BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17626_g4_i1 len=883 path=[861:0-882]

Length=883
                                                                      Score     E

ref|XP_009591795.1|  PREDICTED: L-ascorbate oxidase homolog             417   2e-139   
ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog             414   2e-138   
gb|AAQ90182.1|  ntp101                                                  414   3e-138   Nicotiana tabacum [American tobacco]
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...    411   4e-137   Nicotiana tabacum [American tobacco]
dbj|BAO02510.1|  predicted pollen-specific protein ortholog             411   4e-137   
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog             411   8e-137   
ref|XP_006367595.1|  PREDICTED: L-ascorbate oxidase homolog             410   2e-136   
ref|XP_006341879.1|  PREDICTED: L-ascorbate oxidase homolog             409   2e-136   
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog             408   5e-136   
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog             403   5e-134   
emb|CDP18567.1|  unnamed protein product                                402   1e-133   
gb|EYU32815.1|  hypothetical protein MIMGU_mgv1a003910mg                399   2e-132   
ref|XP_009624631.1|  PREDICTED: L-ascorbate oxidase homolog             398   5e-132   
gb|AAQ90185.1|  ntp805                                                  397   1e-131   Nicotiana tabacum [American tobacco]
gb|EYU32814.1|  hypothetical protein MIMGU_mgv1a003925mg                396   3e-131   
gb|EYU39285.1|  hypothetical protein MIMGU_mgv1a026945mg                394   2e-130   
ref|XP_006354116.1|  PREDICTED: L-ascorbate oxidase homolog             392   8e-130   
ref|XP_011089764.1|  PREDICTED: L-ascorbate oxidase homolog             391   2e-129   
ref|XP_009785667.1|  PREDICTED: L-ascorbate oxidase homolog             390   7e-129   
ref|XP_004228635.1|  PREDICTED: L-ascorbate oxidase homolog             389   2e-128   
gb|ABI52585.1|  pollen-specific protein                                 388   7e-128   Camellia sinensis [black tea]
gb|AAL87103.1|AF479568_1  1-ascorbate oxidase                           387   7e-128   Petunia x hybrida [garden petunia]
ref|XP_011089765.1|  PREDICTED: L-ascorbate oxidase homolog             383   3e-126   
gb|EPS72881.1|  pollen-specific protein                                 384   3e-126   
ref|XP_011089763.1|  PREDICTED: L-ascorbate oxidase homolog             383   4e-126   
ref|XP_011089702.1|  PREDICTED: L-ascorbate oxidase homolog             381   2e-125   
ref|XP_011089767.1|  PREDICTED: L-ascorbate oxidase homolog             381   2e-125   
emb|CDP04133.1|  unnamed protein product                                381   3e-125   
ref|XP_009626538.1|  PREDICTED: L-ascorbate oxidase homolog             380   5e-125   
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             380   6e-125   
emb|CDX97352.1|  BnaA02g21430D                                          377   1e-124   
ref|XP_011089766.1|  PREDICTED: L-ascorbate oxidase homolog             378   3e-124   
ref|XP_006303856.1|  hypothetical protein CARUB_v10012595mg             378   3e-124   
ref|XP_009773307.1|  PREDICTED: L-ascorbate oxidase homolog             378   4e-124   
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             378   4e-124   
ref|XP_009803815.1|  PREDICTED: L-ascorbate oxidase homolog             377   5e-124   
emb|CDY10549.1|  BnaC03g70650D                                          377   5e-124   
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             377   6e-124   
gb|KFK35574.1|  hypothetical protein AALP_AA4G008500                    377   6e-124   
ref|XP_009611384.1|  PREDICTED: L-ascorbate oxidase homolog             377   8e-124   
ref|XP_009106861.1|  PREDICTED: L-ascorbate oxidase homolog             377   8e-124   
ref|XP_009600426.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    375   3e-123   
ref|XP_007157830.1|  hypothetical protein PHAVU_002G101700g             375   4e-123   
gb|KGN54012.1|  hypothetical protein Csa_4G267470                       373   4e-123   
emb|CDY56013.1|  BnaA08g29220D                                          375   5e-123   
ref|XP_004505353.1|  PREDICTED: L-ascorbate oxidase homolog             374   6e-123   
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             375   6e-123   
ref|XP_010034522.1|  PREDICTED: L-ascorbate oxidase homolog             375   6e-123   
ref|XP_010044910.1|  PREDICTED: L-ascorbate oxidase homolog             374   7e-123   
ref|XP_008449912.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    375   7e-123   
ref|XP_006392621.1|  hypothetical protein EUTSA_v10011364mg             374   7e-123   
gb|AFK33666.1|  unknown                                                 372   7e-123   
ref|XP_008449913.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    374   8e-123   
gb|KFK35575.1|  hypothetical protein AALP_AA4G008600                    374   1e-122   
ref|XP_002894511.1|  hypothetical protein ARALYDRAFT_474617             374   1e-122   
ref|XP_006392622.1|  hypothetical protein EUTSA_v10011369mg             373   2e-122   
ref|XP_004164924.1|  PREDICTED: L-ascorbate oxidase homolog             373   2e-122   
ref|XP_010462411.1|  PREDICTED: L-ascorbate oxidase homolog             373   3e-122   
emb|CDY23596.1|  BnaC05g39980D                                          373   3e-122   
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             373   3e-122   
ref|NP_175953.1|  protein SKU5 similar 12                               373   3e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502172.1|  PREDICTED: L-ascorbate oxidase homolog             372   3e-122   
gb|AAD10639.1|  putative pollen specific protein                        373   4e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006345828.1|  PREDICTED: L-ascorbate oxidase homolog             372   5e-122   
ref|XP_010501174.1|  PREDICTED: L-ascorbate oxidase homolog             372   8e-122   
ref|XP_006306349.1|  hypothetical protein CARUB_v10012235mg             372   8e-122   
ref|NP_564697.1|  SKU5 similar 14                                       371   1e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010480096.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    371   1e-121   
ref|XP_010462412.1|  PREDICTED: L-ascorbate oxidase homolog             371   2e-121   
ref|XP_010501175.1|  PREDICTED: L-ascorbate oxidase homolog             370   2e-121   
ref|XP_002303974.1|  multi-copper oxidase type 1 family protein         370   2e-121   Populus trichocarpa [western balsam poplar]
ref|XP_002523381.1|  multicopper oxidase, putative                      370   3e-121   Ricinus communis
emb|CAA47177.1|  Bplo                                                   370   3e-121   Brassica napus [oilseed rape]
ref|XP_002891844.1|  hypothetical protein ARALYDRAFT_892557             370   4e-121   
ref|XP_010480098.1|  PREDICTED: L-ascorbate oxidase homolog             370   4e-121   
ref|XP_006407227.1|  hypothetical protein EUTSA_v10020444mg             370   5e-121   
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         369   6e-121   Populus trichocarpa [western balsam poplar]
gb|AFC88081.1|  skewed-like protein                                     369   6e-121   
ref|XP_002297609.2|  multi-copper oxidase type 1 family protein         369   7e-121   Populus trichocarpa [western balsam poplar]
gb|KFK38673.1|  hypothetical protein AALP_AA3G145200                    369   7e-121   
ref|XP_011048127.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    369   9e-121   
ref|XP_011048126.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    369   1e-120   
gb|KGN54013.1|  hypothetical protein Csa_4G267480                       366   1e-120   
ref|XP_008219577.1|  PREDICTED: L-ascorbate oxidase homolog             369   1e-120   
emb|CDX82541.1|  BnaA03g32800D                                          369   2e-120   
ref|XP_009135302.1|  PREDICTED: L-ascorbate oxidase homolog             369   2e-120   
ref|XP_007014658.1|  SKU5 similar 13                                    368   2e-120   
sp|Q00624.1|ASOL_BRANA  RecName: Full=L-ascorbate oxidase homolog...    368   2e-120   Brassica napus [oilseed rape]
ref|XP_010465172.1|  PREDICTED: L-ascorbate oxidase homolog             368   3e-120   
ref|XP_009147500.1|  PREDICTED: L-ascorbate oxidase homolog             368   3e-120   
ref|XP_002523382.1|  multicopper oxidase, putative                      367   3e-120   Ricinus communis
ref|XP_008219320.1|  PREDICTED: L-ascorbate oxidase homolog             367   4e-120   
ref|XP_010487093.1|  PREDICTED: L-ascorbate oxidase homolog             367   4e-120   
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             367   5e-120   
ref|XP_010500423.1|  PREDICTED: L-ascorbate oxidase homolog             367   6e-120   
dbj|BAL41449.1|  SKU5 similar 1                                         367   6e-120   
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             367   7e-120   
ref|XP_010500435.1|  PREDICTED: L-ascorbate oxidase homolog             367   7e-120   
gb|KHN44494.1|  L-ascorbate oxidase like                                367   7e-120   
ref|XP_009146525.1|  PREDICTED: L-ascorbate oxidase homolog             367   7e-120   
emb|CDY43994.1|  BnaA05g25890D                                          367   8e-120   
ref|NP_187947.1|  protein SKU5-like 11                                  367   8e-120   Arabidopsis thaliana [mouse-ear cress]
emb|CDY23597.1|  BnaC05g39970D                                          367   9e-120   
ref|XP_010465173.1|  PREDICTED: L-ascorbate oxidase homolog             366   9e-120   
emb|CDX75707.1|  BnaC03g37900D                                          367   9e-120   
ref|XP_009135303.1|  PREDICTED: L-ascorbate oxidase homolog             366   1e-119   
emb|CAA47178.1|  Bplo                                                   366   1e-119   Brassica napus [oilseed rape]
ref|XP_010534841.1|  PREDICTED: L-ascorbate oxidase homolog             366   1e-119   
emb|CDY24188.1|  BnaC01g37680D                                          366   2e-119   
emb|CDX82540.1|  BnaA03g32810D                                          365   2e-119   
ref|XP_008219429.1|  PREDICTED: L-ascorbate oxidase homolog             365   2e-119   
ref|XP_006299300.1|  hypothetical protein CARUB_v10015454mg             365   3e-119   
ref|XP_006407228.1|  hypothetical protein EUTSA_v10020433mg             365   3e-119   
ref|XP_010673839.1|  PREDICTED: L-ascorbate oxidase homolog             365   3e-119   
ref|XP_002884964.1|  hypothetical protein ARALYDRAFT_478720             365   3e-119   
emb|CDX75708.1|  BnaC03g37910D                                          365   4e-119   
ref|XP_010673838.1|  PREDICTED: L-ascorbate oxidase homolog             365   5e-119   
ref|XP_003601600.1|  L-ascorbate oxidase-like protein                   364   7e-119   
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             364   7e-119   
ref|XP_003601595.1|  L-ascorbate oxidase-like protein                   364   7e-119   
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             363   1e-118   
ref|XP_004305574.1|  PREDICTED: L-ascorbate oxidase homolog             363   2e-118   
gb|KFK38671.1|  hypothetical protein AALP_AA3G145000                    363   2e-118   
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog             363   2e-118   
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             363   2e-118   
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             362   3e-118   
ref|XP_003635547.1|  PREDICTED: L-ascorbate oxidase homolog             362   3e-118   
ref|XP_008374030.1|  PREDICTED: L-ascorbate oxidase homolog             362   3e-118   
ref|XP_011025085.1|  PREDICTED: L-ascorbate oxidase homolog             362   3e-118   
ref|XP_002882820.1|  hypothetical protein ARALYDRAFT_478721             362   5e-118   
ref|XP_007163845.1|  hypothetical protein PHAVU_001G269200g             362   6e-118   
emb|CAN69061.1|  hypothetical protein VITISV_032605                     362   6e-118   Vitis vinifera
ref|XP_003601601.1|  L-ascorbate oxidase-like protein                   362   7e-118   
gb|KHG27164.1|  L-ascorbate oxidase                                     359   8e-118   
ref|XP_009339221.1|  PREDICTED: L-ascorbate oxidase homolog             361   1e-117   
ref|XP_003601599.1|  L-ascorbate oxidase-like protein                   361   1e-117   
gb|AES71848.2|  L-ascorbate oxidase-like protein                        360   1e-117   
gb|KDP30647.1|  hypothetical protein JCGZ_16212                         361   1e-117   
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             361   1e-117   
ref|XP_006352142.1|  PREDICTED: L-ascorbate oxidase homolog             361   1e-117   
gb|KGN63948.1|  hypothetical protein Csa_1G031720                       358   1e-117   
gb|EPS68478.1|  hypothetical protein M569_06286                         360   1e-117   
ref|XP_007014661.1|  SKU5 similar 12                                    360   2e-117   
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             360   2e-117   
ref|XP_003601596.1|  L-ascorbate oxidase-like protein                   360   2e-117   
ref|XP_003556690.2|  PREDICTED: L-ascorbate oxidase homolog             360   2e-117   
ref|NP_187948.1|  protein SKU5-like 13                                  360   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003601597.1|  L-ascorbate oxidase-like protein                   360   3e-117   
ref|XP_006353286.1|  PREDICTED: L-ascorbate oxidase homolog             360   3e-117   
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             360   3e-117   
emb|CDY49392.1|  BnaC09g53590D                                          357   3e-117   
ref|XP_006299973.1|  hypothetical protein CARUB_v10016186mg             360   4e-117   
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    360   4e-117   
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    360   4e-117   
ref|XP_004296148.1|  PREDICTED: L-ascorbate oxidase homolog             358   4e-117   
ref|XP_003529456.1|  PREDICTED: L-ascorbate oxidase homolog             359   5e-117   
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    359   5e-117   
ref|XP_010093149.1|  L-ascorbate oxidase-like protein                   359   5e-117   
ref|XP_009124743.1|  PREDICTED: L-ascorbate oxidase homolog             359   5e-117   
ref|XP_010552291.1|  PREDICTED: L-ascorbate oxidase homolog             359   6e-117   
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             359   9e-117   
ref|XP_009376784.1|  PREDICTED: L-ascorbate oxidase homolog             363   9e-117   
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    358   1e-116   
ref|XP_004505355.1|  PREDICTED: L-ascorbate oxidase homolog             357   3e-116   
emb|CAA47176.1|  Bplo                                                   357   3e-116   Brassica napus [oilseed rape]
gb|EYU39761.1|  hypothetical protein MIMGU_mgv1a003754mg                358   4e-116   
ref|XP_004250092.1|  PREDICTED: L-ascorbate oxidase homolog             357   4e-116   
emb|CDY24189.1|  BnaC01g37690D                                          357   5e-116   
ref|XP_010034521.1|  PREDICTED: L-ascorbate oxidase homolog             357   6e-116   
ref|XP_010552290.1|  PREDICTED: L-ascorbate oxidase homolog             357   6e-116   
emb|CDY43353.1|  BnaA01g29840D                                          356   9e-116   
gb|AGW80453.1|  pollen-specific protein                                 356   1e-115   
ref|XP_003607814.1|  L-ascorbate oxidase-like protein                   356   1e-115   
ref|XP_009120150.1|  PREDICTED: L-ascorbate oxidase homolog             356   1e-115   
gb|KHG03555.1|  L-ascorbate oxidase                                     355   3e-115   
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                   354   4e-115   
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             354   7e-115   
gb|EYU39505.1|  hypothetical protein MIMGU_mgv1a003980mg                353   1e-114   
ref|XP_004234818.1|  PREDICTED: L-ascorbate oxidase homolog             353   1e-114   
ref|XP_009417950.1|  PREDICTED: L-ascorbate oxidase homolog             353   1e-114   
ref|XP_011077090.1|  PREDICTED: L-ascorbate oxidase homolog             353   2e-114   
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             352   4e-114   
gb|KFK27206.1|  hypothetical protein AALP_AA8G349600                    352   6e-114   
gb|KHG05644.1|  L-ascorbate oxidase                                     350   1e-113   
ref|XP_009384956.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    350   3e-113   
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             349   4e-113   
ref|XP_009384957.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    349   4e-113   
ref|XP_009399915.1|  PREDICTED: L-ascorbate oxidase homolog             349   7e-113   
ref|XP_009402422.1|  PREDICTED: L-ascorbate oxidase homolog             349   7e-113   
ref|XP_003529457.1|  PREDICTED: L-ascorbate oxidase homolog             348   1e-112   
gb|EEC79422.1|  hypothetical protein OsI_20394                          344   3e-112   Oryza sativa Indica Group [Indian rice]
ref|XP_004149657.1|  PREDICTED: L-ascorbate oxidase homolog             345   1e-111   
emb|CDY54363.1|  BnaC06g07290D                                          345   2e-111   
gb|EEE64155.1|  hypothetical protein OsJ_18987                          343   3e-111   Oryza sativa Japonica Group [Japonica rice]
gb|AAT01329.1|  putative L-ascorbate oxidase                            344   7e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008782736.1|  PREDICTED: L-ascorbate oxidase homolog             343   1e-110   
ref|XP_003566121.2|  PREDICTED: L-ascorbate oxidase homolog             342   2e-110   
ref|XP_010938086.1|  PREDICTED: L-ascorbate oxidase homolog             341   8e-110   
ref|XP_009600428.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    339   1e-109   
ref|XP_010921259.1|  PREDICTED: L-ascorbate oxidase homolog             340   2e-109   
ref|XP_007157831.1|  hypothetical protein PHAVU_002G101800g             340   3e-109   
ref|XP_004970369.1|  PREDICTED: L-ascorbate oxidase homolog             339   4e-109   
ref|XP_008788020.1|  PREDICTED: L-ascorbate oxidase homolog             339   5e-109   
ref|XP_003607816.1|  L-ascorbate oxidase-like protein                   338   5e-109   
ref|XP_008793387.1|  PREDICTED: L-ascorbate oxidase homolog             338   8e-109   
ref|XP_008804666.1|  PREDICTED: L-ascorbate oxidase homolog             337   2e-108   
gb|KHN20513.1|  L-ascorbate oxidase like                                336   2e-108   
gb|AFK44839.1|  unknown                                                 331   3e-108   
emb|CDM84722.1|  unnamed protein product                                337   5e-108   
ref|NP_001132891.1|  uncharacterized protein LOC100194388               332   5e-108   Zea mays [maize]
ref|XP_009416330.1|  PREDICTED: L-ascorbate oxidase homolog             336   6e-108   
gb|EMT02825.1|  L-ascorbate oxidase-like protein                        336   7e-108   
ref|XP_003567221.1|  PREDICTED: L-ascorbate oxidase homolog             336   9e-108   
ref|NP_001151662.1|  L-ascorbate oxidase precursor                      336   1e-107   Zea mays [maize]
gb|ACN34077.1|  unknown                                                 336   1e-107   Zea mays [maize]
ref|XP_009383852.1|  PREDICTED: L-ascorbate oxidase homolog             335   1e-107   
emb|CDY50029.1|  BnaA06g00300D                                          335   1e-107   
gb|ACF86554.2|  unknown                                                 334   4e-107   Zea mays [maize]
gb|EMS66047.1|  L-ascorbate oxidase-like protein                        335   4e-107   
ref|XP_009392060.1|  PREDICTED: L-ascorbate oxidase homolog             336   5e-107   
dbj|BAK05994.1|  predicted protein                                      334   5e-107   
ref|XP_002456532.1|  hypothetical protein SORBIDRAFT_03g037970          334   6e-107   Sorghum bicolor [broomcorn]
ref|NP_001151772.1|  pollen-specific protein NTP303 precursor           333   8e-107   Zea mays [maize]
dbj|BAK07214.1|  predicted protein                                      333   1e-106   
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog             332   1e-106   
ref|XP_010922850.1|  PREDICTED: L-ascorbate oxidase homolog             332   3e-106   
gb|ADK47981.1|  L-ascorbate oxidase-like protein                        331   5e-106   
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             331   5e-106   
ref|XP_008672229.1|  PREDICTED: uncharacterized protein LOC100194...    331   8e-106   
ref|XP_008466955.1|  PREDICTED: L-ascorbate oxidase homolog             320   2e-105   
ref|XP_006644902.1|  PREDICTED: L-ascorbate oxidase homolog             330   2e-105   
ref|XP_008449954.1|  PREDICTED: L-ascorbate oxidase homolog             326   2e-105   
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             328   1e-104   
gb|EEE55579.1|  hypothetical protein OsJ_03867                          327   2e-104   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044620.1|  Os01g0816700                                       327   2e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71702.1|  hypothetical protein OsI_04207                          327   3e-104   Oryza sativa Indica Group [Indian rice]
ref|XP_004961713.1|  PREDICTED: L-ascorbate oxidase homolog             326   4e-104   
ref|NP_001151961.1|  pollen-specific protein NTP303 precursor           326   5e-104   Zea mays [maize]
gb|ACN26659.1|  unknown                                                 325   1e-103   Zea mays [maize]
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          323   6e-103   
ref|XP_010931432.1|  PREDICTED: L-ascorbate oxidase homolog             322   2e-102   
ref|XP_002441281.1|  hypothetical protein SORBIDRAFT_09g023770          321   7e-102   Sorghum bicolor [broomcorn]
ref|XP_006386039.1|  multi-copper oxidase type 1 family protein         315   5e-100   
emb|CDY43352.1|  BnaA01g29830D                                          313   1e-99    
gb|EMT12555.1|  L-ascorbate oxidase-like protein                        308   1e-98    
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          295   4e-92    
gb|ABV89619.1|  Sku5-like 11                                            277   4e-85    Brassica rapa
ref|XP_007047154.1|  SKU5 similar 17 isoform 3                          270   3e-84    
emb|CBI18560.3|  unnamed protein product                                274   5e-84    
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             274   5e-84    Vitis vinifera
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                272   3e-83    
ref|XP_007047152.1|  SKU5 similar 17 isoform 1                          270   1e-82    
ref|XP_007047153.1|  SKU5 similar 17 isoform 2                          270   1e-82    
emb|CAN72538.1|  hypothetical protein VITISV_028749                     271   2e-82    Vitis vinifera
ref|XP_003524640.1|  PREDICTED: L-ascorbate oxidase homolog             266   1e-81    
gb|AGE09595.1|  SKU5-like protein                                       266   2e-81    
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             267   2e-81    
gb|KHM99211.1|  L-ascorbate oxidase like                                266   2e-81    
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             267   3e-81    
gb|KHG07318.1|  L-ascorbate oxidase                                     266   3e-81    
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             266   4e-81    
gb|KCW55614.1|  hypothetical protein EUGRSUZ_I01478                     263   5e-81    
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             265   8e-81    
ref|XP_008359469.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    264   1e-80    
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             265   1e-80    
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             265   2e-80    
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             265   2e-80    
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             265   2e-80    
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             264   4e-80    
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             264   4e-80    
gb|ABK25092.1|  unknown                                                 264   4e-80    Picea sitchensis
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             264   4e-80    
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             263   4e-80    
gb|KDO79341.1|  hypothetical protein CISIN_1g0092422mg                  257   6e-80    
ref|XP_007041705.1|  SKU5 similar 5                                     263   6e-80    
gb|KHN36198.1|  L-ascorbate oxidase like                                263   7e-80    
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             263   8e-80    
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    263   9e-80    
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             263   9e-80    
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             263   1e-79    
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             262   2e-79    
ref|XP_010109886.1|  L-ascorbate oxidase-like protein                   262   2e-79    
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    262   2e-79    
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             262   2e-79    
gb|KEH20500.1|  multi-copper oxidase-like protein                       262   2e-79    
ref|XP_004300548.1|  PREDICTED: L-ascorbate oxidase homolog             261   3e-79    
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    261   3e-79    
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             261   3e-79    
gb|KHN42054.1|  L-ascorbate oxidase like                                261   4e-79    
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     262   4e-79    
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog             261   5e-79    
gb|KHG25743.1|  L-ascorbate oxidase                                     261   6e-79    
gb|KHG21949.1|  L-ascorbate oxidase                                     261   6e-79    
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             260   8e-79    
ref|XP_011099220.1|  PREDICTED: L-ascorbate oxidase homolog             260   1e-78    
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   259   1e-78    
gb|EPS74059.1|  hypothetical protein M569_00695                         259   2e-78    
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             259   2e-78    
gb|EYU17541.1|  hypothetical protein MIMGU_mgv1a004531mg                259   2e-78    
gb|KDO79340.1|  hypothetical protein CISIN_1g0092422mg                  257   2e-78    
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             259   2e-78    
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             259   2e-78    
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             259   3e-78    
gb|ABR18324.1|  unknown                                                 259   3e-78    
gb|EPS57861.1|  hypothetical protein M569_16956                         256   4e-78    
ref|XP_004509178.1|  PREDICTED: L-ascorbate oxidase homolog             258   7e-78    
emb|CDY18626.1|  BnaA09g07690D                                          258   1e-77    
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             257   1e-77    
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             257   1e-77    
ref|XP_011099223.1|  PREDICTED: L-ascorbate oxidase homolog             257   1e-77    
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog             257   2e-77    
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             257   2e-77    
emb|CDX81353.1|  BnaC09g07640D                                          257   2e-77    
ref|XP_009347241.1|  PREDICTED: L-ascorbate oxidase homolog             257   2e-77    
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               257   2e-77    
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         257   2e-77    
ref|XP_002522337.1|  multicopper oxidase, putative                      256   2e-77    
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             256   3e-77    
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             256   4e-77    
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog             256   4e-77    
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             256   4e-77    
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         256   4e-77    
emb|CDP07321.1|  unnamed protein product                                256   4e-77    
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             256   5e-77    
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg                256   5e-77    
ref|NP_569041.1|  protein SKU5 similar 17                               256   5e-77    
dbj|BAB08634.1|  pectinesterase like protein                            256   5e-77    
gb|EMT20871.1|  L-ascorbate oxidase-like protein                        254   5e-77    
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             256   5e-77    
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             256   6e-77    
ref|XP_009381277.1|  PREDICTED: L-ascorbate oxidase homolog             256   6e-77    
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             255   6e-77    
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             255   7e-77    
gb|AAM61328.1|  pectinesterase-like protein                             255   7e-77    
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             255   7e-77    
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    255   8e-77    
gb|AGT57427.1|  ascorbate oxidase                                       254   1e-76    
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    255   1e-76    
gb|ACN28536.1|  unknown                                                 251   1e-76    
ref|XP_006469674.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    252   1e-76    
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             254   1e-76    
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                254   1e-76    
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    254   2e-76    
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg             254   2e-76    
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         254   2e-76    
gb|KHG11003.1|  L-ascorbate oxidase                                     254   2e-76    
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             254   2e-76    
ref|XP_009366415.1|  PREDICTED: L-ascorbate oxidase homolog             254   2e-76    
emb|CDY68812.1|  BnaAnng28440D                                          252   2e-76    
ref|XP_011013815.1|  PREDICTED: L-ascorbate oxidase homolog             254   2e-76    
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         254   2e-76    
ref|XP_011039229.1|  PREDICTED: L-ascorbate oxidase homolog             254   2e-76    
gb|EYU44358.1|  hypothetical protein MIMGU_mgv1a004238mg                254   2e-76    
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   254   2e-76    
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog             254   2e-76    
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             254   2e-76    
gb|KHN12597.1|  L-ascorbate oxidase like                                251   3e-76    
ref|XP_007213899.1|  hypothetical protein PRUPE_ppa003872mg             251   3e-76    
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             254   3e-76    
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             254   3e-76    
gb|KEH29685.1|  multi-copper oxidase-like protein                       253   3e-76    
gb|KHG03845.1|  L-ascorbate oxidase                                     253   4e-76    
ref|XP_004511977.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    253   4e-76    
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog             254   4e-76    
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             253   4e-76    
ref|XP_002866726.1|  predicted protein                                  253   5e-76    
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g             253   5e-76    
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             253   5e-76    
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             253   5e-76    
gb|KDO54690.1|  hypothetical protein CISIN_1g009283mg                   251   6e-76    
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog             253   6e-76    
ref|XP_003611825.1|  L-ascorbate oxidase-like protein                   253   6e-76    
ref|XP_003563398.1|  PREDICTED: L-ascorbate oxidase homolog             253   6e-76    
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             253   6e-76    
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog             253   8e-76    
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog             253   8e-76    
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog             253   8e-76    
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             252   9e-76    
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    252   1e-75    
gb|KEH20499.1|  multi-copper oxidase-like protein                       252   1e-75    
ref|XP_009594575.1|  PREDICTED: L-ascorbate oxidase homolog             252   1e-75    
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   252   1e-75    
emb|CDY43557.1|  BnaC02g16540D                                          252   1e-75    
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             252   1e-75    
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             252   1e-75    
ref|XP_006656379.1|  PREDICTED: L-ascorbate oxidase homolog             252   1e-75    
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             251   2e-75    
ref|XP_004511976.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    252   2e-75    
ref|XP_009630902.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    251   2e-75    
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             251   2e-75    
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             251   2e-75    
gb|KEH40258.1|  multi-copper oxidase-like protein                       251   2e-75    
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog             251   2e-75    
ref|XP_002522339.1|  multicopper oxidase, putative                      251   2e-75    
ref|NP_001147597.1|  LOC100281206 precursor                             251   3e-75    
gb|ACF85744.1|  unknown                                                 248   3e-75    
ref|XP_009630899.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    251   3e-75    
ref|XP_007046384.1|  SKU5 similar 5 isoform 2                           248   3e-75    
gb|AGJ03718.1|  multicopper oxidase                                     251   3e-75    
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog             251   3e-75    
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog             251   4e-75    
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             251   4e-75    
dbj|BAK00459.1|  predicted protein                                      251   4e-75    
gb|KDP31875.1|  hypothetical protein JCGZ_12336                         250   5e-75    
gb|EAZ38022.1|  hypothetical protein OsJ_22366                          250   6e-75    
dbj|BAJ91397.1|  predicted protein                                      250   6e-75    
ref|XP_011008684.1|  PREDICTED: L-ascorbate oxidase homolog             248   6e-75    
ref|XP_009765874.1|  PREDICTED: L-ascorbate oxidase homolog             250   6e-75    
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             250   6e-75    
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             250   7e-75    
ref|NP_001058365.1|  Os06g0678800                                       250   7e-75    
gb|EAZ02087.1|  hypothetical protein OsI_24168                          250   7e-75    
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             250   7e-75    
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog             250   8e-75    
ref|XP_010103298.1|  L-ascorbate oxidase-like protein                   252   8e-75    
gb|KHG04142.1|  L-ascorbate oxidase                                     250   9e-75    
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog             249   1e-74    
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog             249   1e-74    
ref|XP_008791980.1|  PREDICTED: L-ascorbate oxidase homolog             249   1e-74    
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             249   1e-74    
ref|XP_010905243.1|  PREDICTED: L-ascorbate oxidase homolog             249   1e-74    
emb|CBI18561.3|  unnamed protein product                                251   1e-74    
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             249   1e-74    
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             249   2e-74    
ref|XP_009769792.1|  PREDICTED: L-ascorbate oxidase homolog             249   2e-74    
ref|XP_010099197.1|  L-ascorbate oxidase-like protein                   247   2e-74    
ref|XP_008338225.1|  PREDICTED: L-ascorbate oxidase homolog             249   2e-74    
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             249   2e-74    
ref|XP_008440923.1|  PREDICTED: L-ascorbate oxidase homolog             249   2e-74    
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             249   2e-74    
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             249   2e-74    
gb|EEC82126.1|  hypothetical protein OsI_26158                          249   2e-74    
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog             249   2e-74    
emb|CAA65634.1|  PS60                                                   249   2e-74    
ref|XP_010667350.1|  PREDICTED: L-ascorbate oxidase homolog             249   2e-74    
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             249   2e-74    
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             249   2e-74    
gb|KEH30610.1|  multi-copper oxidase-like protein                       246   2e-74    
gb|KDO79346.1|  hypothetical protein CISIN_1g009171mg                   249   2e-74    
emb|CDP10787.1|  unnamed protein product                                249   2e-74    
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             248   2e-74    
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           248   3e-74    
ref|XP_007026110.1|  SKU5 similar 4 isoform 3                           248   3e-74    
ref|XP_004301852.1|  PREDICTED: L-ascorbate oxidase homolog             248   3e-74    
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             248   3e-74    
ref|XP_003550084.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    248   3e-74    
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             248   3e-74    
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    248   4e-74    
gb|KHN33820.1|  L-ascorbate oxidase like                                248   4e-74    
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             248   4e-74    
ref|XP_002528421.1|  multicopper oxidase, putative                      248   4e-74    
emb|CDP19581.1|  unnamed protein product                                248   4e-74    
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog             248   5e-74    
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog             248   5e-74    
ref|XP_008382461.1|  PREDICTED: L-ascorbate oxidase homolog             248   5e-74    
ref|XP_004170388.1|  PREDICTED: L-ascorbate oxidase homolog             246   5e-74    
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             248   5e-74    
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             248   6e-74    
ref|XP_006466655.1|  PREDICTED: L-ascorbate oxidase homolog             248   6e-74    
gb|EEE67250.1|  hypothetical protein OsJ_24405                          248   6e-74    
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         248   6e-74    
gb|ACL53812.1|  unknown                                                 248   6e-74    
ref|XP_007131584.1|  hypothetical protein PHAVU_011G025400g             248   7e-74    
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           247   7e-74    
ref|XP_010539014.1|  PREDICTED: L-ascorbate oxidase homolog             247   8e-74    
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             247   8e-74    
gb|ABK95805.1|  unknown                                                 247   8e-74    
ref|XP_002272880.1|  PREDICTED: L-ascorbate oxidase homolog             247   8e-74    
ref|XP_006425822.1|  hypothetical protein CICLE_v10027285mg             248   9e-74    
ref|XP_009619786.1|  PREDICTED: L-ascorbate oxidase homolog             247   9e-74    
ref|XP_010484570.1|  PREDICTED: L-ascorbate oxidase homolog             247   1e-73    
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             247   1e-73    
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             247   1e-73    
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             247   1e-73    
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             247   1e-73    
emb|CDP02462.1|  unnamed protein product                                247   1e-73    
ref|XP_006283464.1|  hypothetical protein CARUB_v10004509mg             247   1e-73    
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             246   1e-73    
dbj|BAC83966.1|  putative PS60                                          247   1e-73    
ref|XP_009418785.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    247   1e-73    
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             246   2e-73    
gb|KDO85017.1|  hypothetical protein CISIN_1g009149mg                   244   2e-73    
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             246   2e-73    
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             246   2e-73    
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                     245   2e-73    
ref|XP_006435292.1|  hypothetical protein CICLE_v10000783mg             244   2e-73    
ref|XP_010436936.1|  PREDICTED: L-ascorbate oxidase homolog             246   2e-73    
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             246   2e-73    
dbj|BAK04971.1|  predicted protein                                      246   3e-73    
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         246   3e-73    
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog             246   3e-73    
ref|XP_002307765.1|  multi-copper oxidase type 1 family protein         246   4e-73    
ref|XP_004145114.1|  PREDICTED: L-ascorbate oxidase homolog             245   4e-73    
gb|KHG02352.1|  L-ascorbate oxidase                                     245   4e-73    
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             245   4e-73    
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             246   5e-73    
gb|KEH30611.1|  multi-copper oxidase-like protein                       245   5e-73    
ref|XP_002310164.1|  multi-copper oxidase type 1 family protein         245   5e-73    
ref|XP_003527461.1|  PREDICTED: L-ascorbate oxidase homolog             245   5e-73    
gb|EMT08995.1|  L-ascorbate oxidase-like protein                        245   5e-73    



