTQQTNSSEQQISNIVVTQTNSSYASVLRAYIRNARFNLSSTLKPTVIITPLQES  100

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+ A+++C+K+ G Q+K RSGGHDYEG+SY+SD PFFILDMFN RS++V ++DE+AWVEA
Sbjct  101   HVSAAVICSKQVGFQLKIRSGGHDYEGLSYISDRPFFILDMFNLRSIDVDVKDESAWVEA  160

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE+YY I  KS +HG+PAGVCPTVGVGGH  G GYGNM+RK+GL+ DN++DAK++D
Sbjct  161   GATLGELYYRIWQKSKLHGYPAGVCPTVGVGGHLSGGGYGNMLRKFGLSTDNVVDAKIVD  220

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             V GR+LDRK+MGE+LFWAI GGG +SF VVL+Y+I LV VP  VT+F   R   +NAT++
Sbjct  221   VRGRILDRKAMGEDLFWAIRGGGGASFGVVLAYKIKLVPVPETVTVFRAERLLAENATDV  280

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             VY +Q ++   D NLF+R+ +  V     P   T+RA+  AL+LG + +L++ + + FPE
Sbjct  281   VYKWQLVAPATDDNLFMRMLLQPVTRNKKP---TVRASIVALYLGGADSLVTLLAKDFPE  337

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL + +  EM WI+SVL++ +F +GT    LL R       LKRKSDY+Q P+P+  + 
Sbjct  338   LGLKKENVMEMSWIQSVLWWANFDNGTSPNVLLDRDLNSADFLKRKSDYVQKPIPKYSLN  397

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              ++K+M+EL    L FNPYGG+MAEIP++   FPHR+GN+  IQY+ +W + G E  +  
Sbjct  398   LLWKQMMELGKIGLVFNPYGGKMAEIPASETAFPHRAGNLFKIQYSISWSDPGTEIEEDR  457

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L     LY +MTPFVS +PR A+LNYRD+D+GINH+     SY EGK YG KYF  N++R
Sbjct  458   LSQATSLYSFMTPFVSTSPRSAYLNYRDVDIGINHHG--EDSYAEGKVYGEKYFNGNFDR  515

Query  1576  LVKIKTKVDPDNFFRDEQSIPTFP  1647
             LVK+KT VDP+NFFR+EQSIPT P
Sbjct  516   LVKVKTMVDPENFFRNEQSIPTQP  539



>ref|XP_008225666.1| PREDICTED: reticuline oxidase-like protein [Prunus mume]
Length=530

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/499 (54%), Positives = 370/499 (74%), Gaps = 5/499 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL    +P+H I   IYTP N SF SVL  +I N R++ + T KPL I+ A + SH+Q
Sbjct  34    LQCLTKYPHPAHTIQESIYTPQNSSFQSVLVAHINNRRYSTAATPKPLAIIAAKNESHVQ  93

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A++LCAK HGLQ+K RSGGHD+EG+SY SDVPF ILDMFN  S++V++ D++AWV +GAT
Sbjct  94    ATVLCAKHHGLQIKIRSGGHDFEGLSYTSDVPFVILDMFNINSIDVNVADKSAWVHSGAT  153

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY I  K+NV+GFPAG+CPTVG GGHF G GYG +MRKYGL+VDNI+DA+L+  NG
Sbjct  154   LGEVYYAIGTKTNVYGFPAGICPTVGAGGHFSGGGYGFLMRKYGLSVDNIVDARLVTANG  213

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+LDRKSMGE++FWAI GGG +SF V+LS+++ LV VPPKVT+F++ +T ++ AT++VY 
Sbjct  214   RILDRKSMGEDVFWAIRGGGGASFGVILSWKLKLVPVPPKVTVFNLTKTIEEGATDLVYK  273

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ +L   +F+R    V NI T  G KT+  +F   FLG S  +++ ++ESFPELGL
Sbjct  274   WQTLAPQLPKEVFLRAQPQVKNIDTK-GNKTVGVSFIGHFLGTSDKVVALLNESFPELGL  332

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              + +C E+ W+ES +F+   P GTP+E LLS+  +     K KSDY++ P+P++  + I+
Sbjct  333   QRKNCYEVSWVESTVFWAESPIGTPIEILLSKPTEPETFYKGKSDYVKEPIPKHVFDSIW  392

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             KKM+E++   L +NPYGGRM+EI  +A P+PHR+GN+    Y ++W + G EA   Y+ +
Sbjct  393   KKMIEIEHIWLDWNPYGGRMSEISESATPYPHRAGNLFFALYYSSWYDEGIEATNKYVSL  452

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKT-YGLKYFKENYNRLV  1581
             TR+LY+ MTP+VSKNPREAF NYRDLD+G N +    K+ FE  T YG KYFK N++RLV
Sbjct  453   TRELYDMMTPYVSKNPREAFQNYRDLDIGANQD---NKTNFETATLYGRKYFKGNFDRLV  509

Query  1582  KIKTKVDPDNFFRDEQSIP  1638
             ++KT VDP NFF+ +QSIP
Sbjct  510   RVKTMVDPLNFFKHKQSIP  528



>ref|XP_010685240.1| PREDICTED: reticuline oxidase-like protein [Beta vulgaris subsp. 
vulgaris]
Length=532

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/508 (55%), Positives = 366/508 (72%), Gaps = 17/508 (3%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L CL  RSN SHPIS  IYTP+N SF +VLQ Y+R  RFN S T KPL IVTA  +SH+Q
Sbjct  38    LLCLPSRSNSSHPISRAIYTPSNPSFLNVLQYYVRESRFNTSSTPKPLAIVTALDVSHVQ  97

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++CAK + L+++ RSGGHDYEG+SYVS+VPF ILDMFN RS+++ I  ETAW +AGAT
Sbjct  98    ATVICAKANKLEIRIRSGGHDYEGMSYVSNVPFVILDMFNLRSIDIDIPSETAWTQAGAT  157

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGE+YY IA KS  H FPAGVC TVG GGHF G GYGNM+R+YGL++DNIIDAK++D NG
Sbjct  158   LGELYYKIAQKSKTHAFPAGVCSTVGTGGHFTGGGYGNMLRQYGLSIDNIIDAKIVDANG  217

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+ +RKSMGE+LFWAI GGG +SF V+LS++I LVRVP  VT+F + RT +Q AT+IV  
Sbjct  218   RIFNRKSMGEDLFWAIRGGGGASFCVILSWKIKLVRVPEIVTVFRIPRTLEQGATDIVLQ  277

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q+++  +D  LFIR+  +V+      G KT++ +F  L+LG + +L S M+ SFP LGL
Sbjct  278   WQQVASTIDRKLFIRVQQEVIQ---QGGNKTVQVSFIGLYLGRTNSLRSLMNNSFPLLGL  334

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSR-VPQVLVHLKRKSDYLQTPMPRNGIEFI  1221
                DC EM W+E+ LF+  FP GTPVE LL R +   + + K+KSDY++ P+PR G+E I
Sbjct  335   QAQDCIEMPWVETTLFWYDFPLGTPVEVLLERTITPAMSYTKKKSDYVKNPIPREGLETI  394

Query  1222  FKKMVELQTP---MLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             +KKM+ELQ+    ++ +NPYGGRM EI   A  FPHR+GN+  IQY T WD+        
Sbjct  395   WKKMIELQSDNSFVVQWNPYGGRMDEIAEDATAFPHRAGNLFKIQYITIWDDDS--GTSR  452

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
              +E+ R+L++  TPFVS NPREAFLNYRD+D+G N N            + L +FK N  
Sbjct  453   NIEVARELHDVYTPFVSMNPREAFLNYRDIDVGTNENGSL--------DFALDFFKGNVK  504

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFPGRK  1656
             RL+++K KVDP NFF++EQS+P FP ++
Sbjct  505   RLLQVKAKVDPSNFFKNEQSLPVFPMKQ  532



>ref|XP_007212909.1| hypothetical protein PRUPE_ppa022216mg [Prunus persica]
 gb|EMJ14108.1| hypothetical protein PRUPE_ppa022216mg [Prunus persica]
Length=530

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/499 (54%), Positives = 370/499 (74%), Gaps = 5/499 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL    +P+H I   IYTP N SF SVL  +I N R++ + T KPL I+ A + SH+Q
Sbjct  34    LQCLTKYPHPAHTIQESIYTPQNSSFQSVLVAHINNRRYSTAATPKPLAIIAAKNESHVQ  93

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A++LCAK HGLQ+K RSGGHD+EG+SY SDVPF ILDMFN  S++V++ D++AWV +GAT
Sbjct  94    ATVLCAKHHGLQIKIRSGGHDFEGLSYTSDVPFVILDMFNINSIDVNVADKSAWVHSGAT  153

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY I  K+NV+GFPAG+CPTVG GGHF G GYG +MRKYGL+VDNI+DA+L+  NG
Sbjct  154   LGEVYYAIGTKTNVYGFPAGICPTVGAGGHFSGGGYGFLMRKYGLSVDNIVDARLVTANG  213

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+LDRKSMGE+LFWAI GGG +SF V+LS+++ LV VPPKVT+F++ +T ++  T++VY 
Sbjct  214   RILDRKSMGEDLFWAIRGGGGASFGVILSWKLKLVPVPPKVTVFNLTKTIEEGVTDLVYK  273

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ +L  ++F+R    V NI T  G KT+  +F   FLG S  +++ ++ESFPELGL
Sbjct  274   WQTLAPQLPKDVFLRAQPQVKNIDTK-GNKTVGVSFIGHFLGTSDKVVALLNESFPELGL  332

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              + DC E+ W+ES +F+   P GTP+E LLS+  +     K KSDY++ P+P++  + I+
Sbjct  333   QRKDCYEVSWVESTVFWAESPIGTPIEILLSKPTEPETFYKGKSDYVKEPIPKHVFDSIW  392

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             KKM+E++   L +NPYGGRM+EI  +A P+PHR+GN+    Y ++W + G EA   Y+ +
Sbjct  393   KKMIEIEHIWLDWNPYGGRMSEISESATPYPHRAGNLFFALYYSSWYDEGIEATNKYVSL  452

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKT-YGLKYFKENYNRLV  1581
             TR+LY+ MTP+VSK+PREAF NYRDLD+G N +    K+ FE  T YG KYFK N++RLV
Sbjct  453   TRELYDMMTPYVSKSPREAFQNYRDLDIGANQD---NKTDFETATLYGRKYFKGNFDRLV  509

Query  1582  KIKTKVDPDNFFRDEQSIP  1638
             ++KT VDP NFF+ +QSIP
Sbjct  510   RVKTMVDPLNFFKHKQSIP  528



>emb|CDX77576.1| BnaA07g07140D [Brassica napus]
Length=531

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/506 (54%), Positives = 368/506 (73%), Gaps = 18/506 (4%)
 Frame = +1

Query  148   ECLND--RSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHI  321
             +C  D   SNP+ PI    YT  + SF ++L  Y+RNLR+  + T+KP+ IV A  ++HI
Sbjct  34    QCTTDFKPSNPNFPIQNFTYTQQDPSFLTILNNYVRNLRYFNNTTRKPVAIVAAADVTHI  93

Query  322   QASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGA  501
             QA+I CAK   LQ++ RSGGHDY+G+SY+S V F +LDMFN RS+    + +TAW+++GA
Sbjct  94    QATITCAKRLSLQLRVRSGGHDYDGMSYLSTVEFVVLDMFNLRSIEFDPKLDTAWIQSGA  153

Query  502   TLGEVYYGIANKSN-VHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             TLGE+YYG+ANKSN + GFPAG+CP +G GGHF G GYGNMMRKYGL++DNIIDAK++D 
Sbjct  154   TLGEIYYGVANKSNDLRGFPAGICPGLGAGGHFSGGGYGNMMRKYGLSIDNIIDAKIVDA  213

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQ---NAT  849
              GR+LDR SMGE+LFWA+ GGGA+SF VVL+++I LV VP KVT+F+V    ++   N T
Sbjct  214   KGRVLDRSSMGEDLFWALRGGGAASFCVVLAWKIKLVPVPGKVTVFNVETVGNRGGVNTT  273

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
              +V  +Q ++ K D NLFIRLT+   N       KT++A+F  +FLGDS  LL  M+  F
Sbjct  274   ELVLKWQEIADKTDNNLFIRLTLSTSN-------KTVKASFMGMFLGDSAKLLEIMNTDF  326

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGT-PVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             PELGL +S+C E++WIESVLF+ S P GT P   +L+R+PQ  ++LKRKSDY+Q P+ R 
Sbjct  327   PELGLNKSECLEIKWIESVLFWLSIPPGTAPTSVILNRIPQKQIYLKRKSDYVQKPISRT  386

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G++ IFK ++E +   + +NPYGGRM+EIPS    FPHR+GN+  IQYA NW   G   A
Sbjct  387   GLDAIFKVLLENENVTMAWNPYGGRMSEIPSTETAFPHRAGNMFKIQYAANWFVQGEAVA  446

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
                L  T +++E M+P+VS+NPREAFLNYRD+D+G + N     +Y EGK YG+KYFK N
Sbjct  447   NECLSQTERVFEAMSPYVSENPREAFLNYRDVDIGTSLN----STYEEGKVYGVKYFKNN  502

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIPTF  1644
             ++RLVK+K++VDPDNFFR EQSIP  
Sbjct  503   FDRLVKVKSRVDPDNFFRYEQSIPVL  528



>ref|XP_007212681.1| hypothetical protein PRUPE_ppa018446mg, partial [Prunus persica]
 gb|EMJ13880.1| hypothetical protein PRUPE_ppa018446mg, partial [Prunus persica]
Length=513

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/498 (53%), Positives = 367/498 (74%), Gaps = 7/498 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             ++CL + S  + PI    YTP N SF  VL   I+N R+    T KPL IV  TH SH+Q
Sbjct  21    IQCLGETSQSNPPI----YTPQNTSFPHVLLSLIKNRRYFTPTTPKPLAIVAPTHESHVQ  76

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++C K HGLQ++ RSGGHDYEG+SYVS++PF +LDMFN RSV++++EDE+AWV+AGAT
Sbjct  77    ATVICTKRHGLQIRIRSGGHDYEGLSYVSNLPFVVLDMFNLRSVDMNLEDESAWVQAGAT  136

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             +GE+YY I  KS VHGF AG CP+VG+GGHF G GYG +MRKYGLTVDN+ DAKL++VNG
Sbjct  137   IGELYYAIGQKSKVHGFAAGSCPSVGIGGHFSGGGYGPLMRKYGLTVDNVEDAKLVNVNG  196

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+LDR +MGE+LFWAI GGG +SF V+LS++I L+RVPPKVT+F+VRRT ++  T++++ 
Sbjct  197   RILDRNTMGEDLFWAIRGGGGASFGVILSWKIKLIRVPPKVTMFNVRRTLEEGGTDVLHR  256

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++ KL  ++FIR+ + V N ++  G+KT++  F   FLG S  L+  +++ FPELGL
Sbjct  257   WQYVAPKLPEDIFIRVGIQVKN-SSQEGKKTVQVLFTGQFLGQSDKLVPLVNKRFPELGL  315

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              Q DC EM WIES +F  + P GTP++ LLSR     +  K KSDY++ P+P++G + I+
Sbjct  316   QQKDCFEMSWIESTVFMAACPIGTPIDVLLSRPKAPAIFFKSKSDYVKEPIPKHGFKSIW  375

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEI  1404
             KK+++++   +  NPYGGRM+EI  +A PFPHR+GN+  +QY  +W E G +   HY+++
Sbjct  376   KKLIKIEKVWMQLNPYGGRMSEISESATPFPHRAGNLYSVQYFISWMEEGIKTTNHYIKL  435

Query  1405  TRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVK  1584
             +R+LY  M PFVSKNPREA  NYRDLD+G N       ++ + + YG KYFK N++RLV+
Sbjct  436   SRKLYTSMAPFVSKNPREALQNYRDLDIGTNLRN--HTNFHKARLYGRKYFKYNFDRLVQ  493