>ref|XP_009591795.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=558

 Score =   417 bits (1072),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/295 (70%), Positives = 247/295 (84%), Gaps = 2/295 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKL-EPIA  706
            P+PFD PADE+++FL DWYNKGHK LKK+L  GR+I RP+GI IN K   VGDK+ E + 
Sbjct  152  PIPFDKPADEYNVFLGDWYNKGHKTLKKILDGGRTIGRPDGIHINGKSSKVGDKVAEALF  211

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TME GKTYR+R+CNVG+RTS+N R QGH+MKLVE+EGSH VQN YDS+D+HVG CL+VLV
Sbjct  212  TMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVYDSLDLHVGQCLSVLV  271

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TADQEPKDYY+V +SRF K+  SSVA++ YA GKG P +SELP PPP+   GIAWSMNQF
Sbjct  272  TADQEPKDYYMVVSSRFLKQALSSVAILRYANGKG-PASSELPTPPPDNTEGIAWSMNQF  330

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYG+I ITRT+K+V S+S    K+R+A+NG+SH+D +TPL
Sbjct  331  RSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLRFALNGISHMDTDTPL  390

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KL E+F VPEK FKYD++ D PP DL+KVT++PNV NAT RNFVEIIFEN EKTI
Sbjct  391  KLVEFFGVPEKTFKYDLIADEPPSDLSKVTISPNVKNATFRNFVEIIFENQEKTI  445



>ref|XP_009766183.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score =   414 bits (1065),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/295 (69%), Positives = 246/295 (83%), Gaps = 2/295 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDK-LEPIA  706
            P+PFD PA+E+++FL DWYNKGH+ LKK+L  GR+I RP+GI IN K   VGDK  E + 
Sbjct  152  PIPFDKPAEEYNVFLGDWYNKGHRTLKKILDGGRTIGRPDGIHINGKSSKVGDKATEALF  211

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TME GKTYR+R+CNVG+RTS+N R QGH+MKLVE+EGSH VQN YDS+D+HVG CL+VLV
Sbjct  212  TMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVYDSLDIHVGQCLSVLV  271

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TADQEPKDYY+V +SRF K+  SSVA++ YA GKG P +SELP PPP+   GIAWSMNQF
Sbjct  272  TADQEPKDYYMVVSSRFLKQELSSVAILRYANGKG-PASSELPAPPPDNTEGIAWSMNQF  330

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYG+I ITRT+K+V S+S    K+R+A+NG+SH+D +TPL
Sbjct  331  RSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLRFALNGISHMDTDTPL  390

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KL E+F VPEK FKYD+M D PP DL+KVT++PNV NAT RNFVEIIFEN EKTI
Sbjct  391  KLVEFFGVPEKTFKYDLMADEPPSDLSKVTISPNVKNATFRNFVEIIFENEEKTI  445



>gb|AAQ90182.1| ntp101 [Nicotiana tabacum]
 gb|AAQ90184.1| ntp302 [Nicotiana tabacum]
Length=558

 Score =   414 bits (1064),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 205/295 (69%), Positives = 246/295 (83%), Gaps = 2/295 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKL-EPIA  706
            P+PFD PADE+++FL DWYNKGHK LKK+L  GR+I RP+GI IN K   VGDK+ E + 
Sbjct  152  PIPFDKPADEYNVFLGDWYNKGHKTLKKILDGGRTIGRPDGIHINGKSSKVGDKVAEALF  211

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TME GKTYR+R+CNVG+RTS+N R QGH+MKLVE+EGSH VQN YDS+D+HVG CL+VLV
Sbjct  212  TMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVYDSLDLHVGQCLSVLV  271

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TADQEPKDYY+V +SRF K+  SSVA++ YA GKG P +SELP PPP+   GIAWSMNQF
Sbjct  272  TADQEPKDYYMVVSSRFLKQALSSVAILRYANGKG-PASSELPTPPPDNTEGIAWSMNQF  330

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYG+I ITRT+K+V S+S    K+R+A+NG+SH+D +TPL
Sbjct  331  RSFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSRSQVAGKLRFALNGISHMDTDTPL  390

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KL E+F VPEK FKYD++ D PP DL+KVT++ NV NAT RNFVEIIFEN EKTI
Sbjct  391  KLVEFFGVPEKTFKYDLIADEPPSDLSKVTISSNVKNATFRNFVEIIFENQEKTI  445



>sp|P29162.1|ASOL_TOBAC RecName: Full=L-ascorbate oxidase homolog; AltName: Full=Pollen-specific 
protein NTP303; Flags: Precursor [Nicotiana tabacum]
 emb|CAA43454.1| pollen specific protein [Nicotiana tabacum]
Length=554

 Score =   411 bits (1056),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/294 (70%), Positives = 237/294 (81%), Gaps = 1/294 (0%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PADE+++F+ DWYNKGHK LKK+L  GR+I RP+GI IN K   VG+  EP+ T
Sbjct  149  PVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIIINGKSAKVGEAKEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTYR+R CN+G+R+S+N RFQGH MKLVELEGSH VQN YDS+D+HVG CL+VLVT
Sbjct  209  MEAGKTYRYRFCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDYYLV +SRF K+  SSVA+I YA GKG P + ELP PPPE   GIAWSMNQFR
Sbjct  269  ADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKG-PASPELPTPPPENTEGIAWSMNQFR  327

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK+  S S  G K+RY +NG+SH + ETPLK
Sbjct  328  SFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSMSQVGGKLRYGLNGISHTNGETPLK  387

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            L EYF    K FKYD+M D  P D +K+T+A NV NAT+RNFVEIIFENHEKTI
Sbjct  388  LVEYFGATNKAFKYDLMADEAPADPSKLTIATNVKNATYRNFVEIIFENHEKTI  441



>dbj|BAO02510.1| predicted pollen-specific protein ortholog [Nicotiana alata]
Length=555

 Score =   411 bits (1056),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 206/294 (70%), Positives = 236/294 (80%), Gaps = 1/294 (0%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PADE+++F+ DWYNKGHK LKK+L  GR+I RP+GI IN K   VG+  EP+ T
Sbjct  150  PVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIIINGKSAKVGEAKEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTYR+R CN+G+R+S+N RFQGH MKLVELEGSH VQN YDS+D+HVG C +VLVT
Sbjct  210  MEAGKTYRYRFCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDYYLV +SRF K+  SSVA+I YA GKG P + ELP PPPE   GIAWSMNQFR
Sbjct  270  ADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKG-PASPELPTPPPENTEGIAWSMNQFR  328

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK+  SKS    K+RY +NG+SH D ETPLK
Sbjct  329  SFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSKSQVDGKLRYGLNGISHTDGETPLK  388

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            L EYF   +K FKYD+M D  P D TK+T+  NV NAT+RNFVEIIFENHEKTI
Sbjct  389  LVEYFGATDKAFKYDLMADEAPADATKLTITANVKNATYRNFVEIIFENHEKTI  442



>ref|XP_009588330.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=589

 Score =   411 bits (1057),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 206/294 (70%), Positives = 238/294 (81%), Gaps = 1/294 (0%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PADE+++F+ DWYNKGHK LKK+L  GR+I RP+GI IN K   VG+  EP+ T
Sbjct  184  PVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRPDGIIINGKSAKVGEAKEPLFT  243

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTYR+R CN+G+R+S+N RFQGH MKLVELEGSH VQN YDS+D+HVG CL+VLVT
Sbjct  244  MEAGKTYRYRFCNLGMRSSVNIRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVLVT  303

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDYYLV +SRF K+  SSVA+I YA GKG P + ELP PPPE   GIAWSMNQFR
Sbjct  304  ADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKG-PASPELPTPPPENTEGIAWSMNQFR  362

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK+  S S  G K+RY +NG+SH + ETPLK
Sbjct  363  SFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSMSQVGGKLRYGLNGISHTNGETPLK  422

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            L EYF   +K FKYD+M D  P D +K+T+A NV NAT+RNFVEIIFENHEKTI
Sbjct  423  LVEYFGATDKAFKYDLMADEAPADPSKLTIATNVKNATYRNFVEIIFENHEKTI  476



>ref|XP_006367595.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=567

 Score =   410 bits (1053),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/301 (66%), Positives = 234/301 (78%), Gaps = 7/301 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            P+PFD PADE+++FL DWYNKGHK LKK L  GR+I RP+GI IN K   +GDK EP+ +
Sbjct  154  PIPFDKPADEYNVFLGDWYNKGHKALKKTLDGGRTIGRPDGIHINGKSNKLGDKAEPLFS  213

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GK YR+R+CNVG+RTS+N R QGH+MKLVE+EGSH VQN YDS+D+HVG CL+VLVT
Sbjct  214  MEAGKIYRYRMCNVGMRTSVNVRIQGHAMKLVEMEGSHTVQNMYDSLDIHVGQCLSVLVT  273

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselppppp---egipgiAWSMN  352
            ADQEPKDYY+V +SRF K+  SSVA++ YA GKGV   S     P        GIAWSMN
Sbjct  274  ADQEPKDYYMVVSSRFLKQAISSVAILRYANGKGVGSTSISDHLPTPPPNNTQGIAWSMN  333

Query  351  QFRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPET  172
            QFRSFRWNLTASAARPNPQGSYHYGQI ITRTIK+V S+S    K+R+A+NG+SH+D +T
Sbjct  334  QFRSFRWNLTASAARPNPQGSYHYGQINITRTIKIVNSRSQVNGKLRFALNGISHMDSDT  393

Query  171  PLKLAEYFQVPEKVFKYDIMKDNPPEDLTK----VTVAPNVVNATHRNFVEIIFENHEKT  4
            PLKL EYF V EK FKYD+M D PP   +     VT+APNV NAT RNFVEIIFEN EKT
Sbjct  394  PLKLVEYFGVAEKTFKYDVMGDEPPTPSSNNNKVVTIAPNVKNATFRNFVEIIFENEEKT  453

Query  3    I  1
            I
Sbjct  454  I  454



>ref|XP_006341879.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=554

 Score =   409 bits (1051),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/294 (69%), Positives = 236/294 (80%), Gaps = 1/294 (0%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PADE+++F+ DWYNKGHK LKK+L  G ++ RP+GI IN K   VG+  EP+ T
Sbjct  149  PVPFDNPADEYNVFVGDWYNKGHKTLKKVLDGGHTVGRPDGIIINGKSAKVGEAKEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTYR+R CN+G+R+S+N RFQGH MKLVELEGSH VQN YDS+D+HVG CL+VLVT
Sbjct  209  MEAGKTYRYRFCNLGMRSSVNVRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDYYLV +SRF K+  SSVA+I YA GKG P + ELP  PP+   GIAWSMNQFR
Sbjct  269  ADQEPKDYYLVVSSRFLKQELSSVAIIRYANGKG-PASPELPASPPDNTEGIAWSMNQFR  327

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK++ S      K+RY +NG+SH D ETPLK
Sbjct  328  SFRWNLTASAARPNPQGSYHYGQINITRTIKIINSMGQVNGKLRYGLNGISHSDTETPLK  387

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            L EYF   +K FKYD+M D  P D +K+TVAPNV NAT+RNFVEIIFENHEK+I
Sbjct  388  LVEYFGAADKTFKYDLMADEAPADPSKLTVAPNVKNATYRNFVEIIFENHEKSI  441



>ref|XP_009773470.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=554

 Score =   408 bits (1049),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 206/294 (70%), Positives = 236/294 (80%), Gaps = 1/294 (0%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PADE+++F+ DWYNKGHK LKK+L  GR+I R +GI IN K   VG+  E + T
Sbjct  149  PVPFDNPADEYNVFVGDWYNKGHKTLKKILDGGRTIGRADGIIINGKSAKVGEAKESLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTYR+R CN+G+R+S+N RFQGH MKLVELEGSH VQN YDS+D+HVG CL+VLVT
Sbjct  209  MEAGKTYRYRFCNLGMRSSVNVRFQGHPMKLVELEGSHTVQNIYDSLDLHVGQCLSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDYYLV +SRF K+  SSVA+I YA GKG P + ELP PPPE   GIAWSMNQFR
Sbjct  269  ADQEPKDYYLVVSSRFLKQALSSVAIIRYANGKG-PASPELPTPPPENTEGIAWSMNQFR  327

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK+  SKS    K+RY +NG+SH D ETPLK
Sbjct  328  SFRWNLTASAARPNPQGSYHYGQINITRTIKIFNSKSQVDGKLRYGLNGISHTDSETPLK  387

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            L EYF   +K FKYD+M D  P D TK+T+A NV NAT+RNFVEIIFENHEKTI
Sbjct  388  LVEYFGATDKAFKYDLMADEAPADSTKLTIAANVKNATYRNFVEIIFENHEKTI  441



>ref|XP_004229062.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=554

 Score =   403 bits (1036),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 200/294 (68%), Positives = 234/294 (80%), Gaps = 1/294 (0%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PADE+++F+ DWYNKGHK LKK+L  G ++ RP+GI IN K   VG+  EP+ T
Sbjct  149  PVPFDNPADEYNVFVGDWYNKGHKTLKKVLDGGHTVGRPDGIIINGKSAKVGEAKEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTYR+R CN+G+R+S+N R QGH MKLVELEGSH VQN YDS+D+HVG CL+VLVT
Sbjct  209  MEAGKTYRYRFCNLGMRSSVNVRLQGHPMKLVELEGSHTVQNIYDSLDIHVGQCLSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYYLV +SRF K+  SSVA+I YA GKG P + ELP  PP+   GIAWSMNQFR
Sbjct  269  ANQEPKDYYLVVSSRFLKQELSSVAIIRYANGKG-PASPELPASPPDNTEGIAWSMNQFR  327

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK+V S      K+RY +NG+SH D ETPLK
Sbjct  328  SFRWNLTASAARPNPQGSYHYGQINITRTIKIVNSMGQVNGKLRYGLNGISHSDTETPLK  387

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            L EYF   +K FKYD+M D  P D +K+TVAPNV N T+RNFVEIIFENHEK+I
Sbjct  388  LVEYFGAADKSFKYDLMADEAPADPSKLTVAPNVKNTTYRNFVEIIFENHEKSI  441



>emb|CDP18567.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   402 bits (1034),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 204/295 (69%), Positives = 238/295 (81%), Gaps = 2/295 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFDWPADE+++ + DWY KGHK LK +L  GRS+ RP+GI IN K   VGD +EP+ T
Sbjct  150  PVPFDWPADEYNVLVGDWYTKGHKALKNMLDSGRSLGRPDGIQINGKSAKVGDNVEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTYR+RVCNVGL+TSINFR QGH +KLVE+EGSH VQ D+DS+D+HVG CL+VLVT
Sbjct  210  MEPGKTYRYRVCNVGLKTSINFRIQGHPLKLVEIEGSHTVQYDFDSLDVHVGQCLSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDYY VA+SRF +   SSV +I Y  GKG P + ELPP PP G  GIAWSMNQFR
Sbjct  270  ADKEPKDYYFVASSRFIQAPLSSVGIIRYTNGKG-PASPELPPSPPVGSAGIAWSMNQFR  328

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKLV S+S  G K+RYAINGVSH+D  TPLK
Sbjct  329  SFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSESRVGGKLRYAINGVSHIDTPTPLK  388

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKV-TVAPNVVNATHRNFVEIIFENHEKTI  1
             AEYF V +K+F+Y+++KD+     T    +AP+VVNAT RNFVEIIFENHEKTI
Sbjct  389  HAEYFGVADKLFQYNLVKDDGSAVNTPAPIIAPSVVNATFRNFVEIIFENHEKTI  443



>gb|EYU32815.1| hypothetical protein MIMGU_mgv1a003910mg [Erythranthe guttata]
Length=555

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 229/295 (78%), Gaps = 2/295 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKL-EPIA  706
            PVPFD PADEF + L DWYNKGHK LK++L  GRSI +P+GI IN K  SVGD   +P+A
Sbjct  150  PVPFDMPADEFAVLLGDWYNKGHKTLKRILDSGRSIGKPDGIQINGKSSSVGDAAAQPLA  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
             ME GKTYR+RVCNVG++ S+NFRFQGH+MKLVELEGSH VQN YDS+D+HVG CL+VLV
Sbjct  210  VMEPGKTYRYRVCNVGMKLSVNFRFQGHTMKLVELEGSHTVQNVYDSLDLHVGQCLSVLV  269

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TADQ PKDYYLV +SRF K+  S+VA+I Y  G G    S  PPP         WSMNQF
Sbjct  270  TADQAPKDYYLVVSSRFSKKVMSTVAVIRYKNGNGAASLSIPPPPAENRAGIA-WSMNQF  328

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYG+I ITRTIK+  S +    K+R+ ING+SHV+ ETPL
Sbjct  329  RSFRWNLTASAARPNPQGSYHYGKINITRTIKIANSHAVVDGKLRFGINGISHVNTETPL  388

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF + +KVF Y++MKD P E   K+ +AP+VVNAT RNFVEIIFEN EKTI
Sbjct  389  KLAEYFGLGDKVFTYNLMKDEPTEGDNKLALAPSVVNATFRNFVEIIFENREKTI  443



>ref|XP_009624631.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=559

 Score =   398 bits (1023),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 207/298 (69%), Positives = 244/298 (82%), Gaps = 5/298 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKL-EPIA  706
            PVPFD PADE+++F+ DWYNKG+K LKK+L  GR+I RP+GI IN K   VGDK+ EP+ 
Sbjct  150  PVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSVKVGDKVAEPLF  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TME GKTYR+RVCN G+RTS+NFR QGH MKLVE+EGSH VQN Y+S+D+HVG CL+VLV
Sbjct  210  TMEAGKTYRYRVCNAGMRTSVNFRIQGHPMKLVEMEGSHTVQNVYESLDLHVGQCLSVLV  269

Query  525  TADQEPKDYYLVATSRFFKET-YSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            TADQEPKDYY++ +SRF K+   SSVA+I YA GKG P +S+LP PPPE   GIAWS+NQ
Sbjct  270  TADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGKG-PASSDLPAPPPENTQGIAWSINQ  328

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVD-PET  172
            FRSFRWNLTASAARPNPQGSYHYGQI ITRT K+V S+S    K+R+A+NG+SH +  ET
Sbjct  329  FRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKLRFALNGISHTNAAET  388

Query  171  PLKLAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            P KLAEYF V EK+FKYD+M D P  +DL KVTVAPN+ NAT RNFVEIIFEN EKTI
Sbjct  389  PFKLAEYFGVTEKMFKYDLMADEPQTDDLNKVTVAPNIKNATFRNFVEIIFENREKTI  446



>gb|AAQ90185.1| ntp805 [Nicotiana tabacum]
Length=559

 Score =   397 bits (1021),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 206/298 (69%), Positives = 244/298 (82%), Gaps = 5/298 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKL-EPIA  706
            PVPFD PADE+++F+ DWYNKG+K LKK+L  GR+I RP+GI IN K   VGDK+ EP+ 
Sbjct  150  PVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSVKVGDKVAEPLF  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TME GKTYR+RVCN G+RTS+NFR QGH MKLVE+EGSH VQN Y+S+D+HVG CL+VLV
Sbjct  210  TMEAGKTYRYRVCNAGMRTSVNFRIQGHPMKLVEMEGSHTVQNVYESLDLHVGQCLSVLV  269

Query  525  TADQEPKDYYLVATSRFFKET-YSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            TADQEPKDYY++ +SRF K+   SSVA+I YA GKG P +S+LP PPPE   GIAWS+NQ
Sbjct  270  TADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGKG-PASSDLPAPPPENTQGIAWSINQ  328

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVD-PET  172
            FRSFRWNLTASAARPNPQGSYHYGQI ITRT K+V S++    K+R+A+NG+SH +  ET
Sbjct  329  FRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRTEVDGKLRFALNGISHTNAAET  388

Query  171  PLKLAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            P KLAEYF V EK+FKYD+M D P  +DL KVTVAPN+ NAT RNFVEIIFEN EKTI
Sbjct  389  PFKLAEYFGVTEKMFKYDLMADEPQTDDLNKVTVAPNIKNATFRNFVEIIFENREKTI  446



>gb|EYU32814.1| hypothetical protein MIMGU_mgv1a003925mg [Erythranthe guttata]
Length=555

 Score =   396 bits (1018),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/295 (66%), Positives = 227/295 (77%), Gaps = 2/295 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGD-KLEPIA  706
            PVPFD PADEF + L DWYNKGHK LKK+L  GRSI +P+GI IN K   VGD   +P+A
Sbjct  150  PVPFDMPADEFAVLLGDWYNKGHKTLKKILDSGRSIGKPDGIQINGKSSKVGDVAAQPLA  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
             ME GKTYR+RVCNVG++ S+NFRFQGH+MKLVELEGSH VQN YDS+D+HVG CL+VLV
Sbjct  210  VMEPGKTYRYRVCNVGMKLSVNFRFQGHTMKLVELEGSHTVQNVYDSLDLHVGQCLSVLV  269

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TA+Q PKDYYLV +SRF K+  SSVA+I Y    G       PPP    +    WSMNQF
Sbjct  270  TANQAPKDYYLVVSSRFSKQVMSSVAVIKYKNANGAASTVIPPPPAENRVGIA-WSMNQF  328

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYG+I ITRTIK+  + +    K+R+ ING+SHV+ ETPL
Sbjct  329  RSFRWNLTASAARPNPQGSYHYGKINITRTIKIANTHAVVDGKLRFGINGISHVNTETPL  388

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF + +KVF Y++MKD P E   K+ VAP+VVNAT RNFVEIIFEN EKTI
Sbjct  389  KLAEYFGLGDKVFTYNLMKDEPTEGDNKLVVAPSVVNATFRNFVEIIFENREKTI  443



>gb|EYU39285.1| hypothetical protein MIMGU_mgv1a026945mg [Erythranthe guttata]
Length=558

 Score =   394 bits (1011),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 203/295 (69%), Positives = 235/295 (80%), Gaps = 2/295 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDK-LEPIA  706
            PVPFD PADEF + L DWYNKGHK LKK+L  G +I  PNGI IN + G VG   L P+A
Sbjct  153  PVPFDTPADEFAVLLGDWYNKGHKTLKKILDSGATIGLPNGIHINGQSGKVGSAPLTPLA  212

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
             +E GKTYR+RVCNVGLRTSINFRFQ H MKLVE+EGSH VQN YDS+D+H G C++VLV
Sbjct  213  IVEPGKTYRYRVCNVGLRTSINFRFQSHIMKLVEVEGSHTVQNVYDSLDLHAGQCVSVLV  272

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TADQ PKDYYLVA+SRF K+  SSVA+I YA GKG P + ELPPPPPE   GIAWS+NQF
Sbjct  273  TADQAPKDYYLVASSRFSKKPLSSVAIIRYANGKGAPASPELPPPPPENTAGIAWSVNQF  332

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RS+RWNLTASAARPNPQGSYHYG+I ITRTIK+  S+     K+R+ INGVSH++ ETPL
Sbjct  333  RSYRWNLTASAARPNPQGSYHYGKINITRTIKIANSRYQVNGKLRFGINGVSHIESETPL  392

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF + +K F YD++KD P  D  KV +AP+VVNAT RNFVEIIFEN+E TI
Sbjct  393  KLAEYFGLADKAFNYDLVKDEPSND-KKVVLAPSVVNATFRNFVEIIFENNENTI  446



>ref|XP_006354116.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=557

 Score =   392 bits (1008),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 202/296 (68%), Positives = 235/296 (79%), Gaps = 3/296 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKL-EPIA  706
            PVPFD PAD++ +F+ DWYNKG+K LKK+L  GR+I RP+GI IN K   VGDK  EP+ 
Sbjct  150  PVPFDNPADDYSVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSVKVGDKAAEPLY  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
             ME GKTYR+R CNVG+RTS+N R QGH MKLVE+EGSH VQN Y+S+D+HVG CL+VLV
Sbjct  210  KMEAGKTYRYRFCNVGMRTSVNVRIQGHPMKLVEIEGSHTVQNVYESLDLHVGQCLSVLV  269

Query  525  TADQEPKDYYLVATSRFFKET-YSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            TADQEPKDYY++ +SRF K+   SSV++I Y  GKG P +S+LP PPPE   GIAWSMNQ
Sbjct  270  TADQEPKDYYMIVSSRFLKQAELSSVSIIRYTNGKG-PASSDLPAPPPENTKGIAWSMNQ  328

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            FRSFRWNLTASAARPNPQGSYHYGQI ITRT K+V S+S    K+RYA+NG+SH D ETP
Sbjct  329  FRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKLRYALNGISHTDSETP  388

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
             KLAEYF   +KVFKYD+M D P     KVTVA N+ NAT RNFVEIIFENHEKTI
Sbjct  389  FKLAEYFGATDKVFKYDLMDDEPSTSSDKVTVASNIKNATFRNFVEIIFENHEKTI  444



>ref|XP_011089764.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   391 bits (1005),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 200/295 (68%), Positives = 233/295 (79%), Gaps = 3/295 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGD-KLEPIA  706
            P+PFD PADE+ + L DWYNKGHK LK +L  GRSI RP+GI IN +   VGD   +P+ 
Sbjct  150  PIPFDKPADEYPVLLGDWYNKGHKSLKNILDSGRSIGRPDGIQINGQSSKVGDANAKPLF  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            T E GKTYRFRVCNVGLR S+NFR Q HSM +VE+EGSH VQN YDS+D+HVG C++VLV
Sbjct  210  TFEAGKTYRFRVCNVGLRLSVNFRIQAHSMTVVEVEGSHTVQNVYDSLDLHVGQCMSVLV  269

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TADQ PKDYY VA+SRF +   S+VA+I YA G G   + ELPPPPP+   GIAWS++QF
Sbjct  270  TADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGP-ASPELPPPPPQNTMGIAWSISQF  328

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSY YG+I ITRTIKLV ++S    K+R+ INGVSHVD ETPL
Sbjct  329  RSFRWNLTASAARPNPQGSYKYGKINITRTIKLVNTRSSSNGKLRFGINGVSHVDTETPL  388

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEY+ V +KVF Y++MKD P E   KV VAPNVVN T+RNFVEIIFENHEKTI
Sbjct  389  KLAEYYGVADKVFTYNLMKDEPQEG-NKVEVAPNVVNGTYRNFVEIIFENHEKTI  442



>ref|XP_009785667.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
 gb|AAQ90183.1| ntp201 [Nicotiana tabacum]
Length=559

 Score =   390 bits (1002),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 203/298 (68%), Positives = 240/298 (81%), Gaps = 5/298 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKL-EPIA  706
            PVPFD PADE+++F+ DWYNKG+K LKK+L  GR+I RP+GI IN K   VGDK+ EP+ 
Sbjct  150  PVPFDNPADEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSLKVGDKVAEPLF  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TME GKTYR+R+CN G+RTS+N R QGH MKLVE+EGSH VQN Y+S+D+HVG CL+VLV
Sbjct  210  TMEAGKTYRYRMCNAGMRTSVNVRIQGHPMKLVEMEGSHTVQNVYESLDLHVGQCLSVLV  269