Query  1585  IKTKVDPDNFFRDEQSIP  1638
             +KT VDP +FF+ EQSIP
Sbjct  494   VKTMVDPQDFFKHEQSIP  511



>ref|XP_002277294.1| PREDICTED: inactive tetrahydrocannabinolic acid synthase-like 
[Vitis vinifera]
Length=536

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/500 (56%), Positives = 371/500 (74%), Gaps = 6/500 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL   SN S PI+ V+YTP+N S+ +VL   I+NLRF  S T +P  IVT   +SHIQ
Sbjct  34    LQCLTLNSNSSTPITKVVYTPHNSSYETVLDFSIQNLRFTSSCTPRPQVIVTPLLVSHIQ  93

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+++C+K++GLQ++ARSGGHDYEG+SYVS+VPF I+D+   RS+NV +ED +AWVEAGAT
Sbjct  94    AAVICSKKYGLQIRARSGGHDYEGLSYVSEVPFIIVDLLELRSINVDVEDGSAWVEAGAT  153

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY IANK+  HGFPAG+CPTVGVGGH  G GYG ++RKYGL  DNIIDA ++D NG
Sbjct  154   LGEVYYSIANKTATHGFPAGICPTVGVGGHLSGGGYGTLLRKYGLAADNIIDAYIVDSNG  213

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              LL+R+SMGE+LFWAI GGG +SF +++S++I LV VP  VT+F+V RT +Q+A  I+  
Sbjct  214   TLLNRESMGEDLFWAIRGGGGASFGIIVSWKIKLVPVPSTVTVFTVTRTLEQDAEKILLK  273

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q+++ KL  +LFIR+ V  VN  +  GE+TI +T+ +LFLG++  LLS M+ESFPELGL
Sbjct  274   WQQVADKLHEDLFIRVYVQAVN-GSQEGERTISSTYESLFLGNTSGLLSLMNESFPELGL  332

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
                DC E  WIESVL++  F SG P++ LL+R      + K KSD+L+ P+P  G+  I+
Sbjct  333   AADDCNETSWIESVLYFAGF-SGQPLDVLLNRSQTSKNYFKNKSDFLKEPIPETGLHGIW  391

Query  1225  KKMVELQ--TPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             K   EL+  T M+  +PYGGRM EIP    PFPHR G++  IQY  NW E G E ++ ++
Sbjct  392   KLFYELKNATGMIIISPYGGRMNEIPETETPFPHRKGSLYSIQYVVNWLEEGEEVSKRHI  451

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             + TR+LY+YM P+VSK+PR A+LNYRDLDLG   NK    SY +   +GLKY+K N+NRL
Sbjct  452   DWTRKLYKYMAPYVSKSPRAAYLNYRDLDLG--RNKNGNTSYAQASIWGLKYYKINFNRL  509

Query  1579  VKIKTKVDPDNFFRDEQSIP  1638
             V++KTKVDP NFFR+EQSIP
Sbjct  510   VQVKTKVDPSNFFRNEQSIP  529



>ref|XP_010463011.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=531

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/504 (54%), Positives = 372/504 (74%), Gaps = 18/504 (4%)
 Frame = +1

Query  148   ECLND--RSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHI  321
             +CL D   SNP  PI   I+T +N  F ++L  Y+RNLR+  + T+KP+ IV A  ++HI
Sbjct  34    QCLTDFKPSNPKSPIQNFIFTQHNPKFLTILNNYVRNLRYFNNTTRKPVAIVAAADVTHI  93

Query  322   QASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGA  501
             QA+I CAK+  +Q++ RSGGHDY+G+SY+S + F +LDMFN RS+ +  + +TAWVE+GA
Sbjct  94    QATITCAKKLSIQLRIRSGGHDYDGMSYLSTIDFVVLDMFNLRSIKIDPKLDTAWVESGA  153

Query  502   TLGEVYYGIANKSN-VHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDV  678
             TLGE+YYG+ANKSN + GFPAG+CP +G GGHFGG GYGNMMRKYGL++DNIIDAK++D 
Sbjct  154   TLGEIYYGVANKSNDLRGFPAGICPGLGAGGHFGGGGYGNMMRKYGLSIDNIIDAKIVDA  213

Query  679   NGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQ---NAT  849
              GR+LDR SMGE+LFWA+ GGGA+SF V L+++I LV VP KVT+F+V    ++   N T
Sbjct  214   KGRVLDRSSMGEDLFWALRGGGAASFCVALAWKIKLVPVPAKVTVFNVETVGNRGSVNTT  273

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
              +V  +Q ++ K+D +LFIRLT+   N       KT++A+F  ++LG++  LL  M+  F
Sbjct  274   ELVAKWQEIADKIDNDLFIRLTLGSSN-------KTVKASFMGMYLGNASKLLEIMNTKF  326

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGT-PVEELLSRVPQVLVHLKRKSDYLQTPMPRN  1206
             PELGL +++C EM+WIES+LF+ S P GT P   +L+R+PQ  ++LKRKSDY+Q P+ R 
Sbjct  327   PELGLKKTECIEMKWIESILFWLSIPPGTAPTSSMLNRIPQKQIYLKRKSDYVQKPISRT  386

Query  1207  GIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAA  1386
             G++ IFK ++E +   + +NPYGGRM+EIPS    FPHR+GN+  IQYA NW   G   A
Sbjct  387   GLDAIFKVLIENENVSMAWNPYGGRMSEIPSTETAFPHRAGNMFKIQYAANWFVSGEAVA  446

Query  1387  QHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKEN  1566
             +  L  T +++E M+P+VSKNPREAFLNYRD+D+G + N     +Y EGK YG+KYFK N
Sbjct  447   KDCLSQTERVFEAMSPYVSKNPREAFLNYRDVDIGTSMN----STYEEGKVYGVKYFKNN  502

Query  1567  YNRLVKIKTKVDPDNFFRDEQSIP  1638
             + RLV++K++VDPDNFFR EQSIP
Sbjct  503   FERLVQVKSRVDPDNFFRYEQSIP  526



>ref|XP_006448857.1| hypothetical protein CICLE_v10014826mg [Citrus clementina]
 gb|ESR62097.1| hypothetical protein CICLE_v10014826mg [Citrus clementina]
Length=542

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/502 (54%), Positives = 365/502 (73%), Gaps = 6/502 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPS-HPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             + L+CL  ++N S   IS ++ T  N S++SVL+ YIRN RFN S T KP  I+T    S
Sbjct  41    SFLQCLTQQTNSSEQQISNIVVTQTNSSYASVLRAYIRNARFNLSSTLKPTVIITPLQES  100

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+ A+++C+K+ G Q+K RSGGHDYEG+SY+SD PFFILDMFN RS++V ++DE+AWVEA
Sbjct  101   HVSAAVICSKQVGFQLKIRSGGHDYEGLSYISDRPFFILDMFNLRSIDVDVKDESAWVEA  160

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE+YY I  KS +HG+PAGVCPTVGVGGH  G GYGNM+RK+GL+ DN++DAK++D
Sbjct  161   GATLGELYYRIWQKSELHGYPAGVCPTVGVGGHLSGGGYGNMLRKFGLSTDNVVDAKIVD  220

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
               GR+LDRK+MGE+LFWAI GGG +SF VVL+Y+I LV VP  VT+F   R   +NA+++
Sbjct  221   ARGRILDRKAMGEDLFWAIRGGGGASFGVVLAYKIKLVPVPETVTVFRAERLLAENASDV  280

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             VY +Q ++   D NLF+R+ +  V     P   T+RA+  AL+LG + +L++ + + FPE
Sbjct  281   VYKWQLVAPATDDNLFMRMLLQPVTRNKKP---TVRASIVALYLGGADSLVTLLAKDFPE  337

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             LGL + +  EM WI+SVL++ +F +GT    LL R       LKRKSDY+Q P+P+  + 
Sbjct  338   LGLKKENVMEMSWIQSVLWWANFDNGTSPNVLLDRDLNSADFLKRKSDYVQKPIPKYSLN  397

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              ++K+M+EL    L FNPYGG+MAEIP++   FPHR+GN+  IQY+ +W + G E  +  
Sbjct  398   LLWKQMMELGKIGLVFNPYGGKMAEIPASETAFPHRAGNLFKIQYSISWGDPGTEIEEDR  457