Query  525  TADQEPKDYYLVATSRFFKET-YSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            TADQEPKDYY++ +SRF K+   SSVA+I YA GKG P +S+LP PPPE   GIAWS+NQ
Sbjct  270  TADQEPKDYYMIVSSRFLKQAQLSSVAIIRYANGKG-PASSDLPAPPPENTQGIAWSINQ  328

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDP-ET  172
            FRSFRWNLTASAARPNPQGSYHYGQI ITRT K+V S+S    K+R+A+NG+SH    ET
Sbjct  329  FRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRSEVDGKLRFALNGISHTAAGET  388

Query  171  PLKLAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            P KLAEYF   +K+FKYD+M D P  EDL KVTV PN+ NAT RNFVEIIFEN EKTI
Sbjct  389  PFKLAEYFGATDKLFKYDLMADEPQTEDLNKVTVVPNIKNATFRNFVEIIFENREKTI  446



>ref|XP_004228635.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=557

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 198/296 (67%), Positives = 236/296 (80%), Gaps = 3/296 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKL-EPIA  706
            PVPFD PAD++ +F+ DWYNKG+K LKK+L  GR+I RP+GI IN K   VG+K+ EP+ 
Sbjct  150  PVPFDNPADDYSVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSEKVGEKVAEPLY  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
             ME GKTYR+R CNVG+RTS+N R QGH MKLVE+EGSH VQN Y+S+D+HVG CL+VLV
Sbjct  210  KMEAGKTYRYRFCNVGMRTSVNVRIQGHPMKLVEIEGSHTVQNVYESLDLHVGQCLSVLV  269

Query  525  TADQEPKDYYLVATSRFFKET-YSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            TADQEPKDYY++ +SRF K+   SSV++I Y  GKG P +S+LP PPPE   GIAWSMNQ
Sbjct  270  TADQEPKDYYMIVSSRFLKQAELSSVSIIRYVNGKG-PASSDLPAPPPENTQGIAWSMNQ  328

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            FRSFRWNLTASAARPNPQGSYHYGQI ITRT K+V S++    K+RYA+NG+SH D ETP
Sbjct  329  FRSFRWNLTASAARPNPQGSYHYGQINITRTFKIVNSRTEVDGKLRYALNGISHTDSETP  388

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
             KLAEYF   +KVFKYD+M D P     KVT+A N+ NAT RNFVEI+FENHEKTI
Sbjct  389  FKLAEYFGATDKVFKYDLMPDQPSTPDDKVTIASNIKNATFRNFVEIVFENHEKTI  444



>gb|ABI52585.1| pollen-specific protein [Camellia sinensis]
Length=566

 Score =   388 bits (996),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 198/297 (67%), Positives = 236/297 (79%), Gaps = 4/297 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PADE+ +   DWYNKGHK ++K L  GRS+ RP+GI IN K G VG   EP+  
Sbjct  154  PVPFDAPADEYFVIAGDWYNKGHKSIQKQLDTGRSLGRPDGIQINGKSGKVGGSNEPMFN  213

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GK YR+RVCNVG++TS+NFR QGHS+KLVE+EGSH VQN YDS+D+H+G C +VLV 
Sbjct  214  MEAGKIYRYRVCNVGMKTSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHIGQCFSVLVE  273

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEP DYY+V +SRF K+  +SVA+I YA GK   P+SELP PPPE   GIAWS+NQFR
Sbjct  274  ANQEPNDYYMVFSSRFTKQPLTSVAVIRYANGKN-SPSSELPAPPPETATGIAWSINQFR  332

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV S+++   K+RYAINGVSHV+P TPLK
Sbjct  333  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSRNNVDGKLRYAINGVSHVEPTTPLK  392

Query  162  LAEYFQVPEKVFKYDIMKDNP---PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            L EY+ + +KVFKYDI+KD P    E   K+ +APNV+NAT RNFVEII ENHEKTI
Sbjct  393  LVEYYGIQDKVFKYDIIKDEPEAASESNEKIVLAPNVLNATFRNFVEIILENHEKTI  449



>gb|AAL87103.1|AF479568_1 1-ascorbate oxidase [Petunia x hybrida]
Length=559

 Score =   387 bits (995),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 198/296 (67%), Positives = 238/296 (80%), Gaps = 4/296 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKL-EPIA  706
            P+PFD PA E+++F+ DWYNKG+K LKK+L  GR+I RP+GI IN K G VGD   EP+ 
Sbjct  152  PIPFDSPAAEYNVFVGDWYNKGYKSLKKILDGGRTIGRPDGIHINGKSGKVGDNAAEPLF  211

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TME GKTYR+R+CNVG+RTS+N R QGH+MKLVE+EGSH VQN Y+S+D+HVG CL+VLV
Sbjct  212  TMEAGKTYRYRMCNVGMRTSVNVRIQGHTMKLVEMEGSHTVQNVYESLDLHVGQCLSVLV  271

Query  525  TADQEPKDYYLVATSRFFKET-YSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            TADQEPK YY+V +SRF K+   SSVA++ YA GKG P +S+LP PPP+   GIAWS+NQ
Sbjct  272  TADQEPKGYYMVVSSRFLKQAELSSVAIVRYANGKG-PASSDLPAPPPDNTEGIAWSINQ  330

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            FRSFRWNLTASAARPNPQGSYHYGQI ITRTIK+  S+S  G K+R+A+NG+SH   ETP
Sbjct  331  FRSFRWNLTASAARPNPQGSYHYGQINITRTIKIANSRSQVGGKLRFALNGISHSPAETP  390

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
             KLAEYF   +KVFKYD+M D PP    KVTV  N+ NAT+RN+VEIIFEN EKTI
Sbjct  391  FKLAEYFGATDKVFKYDLMADEPPSG-DKVTVDHNIKNATYRNYVEIIFENREKTI  445



>ref|XP_011089765.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=554

 Score =   383 bits (984),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 195/295 (66%), Positives = 233/295 (79%), Gaps = 3/295 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGD-KLEPIA  706
            P+P+D PA+E+ + L DWYNKGHK LK +L  GRSI RP+GI IN +   VGD   +P+ 
Sbjct  150  PIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLF  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            T E GKTY+ RVCNVGLR S+NFR QGH+MK+VE+EGSH VQN YDS+D+HVG C++VLV
Sbjct  210  TFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSVLV  269

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TADQ PKDYY VA+SRF +   S+VA+I YA G G   + ELPPPPPE   GIAWS++QF
Sbjct  270  TADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGA-ASPELPPPPPENTKGIAWSISQF  328

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLT++AARPNPQGSY YG+I ITRTIK+  S+S    K+R+ INGVSHVD ETPL
Sbjct  329  RSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAETPL  388

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEY+ V +KVF Y++MKD P E   KV VAPNVVN T+RNFVEIIFENHEKTI
Sbjct  389  KLAEYYGVADKVFTYNLMKDEPQEG-NKVEVAPNVVNGTYRNFVEIIFENHEKTI  442



>gb|EPS72881.1| pollen-specific protein [Genlisea aurea]
Length=585

 Score =   384 bits (987),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 196/295 (66%), Positives = 235/295 (80%), Gaps = 1/295 (0%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PADEF + + DWYNKGHK LK +L  GRSI  P+G+ IN K G VG    P+ T
Sbjct  177  PVPFDRPADEFAVLVGDWYNKGHKTLKSILDSGRSIGFPDGVHINGKFGKVGGGSPPMFT  236

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +EKGKTYR+RVCNVG+R S+NFR QGH +KLVE+EGSH VQN YDS+D+HVG C++VL+T
Sbjct  237  VEKGKTYRYRVCNVGMRLSVNFRIQGHDLKLVEMEGSHTVQNVYDSLDLHVGQCMSVLIT  296

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ P DY+ V +SRF K+  S+VA+I Y+G KG   +  +PPPPPE   GIAWS+NQFR
Sbjct  297  ADQAPADYHFVVSSRFTKKALSTVAVIRYSGSKGSSDSGAIPPPPPENSRGIAWSINQFR  356

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIK+V ++     K+R+ INGVSHVD ETPLK
Sbjct  357  SFRWNLTASAARPNPQGSYHYGKINITRTIKVVNARYQVNGKLRFGINGVSHVDGETPLK  416

Query  162  LAEYFQVPEKVFKYDIMKDNPP-EDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYD+MKD P  +D  K ++APNVVNAT RNFVEI+FENHE+TI
Sbjct  417  LAEYFGVGDKVFKYDVMKDEPTGQDEQKASLAPNVVNATFRNFVEIVFENHERTI  471



>ref|XP_011089763.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   383 bits (983),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 194/295 (66%), Positives = 233/295 (79%), Gaps = 3/295 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGD-KLEPIA  706
            P+P+D PA+E+ + L DWYNKGHK LK +L  GRSI RP+GI IN +   VGD   +P+ 
Sbjct  151  PIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLF  210

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            T E GKTY+ RVCNVGLR S+NFR QGH+MK+VE+EGSH VQN YDS+D+HVG C++VLV
Sbjct  211  TFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSVLV  270

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TADQ PKDYY VA+SRF +   S+VA+I YA G G   + ELPPPPP+   GIAWS++QF
Sbjct  271  TADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGA-ASPELPPPPPDSTKGIAWSISQF  329

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLT++AARPNPQGSY YG+I ITRTIK+  S+S    K+R+ INGVSHVD ETPL
Sbjct  330  RSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAETPL  389

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEY+ V +KVF Y++MKD P E   KV VAPNVVN T+RNFVEIIFENHEKTI
Sbjct  390  KLAEYYGVADKVFTYNLMKDEPQEG-NKVEVAPNVVNGTYRNFVEIIFENHEKTI  443



>ref|XP_011089702.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   381 bits (979),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 194/295 (66%), Positives = 233/295 (79%), Gaps = 3/295 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGD-KLEPIA  706
            P+P+D PA+E+ + L DWYNKGHK LK +L  GRSI RP+GI IN +   VGD   +P+ 
Sbjct  151  PIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLF  210

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            T E GKTY+ RVCNVGLR S+NFR QGH+MK+VE+EGSH VQN YDS+D+HVG C++VLV
Sbjct  211  TFEAGKTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSVLV  270

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TADQ PKDYY VA+SRF +   S+VA+I YA G G   + ELPPPPP+   GIAWS++QF
Sbjct  271  TADQTPKDYYFVASSRFAQHPLSTVAVIRYANGNGP-ASPELPPPPPDSTKGIAWSISQF  329

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLT++AARPNPQGSY YG+I ITRTIK+  S+S    K+R+ INGVSHVD ETPL
Sbjct  330  RSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAETPL  389

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEY+ V +KVF Y++MKD P E   KV VAPNVVN T+RNFVEIIFENHEKTI
Sbjct  390  KLAEYYGVADKVFTYNLMKDEPQEG-DKVEVAPNVVNGTYRNFVEIIFENHEKTI  443



>ref|XP_011089767.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 194/295 (66%), Positives = 233/295 (79%), Gaps = 3/295 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGD-KLEPIA  706
            P+P+D PA+E+ + L DWYNKGHK LK +L  GRSI RP+GI IN +   VGD   +P+ 
Sbjct  151  PIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLF  210

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            T E G TY+ RVCNVGLR S+NFR QGH+MK+VE+EGSH VQN YDS+D+HVG C++VLV
Sbjct  211  TFEAGNTYKLRVCNVGLRLSVNFRVQGHTMKVVEVEGSHTVQNLYDSLDLHVGQCMSVLV  270

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TADQ PKDYY VA+SRF +  +S+VA+I YA G G   + ELPPPPPE   GIAWS++QF
Sbjct  271  TADQTPKDYYFVASSRFAQHPHSTVAVIRYANGNGA-ASPELPPPPPENTKGIAWSISQF  329

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLT++AARPNPQGSY YG+I ITRTIK+  S+S    K+R+ INGVSHVD ETPL
Sbjct  330  RSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAETPL  389

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEY+ V +KVF Y++MKD P E   KV VAPNVVN T+RNFVEIIFENHEKTI
Sbjct  390  KLAEYYGVADKVFTYNLMKDEPQEG-DKVEVAPNVVNGTYRNFVEIIFENHEKTI  443



>emb|CDP04133.1| unnamed protein product [Coffea canephora]
Length=557

 Score =   381 bits (978),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 223/298 (75%), Gaps = 9/298 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD P  ++ I   DWY+K H  L+KLL  GR++ RP+G+ IN K G    K EP+ T
Sbjct  152  PVPFDAPEADYTIMAGDWYSKSHVALRKLLDSGRTLGRPDGVLINGKSGKADGKDEPMFT  211

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M  GKTYR+RVCNVG++ S+NFRFQGH+MKLVE+EGSH +Q  YDS+D+H+G C +VLVT
Sbjct  212  MIPGKTYRYRVCNVGMKNSLNFRFQGHTMKLVEMEGSHTMQYLYDSLDLHLGQCASVLVT  271

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDYY VA++RF K+  S+ A I Y  GKG        P  P    G AWS+NQFR
Sbjct  272  ADKEPKDYYFVASTRFTKQILSATATIRYTTGKG-----PASPELPPAPVGWAWSLNQFR  326

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTI++V S      K+RYAINGVSHVDPETPLK
Sbjct  327  SFRWNLTASAARPNPQGSYHYGQINITRTIRIVNSAGEADGKLRYAINGVSHVDPETPLK  386

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLT----KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKY+I++D P  D T     +T+APNVVNAT RNF+EII ENHEKT+
Sbjct  387  LAEYFGVADKVFKYNIIQDEPSADATAKNHAITLAPNVVNATFRNFIEIILENHEKTV  444



>ref|XP_009626538.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   380 bits (976),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 189/299 (63%), Positives = 228/299 (76%), Gaps = 9/299 (3%)
 Frame = -2

Query  882  PVPFDW-PADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIA  706
            P+PFD  PADEF + +SDWY K H  L+KLL  GRS  RPNG+ IN K G   +K EP+ 
Sbjct  150  PIPFDVNPADEFFVLVSDWYTKSHSQLRKLLDSGRSAGRPNGVIINGKSGKGDNKDEPMF  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM  GKTYR+R CNVG++ SIN R QGH MKLVE+EGSH VQN YDS+D+H+G C++VLV
Sbjct  210  TMTPGKTYRYRFCNVGMKDSINVRIQGHIMKLVEIEGSHTVQNMYDSLDVHLGQCMSVLV  269

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TAD++PKDY+LVA++RF KE +++ A I Y  GKG           P+   G AWS+NQF
Sbjct  270  TADKDPKDYFLVASTRFTKEPHTATATIRYGNGKGA----PASLELPKAPIGWAWSLNQF  325

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYGQI ITRTIKLV +      K+RYAINGVSHV+PETP+
Sbjct  326  RSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTAGSVDGKLRYAINGVSHVNPETPI  385

Query  165  KLAEYFQVPEKVFKYDIMKDN--PPEDLT--KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEY+ V +KVFKYDI+KD+   P   T  K+T+APNVVN T+RNFVEIIFENHEK++
Sbjct  386  KLAEYYSVADKVFKYDIIKDDYEAPTAKTEEKITLAPNVVNGTYRNFVEIIFENHEKSV  444



>ref|XP_004149637.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   380 bits (975),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 224/295 (76%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LK+LL  GRSIARP+G+ IN K        EP+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTALKQLLDSGRSIARPDGVLINGKSAKGDGTDEPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++RVCNVGL++S+NFRFQGH+MKLVE+EGSH VQNDY+S+D+HVG C +VLVT
Sbjct  211  MKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYESLDVHVGQCFSVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K       ++ Y  GKG        P  PE   G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASTRFIKNVLVGKGIVRYIDGKG-----PASPEIPEAPMGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTASAARPNPQGSYHYG I ITRTIKLV S S    K+RYAINGVSHVDPETPLK
Sbjct  326  TFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSISKVDGKLRYAINGVSHVDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF+V +KVFKYD + D    E  T VTVAPNVVNAT RNF+EIIFENHEK++
Sbjct  386  LAEYFEVADKVFKYDTISDEGLAEGATTVTVAPNVVNATFRNFIEIIFENHEKSL  440



>emb|CDX97352.1| BnaA02g21430D [Brassica napus]
Length=488

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 224/295 (76%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LKK L  GR+I RP+GI IN K G      +P+ T
Sbjct  85   PVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKAGKGDGSDQPLFT  144

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +++GKTYR R+CNVGL+TS+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C  V+VT
Sbjct  145  LKQGKTYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVT  204

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K+  ++  L+ Y GGKG+       P  P    G AWS+NQFR
Sbjct  205  ANQEPKDYYMVASTRFLKKALATTGLLRYEGGKGL-----ASPQLPAAPVGWAWSLNQFR  259

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA++GVSH DPETPLK
Sbjct  260  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALSGVSHTDPETPLK  319

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK-VTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYDI+ DNP  D  K + + PNV+N THR F+E++FENHEK++
Sbjct  320  LAEYFGVADKVFKYDIISDNPTSDQIKNIKIEPNVLNITHRTFIEVVFENHEKSV  374



>ref|XP_011089766.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=555

 Score =   378 bits (971),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 193/295 (65%), Positives = 232/295 (79%), Gaps = 3/295 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGD-KLEPIA  706
            P+P+D PA+E+ + L DWYNKGHK LK +L  GRSI RP+GI IN +   VGD   +P+ 
Sbjct  151  PIPYDNPAEEYPVLLGDWYNKGHKTLKSILDSGRSIGRPDGIQINGQSSKVGDANAKPLF  210

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            T E GKTY+ RVCNVGLR S+NFR QGH++K+VE+EGSH VQN YDS+D+HVG C++VLV
Sbjct  211  TFEAGKTYKLRVCNVGLRLSVNFRVQGHTLKVVEVEGSHNVQNLYDSLDLHVGQCMSVLV  270

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TADQ PKDYY VA+SRF +   S+VA+I Y  G G   + ELPPPPPE   GIAWS++QF
Sbjct  271  TADQTPKDYYFVASSRFAQHPLSTVAVIRYVNGNGA-ASPELPPPPPENTKGIAWSISQF  329

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLT++AARPNPQGSY YG+I ITRTIK+  S+S    K+R+ INGVSHVD ETPL
Sbjct  330  RSFRWNLTSNAARPNPQGSYKYGKINITRTIKIANSRSSSNGKLRFGINGVSHVDAETPL  389

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEY+ V +KVF Y++MKD P E   KV VAPNVVN T+RNFVEIIFENHEKTI
Sbjct  390  KLAEYYGVADKVFTYNLMKDEPQEG-DKVEVAPNVVNGTYRNFVEIIFENHEKTI  443



>ref|XP_006303856.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
 gb|EOA36754.1| hypothetical protein CARUB_v10012595mg [Capsella rubella]
Length=549

 Score =   378 bits (970),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 222/294 (76%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L DWY  GH  LKKLL  GR++  PNG+ IN K G VG K EP+ T
Sbjct  149  PVPYADPEDDYTVLLGDWYTTGHTALKKLLDSGRTLGLPNGVLINGKSGKVGGKNEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C +VLVT
Sbjct  209  MKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  KDYY+VA++RF K+  S+V +I Y G        +     P+   G AWS+NQFR
Sbjct  269  ADQAAKDYYMVASTRFLKKELSTVGVIRYEGSN-----VQASTELPKTPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITR+IKLV SKS    KVR+  NGVSHVD ETPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ EKVFKY+++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  384  LAEYFQMAEKVFKYNVIKDEPEAKITALTVQPNVLNITFRTFVEIIFENHEKSM  437



>ref|XP_009773307.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   378 bits (970),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 187/299 (63%), Positives = 228/299 (76%), Gaps = 9/299 (3%)
 Frame = -2

Query  882  PVPFDW-PADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIA  706
            PVPFD  PADEF + +SDWY K H  ++KLL  GR++ RPNG+ IN K G   +K EP+ 
Sbjct  150  PVPFDVNPADEFFVLVSDWYTKSHSQMRKLLDSGRALGRPNGVIINGKSGKGDNKDEPMF  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM  GKTYR+R CNVG++ SIN R QGH MKLVE+EGSH VQN YDS+D+H+G C++VLV
Sbjct  210  TMTPGKTYRYRFCNVGMKDSINVRIQGHVMKLVEIEGSHTVQNMYDSLDVHLGQCMSVLV  269

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TAD++PKDY+LVA++RF KE +++ A I YA GKG           P+   G AWS+NQF
Sbjct  270  TADKDPKDYFLVASTRFTKEPHTATATIRYANGKGA----PASLELPKAPIGWAWSLNQF  325

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYGQI  TRTIKLV +      K+RYAINGVSHV+PETP+
Sbjct  326  RSFRWNLTASAARPNPQGSYHYGQINFTRTIKLVNAAGSVDGKLRYAINGVSHVNPETPI  385

Query  165  KLAEYFQVPEKVFKYDIMKDN--PPEDLT--KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEY+ V  KVFKYD++KD+   P   T  K+T+APNVVN T+RNFVEIIFENHEK++
Sbjct  386  KLAEYYGVANKVFKYDLIKDDYEAPTAKTEEKITLAPNVVNGTYRNFVEIIFENHEKSV  444



>ref|XP_004164922.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   378 bits (970),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 221/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LK+ L  GRSIARP+G+ IN K        EP+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTTLKQFLDSGRSIARPDGVLINGKTSKDDGIDEPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++RVCNVGL+TS+NFRFQGH+MKLVE+EGSH VQNDY S+D+HVG C +VLVT
Sbjct  211  MKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYKSLDVHVGQCFSVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDYY+VA++RF K       ++ Y  GKG        P  P    G AWS+NQFR
Sbjct  271  ADQEPKDYYMVASTRFIKSALVGKGIVRYTNGKG-----PASPEIPNAPMGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTASAARPNPQGSYHYG I ITRTIKLV S +    K+RYAINGVSHVDPETPLK
Sbjct  326  TFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSATKVDGKLRYAINGVSHVDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF++ +KVFKYD + D    E +T VTVAPNVVN T RNF+EIIFENHEK++
Sbjct  386  LAEYFEITDKVFKYDTISDEGLAEGVTTVTVAPNVVNTTFRNFIEIIFENHEKSL  440



>ref|XP_009803815.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=557

 Score =   377 bits (969),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 227/299 (76%), Gaps = 10/299 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD P D+F + ++DWY K H  LK LL  GR++ RP G+ IN K G    K EP+ T
Sbjct  150  PVPFDTPEDDFMVLVADWYTKSHTELKNLLDNGRALGRPQGVIINGKSGKGDGKDEPMYT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +  GKTYRFR CNVG++ SIN RFQGH+MKLVE+EGSH VQN Y+S+D+H+G C++VL+T
Sbjct  210  LTPGKTYRFRFCNVGMKDSINVRFQGHTMKLVEIEGSHTVQNVYESLDVHLGQCMSVLIT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+PKDY+LVA++RF KE + + A I YA GKG        P  P+   G AWS+NQFR
Sbjct  270  ADQDPKDYFLVASTRFTKEPHVATATIRYANGKG-----PASPELPKAPEGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKLV S  +   K+RYAINGVSHVDP TP+K
Sbjct  325  SFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGNVDGKLRYAINGVSHVDPATPIK  384

Query  162  LAEYFQVPEKVFKYDIMKDN-----PPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKYD++KD+       E   K+T+APNVVNAT+RNFVEIIFENH K++
Sbjct  385  LAEYYGVGDKVFKYDLIKDDYEPASGKEAQDKITLAPNVVNATYRNFVEIIFENHGKSV  443



>emb|CDY10549.1| BnaC03g70650D [Brassica napus]
Length=549

 Score =   377 bits (969),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 223/294 (76%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY  GH  LK  L  GR++  PNG+ IN K G VG K EP+ T
Sbjct  149  PVPYADPEDDYTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C +VLVT
Sbjct  209  MKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QE KDYY+VA++RF K+  S+V +I YAG        +     P+   G AWS+NQFR
Sbjct  269  ANQEAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASTELPKTPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITR+IKLV +K+    KVRY  NGVSHVD ETPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKNVVDGKVRYGFNGVSHVDTETPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ EKVFKYD++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  384  LAEYFQMAEKVFKYDVIKDEPAAQITALTVQPNVLNITFRTFVEIIFENHEKSM  437



>ref|XP_004164925.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   377 bits (968),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 222/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LK+ L  GRSIARP+G+ IN K        EP+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTALKQFLDSGRSIARPDGVLINGKTAKGDGTDEPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++RVCNVGL++S+NFRFQGH+MKLVE+EGSH VQNDY S+D+HVG C +VLVT
Sbjct  211  MKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K       ++ Y  GKG        P  PE   G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASTRFIKNVLVGKGIVRYIDGKG-----PASPEIPEAPMGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTASAARPNPQGSYHYG I ITRTIKLV S S    K+RYAINGVSHVDPETPLK
Sbjct  326  TFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSISKVDGKLRYAINGVSHVDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF+V +KVFKYD + D    E  T VTVAPNVVNAT RNF+EIIFENHEK++
Sbjct  386  LAEYFEVADKVFKYDTISDEGLAEGATTVTVAPNVVNATFRNFIEIIFENHEKSL  440



>gb|KFK35574.1| hypothetical protein AALP_AA4G008500 [Arabis alpina]
Length=555

 Score =   377 bits (969),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 221/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LKK L  GR+I RP+GI IN K G      +P+ T
Sbjct  152  PVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKAGKGDGSDQPLFT  211

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +++GKTYR R+CNVGL++S+NFR Q H M+LVE+EGSHV+QNDYDS+D+HVG C  V+VT
Sbjct  212  LKQGKTYRVRICNVGLKSSLNFRIQNHKMRLVEMEGSHVLQNDYDSLDVHVGQCYGVIVT  271

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDYY+ A++RF K   S+  L+ Y GGKG           P    G AWS+NQFR
Sbjct  272  ADQEPKDYYMAASTRFLKNALSTTGLLRYEGGKG-----PASSQLPAAPVGWAWSLNQFR  326

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH D ETPLK
Sbjct  327  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDSETPLK  386

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYDI+ DNP PE + K+ + PNV+N THR F+E+IFENHEK++
Sbjct  387  LAEYFGVADKVFKYDIISDNPTPEQIKKIKMEPNVLNITHRTFIEVIFENHEKSV  441



>ref|XP_009611384.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=557

 Score =   377 bits (968),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 186/299 (62%), Positives = 227/299 (76%), Gaps = 10/299 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD P D+F + ++DWY K H  LK LL  GR++ RP G+ IN K G    K EP+ T
Sbjct  150  PVPFDTPEDDFMVLVADWYTKSHTELKNLLDNGRALGRPQGVIINGKSGKGDGKDEPMYT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +  GKTYRFR CNVG++ SIN RFQGH+MKLVE+EGSH VQN Y+S+D+H+G C++VL+T
Sbjct  210  LTPGKTYRFRFCNVGMKDSINVRFQGHTMKLVEIEGSHTVQNVYESLDVHLGQCMSVLIT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+PKDY+LVA++RF KE + + A I YA GKG        P  P+   G AWS+NQFR
Sbjct  270  ADQDPKDYFLVASTRFTKEPHVATATIRYANGKG-----PASPQLPKAPEGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKLV S  +   K+RYAINGVSHVDP TP+K
Sbjct  325  SFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGNVDGKLRYAINGVSHVDPATPIK  384

Query  162  LAEYFQVPEKVFKYDIMKDN-----PPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKYD++KD+       E   K+T+APNVVNAT+RNFVEIIFENH K++
Sbjct  385  LAEYYGVGDKVFKYDLIKDDYEPASGKEAQDKITLAPNVVNATYRNFVEIIFENHGKSV  443



>ref|XP_009106861.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score =   377 bits (967),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 223/294 (76%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY  GH  LK  L  GR++  PNG+ IN K G VG K EP+ T
Sbjct  149  PVPYADPEDDYTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C +VLVT
Sbjct  209  MKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QE KDYY+VA++RF K+  S+V +I YAG        +     P+   G AWS+NQFR
Sbjct  269  ANQEAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASAELPKTPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLT++AARPNPQGSYHYG+I ITR+IKLV +KS    KVRY  NGVSHVD ETPLK
Sbjct  324  SFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNTKSFVDGKVRYGFNGVSHVDTETPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ EKVFKYD++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  384  LAEYFQMAEKVFKYDVIKDEPAAQITALTVQPNVLNITFRTFVEIIFENHEKSM  437



>ref|XP_009600426.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=549

 Score =   375 bits (963),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 186/296 (63%), Positives = 223/296 (75%), Gaps = 9/296 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD P +EF +F+SDWY K HK L+ +L EGRSI RP GI IN K+G    K EP+ +
Sbjct  148  PVPFDSPEEEFSVFVSDWYTKSHKTLRSILDEGRSIGRPEGIIINGKNGKGDGKDEPMFS  207

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M  GKTYR+R CNVG++ SIN RFQGH+MKLVE+EGSH VQN Y+S+D+H+G CL+VLVT
Sbjct  208  MVSGKTYRYRFCNVGMKDSINVRFQGHTMKLVEMEGSHTVQNMYESLDIHLGQCLSVLVT  267

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDY+LVA+SRF KE + + A I Y             P  P+   G  WS+NQFR
Sbjct  268  ADQEPKDYFLVASSRFTKEPHIATATIRYTNDPA-------SPELPKAPEGWEWSLNQFR  320

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTI+LV++      K RYAINGVSHVDP TP+K
Sbjct  321  SFRWNLTASAARPNPQGSYHYGQINITRTIRLVSTAGDVDGKRRYAINGVSHVDPTTPIK  380

Query  162  LAEYFQVPEKVFKYDIMKDN--PPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAE + V +KVFKYD++KD    P    K+T+APNVVNAT+RNFVEII ENHEK++
Sbjct  381  LAELYGVADKVFKYDLIKDEYIAPSGNEKITLAPNVVNATYRNFVEIILENHEKSV  436



>ref|XP_007157830.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
 gb|ESW29824.1| hypothetical protein PHAVU_002G101700g [Phaseolus vulgaris]
Length=547

 Score =   375 bits (963),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 181/292 (62%), Positives = 222/292 (76%), Gaps = 9/292 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  PADEF + + DW+ K H+ LK+ L  GRSI RP+G+ IN K+G     LEP  T
Sbjct  150  PVPYADPADEFWVLIGDWFGKSHQTLKQFLDSGRSIGRPSGVHINGKNGG----LEPAYT  205

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTY++R+CNVGL+ S+NFR QGHS+KLVE+EGSHVVQN YDS+D+HVG C +VLVT
Sbjct  206  MEPGKTYKYRICNVGLKDSLNFRIQGHSLKLVEMEGSHVVQNQYDSLDVHVGQCFSVLVT  265

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDYY+VA++RF K+T  +  +I Y+ G G        P  P    G AWS+NQFR
Sbjct  266  ADQEPKDYYMVASTRFAKKTLGATRIIRYSNGVG-----PASPELPPAPEGWAWSLNQFR  320

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKLV + S  G K+RY +NGVSHVDPETPLK
Sbjct  321  SFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTLSRTGGKLRYGLNGVSHVDPETPLK  380

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEK  7
            LAEY+ V ++VFKY+I+ D+P   +  +  APNV+NAT R+F+EIIFEN  K
Sbjct  381  LAEYYGVSDQVFKYNIISDDPASPIGDLACAPNVINATFRDFIEIIFENPTK  432



>gb|KGN54012.1| hypothetical protein Csa_4G267470 [Cucumis sativus]
Length=480

 Score =   373 bits (957),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 185/296 (63%), Positives = 222/296 (75%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEG-RSIARPNGITINAKHGSVGDKLEPIA  706
            PVP+  P D++ + + DWY K H  LK++L  G RSIARP G+ IN K        EP+ 
Sbjct  150  PVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEPLF  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM+  KTY++RVCNVGL+TS+NFRFQGH+MKLVE+EGSH VQNDY S+D+HVG C +VLV
Sbjct  210  TMKPEKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLV  269

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TA+QEPKDYY+VA++RF K       +I Y  GKG        P  P+   G AWS+NQF
Sbjct  270  TANQEPKDYYMVASTRFIKNVLIGKGIIRYTNGKG-----PASPEIPKAPMGWAWSLNQF  324

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            R+FRWNLTASAARPNPQGSYHYG I ITRTIKL  S +    K+RYAINGVSHVDPETPL
Sbjct  325  RTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHVDPETPL  384

Query  165  KLAEYFQVPEKVFKYDIMKD-NPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF++ EKVFKYD++ D  P E  T VT+APNVVNAT RNF+EIIFENHEK++
Sbjct  385  KLAEYFEIAEKVFKYDMISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSL  440



>emb|CDY56013.1| BnaA08g29220D [Brassica napus]
Length=549

 Score =   375 bits (962),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 223/294 (76%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY  GH  LK  L  GR++  PNG+ IN K G VG K EP+ T
Sbjct  149  PVPYADPEDDYTVLINDWYTSGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C +VLVT
Sbjct  209  MKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QE KDYY+VA++RF K+  S+V +I YAG        +     P+   G AWS+NQFR
Sbjct  269  ANQEAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASAELPKTPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLT++AARPNPQGSYHYG+I ITR+IKLV +K+    KVRY  NGVSHVD ETPLK
Sbjct  324  SFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNTKNVVDGKVRYGFNGVSHVDTETPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ EKVFKYD++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  384  LAEYFQMAEKVFKYDVIKDEPAAQITALTVQPNVLNITFRTFVEIIFENHEKSM  437



>ref|XP_004505353.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   374 bits (961),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 181/294 (62%), Positives = 219/294 (74%), Gaps = 9/294 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  PADE+ + + DW+ K H  LKK L  GRS+ RP+G+ I  K  SV    EP+ T
Sbjct  148  PVPYADPADEYWVLIGDWFGKSHTTLKKFLDSGRSMGRPDGVHIMGKSNSV----EPLYT  203

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTY++R+CNVGL+ ++NFR QGHSMKLVE+EGSH VQN YDS+D+HVG C +VLVT
Sbjct  204  MESGKTYKYRICNVGLKDTLNFRIQGHSMKLVEMEGSHTVQNMYDSLDVHVGQCYSVLVT  263

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDYYLVA++RF K   ++ A+I Y+ G G       P P         WS+NQ R
Sbjct  264  ADKEPKDYYLVASTRFTKNVLTTTAVIRYSNGVGPASPIIPPAPVGWA-----WSLNQLR  318

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKLV + S    K+RYAINGVSHVD ETPLK
Sbjct  319  SFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTASRVNGKLRYAINGVSHVDSETPLK  378

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKYDI+ D+PP  +T +T+APNV+NAT R F+EII EN  KTI
Sbjct  379  LAEYYGVADKVFKYDIISDDPPTVITDITLAPNVINATFRTFIEIILENPTKTI  432



>ref|XP_004149634.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   375 bits (962),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 221/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LK+ L  GRSIARP+G+ IN K        EP+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTTLKQFLDSGRSIARPDGVLINGKTSKDDGIDEPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++RVCNVGL++S+NFRFQGH+MKLVE+EGSH VQNDY S+D+HVG C +VLVT
Sbjct  211  MKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYKSLDVHVGQCFSVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K       ++ Y  GKG        P  P    G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASTRFIKSALVGKGIVRYTNGKG-----PASPEIPNAPMGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTASAARPNPQGSYHYG I ITRTIKLV S +    K+RYAINGVSHVDPETPLK
Sbjct  326  TFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSATKVDGKLRYAINGVSHVDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF++ +KVFKYD + D    E +T VTVAPNVVN T RNF+EIIFENHEK++
Sbjct  386  LAEYFEITDKVFKYDTISDEGLAEGVTTVTVAPNVVNTTFRNFIEIIFENHEKSL  440



>ref|XP_010034522.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52300.1| hypothetical protein EUGRSUZ_J01720 [Eucalyptus grandis]
Length=552

 Score =   375 bits (962),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 182/295 (62%), Positives = 222/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY+K HK LK  L  GRS+ARP+G+ IN K G      +P+ T
Sbjct  150  PVPYADPEDDYTVLIGDWYSKTHKQLKTFLDSGRSLARPDGVVINGKSGKGPGGDKPVFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NFR QGH MKLVE+EGSHVVQN Y+S+D+HVG C +VLVT
Sbjct  210  MKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEP+DYY+VA++RF KE  ++  ++ Y  GKG           P+   G AWS+NQFR
Sbjct  270  ADQEPRDYYMVASTRFTKEVITATRILRYTNGKG-----PASTVLPKAPEGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKLV S S  G K+RYAINGVSHV+P TPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSASRAGGKLRYAINGVSHVNPTTPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK-VTVAPNVVNATHRNFVEIIFENHEKTI  1
             AEYF   +KVFKYD++ D+PPE   K VT+ PNV N T R FVEIIFENHEK+I
Sbjct  385  FAEYFGTADKVFKYDVIPDSPPEQEPKLVTLEPNVGNITFRTFVEIIFENHEKSI  439



>ref|XP_010044910.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87033.1| hypothetical protein EUGRSUZ_B03580 [Eucalyptus grandis]
Length=551

 Score =   374 bits (961),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 222/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY+K H  L K L  GR++ RP+G+ IN K      K EP+ T
Sbjct  149  PVPYADPEDDYTVLIGDWYSKSHTTLHKFLDSGRALGRPDGVLINGKSSKSKGKEEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NFR QGH MKLVE+EGSH +QN YDS+D+HVG C AVLVT
Sbjct  209  MKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGSHTIQNSYDSLDVHVGQCFAVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDYY+VA++R+ K   ++ A+ISY  GKG        P  PE   G AW++NQFR
Sbjct  269  ADKEPKDYYMVASTRYTKTVLTTTAVISYTNGKG-----PASPVLPEAPVGWAWTLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKLV S S EG K+RYAING+SH +P TPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSASREGGKLRYAINGISHANPATPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLT-KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +K+FKYD M D+ P   + K+TV PNV N T+R FVE+IFENHEK+I
Sbjct  384  LAEYYGVADKIFKYDTMSDDAPATASDKITVEPNVANITYRTFVEVIFENHEKSI  438



>ref|XP_008449912.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Cucumis melo]
Length=554

 Score =   375 bits (962),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 185/296 (63%), Positives = 222/296 (75%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEG-RSIARPNGITINAKHGSVGDKLEPIA  706
            PVP+  P D++ + + DWY K H  LK++L  G RSIARP G+ IN K        EP+ 
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEPLF  210

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM+ GKTY++RVCNVGL+TS+NFRFQGH+MKLVE+EGSH VQNDY S+D+HVG C +VLV
Sbjct  211  TMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLV  270

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TA+QEPKDYY+VA++RF K       +I Y  GKG        P  P+   G AWS+NQF
Sbjct  271  TANQEPKDYYMVASTRFIKNVIIGKGIIRYTNGKG-----PASPEIPKAPMGWAWSLNQF  325

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            R+FRWNLTASAARPNPQGSYHYG I ITRTIKL  S +    K+RYAINGVSH+DPETPL
Sbjct  326  RTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHIDPETPL  385

Query  165  KLAEYFQVPEKVFKYDIMKD-NPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF + +KVFKYDI+ D  P E  T VT+APNVVNAT RNF+EIIFENHEK++
Sbjct  386  KLAEYFGIADKVFKYDIISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSL  441



>ref|XP_006392621.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
 gb|ESQ29907.1| hypothetical protein EUTSA_v10011364mg [Eutrema salsugineum]
Length=553

 Score =   374 bits (961),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 220/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ I ++DWY K H  LKK L  GR+I RP+GI IN K G      +P+ T
Sbjct  150  PVPYADPEDDYTILINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKAGKGDGSDQPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +++GKTYR R+CNVGL+ S+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C  VLVT
Sbjct  210  LKQGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K   ++  L+ Y GGKG           P    G AWS+NQFR
Sbjct  270  ANQEPKDYYMVASTRFLKNALTTTGLLRYEGGKG-----PASSQLPAAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA++GVSH DPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALSGVSHTDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK-VTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYD + DNP  D  K + + PNV+N THRNF+EI+FENHE+++
Sbjct  385  LAEYFGVVDKVFKYDSISDNPTSDQIKNIKIEPNVLNITHRNFIEIVFENHERSV  439



>gb|AFK33666.1| unknown [Lotus japonicus]
Length=467

 Score =   372 bits (954),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 184/294 (63%), Positives = 217/294 (74%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K HK LK LL  GRSI RPNG+ IN K        +P+ T
Sbjct  148  PVPYPDPEDEYWVIIGDWYAKSHKTLKSLLDSGRSIGRPNGVLINGKTAKGDGSDQPLYT  207

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NFR QGH MKLVE EGSHVVQN YDS+D+HVG C  VLVT
Sbjct  208  MKPGKTYKYRICNVGLKDSLNFRIQGHPMKLVETEGSHVVQNTYDSLDVHVGQCYTVLVT  267

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDYYLVA++RF K + +   +I Y  G G        P  P    G AWS+NQFR
Sbjct  268  ADKDPKDYYLVASTRFTKYSLTGKGIIRYTNGVG-----PASPELPPAPVGWAWSLNQFR  322