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNR  1575
             L     LY +MTPFVSK+PR A+LNYRD+D+GINH+     SY EGK YG KYF  N++R
Sbjct  458   LSQATSLYSFMTPFVSKSPRSAYLNYRDVDIGINHHG--EDSYAEGKVYGEKYFNGNFDR  515

Query  1576  LVKIKTKVDPDNFFRDEQSIPT  1641
             LVK+K+ VDP+NFFR+EQSIPT
Sbjct  516   LVKVKSMVDPENFFRNEQSIPT  537



>ref|XP_007211550.1| hypothetical protein PRUPE_ppa004087mg [Prunus persica]
 gb|EMJ12749.1| hypothetical protein PRUPE_ppa004087mg [Prunus persica]
Length=531

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/500 (54%), Positives = 367/500 (73%), Gaps = 7/500 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL  + +  HPI   +YTP N SF S+L   ++N RF+   T KPL IV A H SH+Q
Sbjct  35    LQCLPKQFHSGHPIFEAVYTPQNTSFQSILMARLKNRRFSSPTTPKPLAIVAAKHESHVQ  94

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A+I+CAK+HGLQ++ RSGGHDYEG+SYVS VPF +LDMF+ +SVNVS++DE+AWVE+GAT
Sbjct  95    ATIVCAKQHGLQIRIRSGGHDYEGLSYVSHVPFVVLDMFHLQSVNVSVKDESAWVESGAT  154

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LG++Y+ IA KS VHGFPAGV PTVG GGHF G GYGN+MRKYGL++DNI+DAKL+D NG
Sbjct  155   LGKIYHKIAQKSKVHGFPAGVGPTVGAGGHFSGGGYGNLMRKYGLSIDNIVDAKLVDANG  214

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
             R+LDRKSMGE++FWAI GGG +SF V+LS+++ LVRVP KVT+F+V RT +Q  T+++Y 
Sbjct  215   RILDRKSMGEDIFWAINGGGGASFGVILSWKLKLVRVPEKVTVFNVTRTLEQGVTDVLYK  274

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q ++  L  +LF+R   ++ N T   G+K    +F   FLG ++ LL  M+ESFPEL L
Sbjct  275   WQFVAPVLPKDLFLRARPEIENNTE--GKKIAEVSFIGQFLGQTRELLPLMNESFPELRL  332

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
              + DC E+ W ESV+F+   P GTP    L+   + +   K KSDY++ P+P+  IE++F
Sbjct  333   RREDCHEVSWFESVVFWAELPLGTPRSIYLNLKNKPIPFFKAKSDYVKKPIPKKVIEYMF  392

Query  1225  KKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNW-DEHGYEAAQHYLE  1401
             K M+E+    + +NP+GGRM+EI ++A P PHR+GN+  IQY T+W  + G EA   Y+ 
Sbjct  393   KAMLEIGNIWMEWNPHGGRMSEISASATPSPHRAGNLYSIQYYTSWFQDEGIEATNRYIH  452

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGIN-HNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             +TR+L+E MTPFVS+NPREAF NYRDLD+G N +N+    +    + YG KYFK N+ RL
Sbjct  453   LTRKLHEKMTPFVSRNPREAFQNYRDLDIGANVYNQS---NLLTARVYGSKYFKGNFERL  509

Query  1579  VKIKTKVDPDNFFRDEQSIP  1638
             V++KT VDP NFF+ EQSIP
Sbjct  510   VRVKTMVDPHNFFKHEQSIP  529



>gb|KHN25855.1| Reticuline oxidase-like protein [Glycine soja]
Length=541

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/508 (54%), Positives = 372/508 (73%), Gaps = 4/508 (1%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T+ LECL + +     +S +++   N SFSSVLQ YIRN RFN + T KPL +VT +   
Sbjct  36    TSFLECLTNYTKAQDQVSNIVFAQTNASFSSVLQAYIRNARFNTTSTPKPLLVVTPSEDP  95

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+Q +++CAK  G+Q+K RSGGHDYEG+SYVSD PF ILDMF+FR++ V++E+E A V+A
Sbjct  96    HVQGAVICAKSIGIQLKIRSGGHDYEGISYVSDQPFIILDMFHFRNITVAVENEVAVVQA  155

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGEVYY I  KS VHGFPAGVCPTVGVGGH  G GYGNM+RK+GL+VD+++DAK++D
Sbjct  156   GATLGEVYYRIWEKSKVHGFPAGVCPTVGVGGHLSGGGYGNMLRKHGLSVDHVVDAKIVD  215

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQN--AT  849
             V GR+LD++SMGE+LFWAI GGG +SF V+LSY + L+ VP  VT+F + ++ DQN  AT
Sbjct  216   VKGRILDKESMGEDLFWAIRGGGGASFGVILSYTVKLIPVPEVVTVFRIAKSLDQNESAT  275

Query  850   NIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
              +V  +Q+++   D  LF+RL +  V+     G++TIRAT  ALFLG +  +++ M + F
Sbjct  276   ELVLQWQQVAPHTDHRLFMRLLLQPVSSKVVKGQRTIRATVMALFLGGADEVVTLMGKEF  335

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNG  1209
             P LGL++ +C E+ WI+SVL++++F + T  + LL R       LKRKSDY+Q P+ + G
Sbjct  336   PALGLSKENCTELSWIDSVLWWSNFDNTTKPDALLDRDLNSASFLKRKSDYVQNPISKKG  395

Query  1210  IEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQ  1389
             +E I++KM+EL      FNPYGG+M+E+ S A PFPHR+GN+  IQY+ NWD+ G E  +
Sbjct  396   LEGIWEKMIELGKTGFVFNPYGGKMSEVSSDATPFPHRAGNLFKIQYSVNWDDPGVELEK  455

Query  1390  HYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENY  1569
             ++    + LY YMTPFVS +PR AFLNYRDLD+G N     + SY EG  YG+KYF +N+
Sbjct  456   NFTSQAKMLYSYMTPFVSSDPRSAFLNYRDLDIGTNSFG--KNSYEEGAVYGVKYFNDNF  513

Query  1570  NRLVKIKTKVDPDNFFRDEQSIPTFPGR  1653
              RLVKIKT+VDP+NFFR+EQSIP  PG+
Sbjct  514   KRLVKIKTEVDPENFFRNEQSIPIHPGQ  541



>ref|XP_007023044.1| FAD-binding and BBE domain-containing protein [Theobroma cacao]
 gb|EOY25666.1| FAD-binding and BBE domain-containing protein [Theobroma cacao]
Length=537

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/509 (54%), Positives = 366/509 (72%), Gaps = 10/509 (2%)
 Frame = +1

Query  145   LECLNDR-SNPSHPISPVIYTPNNGSFSSVLQEYIRNLRF--NESYTKKPLFIVTATHLS  315
             L+CL +  SNPS PI+  IYTP N SF SV + +  NLR     + T KP+ I+ A H S
Sbjct  32    LQCLPEHYSNPSKPIADAIYTPTNPSFQSVYELHAYNLRVLTQANATLKPMAIIAALHES  91

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H QA+I CAK  GLQ++ RSGGHDYEG+S+ S VPF ILD+ N RS+ + +  ETAW++A
Sbjct  92    HAQATIFCAKHFGLQIRLRSGGHDYEGLSFASSVPFVILDLSNLRSIKIDMASETAWIQA  151

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GAT GE+YY IA KSNVH FPAGVC T+GVGGHF G GYG M+RK+GL++DN+IDA+LID
Sbjct  152   GATTGELYYRIAEKSNVHAFPAGVCTTLGVGGHFTGGGYGPMIRKFGLSIDNVIDAQLID  211

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNGR+LDRKSMGE++FWAI GGG +SF V+LS++I LVRVP KVT+F V++T +Q AT++
Sbjct  212   VNGRILDRKSMGEDVFWAIRGGGGTSFGVILSWKIKLVRVPAKVTVFEVKKTLEQGATDL  271

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTH-PGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             VY + ++++KLD +LFIR+T   V IT +  G KT++ +F   FLG ++TLL  +   FP
Sbjct  272   VYKWLQVAYKLDEDLFIRIT--PVAITGNGKGNKTVQVSFIGHFLGQTETLLQLVQARFP  329