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNP+GSYHYGQI ITRTIKLV + S    K+RYAINGVSHVD ETPLK
Sbjct  323  SFRWNLTASAARPNPRGSYHYGQINITRTIKLVNTVSKAQGKLRYAINGVSHVDGETPLK  382

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKY+I+ D PP DL  +T+APNVVNAT R F+EIIFEN  KT+
Sbjct  383  LAEYFGVADKVFKYNIISDEPPADLNTITLAPNVVNATFRTFIEIIFENPGKTV  436



>ref|XP_008449913.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Cucumis melo]
Length=554

 Score =   374 bits (961),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 185/296 (63%), Positives = 222/296 (75%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEG-RSIARPNGITINAKHGSVGDKLEPIA  706
            PVP+  P D++ + + DWY K H  LK++L  G RSIARP G+ IN K        EP+ 
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEPLF  210

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM+ GKTY++RVCNVGL+TS+NFRFQGH+MKLVE+EGSH VQNDY S+D+HVG C +VLV
Sbjct  211  TMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLV  270

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TA+QEPKDYY+VA++RF K       +I Y  GKG        P  P+   G AWS+NQF
Sbjct  271  TANQEPKDYYMVASTRFIKNVIIGKGIIRYTNGKG-----PASPEIPKAPMGWAWSLNQF  325

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            R+FRWNLTASAARPNPQGSYHYG I ITRTIKL  S +    K+RYAINGVSH+DPETPL
Sbjct  326  RTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHIDPETPL  385

Query  165  KLAEYFQVPEKVFKYDIMKD-NPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF + +KVFKYDI+ D  P E  T VT+APNVVNAT RNF+EIIFENHEK++
Sbjct  386  KLAEYFGIADKVFKYDIISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSL  441



>gb|KFK35575.1| hypothetical protein AALP_AA4G008600 [Arabis alpina]
Length=549

 Score =   374 bits (960),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 219/294 (74%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L DWY  GH  LK LL  GR++  PNG+ IN K G VG   EP+ T
Sbjct  149  PVPYADPEDDYTVILGDWYTSGHTALKNLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M  GKTY++R+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  209  MNPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q  KDYY+VA++RF K+  S+V +I YAG        +     P+   G AWS+NQFR
Sbjct  269  ANQAAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASSELPKTPIGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITR+IKLV SKS    K R+  NGVSHVD +TPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGRINITRSIKLVNSKSSVNGKTRFGFNGVSHVDTDTPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ EKVFKY+++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  384  LAEYFQMSEKVFKYNVIKDEPASKITTLTVQPNVLNITFRTFVEIIFENHEKSM  437



>ref|XP_002894511.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70770.1| hypothetical protein ARALYDRAFT_474617 [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   374 bits (960),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 220/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L DWY  GH  LK  L  GR++  PNG+ IN K G VG K EP+ T
Sbjct  149  PVPYADPEDDYTVLLGDWYTAGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C +VLVT
Sbjct  209  MKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  KDYY+VA++RF K+  S+V +I Y G        +     P+   G AWS+NQFR
Sbjct  269  ADQAAKDYYMVASTRFLKKELSTVGVIRYEGSN-----VQASAELPKAPIGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITR+IKLV SKS    KVR+  NGVSHVD ETPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ EKVFKY+++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  384  LAEYFQMSEKVFKYNVIKDEPAAKITALTVQPNVLNITFRTFVEIIFENHEKSM  437



>ref|XP_006392622.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
 gb|ESQ29908.1| hypothetical protein EUTSA_v10011369mg [Eutrema salsugineum]
Length=549

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 220/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L DWY  GH  LK  L  GR++  PNG+ IN K G VG   EP+ T
Sbjct  149  PVPYADPEDDYTVLLGDWYTSGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGNNEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C +VLVT
Sbjct  209  MKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  KDYY+VA++RF K+  S+V +I YAG        +     P+   G AWS+NQFR
Sbjct  269  ADQAAKDYYMVASTRFLKKELSTVGVIRYAGSN-----VQASAELPKAPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITR+IKLV+SK+    KVR+  N VSHVD ETPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGKINITRSIKLVSSKNMVNGKVRFGFNSVSHVDTETPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ EKVFKY+++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  384  LAEYFQMAEKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSM  437



>ref|XP_004164924.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/296 (63%), Positives = 222/296 (75%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEG-RSIARPNGITINAKHGSVGDKLEPIA  706
            PVP+  P D++ + + DWY K H  LK++L  G RSIARP G+ IN K        EP+ 
Sbjct  150  PVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEPLF  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM+  KTY++RVCNVGL+TS+NFRFQGH+MKLVE+EGSH VQNDY S+D+HVG C +VLV
Sbjct  210  TMKPEKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLV  269

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TA+QEPKDYY+VA++RF K       +I Y  GKG        P  P+   G AWS+NQF
Sbjct  270  TANQEPKDYYMVASTRFIKNVLIGKGIIRYTNGKG-----PASPEIPKAPMGWAWSLNQF  324

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            R+FRWNLTASAARPNPQGSYHYG I ITRTIKL  S +    K+RYAINGVSHVDPETPL
Sbjct  325  RTFRWNLTASAARPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHVDPETPL  384

Query  165  KLAEYFQVPEKVFKYDIMKD-NPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF++ EKVFKYD++ D  P E  T VT+APNVVNAT RNF+EIIFENHEK++
Sbjct  385  KLAEYFEIAEKVFKYDMISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSL  440



>ref|XP_010462411.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 221/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + L DWY  GH  LK LL  GR++  PNG+ IN K G VG   EP+ T
Sbjct  149  PVPYADPEDEYTVLLGDWYTTGHTALKNLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+  KTY++R+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C +VLVT
Sbjct  209  MKPRKTYKYRLCNVGFKSTLNFRIQNHMMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q  KDYY+VA++RF K+  S+V +I Y G        +     P+   G AWS+NQFR
Sbjct  269  ANQAAKDYYMVASTRFLKKELSTVGVIRYEGSN-----VQASTELPKAPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITR+IKLV +KS    K+R+ +NGVSHVDPETPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLRFGLNGVSHVDPETPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ EKVFKY+++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  384  LAEYFQMAEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIIFENHEKSM  437



>emb|CDY23596.1| BnaC05g39980D [Brassica napus]
Length=555

 Score =   373 bits (958),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 219/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GR+I RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVGL+TSINFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C   +VT
Sbjct  211  LKPGKTYRVRICNVGLKTSINFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGTIVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+R+A+NGVSH DPETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRFALNGVSHTDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYD + D+P PE +  + + PNV+N THRNF+E++FENHEK++
Sbjct  386  LAEYFGISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITHRNFIEVVFENHEKSV  440



>ref|XP_007208287.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
 gb|EMJ09486.1| hypothetical protein PRUPE_ppa003715mg [Prunus persica]
Length=554

 Score =   373 bits (958),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 182/295 (62%), Positives = 225/295 (76%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY KGH  LKK L  GRS+ARP+G+ IN K      K EP+ T
Sbjct  150  PVPYADPEDDYTVLIGDWYAKGHTALKKHLDSGRSMARPDGVIINGKSAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NFR QGH MKLVE+EGSH VQN Y+S+D+HVG C +VLVT
Sbjct  210  MKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGSHTVQNTYESLDVHVGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDYY+VA++RF K+  +   ++ Y  G G        P  PE   G AWS+NQFR
Sbjct  270  ADKDPKDYYMVASTRFTKKVLTGKGIMRYENGNG-----PASPELPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRT+K+V S +    K+RYAINGVSHVDPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTLKIVNSATKVDGKLRYAINGVSHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLT-KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKYD ++D+PP  +  KVT+APNVVN T RNFVEIIFENHEK+I
Sbjct  385  LAEYYGVADKVFKYDTIQDDPPATVEDKVTLAPNVVNQTFRNFVEIIFENHEKSI  439



>ref|NP_175953.1| protein SKU5 similar 12 [Arabidopsis thaliana]
 gb|AAK32912.1|AF367325_1 At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AAD10638.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM91432.1| At1g55570/T5A14_1 [Arabidopsis thaliana]
 gb|AEE33267.1| protein SKU5 similar 12 [Arabidopsis thaliana]
Length=555

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 220/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ I ++DWY K H  LKK L  GR+I RP+GI IN K G      +P+ T
Sbjct  152  PVPYADPEDDYTILINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKSGKTDGSDKPLFT  211

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVGL+ S+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C  V+VT
Sbjct  212  LKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVT  271

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDYY++A++RF K+  ++  L+ Y GGKG           P    G AWS+NQ+R
Sbjct  272  ADQEPKDYYMIASTRFLKKPLTTTGLLRYEGGKG-----PASSQLPAAPVGWAWSLNQYR  326

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA++GVSH DPETPLK
Sbjct  327  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETPLK  386

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYD + DNP P+ +  + + PNV+N THR F+E++FENHE+++
Sbjct  387  LAEYFGVADKVFKYDTISDNPNPDQIKNIKIEPNVLNITHRTFIEVVFENHERSV  441



>ref|XP_004502172.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=545

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 222/294 (76%), Gaps = 9/294 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWYNKGHK LK +L  GRSI RP+G+ +N K        EP+ T
Sbjct  148  PVPYPDPEDEYWVIIGDWYNKGHKTLKMMLDSGRSIGRPDGVIMNGK----ATNEEPLYT  203

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ ++NFRFQGH+MKLVE EGSHVVQ+ YDS+D+HVG C  VLVT
Sbjct  204  MKPGKTYKYRICNVGLKDALNFRFQGHAMKLVETEGSHVVQSFYDSLDVHVGQCYTVLVT  263

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDYY+VA++RF K T+++  +I Y  G G           P    G AWS+NQFR
Sbjct  264  ADKDPKDYYMVASTRFTKYTHTATGIIRYTNGAG-----PASNVLPPAPVGWAWSLNQFR  318

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKLV S +    K+RYAINGVSHVD ETPLK
Sbjct  319  SFRWNLTASAARPNPQGSYHYGQINITRTIKLVNSVAKVDGKLRYAINGVSHVDGETPLK  378

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKY+I+ D PP DLT +T+APNV+NAT R F+E+I EN  K+I
Sbjct  379  LAEYYGVADKVFKYNIIGDEPPADLTAITIAPNVINATFRTFIEVILENSGKSI  432



>gb|AAD10639.1| putative pollen specific protein [Arabidopsis thaliana]
Length=558

 Score =   373 bits (957),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 220/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L DWY  GH  LK  L  GR++  PNG+ IN K G VG K EP+ T
Sbjct  158  PVPYADPEDDYTVLLGDWYTAGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFT  217

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C +VLVT
Sbjct  218  MKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVIQNDYDSLDVHVGQCFSVLVT  277

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q  KDYY+VA++RF K+  S+V +I Y G        +     P+   G AWS+NQFR
Sbjct  278  ANQAAKDYYMVASTRFLKKELSTVGVIRYEGSN-----VQASTELPKAPVGWAWSLNQFR  332

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLT++AARPNPQGSYHYG+I ITR+IKLV SKS    KVR+  NGVSHVD ETPLK
Sbjct  333  SFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETPLK  392

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ EKVFKY+++KD P   +T +TV PNV+N T R FVEIIFENHEKT+
Sbjct  393  LAEYFQMSEKVFKYNVIKDEPAAKITALTVQPNVLNITFRTFVEIIFENHEKTM  446



>ref|XP_006345828.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=552

 Score =   372 bits (956),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 219/296 (74%), Gaps = 6/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+F + +SDWY   HK LK LL  GRS+ RP+GI IN K G    K EP+ T
Sbjct  148  PVPFDTPADDFTVLVSDWYTNSHKSLKGLLDTGRSLGRPDGIVINGKSGKGDGKDEPMFT  207

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M KGKTYRFR CNVG++ +IN R QGH+MKLVE+EGSH VQN Y+ +D+H+G CL+VL+T
Sbjct  208  MVKGKTYRFRFCNVGMKDTINVRIQGHTMKLVEMEGSHTVQNLYELLDIHLGQCLSVLIT  267

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ PKDY++VATSRF KE+  + A I YA GKG       P    E   G  WS+NQF 
Sbjct  268  ADQNPKDYFIVATSRFTKESRVATATIRYANGKG----PASPLEKKEAPEGWEWSLNQFN  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTAS+ARPNPQGSYHYGQI ITRTI+LV++      K RYAINGVSH DPETP+K
Sbjct  324  SFRWNLTASSARPNPQGSYHYGQINITRTIRLVSTAGVVNGKHRYAINGVSHTDPETPIK  383

Query  162  LAEYFQVPEKVFKYDIMKDN--PPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LA+Y+ V +KVFKY + KD   PP     +T+APNVVN T+RNFVEII ENHEK++
Sbjct  384  LAQYYGVADKVFKYGLCKDEYIPPSGNEVITIAPNVVNVTYRNFVEIILENHEKSV  439



>ref|XP_010501174.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=549

 Score =   372 bits (954),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 219/294 (74%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + L DWY  GH  LK LL  GR++  PNG+ IN K G VG   EP+ T
Sbjct  149  PVPYAAPEDEYTVLLGDWYTTGHTALKNLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C +VLVT
Sbjct  209  MKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q  KDYY+VA++RF K+   +V +I Y G        +     P+   G AWS+NQFR
Sbjct  269  ANQAAKDYYMVASTRFLKKELGTVGVIRYEGSN-----VQASTKLPKAPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITR+IKLV +KS    K+R+  NGVSHVD ETPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLRFGFNGVSHVDTETPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ EKVFKY+++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  384  LAEYFQMAEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIIFENHEKSM  437



>ref|XP_006306349.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
 gb|EOA39247.1| hypothetical protein CARUB_v10012235mg [Capsella rubella]
Length=555

 Score =   372 bits (955),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 173/295 (59%), Positives = 221/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LKK L  GR++ RP+GI IN K G      +P+ T
Sbjct  152  PVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKTDGSDKPLFT  211

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVGL+TS+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C  V+VT
Sbjct  212  LKPGKTYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVT  271

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QE KDYY+VA++RF K+  ++  L+ Y GGKG           P    G AWS+NQFR
Sbjct  272  ANQEAKDYYMVASTRFLKKPLTTTGLLRYEGGKG-----PASSQLPAAPVGWAWSLNQFR  326

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA++GVSH DPETPLK
Sbjct  327  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYAMSGVSHTDPETPLK  386

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKY+I+ DNP PE +  + + PNV+N THR F+E++FENHEK++
Sbjct  387  LAEYFGVADKVFKYNIITDNPNPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSV  441



>ref|NP_564697.1| SKU5 similar 14 [Arabidopsis thaliana]
 emb|CAB59910.1| BNH protein [Arabidopsis thaliana]
 dbj|BAC43197.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64845.1| At1g55560 [Arabidopsis thaliana]
 gb|AEE33266.1| SKU5 similar 14 [Arabidopsis thaliana]
Length=549

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 220/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L DWY  GH  LK  L  GR++  PNG+ IN K G VG K EP+ T
Sbjct  149  PVPYADPEDDYTVLLGDWYTAGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C +VLVT
Sbjct  209  MKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVIQNDYDSLDVHVGQCFSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q  KDYY+VA++RF K+  S+V +I Y G        +     P+   G AWS+NQFR
Sbjct  269  ANQAAKDYYMVASTRFLKKELSTVGVIRYEGSN-----VQASTELPKAPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLT++AARPNPQGSYHYG+I ITR+IKLV SKS    KVR+  NGVSHVD ETPLK
Sbjct  324  SFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNSKSVVDGKVRFGFNGVSHVDTETPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ EKVFKY+++KD P   +T +TV PNV+N T R FVEIIFENHEKT+
Sbjct  384  LAEYFQMSEKVFKYNVIKDEPAAKITALTVQPNVLNITFRTFVEIIFENHEKTM  437



>ref|XP_010480096.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010480097.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=549

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 220/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + L DWY  GH  LK LL  GR++  PNG+ IN K G VG   EP+ T
Sbjct  149  PVPYADPEDEYTVLLGDWYTTGHTALKSLLDSGRTLGLPNGVLINGKSGKVGGNNEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C +VLVT
Sbjct  209  MKPGKTYKYRLCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q  KDYY+VA++RF K+  S+V +I Y G        +     P+   G AWS+NQFR
Sbjct  269  ANQAAKDYYMVASTRFLKKELSTVGVIRYEGSN-----VQASAELPKAPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITR+IKLV +KS    K+R+  NGVSHVD ETPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTKSMVDGKLRFGFNGVSHVDTETPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ +KVFKY+++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  384  LAEYFQMADKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSM  437



>ref|XP_010462412.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 220/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LKK L  GR++ RP+GI IN K G      +P+ T
Sbjct  152  PVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKTDGSDKPLFT  211

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVGL+ S+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C  V+VT
Sbjct  212  LKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDIHVGQCFGVIVT  271

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K+  ++  L+ Y GGKG           P    G AWS+NQFR
Sbjct  272  ANQEPKDYYMVASTRFLKKPLTTTGLLRYEGGKG-----PASSQLPAAPVGWAWSLNQFR  326

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA++GVSH DPETPLK
Sbjct  327  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETPLK  386

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYD + DNP P+ +  + + PNV+N THR F+E++FENHEK++
Sbjct  387  LAEYFGVTDKVFKYDSISDNPNPDQIKTIKIEPNVLNITHRTFIEVVFENHEKSV  441



>ref|XP_010501175.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 220/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LKK L  GR++ RP+GI IN K G      +P+ T
Sbjct  152  PVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKTDGSDKPLFT  211

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVGL+ S+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C  V+VT
Sbjct  212  LKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDIHVGQCFGVIVT  271

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K+  ++  L+ Y GGKG           P    G AWS+NQFR
Sbjct  272  ANQEPKDYYMVASTRFLKKPLTTTGLLLYEGGKG-----PASSQLPAAPVGWAWSLNQFR  326

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA++GVSH DPETPLK
Sbjct  327  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETPLK  386

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYD + DNP P+ +  + + PNV+N THR F+E++FENHEK++
Sbjct  387  LAEYFGVTDKVFKYDSISDNPNPDQIKTIKIEPNVLNITHRTFIEVVFENHEKSV  441



>ref|XP_002303974.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE78953.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/296 (60%), Positives = 227/296 (77%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L+DWY+K H  L+KLL  GR++ARP+G+ +N K+     K EP+ T
Sbjct  150  PVPYADPEDDYTVILNDWYSKSHTALQKLLDSGRTLARPDGVLVNGKNAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CN GL+ ++NFR QGH+MKLVE+EGSHVVQN Y+S+D+HVG C +VLVT
Sbjct  210  MKPGKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q+PKDYY+VA++RF K+  +   +I Y  GKG        P  PE   G AWS+NQFR
Sbjct  270  ANQDPKDYYMVASTRFNKQVLTGKGIIRYTNGKG-----PASPELPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I ITRTIKL+ S S EG K+RYA+NGVSHV+PETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGSINITRTIKLINSASQEGGKLRYALNGVSHVNPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL--TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKYD + D+P  ++   K+   PNV+N T RNFVEIIFENHEK++
Sbjct  385  LAEYYGVADKVFKYDTILDSPQANVANAKIVTQPNVLNLTFRNFVEIIFENHEKSM  440



>ref|XP_002523381.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38960.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 220/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L+DWY K HK L+  L  GRS+ RP+G+ IN K+     K EP+ T
Sbjct  150  PVPYPDPEDDYTVVLNDWYTKSHKSLRTFLDSGRSLGRPDGVLINGKNAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+  KTY++RVCN G++TS+NFR QGH MKLVE+EGSHVVQN Y+S+D+HVG CL+VLV 
Sbjct  210  MKPDKTYKYRVCNAGIKTSLNFRIQGHEMKLVEMEGSHVVQNVYESLDVHVGQCLSVLVR  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q PKDYY+VA++RF K   ++  +I Y  GKG        P  PE   G AWS+NQFR
Sbjct  270  ANQAPKDYYMVASTRFMKTVQTAKGIIRYTNGKG-----PASPELPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I ITRTIKLV S S  G K+RYAINGVSH D ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSPSRAGGKLRYAINGVSHTDTETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ + +KVFKYD +KD+PP  +T+V   PNV+N T RNFVEIIFEN EK+I
Sbjct  385  LAEYYGIADKVFKYDTIKDDPPPKITEVVTQPNVLNMTFRNFVEIIFENPEKSI  438



>emb|CAA47177.1| Bplo [Brassica napus]
Length=555

 Score =   370 bits (950),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/295 (59%), Positives = 220/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DW+ K H  LKK L  GR+I RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVG++TS+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C   +VT
Sbjct  211  LKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K+  ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH +PETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYDI+ DNP PE +  + + PNV+N THR FVE++FENHEK++
Sbjct  386  LAEYFGITDKVFKYDIITDNPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSV  440