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGL  +DC EM WIES L++  FP+GT ++ LL+RVPQ  V  K KSDY++  +P+ G+
Sbjct  330   ELGLQPNDCIEMSWIESTLYWAGFPNGTSIDILLNRVPQSKVFFKTKSDYVKNVIPKAGL  389

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             + ++K M+ +++  +  NPYGGRMAEIP +   F HR GN+  +QY  +W E   EA + 
Sbjct  390   KTLWKMMMRIESIWIQMNPYGGRMAEIPESETAFAHRGGNLYKVQYTVHWSEESSEATKK  449

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFE-GKTYGLKYFKENY  1569
             Y+   R+LY  M P+VS  PREAFLNYRDLD+G N   G   S F   K YG KYFK N+
Sbjct  450   YVGWIRKLYTAMAPYVSSRPREAFLNYRDLDIGSN---GSNSSDFAVAKVYGAKYFKTNF  506

Query  1570  NRLVKIKTKVDPDNFFRDEQSIPTFPGRK  1656
              RL ++K KVDP+NFF++EQSIP FP  K
Sbjct  507   LRLARVKAKVDPENFFKNEQSIPPFPSSK  535



>ref|XP_009353860.1| PREDICTED: reticuline oxidase-like protein isoform X1 [Pyrus 
x bretschneideri]
Length=562

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/505 (54%), Positives = 366/505 (72%), Gaps = 4/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSH--PISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             + L+CL+ ++N S+   +S ++Y  NN S++ +LQ YIRN RFN + T KPL +VT    
Sbjct  29    SFLQCLDTKTNSSNTTQLSSIVYAQNNPSYTPILQAYIRNSRFNRTSTPKPLLVVTPLTE  88

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVE  492
             SH+QAS+LCAK  G+Q+K RSGGHDYEG+SY S   F +LDMFN RS+ V+IED + W +
Sbjct  89    SHVQASVLCAKLAGVQLKIRSGGHDYEGISYWSSQTFIVLDMFNLRSITVNIEDNSVWAQ  148

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
              GATLGE+YY I  KS VH FPAG+C  VGVGGH  G GYGN++RKYGL VDN++DA+++
Sbjct  149   TGATLGELYYRIWEKSKVHAFPAGICQLVGVGGHISGGGYGNLLRKYGLAVDNVLDAQIV  208

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             + NG LLDRKSMGE+LFWAI GGG  SF V++SY++ LV VP  VTIF V +T +++AT 
Sbjct  209   NANGELLDRKSMGEDLFWAIKGGGGGSFGVIISYKLKLVSVPEVVTIFRVEKTLEEDATA  268

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             +V  +Q ++   D  LF+RL +  V+     GEKT+RAT  A FLG+   L++ + + FP
Sbjct  269   LVLRWQEVAPTTDDGLFLRLLLQPVSSKVKKGEKTVRATVLAEFLGNGDQLVTLLGKEFP  328

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGLT+ +C E  WIESVL++ +F  GT  E LL R+P     LKRKSDY+QTP+ ++G+
Sbjct  329   ELGLTKENCTETSWIESVLWWANFDIGTSPEALLDRMPNDANFLKRKSDYVQTPISKDGL  388

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E+++KKM+EL    L FNPYGG M+ I  +  PFPHR+GN+  IQY+ NW++ G +  ++
Sbjct  389   EWLWKKMIELGKTGLVFNPYGGEMSRIAPSETPFPHRAGNLFKIQYSVNWEDAGEDLEKN  448

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             Y   +++L+ YMTPFVSKNPR AFLNYRDLD+G + N     +Y EGK YG+KYF +N++
Sbjct  449   YTTESKRLFSYMTPFVSKNPRSAFLNYRDLDIGASSNGA--PTYEEGKVYGVKYFNDNFD  506

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLVK+KT VDP+NFF +EQSIP  P
Sbjct  507   RLVKVKTAVDPENFFYNEQSIPILP  531



>ref|XP_009115055.1| PREDICTED: reticuline oxidase-like protein [Brassica rapa]
Length=531

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/496 (55%), Positives = 362/496 (73%), Gaps = 16/496 (3%)
 Frame = +1

Query  166   SNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQASILCAK  345
             SNP  PI    YTP N  F  +L  Y+RNLR+  + T+KP+ IV A  ++HIQA+I CAK
Sbjct  42    SNPCSPIQNFTYTPQNPKFLIILNNYVRNLRYFNNTTRKPIAIVAAADVTHIQATITCAK  101

Query  346   EHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATLGEVYYG  525
             +  LQ++ RSGGHDY+G+SY+S V F +LDMFN RS+    + +TAWV++GATLGE+YYG
Sbjct  102   KLSLQLRIRSGGHDYDGLSYLSTVDFVVLDMFNLRSIEFGRKLDTAWVQSGATLGEIYYG  161

Query  526   IANKSN-VHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGRLLDRK  702
             +ANKSN + GFPAG+CP +G GGHF G GYGNMMR+YGL++DNIIDAK++D  GR+LDR 
Sbjct  162   VANKSNDLRGFPAGICPGLGAGGHFSGGGYGNMMRRYGLSIDNIIDAKIVDAKGRVLDRT  221

Query  703   SMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN---IVYCYQR  873
             SMGE+LFWA+ GGGA+SF VVL+++I LV VP KVT+F+V     +   N   +V  +Q 
Sbjct  222   SMGEDLFWALRGGGAASFCVVLAWKIKLVPVPEKVTVFNVEAVGKRGGVNTKELVVKWQE  281

Query  874   MSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGLTQS  1053
             ++ K+D +LFIRLT+   N       KT++A+F  +FLGDS  LL  M + FPELGL ++
Sbjct  282   IADKIDNSLFIRLTLSTSN-------KTVKASFMGMFLGDSSRLLEIMTKEFPELGLNKT  334

Query  1054  DCREMRWIESVLFYTSFPSGT-PVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFKK  1230
             +C EM+WIESVLF+ S P GT P   +L+R+PQ  ++LKRKSDY+Q P+ R G++ IFK 
Sbjct  335   ECIEMKWIESVLFWLSIPPGTAPTSVMLNRIPQKQIYLKRKSDYVQKPISRTGLDAIFKV  394

Query  1231  MVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLEITR  1410
             ++E +   + +NPYGGRM+EIPS    FPHR+GN   IQYA NW   G E A+  +  T 
Sbjct  395   LLENENVTMAWNPYGGRMSEIPSTETAFPHRAGNKFKIQYAANWFVPGEEVAKECMSQTE  454

Query  1411  QLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLVKIK  1590
             +++E MTP+VSKNPREAFLNYRD+D+G + N     +Y EGK YG+KYFK N+ RLV +K
Sbjct  455   RVFEAMTPYVSKNPREAFLNYRDVDIGTSLN----STYEEGKVYGVKYFKNNFERLVSVK  510

Query  1591  TKVDPDNFFRDEQSIP  1638
             ++VDPDNFFR EQSIP
Sbjct  511   SRVDPDNFFRYEQSIP  526



>emb|CAN63059.1| hypothetical protein VITISV_004192 [Vitis vinifera]
Length=536

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/500 (56%), Positives = 369/500 (74%), Gaps = 6/500 (1%)
 Frame = +1

Query  145   LECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQ  324
             L+CL   SN S PI+ V+YTP+N S+ +VL   I+NLRF  S T +P  IVT   +SHIQ
Sbjct  34    LQCLTLNSNSSTPITKVVYTPHNSSYETVLDFSIQNLRFTSSCTPRPQVIVTPLLVSHIQ  93

Query  325   ASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGAT  504
             A++ C+K +GLQ++ARSGGHDYEG+SYVS+VPF I+D+   RS+NV +ED +AWVEAGAT
Sbjct  94    AAVXCSKXYGLQIRARSGGHDYEGLSYVSEVPFIIVDLLELRSINVDVEDGSAWVEAGAT  153

Query  505   LGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNG  684
             LGEVYY IANK+  HGFPAG+CPTVGVGGH  G GYG ++RKYGL  DNIIDA ++D NG
Sbjct  154   LGEVYYSIANKTATHGFPAGICPTVGVGGHLSGGGYGTLLRKYGLAADNIIDAYIVDSNG  213