>ref|XP_002891844.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68103.1| hypothetical protein ARALYDRAFT_892557 [Arabidopsis lyrata subsp. 
lyrata]
Length=555

 Score =   370 bits (950),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 219/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LKK L  GR+I RP+GI IN K G      +P+ T
Sbjct  152  PVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKSGKTDGSDKPLFT  211

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVGL+ S+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C  V+VT
Sbjct  212  LKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVT  271

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQE KDYY+VA++RF K+  ++  L+ Y GGKG           P    G AWS+NQFR
Sbjct  272  ADQELKDYYMVASTRFLKKPLTTTGLLRYEGGKG-----PASSQLPAAPVGWAWSLNQFR  326

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA++GVSH DPETPLK
Sbjct  327  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETPLK  386

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYD + DNP P+ +  + + PNV+N THR F+E++FENHE+++
Sbjct  387  LAEYFGVADKVFKYDTISDNPNPDQIKNIKIEPNVLNITHRTFIEVVFENHERSV  441



>ref|XP_010480098.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=555

 Score =   370 bits (950),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/295 (59%), Positives = 219/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LKK L  GR++ RP+GI IN K G      +P+ T
Sbjct  152  PVPYADPEDDYTVLINDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKTDGSDKPLFT  211

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVGL+ S+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C  V+VT
Sbjct  212  LKPGKTYRVRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDIHVGQCFGVIVT  271

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K+  ++  L+ Y GGKG           P    G AWS+NQFR
Sbjct  272  ANQEPKDYYMVASTRFLKKPLTTTGLLRYEGGKG-----PASSQLPAAPVGWAWSLNQFR  326

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA++GVSH DPETPLK
Sbjct  327  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALSGVSHTDPETPLK  386

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK-VTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYD + DNP  D  K + + PNV+N THR F+E++FENHEK++
Sbjct  387  LAEYFGVTDKVFKYDSISDNPNADQIKTIKIEPNVLNITHRTFIEVVFENHEKSV  441



>ref|XP_006407227.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
 gb|ESQ48680.1| hypothetical protein EUTSA_v10020444mg [Eutrema salsugineum]
Length=551

 Score =   370 bits (949),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 221/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LK  L  GR++  P+G+ IN K G VG   EP+ T
Sbjct  150  PVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGNNEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  210  MKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVIQNDYDSLDVHVGQCFAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        +     P+   G AWS+NQFR
Sbjct  270  ADQVAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQASNELPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  +K+    KVR+ +NGVSHVDPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGLNGVSHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + EKVFKY+++KD P   +T + V PNV+N T R FVEI+FENHEK++
Sbjct  385  LAEYFGLAEKVFKYNVIKDEPAAKITTLVVEPNVLNITFRTFVEIVFENHEKSM  438



>ref|XP_002299087.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE83892.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=551

 Score =   369 bits (948),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 222/294 (76%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L+DWY   H  L+K L +GRS+ARP G+ IN K+     K EP+ T
Sbjct  150  PVPYADPEDDYTVILNDWYTSSHATLRKYLDDGRSLARPTGVLINGKNAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CN G++ ++NFR QGH+MKLVE+EGSHVVQN Y+++D+HVG C +VLVT
Sbjct  210  MKPGKTYKYRICNAGIKNTLNFRIQGHTMKLVEMEGSHVVQNVYEALDVHVGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q PKDYY+V T+RF K+  ++  +I Y  GKG        P  PE   G AWS+NQFR
Sbjct  270  ANQAPKDYYMVTTTRFNKQILTAKGIIRYTNGKG-----PASPELPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I ITRTIKLV S S EG K+RYA+NGVSHVDPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            +AEY+ + +KVFKY+ +KD P   + KV   PNV+N T RNFVEIIFENHEK++
Sbjct  385  IAEYYGIADKVFKYNTIKDMPSAKIGKVVTQPNVLNQTFRNFVEIIFENHEKSM  438



>gb|AFC88081.1| skewed-like protein [Brassica rapa subsp. oleifera]
Length=555

 Score =   369 bits (948),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 175/295 (59%), Positives = 218/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GR+I RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVGL+TSINFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C   +VT
Sbjct  211  LKPGKTYRVRICNVGLKTSINFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGTIVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+R+A+NGVSH +PETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRFALNGVSHTEPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYD + D+P PE +  + + PNV+N THR FVE++FENHEK++
Sbjct  386  LAEYFGISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSV  440



>ref|XP_002297609.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE82414.2| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=553

 Score =   369 bits (948),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 179/296 (60%), Positives = 225/296 (76%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L+DWY K H  L+KLL  GRS+ARP+G+ IN K+     K EP+ T
Sbjct  150  PVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLINGKNAMGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+  KTY++R+CN GL+ ++NFR Q H+MKLVE+EGSHVVQN Y+S+D+HVG C +VLVT
Sbjct  210  MKPEKTYKYRICNAGLKNTLNFRIQDHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q PKDYY+VA++RF K+  ++  +I Y  GKG        P  PE   G AWS+NQFR
Sbjct  270  ANQAPKDYYMVASTRFNKQVLTAKGIIRYTNGKG-----PASPELPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I ITRTIKLV S S EG K+RYA+NGVSHVDPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL--TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            +AEY+ V +K+FKYD M+D+P  D+   K+   PNV+N T RNFVEIIFENHEK++
Sbjct  385  IAEYYGVADKLFKYDTMQDSPQADIAHAKIVSQPNVLNLTFRNFVEIIFENHEKSM  440



>gb|KFK38673.1| hypothetical protein AALP_AA3G145200 [Arabis alpina]
Length=551

 Score =   369 bits (948),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 222/294 (76%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P ++  I ++DWY K H  LK  L  GR++  P+G+ IN K G VG K EP+ T
Sbjct  150  PVPYADPEEDHTILINDWYTKSHTALKNFLDSGRTLGLPDGVLINGKSGKVGGKNEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTY+FR+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  210  LKPGKTYKFRICNVGFKSTLNFRVQGHKMKLVEMEGSHVLQNDYDSLDIHVGQCFAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S++ ++SYAG K      E     P+   G AWS+NQFR
Sbjct  270  ADQTAKNYYMVASTRFLKKEVSTIGVMSYAGSK-----VEASAVIPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  +K+    K+R+  NGVSHVD ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNMVDGKIRFGFNGVSHVDTETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + EK+FKY+++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  385  LAEYFGMAEKIFKYNVIKDEPAAKITTLTVEPNVLNVTFRTFVEIIFENHEKSM  438



>ref|XP_011048127.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=537

 Score =   369 bits (946),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 226/296 (76%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L+DWY K H  L+KLL  GRS+ARP+G+ IN K+     K EP+ T
Sbjct  134  PVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLINGKNAMGDGKDEPLFT  193

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+  KTY++R+CN GL+ ++NFR QGH+MKLVE+EGSHVVQN Y+S+D+HVG C +VLVT
Sbjct  194  MKPEKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVT  253

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q PKDYY++A++RF K+  + + +I Y  GKG        P  PE   G AWS+NQFR
Sbjct  254  ANQAPKDYYMMASTRFNKQVLTYMGIIRYTNGKG-----PASPEFPEAPVGWAWSLNQFR  308

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I ITRTIKLV S S EG K+RYA+NGVSHVDPETPLK
Sbjct  309  SFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHVDPETPLK  368

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL--TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            +AEY+ V +K+FKYD M+D+P  ++   K+   PNV+N T RNFVEIIFENHEK++
Sbjct  369  IAEYYGVADKLFKYDTMQDSPQANIAHAKIVSQPNVLNLTFRNFVEIIFENHEKSM  424



>ref|XP_011048126.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
Length=553

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 226/296 (76%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L+DWY K H  L+KLL  GRS+ARP+G+ IN K+     K EP+ T
Sbjct  150  PVPYADPEDDYTVVLNDWYTKSHTALQKLLDSGRSLARPDGVLINGKNAMGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+  KTY++R+CN GL+ ++NFR QGH+MKLVE+EGSHVVQN Y+S+D+HVG C +VLVT
Sbjct  210  MKPEKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q PKDYY++A++RF K+  ++  +I Y  GKG        P  PE   G AWS+NQFR
Sbjct  270  ANQAPKDYYMMASTRFNKQVLTAKGIIRYTNGKG-----PASPEFPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I ITRTIKLV S S EG K+RYA+NGVSHVDPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYALNGVSHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL--TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            +AEY+ V +K+FKYD M+D+P  ++   K+   PNV+N T RNFVEIIFENHEK++
Sbjct  385  IAEYYGVADKLFKYDTMQDSPQANIAHAKIVSQPNVLNLTFRNFVEIIFENHEKSM  440



>gb|KGN54013.1| hypothetical protein Csa_4G267480 [Cucumis sativus]
Length=476

 Score =   366 bits (940),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 186/315 (59%), Positives = 223/315 (71%), Gaps = 26/315 (8%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LK+ L  GRSIARP+G+ IN K        EP+ T
Sbjct  127  PVPYADPEDDYTVLIGDWYTKSHTALKQFLDSGRSIARPDGVLINGKSAKGDGTDEPLFT  186

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++RVCNVGL++S+NFRFQGH+MKLVE+EGSH VQNDY+S+D+HVG C +VLVT
Sbjct  187  MKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYESLDVHVGQCFSVLVT  246

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K       ++ Y  GKG        P  PE   G AWS+NQFR
Sbjct  247  ANQEPKDYYMVASTRFIKSILVGKGIVRYTDGKG-----PASPEIPEAPMGWAWSLNQFR  301

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTASAARPNPQGSYHYG I ITRTIKLV S S    K+RYAINGVSHVDPETPLK
Sbjct  302  TFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSISKVDGKLRYAINGVSHVDPETPLK  361

Query  162  --------------------LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATH  46
                                LAEYF+V +KVFKYD + D    E  T VTVAPNVVNAT 
Sbjct  362  LAEYFEIAATALKYDNPTIMLAEYFEVADKVFKYDTISDEGLAEGATTVTVAPNVVNATF  421

Query  45   RNFVEIIFENHEKTI  1
            RNF+EI+FENHEK++
Sbjct  422  RNFIEIVFENHEKSL  436



>ref|XP_008219577.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   369 bits (946),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/294 (62%), Positives = 221/294 (75%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DW+ K H  LKKLL  GRS+ARP+G+ IN K      K EP+  
Sbjct  150  PVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMARPDGVLINGKSSKGDGKDEPLFV  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ ++NFR QGHSMKLVELEGSH VQN YDSMD+H+G C +VLVT
Sbjct  210  MKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDYY+VA++RF K   +   +I Y  GKG        P  P+   G AWS+NQFR
Sbjct  270  ADKDPKDYYMVASTRFTKSVLTGKGIIRYENGKG-----PASPELPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV S S    K+RYAING+SHVDPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSASKVDGKLRYAINGISHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLT-KVTVAPNVVNATHRNFVEIIFENHEKT  4
            LA+Y++V +KVFK+D MKD PP     K+T+ PNVVN T R+FVEIIFEN EK+
Sbjct  385  LADYYKVYDKVFKFDTMKDTPPATAADKITMEPNVVNITIRDFVEIIFENPEKS  438



>emb|CDX82541.1| BnaA03g32800D [Brassica napus]
Length=555

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/295 (59%), Positives = 219/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DW+ K H  LKK L  GR+I RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVG++TS+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C   +V 
Sbjct  211  LKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVA  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K+  ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH +PETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYDI+ DNP PE +  + + PNV+N THR FVE++FENHEK++
Sbjct  386  LAEYFGITDKVFKYDIITDNPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSV  440



>ref|XP_009135302.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/295 (59%), Positives = 219/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DW+ K H  LKK L  GR+I RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWFTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVG++TS+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C   +V 
Sbjct  211  LKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVA  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K+  ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASTRFLKKVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH +PETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYDI+ DNP PE +  + + PNV+N THR FVE++FENHEK++
Sbjct  386  LAEYFGITDKVFKYDIITDNPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSV  440



>ref|XP_007014658.1| SKU5 similar 13 [Theobroma cacao]
 gb|EOY32277.1| SKU5 similar 13 [Theobroma cacao]
Length=553

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 215/294 (73%), Gaps = 4/294 (1%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P  ++ + + DWY K H  LKK L  GRS+ RP+G+ IN K      K +P+ T
Sbjct  151  PVPYSDPEADYTVLIGDWYTKSHTMLKKFLDSGRSLGRPDGVLINGKVAKGNGKDKPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NFR QGH MKLVE+EGSH VQN Y+S+D+HVG C AVLVT
Sbjct  211  MKPGKTYKYRICNVGLKNSLNFRIQGHRMKLVEMEGSHTVQNVYESLDVHVGQCFAVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ PKDY++VA++RF K   ++  +I Y  GKG        P  P    G AWS+NQFR
Sbjct  271  ADQGPKDYFMVASTRFTKNVLTATGIIRYTNGKGA----AASPKLPPAPVGWAWSLNQFR  326

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTASAARPNPQGSYHYG I ITRTIKLV + S  G K+RY INGVSH++P TPLK
Sbjct  327  TFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTASRAGGKLRYGINGVSHINPPTPLK  386

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V  KVFKYD++ D PP  +T VTV PNV+N T RNFVEII ENHEK+I
Sbjct  387  LAEYYNVANKVFKYDVIGDEPPAKITGVTVQPNVLNMTFRNFVEIILENHEKSI  440



>sp|Q00624.1|ASOL_BRANA RecName: Full=L-ascorbate oxidase homolog; Flags: Precursor [Brassica 
napus]
 emb|CAA45554.1| Bp10 [Brassica napus]
 emb|CDY43995.1| BnaA05g25900D [Brassica napus]
Length=555

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/295 (59%), Positives = 218/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GR+I RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVG++TSINFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C   +VT
Sbjct  211  LKPGKTYRVRICNVGVKTSINFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGTIVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+R+A+NGVSH +PETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRFALNGVSHTEPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYD + D+P PE +  + + PNV+N THR FVE++FENHEK++
Sbjct  386  LAEYFGISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSV  440



>ref|XP_010465172.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
 ref|XP_010487091.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010487092.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=554

 Score =   368 bits (944),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/295 (59%), Positives = 217/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GR++ RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVGL+TS+NFR Q H +KLVE+EGSHV+QNDYDS+D+HVG C   ++T
Sbjct  211  LKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQE KDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ADQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH DPETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYD + DNP PE +  + + PNV+N THR F+E++FENHEK++
Sbjct  386  LAEYFGIADKVFKYDTITDNPTPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSV  440



>ref|XP_009147500.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=555

 Score =   368 bits (944),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/295 (58%), Positives = 219/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LK  L  GR+I RP+GI IN K G      +P+ T
Sbjct  152  PVPYADPEDDYTVLINDWYTKSHTQLKNFLDSGRTIGRPDGILINGKAGKGDGSDQPLFT  211

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +++GKTYR R+CNVGL+ S+NFR Q   MKLVE+EGSHV+QNDYDS+D+HVG C  V++T
Sbjct  212  LKQGKTYRIRICNVGLKASLNFRIQNLKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVILT  271

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K   ++  L+ Y GGKG+          P    G AWS+NQFR
Sbjct  272  ANQEPKDYYIVASTRFLKNALTTTGLLRYEGGKGL-----ASSQLPAAPVGWAWSLNQFR  326

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH+D ETPLK
Sbjct  327  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLRYALNGVSHIDTETPLK  386

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK-VTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYD + DNP  D  K + + PNV+N THRNF+E++FENHE+++
Sbjct  387  LAEYFGVTDKVFKYDSISDNPTSDQIKNIKIEPNVLNITHRNFIEVVFENHERSV  441



>ref|XP_002523382.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF38961.1| multicopper oxidase, putative [Ricinus communis]
Length=551

 Score =   367 bits (943),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/294 (61%), Positives = 216/294 (73%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  L+K L  G SI RP G+ IN K      K +P+ T
Sbjct  150  PVPYPDPEDDYTVIVNDWYTKSHTSLRKSLDSGVSIGRPEGVLINGKTAKGNGKDKPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CN GL+TSINFR QGH+MKLVE+EGSHVVQN Y+S+D+HVG C +VLVT
Sbjct  210  MKPGKTYKYRICNAGLKTSINFRIQGHTMKLVEMEGSHVVQNIYESLDVHVGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q PKDYY+VA++RF K       ++ Y  GKG     +  P  P+   G AWS+NQFR
Sbjct  270  ANQAPKDYYMVASTRFLKTVLVGKGIVRYTNGKG-----QASPVLPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I ITRTIKLV S S  G K+RYAIN VSHV+PETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASTTGGKLRYAINSVSHVEPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V  KVFKYD  +DNPP  + K+   PNV+N T RNFVEIIFEN EK+I
Sbjct  385  LAEYFGVANKVFKYDTFQDNPPAKIGKIVSQPNVLNMTFRNFVEIIFENPEKSI  438



>ref|XP_008219320.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   367 bits (943),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 221/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DW+ K H  LKKLL  GRS+ARP+G+ IN K      K EP+  
Sbjct  150  PVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMARPDGVLINGKSSKGDGKDEPLFV  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ ++NFR QGHSMKLVELEGSH VQN YDSMD+H+G C +VLVT
Sbjct  210  MKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDYY+VA++RF     +   +I Y  GKG        P  P+   G AWS+NQFR
Sbjct  270  ADKDPKDYYMVASTRFTNSVLTGKGIIRYENGKG-----PASPELPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV S S    K+RYAING+SHVDPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSASKVDGKLRYAINGISHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLT-KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LA+Y++V +KVFK+D MKD PP     K+T+ PNVVN T R+FVEIIFEN EK++
Sbjct  385  LADYYKVYDKVFKFDTMKDTPPATAADKITMEPNVVNITIRDFVEIIFENPEKSL  439



>ref|XP_010487093.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   367 bits (943),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 220/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D+  I ++DW+ K H  LK  L  GR++  P+G+ IN K G VG+K E + T
Sbjct  150  PVPYADPEDDHTILINDWFTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGEKNEALFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY+FR+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  210  MKPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        E     P+   G AWS+NQFR
Sbjct  270  ADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSN-----VEASAELPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  SK+    KVR+  NGVSHVD ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANSKNVVNGKVRFGFNGVSHVDTETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + EKVFKY+++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  385  LAEYFGMAEKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSM  438



>ref|XP_009339220.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   367 bits (942),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 221/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K H  LKK+L  GRS+ RP G+ IN K+     K EP+ T
Sbjct  150  PVPYADPEDEYTVMIGDWYTKSHTALKKILDSGRSMGRPAGVLINGKNAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++RVCNVGL+ S+NFR QGH +KLVE+EGSH VQN Y+S+D+HVG C ++LVT
Sbjct  210  MKPGKTYKYRVCNVGLKNSLNFRIQGHPLKLVEMEGSHTVQNTYESLDVHVGQCFSLLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDYY+VA++RF K   +   +I Y  G G        P  PE   G AWS+NQFR
Sbjct  270  ADKEPKDYYMVASTRFTKTVLTGKGIIRYENGNG-----PASPELPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIK+V S S    K+RYA+NGVSHV+ ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKIVNSASRVDGKLRYAVNGVSHVESETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLT-KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYD ++D PP  +  K+T+APNVVN T R+FVEIIFENHEK+I
Sbjct  385  LAEYFGVADKVFKYDTIEDEPPATVEDKITLAPNVVNQTFRDFVEIIFENHEKSI  439



>ref|XP_010500423.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=554

 Score =   367 bits (942),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 217/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GR++ RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVG++TS+NFR Q H +KLVE+EGSHV+QNDYDS+D+HVG C   ++T
Sbjct  211  LKPGKTYRVRICNVGMKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQE KDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ADQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH DPETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYD + DNP PE +  + + PNV+N THR F+E++FENHEK++
Sbjct  386  LAEYFGIADKVFKYDTITDNPTPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSV  440



>dbj|BAL41449.1| SKU5 similar 1 [Linum grandiflorum]
Length=552

 Score =   367 bits (942),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 173/295 (59%), Positives = 219/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P  ++ + ++DW++K H  L+ +L  GR++ARP G+ +N K+     K EP+ T
Sbjct  150  PVPYADPEADYTVIINDWFSKTHSALRTMLDSGRTLARPEGVLLNGKNAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CN GL+TS+NFR QGH+MKLVE+EGSHVVQN YDS+D+HVG C+AVLVT
Sbjct  210  MKAGKTYKYRICNAGLKTSLNFRIQGHTMKLVEMEGSHVVQNMYDSLDVHVGGCMAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+PKDYY++A++RF K   +   +I Y GGKG           P    G AWS+NQFR
Sbjct  270  ADQDPKDYYMIASTRFTKTVTTGKGIIRYEGGKG-----PADTEIPAAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRT++L  +      K+RYA NG+SHVDP TPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGQINITRTLRLANTAGRSNGKLRYAFNGISHVDPPTPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPP-EDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKYD MKD PP  D   + + PNV+N T RNFVEIIFENHEK+I
Sbjct  385  LAEYYGVADKVFKYDTMKDTPPSSDKVDIVMQPNVMNFTFRNFVEIIFENHEKSI  439