Query  685   RLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYC  864
              LL+R+SMGE+LFWAI GGG +SF +++S++I LV VP  VT+F+V RT +Q+A  I+  
Sbjct  214   TLLNRESMGEDLFWAIRGGGGASFGIIVSWKIKLVPVPSTVTVFTVTRTLEQDAEKILLK  273

Query  865   YQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGL  1044
             +Q+++ KL  +LFIR+ V  VN  +  GE+TI +T+ +LFLG++  LLS M+ESFPELGL
Sbjct  274   WQQVADKLHEDLFIRVYVQAVN-GSQEGERTISSTYESLFLGNTSGLLSLMNESFPELGL  332

Query  1045  TQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIF  1224
                DC E  WIESVL++  F SG P++ LL+R      + K KSD+L+ P+P  G+  I+
Sbjct  333   AADDCNETSWIESVLYFAGF-SGQPLDVLLNRSQTSKNYFKNKSDFLKEPIPETGLHGIW  391

Query  1225  KKMVELQ--TPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYL  1398
             K   EL+  T M+  +PYGGRM EIP    PFPHR G++  IQY  NW E G E ++ ++
Sbjct  392   KLFYELKNATGMIIISPYGGRMNEIPETETPFPHRKGSLYSIQYVVNWLEEGEEVSKRHI  451

Query  1399  EITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRL  1578
             + TR+LY+YM P+VSK+PR A+LNYRDLDLG   NK    SY +   +GLKY+K N+NRL
Sbjct  452   DWTRKLYKYMAPYVSKSPRAAYLNYRDLDLG--RNKNGNTSYAQASIWGLKYYKINFNRL  509

Query  1579  VKIKTKVDPDNFFRDEQSIP  1638
             V++KTKVDP NFFR+EQSIP
Sbjct  510   VQVKTKVDPSNFFRNEQSIP  529



>ref|XP_007212705.1| hypothetical protein PRUPE_ppa018650mg, partial [Prunus persica]
 gb|EMJ13904.1| hypothetical protein PRUPE_ppa018650mg, partial [Prunus persica]
Length=513

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/511 (53%), Positives = 358/511 (70%), Gaps = 6/511 (1%)
 Frame = +1

Query  109   AWAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             +WA         L+CL   S  S+PI   IYT  N SF  VL  YI+N R++     KP+
Sbjct  6     SWATAYADLNDFLQCLPKFSESSYPIIETIYTQKNTSFQYVLNAYIQNRRYSTPTIPKPM  65

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
              I+ A H SH+QA+++CAKEH L ++ RSGGHDYEG+SYVS VPF ILDMFN RS+ +++
Sbjct  66    AIIAAMHESHVQATVVCAKEHALHIRIRSGGHDYEGLSYVSSVPFIILDMFNLRSIEINV  125

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
              DE+AWV+AGAT GE+YY IA KS VHGFPAGVCPTV  GG   G GYG  MRK+GL+ D
Sbjct  126   TDESAWVQAGATAGELYYKIAEKSKVHGFPAGVCPTVATGGLISGGGYGPTMRKFGLSAD  185

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             NI DA L++VNG +LD+ SMGE+LFWAI GGG +SF V+LS++I LVRVP KVT+F+V R
Sbjct  186   NIEDATLVNVNGTILDKNSMGEDLFWAIRGGGGASFGVILSWKIKLVRVPAKVTVFNVTR  245

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             + +Q A +++Y +Q ++ KL  N +IR T  V N      +K +  +F+  FLG    LL
Sbjct  246   SIEQGALDVLYRWQYVAPKLPKNTYIRATSQVSN--GEGKKKAVEVSFSGHFLGQIDELL  303

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQ  1188
               ++ESFPELGL + DC EM W+ES +F+  +P GTP+  LL+R        K KSDY++
Sbjct  304   RLINESFPELGLQRKDCFEMSWVESTVFWAGYPIGTPINVLLNRTNIPTFFFKSKSDYVK  363

Query  1189  TPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDE  1368
              P+P+ GIE I++ + +++   + +NPYGGRM EI ++A PFPHR+GN+  IQY  +W E
Sbjct  364   EPIPKEGIESIWQMVQKIEKVYVQWNPYGGRMDEIAASATPFPHRAGNLFKIQYYMSWTE  423

Query  1369  HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGIN-HNKGRRKSYFEGKTYG  1545
              G E   +YL  +R+LYE MTPFVSKNPREAFLNYRD+D+G N HN+     +   + YG
Sbjct  424   EGIETTNNYLSFSRKLYEEMTPFVSKNPREAFLNYRDIDIGANLHNQ---TEFGIARVYG  480

Query  1546  LKYFKENYNRLVKIKTKVDPDNFFRDEQSIP  1638
              K+FK+N++RLV++KT VDP NFFR+EQSIP
Sbjct  481   SKFFKDNFDRLVRVKTVVDPQNFFRNEQSIP  511



>ref|XP_009353861.1| PREDICTED: reticuline oxidase-like protein isoform X2 [Pyrus 
x bretschneideri]
Length=562

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/505 (54%), Positives = 366/505 (72%), Gaps = 4/505 (1%)
 Frame = +1

Query  139   TVLECLNDRSNPSH--PISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHL  312
             + L+CL+ ++N S+   +S ++Y  NN S++ +LQ YIRN RFN + T KPL +VT    
Sbjct  29    SFLQCLDTKTNSSNTTQLSSIVYAQNNPSYTPILQAYIRNSRFNRTSTPKPLLVVTPLTE  88

Query  313   SHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVE  492
             SH+QAS+LCAK  G+Q+K RSGGHDYEG+SY S   F +LDMFN RS+ V+IED + W +
Sbjct  89    SHVQASVLCAKLAGVQLKIRSGGHDYEGISYWSSQTFIVLDMFNLRSITVNIEDNSVWAQ  148

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
              GATLGE+YY I  KS VH FPAG+C  VGVGGH  G GYGN++RKYGL VDN++DA+++
Sbjct  149   TGATLGELYYRIWEKSKVHAFPAGICQLVGVGGHISGGGYGNLLRKYGLAVDNVLDAQIV  208

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             + NG LLDRKSMGE+LFWAI GGG  SF V++SY++ LV VP  VTIF V +T +++AT 
Sbjct  209   NANGELLDRKSMGEDLFWAIKGGGGGSFGVIISYKLKLVSVPEVVTIFRVEKTLEEDATA  268

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             +V  +Q ++   D  LF+RL +  V+     GEKT+RAT  A FLG+   L++ + + FP
Sbjct  269   LVLRWQEVAPTTDDGLFLRLLLQPVSSKVKKGEKTVRATVLAEFLGNGDQLVTLLGKEFP  328

Query  1033  ELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGI  1212
             ELGLT+ +C E  WIESVL++ +F  GT  E LL R+P     LKRKSDY+QTP+ ++G+
Sbjct  329   ELGLTKENCTETSWIESVLWWANFDIGTSPEALLDRMPNDANFLKRKSDYVQTPISKDGL  388

Query  1213  EFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQH  1392
             E+++KKM+EL    L FNPYGG M+ I  +  PFPHR+GN+  IQY+ NW++ G +  ++
Sbjct  389   EWLWKKMIELGKTGLVFNPYGGEMSRIAPSETPFPHRAGNLFKIQYSVNWEDAGEDLEKN  448

Query  1393  YLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYN  1572
             Y   +++L+ YMTPFVSKNPR AFLNYRDLD+G + N     +Y EGK YG+KYF +N++
Sbjct  449   YTTESKRLFSYMTPFVSKNPRSAFLNYRDLDIGASSNGA--PTYEEGKVYGVKYFNDNFD  506

Query  1573  RLVKIKTKVDPDNFFRDEQSIPTFP  1647
             RLVK+KT VDP+NFF +EQSIP  P
Sbjct  507   RLVKVKTAVDPENFFYNEQSIPILP  531



>gb|KDP36344.1| hypothetical protein JCGZ_09764 [Jatropha curcas]
Length=540

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/505 (54%), Positives = 363/505 (72%), Gaps = 5/505 (1%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
              + L+CL + +NP+  I+ ++YT +N  ++SVL+ YIRN R N+S T KP  I+T   +S
Sbjct  35    ASFLQCLKNNTNPNDQIANLVYTKSNKGYTSVLRSYIRNARLNKSTTPKPSIILTPKQVS  94

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+Q+ ++C K+ G Q+K RSGGHDYEG+SY SD PFFILDMFN RS+NV + + +AWVE+
Sbjct  95    HVQSFVICTKKVGYQLKIRSGGHDYEGISYYSDEPFFILDMFNLRSINVDVTNNSAWVES  154

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GATLGE+YY I  KS VHGFPAGVCPTVGVGGH  G GYGNM+RKYGL VDN+IDA ++D
Sbjct  155   GATLGELYYSIWEKSKVHGFPAGVCPTVGVGGHISGGGYGNMLRKYGLAVDNVIDAVIVD  214

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNG++LDRK MGE+LFWAI GGG  SF V++SY+I LV VP  VT+F V +  D++ + I
Sbjct  215   VNGKVLDRKQMGEDLFWAIRGGGGGSFGVIVSYKIQLVSVPETVTVFRVEKYIDEDNSTI  274

Query  856   --VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESF  1029
               VY YQ ++  +D  LF+R+ V  V+   + G+KTIR T  AL+LG++ +++S++ +  
Sbjct  275   DLVYKYQSVAPTIDNGLFMRMLVQPVSSKINKGQKTIRITIVALYLGNADSVVSSLSKEL  334

Query  1030  PELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNG  1209
             PELGL +  C EM WI+SV+++ +  + T    LL R       LKRKSDY+Q P+ + G
Sbjct  335   PELGLKKEKCSEMSWIDSVVWW-AIDNATSPNALLDRDLNSAEFLKRKSDYVQNPISKTG  393

Query  1210  IEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQ  1389
             +  IF KM+EL    L FNPYGG+MAEIP++  PFPHR+GN+  IQY+ +W + G  A  
Sbjct  394   LSSIFTKMIELGKTGLVFNPYGGKMAEIPASDAPFPHRAGNLYKIQYSMSWQDEGNAAES  453

Query  1390  HYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENY  1569
              YL   R+LY + TPFVSKNPR AFLNYRDLD+GI   +  + SY  G  YG KYF  NY
Sbjct  454   EYLGQIRELYNFTTPFVSKNPRSAFLNYRDLDIGI--MEPGKNSYQAGSVYGFKYFNGNY  511

Query  1570  NRLVKIKTKVDPDNFFRDEQSIPTF  1644
             +RLVK+KT VDP+NFFR+EQSIPT 
Sbjct  512   DRLVKVKTAVDPENFFRNEQSIPTL  536



>ref|XP_007212922.1| hypothetical protein PRUPE_ppa022296mg [Prunus persica]
 gb|EMJ14121.1| hypothetical protein PRUPE_ppa022296mg [Prunus persica]
Length=524

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/502 (55%), Positives = 361/502 (72%), Gaps = 6/502 (1%)
 Frame = +1

Query  136   TTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T  L+CL  +   ++PI   IYT  N SF SVL  YIRN R++   T KPL IVTA H S
Sbjct  26    TGFLQCLPKQPQSAYPIFEAIYTHENTSFQSVLLGYIRNSRYSTLATPKPLAIVTALHES  85

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEA  495
             H+QA+++CAK+HGLQ++ RSGGHDYEG+SYVS VPF ILDMFN RS+++ + +E+AWV+A
Sbjct  86    HVQATVICAKQHGLQIRTRSGGHDYEGLSYVSGVPFIILDMFNLRSIDIDVTNESAWVQA  145

Query  496   GATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLID  675
             GAT+GE+YY IANKS VHGFPAG CPTVG+GGHF G GYG MMRKYGLTVDNI DAKL++
Sbjct  146   GATIGELYYEIANKSKVHGFPAGACPTVGIGGHFSGGGYGPMMRKYGLTVDNIEDAKLVN  205

Query  676   VNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNI  855
             VNG +LDR SMGE+LFWAI GGG +SF V+LS++I L+ VP  VT+F+V+RT +Q A N+
Sbjct  206   VNGTILDRNSMGEDLFWAIRGGGGASFGVILSWKIRLLPVPANVTVFNVKRTLEQGALNV  265

Query  856   VYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPE  1035
             +Y +Q ++ KL   +FIR    + N T   G+KT+  +F  LFLG    L+  M+ESFPE
Sbjct  266   IYKWQYVAPKLLDEIFIRAITRLKNSTE--GKKTVEVSFVGLFLGQRDKLVPLMNESFPE  323

Query  1036  LGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIE  1215
             L L   DC EM W+ES LF+   P GTPV  LL+R        K KSDY++ P+P+ GIE
Sbjct  324   LDLQLKDCFEMSWVESTLFWADQPIGTPVNFLLNRPQGPPNFFKSKSDYVKEPIPKQGIE  383

Query  1216  FIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHY  1395
              I++ M+++   ++ ++PYGGRM+ IP    PFPHR GN+ +IQY T W E G E  + +
Sbjct  384   SIWQMMLKMDKVLMQWSPYGGRMSMIPEWETPFPHRDGNLFLIQYVTYWVEEGTETLKQH  443

Query  1396  LEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFE-GKTYGLKYFKENYN  1572
             L   R+LYE MT +VSK+PREAF NYRDLD+G N    +  + FE  K YG KYFK N++
Sbjct  444   LGFVRKLYEGMTLYVSKSPREAFQNYRDLDIGANR---QNHTEFETAKVYGSKYFKGNFD  500

Query  1573  RLVKIKTKVDPDNFFRDEQSIP  1638
             RL+++K  VDP NFF++EQSIP
Sbjct  501   RLIRVKVMVDPYNFFKNEQSIP  522



>ref|XP_003534766.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=533

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/510 (55%), Positives = 361/510 (71%), Gaps = 14/510 (3%)
 Frame = +1

Query  139   TVLECLNDRS-NPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLS  315
             T L+CL   + N S  +S +++   N  F +VLQ YIRN RFN S T KPL IVT    S
Sbjct  32    TFLQCLTHHTKNCSTQLSDIVFANTNPKFPTVLQNYIRNARFNTSSTPKPLLIVTPLTES  91

Query  316   HIQASILCAKEHGLQMKARSGGHDYEGVSYVSDV-PFFILDMFNFRSVNVSIEDETAWVE  492
             H+QA+++CAK   +Q+K RSGGHDYEG+SY+S   PF +LDMFN R + V I++E A V+
Sbjct  92    HVQAAVICAKTVNVQLKIRSGGHDYEGISYISKKHPFIVLDMFNLRKIKVDIKNEVAVVQ  151

Query  493   AGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLI  672
             AGA +GEVYY I  KS VHGF A VCPTVGVGGH  G GYGNM+RKYGL+VDN+IDA+++
Sbjct  152   AGAVMGEVYYRIWKKSKVHGFSAAVCPTVGVGGHISGGGYGNMLRKYGLSVDNVIDAQIV  211

Query  673   DVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATN  852
             DV G LL+RK+MGE+LFWAI GGG +SF V++S+ I L+ VP  VT+F V RT +QNAT+
Sbjct  212   DVKGNLLNRKTMGEDLFWAIRGGGGASFGVIVSFTIKLLPVPKTVTVFRVERTLEQNATD  271

Query  853   IVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFP  1032
             +V  +Q+++   DP LF+RL +        P  KT+ A+  ALFLG +K L+S +++ FP
Sbjct  272   LVLQWQQVAPTTDPGLFLRLLL-------QPEGKTVTASVVALFLGGAKELVSILEKEFP  324

Query  1033  ELGLTQSDCREMRWIESVLFY---TSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPR  1203
              LGL +  C EMRWI+SVL++    S  +G   E LL R       LKRKSDY+Q  +PR
Sbjct  325   LLGLKKESCTEMRWIDSVLWFYDDKSLKNGAKPETLLDRHVNTAFFLKRKSDYVQKAIPR  384

Query  1204  NGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEA  1383
              G+E IFK+M++L    L FNPYGGRMAEIPS A PFPHR GN+  IQY+ NW +    A
Sbjct  385   EGLECIFKRMIKLGKIGLVFNPYGGRMAEIPSDATPFPHRKGNLFKIQYSVNWFDPSVGA  444

Query  1384  AQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKE  1563
             A+++    ++LY YMTPFVSKNPR AFLNYRDLD+G+  N+  + S+ EG+ YG KYF  
Sbjct  445   AKNFTNQAKKLYNYMTPFVSKNPRSAFLNYRDLDIGV--NRFGKNSFQEGEVYGAKYFNN  502

Query  1564  NYNRLVKIKTKVDPDNFFRDEQSIPTFPGR  1653
             N+ RLVK+KTKVDPDNFFR+EQSIP  P +
Sbjct  503   NFQRLVKVKTKVDPDNFFRNEQSIPVCPSK  532



>emb|CAN63058.1| hypothetical protein VITISV_004191 [Vitis vinifera]
Length=545

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/512 (53%), Positives = 362/512 (71%), Gaps = 3/512 (1%)
 Frame = +1

Query  109   AWAPLCYCATTVLECLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPL  288
             +WA         L+CL+  SN + PIS V+YTP N S+S++L+  I NLRF+ S T KPL
Sbjct  31    SWATSSSIHENFLQCLSLNSNHTTPISNVLYTPKNLSYSAILESTIENLRFSSSATPKPL  90

Query  289   FIVTATHLSHIQASILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSI  468
              I+T  H+SHIQA+++C+K+ G+ ++ RSGGHDYEG+SYVS++PF I+D+   RS+N+SI
Sbjct  91    LILTPLHVSHIQAAVICSKKFGMNIRVRSGGHDYEGLSYVSEIPFIIIDLVELRSINISI  150

Query  469   EDETAWVEAGATLGEVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVD  648
             ED TAWVEAGAT+GEVYY IA KS  +GFPAG CPTVGVGGHF G G G +MRKYGL+ D
Sbjct  151   EDGTAWVEAGATVGEVYYRIAQKSRTYGFPAGSCPTVGVGGHFSGGGXGTLMRKYGLSAD  210

Query  649   NIIDAKLIDVNGRLLDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRR  828
             NIIDA ++  +GR+L+R+SMGE+LFWAI GGG +SF ++LS++I LV VPP VT+F+V R
Sbjct  211   NIIDAYIVVSDGRVLNRESMGEDLFWAIRGGGGASFGIILSWKIILVPVPPIVTVFTVGR  270

Query  829   TYDQNATNIVYCYQRMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLL  1008
             T +Q A  +   +Q++  +L  ++FI      V+  +  GE+TI  +F +LFLG++  LL
Sbjct  271   TLEQGALKVFLKWQQVGSRLQEDIFIGAXFGAVS-GSQEGERTIEVSFKSLFLGNTSQLL  329

Query  1009  STMDESFPELGLTQSDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQ  1188
             S M +SFPELGL   DC EM WIESVL+YT   SG PV  LL+R+PQ   + K KSDY+Q
Sbjct  330   SLMKKSFPELGLEAKDCLEMSWIESVLYYTDL-SGEPVNVLLNRIPQFKNYFKAKSDYVQ  388

Query  1189  TPMPRNGIEFIFKKMVELQTPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDE  1368
              P+   G++ ++K + + +  ++  +PYGGRM EI     PFP R GN+  IQY  +WDE
Sbjct  389   EPISETGLQGVWKMLYQEEAGIMILSPYGGRMNEISETEVPFPXRKGNLYKIQYLVSWDE  448

Query  1369  HGYEAAQHYLEITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGL  1548
              G   +   +   R+LY YM P+VSK PR A+LNYRDLDLG N  KG   SY +   +G+
Sbjct  449   EGDRVSXKRINWIRKLYAYMAPYVSKFPRAAYLNYRDLDLGXNKLKG-NTSYAQASIWGI  507

Query  1549  KYFKENYNRLVKIKTKVDPDNFFRDEQSIPTF  1644
             KYF  N+NRLV +KTKVDP NFFR+EQSIP+ 
Sbjct  508   KYFSCNFNRLVHVKTKVDPSNFFRNEQSIPSL  539



>emb|CDP12593.1| unnamed protein product [Coffea canephora]
Length=542

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/501 (56%), Positives = 363/501 (72%), Gaps = 6/501 (1%)
 Frame = +1

Query  151   CLNDRSNPSHPISPVIYTPNNGSFSSVLQEYIRNLRFNESYTKKPLFIVTATHLSHIQAS  330
             CL     PS+ IS ++Y+P+N SFSSVL  Y+RN R N   T+KP  IVT   + HIQA+
Sbjct  33    CLTRNGIPSNQISKILYSPSNSSFSSVLDAYVRNKRLNTPTTRKPSIIVTPLQVQHIQAA  92

Query  331   ILCAKEHGLQMKARSGGHDYEGVSYVSDVPFFILDMFNFRSVNVSIEDETAWVEAGATLG  510
             ILC K  GLQ+  RSGGHD+EG+SYVSDVPF ILD+FN RS++V    ETAWV+AGATLG
Sbjct  93    ILCTKGTGLQLNIRSGGHDFEGLSYVSDVPFIILDLFNLRSISVDTATETAWVQAGATLG  152

Query  511   EVYYGIANKSNVHGFPAGVCPTVgvgghfggagygNMMRKYGLTVDNIIDAKLIDVNGRL  690
             E+YY I  KS + GFPAGVCPTVGVGGH  G GYG+++R+YGLTVDN++DA++IDVNGR+
Sbjct  153   ELYYRIWEKSKILGFPAGVCPTVGVGGHISGGGYGSLLRRYGLTVDNVLDAQIIDVNGRV  212

Query  691   LDRKSMGEELFWAITGGGASSFAVVLSYRINLVRVPPKVTIFSVRRTYDQNATNIVYCYQ  870
             LDRK+MGE+LFWAI GGG +SF VVL+YRI LVRV    ++F+V++T  +NAT+++Y +Q
Sbjct  213   LDRKAMGEDLFWAIRGGGGASFGVVLAYRIRLVRVLEIHSVFTVQKTEAENATDVLYKWQ  272

Query  871   RMSHKLDPNLFIRLTVDVVNITTHPGEKTIRATFNALFLGDSKTLLSTMDESFPELGLTQ  1050
              ++ K+D +LFIR+ V  +      G+K IR TF   FLGD+  L+S M+  FPELGL +
Sbjct  273   NVADKIDNDLFIRVLVQPITGKVK-GQKIIRLTFMGHFLGDANRLISVMNTGFPELGLKR  331

Query  1051  SDCREMRWIESVLFYTSFPSGTPVEELLSRVPQVLVHLKRKSDYLQTPMPRNGIEFIFKK  1230
             SDC E  WI+++L++  +  GT  E LLSR    L+  KRKSDY+Q P+P++G+  +FKK
Sbjct  332   SDCLETSWIDTMLWWYKYKIGTAKEVLLSRAYDQLIFFKRKSDYVQNPIPKDGLVSLFKK  391

Query  1231  MVELQ---TPMLTFNPYGGRMAEIPSAAKPFPHRSGNIAMIQYATNWDEHGYEAAQHYLE  1401
             M E+       L FNPYGGRM EIP    PFPHR+G I  IQY+ NW++        Y+ 
Sbjct  392   MSEITYGGKIGLVFNPYGGRMREIPENETPFPHRAGIIFKIQYSVNWEDADPNLINEYVG  451

Query  1402  ITRQLYEYMTPFVSKNPREAFLNYRDLDLGINHNKGRRKSYFEGKTYGLKYFKENYNRLV  1581
               R LY +MTPFVSKNPR+AFLNYRDLD+G   N   R  Y EG+ YG+KYFK N++RLV
Sbjct  452   EARNLYSFMTPFVSKNPRQAFLNYRDLDIGTTDNGKNR--YNEGQVYGVKYFKNNFDRLV  509

Query  1582  KIKTKVDPDNFFRDEQSIPTF  1644
             K+KT VDP NFFR+EQSIPT 
Sbjct  510   KVKTMVDPQNFFRNEQSIPTL  530



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5333211914502