>ref|XP_003538519.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   367 bits (942),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 182/295 (62%), Positives = 217/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K H  L+KLL  GRS+ RP G+ IN K      K EP+ T
Sbjct  151  PVPYPDPEDEYTVLIGDWYTKSHTILRKLLDSGRSLGRPEGVLINGKTAKGDGKDEPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+  KTY++R+CNVGL+ S+N+R QGHSMKLVE+EGSHVVQN YDS+D+HVG C +VLVT
Sbjct  211  MKPAKTYKYRICNVGLKNSLNYRIQGHSMKLVEMEGSHVVQNMYDSLDVHVGECFSVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDYY+VA++RF K       +I Y  GKG        P  P    G AWS+NQF 
Sbjct  271  ADKEPKDYYMVASTRFTKTVLIGKGIIRYTNGKG-----PASPDIPPAPVGWAWSLNQFH  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTASAARPNPQGSY YGQI ITRTIKLV S S    K+RYA+NGVSHVDPETPLK
Sbjct  326  TFRWNLTASAARPNPQGSYKYGQINITRTIKLVNSVSKSNGKLRYALNGVSHVDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL-TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYD + DNP  ++   VTV PNV+N THRNF+EIIFEN EKTI
Sbjct  386  LAEYFGISDKVFKYDTIPDNPSPNIGNAVTVQPNVLNITHRNFIEIIFENPEKTI  440



>ref|XP_010500435.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   367 bits (941),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 220/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D+  I ++DW+ K H  LK  L  GR++  P+G+ IN K G VG+K E + T
Sbjct  150  PVPYADPEDDRTILINDWFTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGEKNEALFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY+FR+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  210  MKPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        E     P+   G AWS+NQFR
Sbjct  270  ADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSN-----VEASAELPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  SK+    KVR+  NGVSHVD ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANSKNVVNGKVRFGFNGVSHVDTETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + EKVFKY+++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  385  LAEYFGMAEKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSM  438



>gb|KHN44494.1| L-ascorbate oxidase like [Glycine soja]
Length=551

 Score =   367 bits (941),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 182/295 (62%), Positives = 217/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K H  L+KLL  GRS+ RP G+ IN K      K EP+ T
Sbjct  150  PVPYPDPEDEYTVLIGDWYTKSHTILRKLLDSGRSLGRPEGVLINGKTAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+  KTY++R+CNVGL+ S+N+R QGHSMKLVE+EGSHVVQN YDS+D+HVG C +VLVT
Sbjct  210  MKPAKTYKYRICNVGLKNSLNYRIQGHSMKLVEMEGSHVVQNMYDSLDVHVGECFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDYY+VA++RF K       +I Y  GKG        P  P    G AWS+NQF 
Sbjct  270  ADKEPKDYYMVASTRFTKTVLIGKGIIRYTNGKG-----PASPDIPPAPVGWAWSLNQFH  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTASAARPNPQGSY YGQI ITRTIKLV S S    K+RYA+NGVSHVDPETPLK
Sbjct  325  TFRWNLTASAARPNPQGSYKYGQINITRTIKLVNSVSKSNGKLRYALNGVSHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL-TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYD + DNP  ++   VTV PNV+N THRNF+EIIFEN EKTI
Sbjct  385  LAEYFGISDKVFKYDTIPDNPSPNIGNAVTVQPNVLNITHRNFIEIIFENPEKTI  439



>ref|XP_009146525.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=552

 Score =   367 bits (941),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 221/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LK  L  GR++  P+G+ IN K G VG    P+ T
Sbjct  151  PVPYADPEDDYTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLINGKSGKVGGPNVPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  211  MKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        +     P+   G AWS+NQFR
Sbjct  271  ADQNAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQASSELPKAPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  +K+    KVR+ +NGVSHVD ETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGLNGVSHVDTETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF++ EKVFKY+++KD P   +T +TV PNV+N T R FVEI+FENHEK++
Sbjct  386  LAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSM  439



>emb|CDY43994.1| BnaA05g25890D [Brassica napus]
Length=552

 Score =   367 bits (941),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 221/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LK  L  GR++  P+G+ IN K G VG    P+ T
Sbjct  151  PVPYADPEDDYTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLINGKSGKVGGPNVPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  211  MKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        +     P+   G AWS+NQFR
Sbjct  271  ADQNAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQASSELPKAPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  +K+    KVR+ +NGVSHVD ETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGLNGVSHVDTETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF++ EKVFKY+++KD P   +T +TV PNV+N T R FVEI+FENHEK++
Sbjct  386  LAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSM  439



>ref|NP_187947.1| protein SKU5-like 11 [Arabidopsis thaliana]
 dbj|BAB01744.1| l-ascorbate oxidase; pectinesterase-like protein; pollen-specific 
protein-like [Arabidopsis thaliana]
 gb|AAO42003.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AAO50591.1| putative pectinesterase (pectin methylesterase) family protein 
[Arabidopsis thaliana]
 gb|AEE75341.1| protein SKU5-like 11 [Arabidopsis thaliana]
Length=554

 Score =   367 bits (941),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 173/295 (59%), Positives = 217/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GR++ RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTQLKKFLDSGRTLGRPDGILINGKSGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVGL+TS+NFR Q H +KLVE+EGSHV+QNDYDS+D+HVG C   ++T
Sbjct  211  LKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QE KDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQLPPGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH DPETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYD + DNP PE +  + + PNV+N THR F+E++FENHEK++
Sbjct  386  LAEYFGVADKVFKYDSITDNPTPEQIKSIKIVPNVLNITHRTFIEVVFENHEKSV  440



>emb|CDY23597.1| BnaC05g39970D [Brassica napus]
Length=552

 Score =   367 bits (941),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 221/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LK  L  GR++  P+G+ IN K G VG    P+ T
Sbjct  151  PVPYADPEDDYTVLINDWYTKSHTALKTFLDSGRTLGSPDGVLINGKSGKVGGPNVPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  211  MKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        +     P+   G AWS+NQFR
Sbjct  271  ADQTAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQASSELPKAPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  +K+    KVR+ +NGVSHVD ETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGLNGVSHVDTETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF++ EKVFKY+++KD P   +T +TV PNV+N T R FVEI+FENHEK++
Sbjct  386  LAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSM  439



>ref|XP_010465173.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=551

 Score =   366 bits (940),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 220/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D+  I ++DW+ K H  LK  L  GR++  P+G+ IN K G VG+K E + T
Sbjct  150  PVPYADPEDDHTILINDWFTKSHTALKNFLDSGRTLGSPDGVLINGKFGKVGEKNEALFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++S+NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  210  MKPGKTYKYRICNVGFKSSLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        E     P+   G AWS+NQFR
Sbjct  270  ADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSN-----VEASAELPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  SK+    KVR+  NGVSHVD ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANSKNVVNGKVRFGFNGVSHVDTETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + EKVFKY+++KD P   +T +TV PNV+N T R FVEIIFENHEK++
Sbjct  385  LAEYFGMAEKVFKYNVIKDEPAAKITALTVEPNVLNITFRTFVEIIFENHEKSM  438



>emb|CDX75707.1| BnaC03g37900D [Brassica napus]
Length=555

 Score =   367 bits (941),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 220/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DW+ K H  +KK L  GR+I RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWFTKSHTQVKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVG++TS+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C   +V+
Sbjct  211  LKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVS  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA+SRF K+  ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASSRFLKKVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH +PETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYDI+ D+P PE +  + + PNV+N THR FVE++FENHEK++
Sbjct  386  LAEYFGITDKVFKYDIITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSV  440



>ref|XP_009135303.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=551

 Score =   366 bits (940),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 222/294 (76%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LK  L  GR++  P+G+ IN K G VG + +P+ T
Sbjct  150  PVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  210  MKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        +     P+   G AWS+NQ+R
Sbjct  270  ADQAAKNYYMVASTRFLKKEVSTVGVMSYEGS-----TVQPSSELPKAPVGWAWSLNQYR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  +KS    KVR+  NGVSHVD ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKSVVNGKVRFGFNGVSHVDTETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF++ EKVFKY+++KD P   +T +TV PNV+N T R FVEI+FENHEK++
Sbjct  385  LAEYFEMSEKVFKYNVIKDEPAAKVTTLTVEPNVLNITFRTFVEIVFENHEKSM  438



>emb|CAA47178.1| Bplo [Brassica napus]
Length=555

 Score =   366 bits (940),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 220/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DW+ K H  +KK L  GR+I RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWFTKSHTQVKKFLDGGRTIGRPDGIVINGKAGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVG++TS+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C   +V+
Sbjct  211  LKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVS  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA+SRF K+  ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASSRFLKKVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH +PETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALNGVSHTEPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYDI+ D+P PE +  + + PNV+N THR FVE++FENHEK++
Sbjct  386  LAEYFGITDKVFKYDIITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSV  440



>ref|XP_010534841.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   366 bits (939),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 220/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + +SDWY K H  LK LL  GR++  P+G+ IN K   +  K +P+ T
Sbjct  149  PVPYPDPEDDYTVLISDWYTKSHTSLKNLLDSGRALGSPDGVLINGKSAKMDGKDQPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  209  MKLGKTYKYRICNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ   DYY+VA+SRF K+  S   LI Y GG+G     +  P  P+   G AWS+NQFR
Sbjct  269  ADQTATDYYMVASSRFLKKQLSGTGLIRYEGGQG-----QASPVLPKAPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV S+     K+R+  NGVSH+D ETPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSQKVVDRKLRFGFNGVSHIDTETPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ EKVFKY+++KD P   +T +TV PNV+N T R FVE+IFENHEK++
Sbjct  384  LAEYFQMAEKVFKYNVIKDEPAGKITGLTVEPNVLNITFRTFVEVIFENHEKSM  437



>emb|CDY24188.1| BnaC01g37680D [Brassica napus]
Length=550

 Score =   366 bits (939),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 222/294 (76%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D+  I ++DWY K H  LK  L  GR++  P+G+ IN K G VG + +P+ T
Sbjct  149  PVPYADPEDDHTILINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  209  MKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        +     P+   G AWS+NQFR
Sbjct  269  ADQNAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQPSNVLPKAPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  +K+    KVR+ +NGVSHVD ETPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVDGKVRFGLNGVSHVDTETPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF++ EKVFKY+++KD P   +T +TV PNV+N T R FVEI+FENHEK++
Sbjct  384  LAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSM  437



>emb|CDX82540.1| BnaA03g32810D [Brassica napus]
Length=551

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 221/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LK  L  GR++  P+G+ IN K G VG + +P+ T
Sbjct  150  PVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  210  MKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        +     P+   G AWS+NQ+R
Sbjct  270  ADQAAKNYYMVASTRFLKKEVSTVGVMSYEGS-----TVQPSSELPKAPVGWAWSLNQYR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  +KS    KVR+  NGVSHVD ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKSVVNGKVRFGFNGVSHVDTETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF++ EKVFKY+++KD P    T +TV PNV+N T R FVEI+FENHEK++
Sbjct  385  LAEYFEMSEKVFKYNVIKDEPAAKATTLTVEPNVLNITFRTFVEIVFENHEKSM  438



>ref|XP_008219429.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=552

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 220/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DW+ K H  LKKLL  GRS+ARP+G+ IN K      K EP+  
Sbjct  150  PVPYADPEDEYTVLIGDWFTKSHTQLKKLLDGGRSMARPDGVLINGKSSKGDGKDEPLFV  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ ++NFR QGHSMKLVELEGSH VQN YDSMD+H+G C +VLVT
Sbjct  210  MKPGKTYKYRICNVGLKNTLNFRIQGHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDYY+VA++RF     +   +I Y  GKG        P  P+   G AWS+NQFR
Sbjct  270  ADKDPKDYYMVASTRFTNSVLTGKGIIRYENGKG-----PASPELPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV S S    K+RYAING+SHVDPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSASKVDGKLRYAINGISHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLT-KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LA+Y++V +KVFK+D MKD PP     K+T+ PNVVN T R+FVEIIFEN E ++
Sbjct  385  LADYYKVYDKVFKFDTMKDTPPATAADKITMEPNVVNITIRDFVEIIFENPENSL  439



>ref|XP_006299300.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
 gb|EOA32198.1| hypothetical protein CARUB_v10015454mg [Capsella rubella]
Length=554

 Score =   365 bits (938),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 216/295 (73%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GR++ RP+GI IN K G       P+  
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGKGDGSDAPLFN  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVGL+TS+NFR Q H +KLVE+EGSHV+QNDYDS+D+HVG C   ++T
Sbjct  211  LKPGKTYRVRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QE KDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH DPETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGVSHTDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYD + DNP PE    + + PNV+N THRNF+E++FENHEK++
Sbjct  386  LAEYFGIADKVFKYDTITDNPTPEQTKNIKIEPNVLNITHRNFIEVVFENHEKSV  440



>ref|XP_006407228.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
 gb|ESQ48681.1| hypothetical protein EUTSA_v10020433mg [Eutrema salsugineum]
Length=554

 Score =   365 bits (937),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/295 (58%), Positives = 217/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GR++ RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKAGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVGL+TS+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C   +VT
Sbjct  211  LKPGKTYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I I+RTI L  ++     K+RYA+NGVSH+DPETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINISRTIVLKNTQGKVDGKLRYALNGVSHIDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYD + DNP PE +  + + PNV+N THR F+E++FENHEK++
Sbjct  386  LAEYFGIADKVFKYDSITDNPTPEQIKTIKIEPNVLNITHRTFIEVVFENHEKSV  440



>ref|XP_010673839.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=558

 Score =   365 bits (938),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/298 (60%), Positives = 219/298 (73%), Gaps = 9/298 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGD-KLEPIA  706
            PVPF  P D++ I + DWY + H  L+K L  G+S+ARP+ + +N K G VGD K EP+ 
Sbjct  153  PVPFADPEDDYTIMVGDWYKESHAVLRKHLENGKSLARPDAVLMNGKQGKVGDPKEEPLF  212

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM+ GKTYR+R+CNVG++ SINFR QGH+MKLVE+EGSH VQN YDS+D+H+G C +VLV
Sbjct  213  TMKPGKTYRYRICNVGMKNSINFRMQGHTMKLVEVEGSHTVQNMYDSLDIHLGQCYSVLV  272

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TAD+EPKDYY+VA++RF K    +  ++ Y GGKG           PE   G AWS+NQF
Sbjct  273  TADKEPKDYYMVASTRFTKYHLQATGIVRYEGGKGA-----PSTVLPEAPVGWAWSLNQF  327

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RS RWNLTASAARPNPQGSYHYGQI ITRTIKL  +      K+RYAING SH D +TPL
Sbjct  328  RSLRWNLTASAARPNPQGSYHYGQINITRTIKLANTAGTVDGKLRYAINGHSHTDVDTPL  387

Query  165  KLAEYFQVPEKVFKYDIMKDNPP---EDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KL EY+QV +K FKYD++KD PP   E L K T  PNV+N T RNF+EIIFENHEK+I
Sbjct  388  KLLEYYQVAQKAFKYDVIKDEPPANVETLDKFTTGPNVLNGTFRNFIEIIFENHEKSI  445



>ref|XP_002884964.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61223.1| hypothetical protein ARALYDRAFT_478720 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   365 bits (937),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 173/295 (59%), Positives = 217/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GR++ RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKAGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR RVCNVGL+TS+NFR Q H +KLVE+EGSHV+QNDYDS+D+HVG C   +++
Sbjct  211  LKPGKTYRVRVCNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILS  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QE KDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQLPPGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH DPETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVNGKLRYALNGVSHTDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYD + DNP PE +  + + PNV+N THR F+E++FENHEK++
Sbjct  386  LAEYFGVADKVFKYDSITDNPTPEQIKSIKIEPNVLNITHRTFIEVVFENHEKSV  440



>emb|CDX75708.1| BnaC03g37910D [Brassica napus]
Length=551

 Score =   365 bits (936),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 222/294 (76%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LK  L  GR++  P+G+ IN K G VG + +P+ T
Sbjct  150  PVPYADPEDDYTVLINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGGQDKPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  210  MKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        +     P+   G AWS+NQ+R
Sbjct  270  ADQAAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQPSSELPKAPVGWAWSLNQYR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  +KS    KVR+  NGVSHVD ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKSVVNGKVRFGFNGVSHVDTETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF++ EKVFKY++++D P   +T +TV PNV+N T R FVEI+FENHEK++
Sbjct  385  LAEYFEMSEKVFKYNVIEDEPAAKVTTLTVEPNVLNITFRTFVEIVFENHEKSM  438



>ref|XP_010673838.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=557

 Score =   365 bits (936),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 173/298 (58%), Positives = 221/298 (74%), Gaps = 9/298 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGD-KLEPIA  706
            PVP+  P D++ + + DWY + H  L+K+L  G+S+ RP+G+ +N K G VGD K EP+ 
Sbjct  152  PVPYPDPEDDYTVLIGDWYKQSHTALRKVLDSGKSLGRPDGVLMNGKQGKVGDAKEEPLF  211

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM+ GKTY++R+CNVGL+ ++NFR QGH +KLVE+EGSH VQN YDS+D+H+G C AVLV
Sbjct  212  TMKPGKTYKYRICNVGLKNTLNFRIQGHKIKLVEVEGSHSVQNSYDSLDVHLGQCYAVLV  271

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TADQ+PKDYY+VA+ RF K    +   I Y  GKG           PE   G AWS+NQF
Sbjct  272  TADQDPKDYYMVASVRFTKYHLQATGKIRYENGKG-----PASNILPEAPTGWAWSLNQF  326

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYGQI ITRT+KL  + +    K+RYA+NGVSH DPETP+
Sbjct  327  RSFRWNLTASAARPNPQGSYHYGQINITRTVKLATTANTVDGKLRYAVNGVSHTDPETPM  386

Query  165  KLAEYFQVPEKVFKYDIMKDNPP---EDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEY++ P KVFKYD + D PP   E L K+T+AP V+N  HR+F+E+IFENHEK++
Sbjct  387  KLAEYYEAPAKVFKYDPIGDEPPANIEKLDKITIAPIVLNFKHRDFIEVIFENHEKSV  444



>ref|XP_003601600.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71851.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   364 bits (934),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 213/294 (72%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K HK LK  L  GRSI RP G+ IN K+       EP+ T
Sbjct  148  PVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYT  207

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CN GL+ ++NFRFQGH MKLVE EGSHVVQN YDS+D+HVG C  VLVT
Sbjct  208  MKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVT  267

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EP+DYY++A++R  K       +I Y  GKG        P  P    G AWS+NQFR
Sbjct  268  ADKEPRDYYMIASTRMTKYNLLGKGIIRYTNGKG-----PASPVLPPAPVGWAWSLNQFR  322

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK V S S+   K+RYAINGVSHVDPETP+K
Sbjct  323  SFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLRYAINGVSHVDPETPVK  382

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKY+I+ D PP DL  +T+APNV+  T R F+EIIFEN EK +
Sbjct  383  LAEYYGVADKVFKYNIISDEPPTDLKAITIAPNVMQTTFRTFIEIIFENPEKVL  436



>ref|XP_011048128.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=551

 Score =   364 bits (935),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 221/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L+DWY   H  L+K L +GRS+ARP G+ IN K+     K EP+  
Sbjct  150  PVPYADPEDDYTVILNDWYTSSHATLRKYLDDGRSLARPTGVLINGKNAKGDGKDEPLFK  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+  KTY++R+CN G++ ++NFR QGH+MKLVE+EGSHVVQN Y+S+D+HVG C +VLVT
Sbjct  210  MKPEKTYKYRICNAGIKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q PKDYY+VA++RF K+  ++  +I Y  GKG        P  PE   G AWS+NQFR
Sbjct  270  ANQAPKDYYMVASTRFNKQVLTAKGIIRYTNGKG-----PASPEFPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I ITRTIKLV S S EG K+RY++NGVSHVDPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASREGGKLRYSLNGVSHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            +AEY+ + +KVFKY+ +KD P   + KV   PNV+N T RNFVEIIFENHEK++
Sbjct  385  IAEYYGIADKVFKYNTIKDMPSAKIGKVVTQPNVLNQTFRNFVEIIFENHEKSM  438



>ref|XP_003601595.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71846.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   364 bits (934),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 176/294 (60%), Positives = 214/294 (73%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K HK LK  L  GRSI RP G+ IN K+     + EP+ T
Sbjct  148  PVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGRDEPLYT  207

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CN GL+ ++NFRFQGH MKLVE EGSHVVQN YDS+D+HVG C  VLVT
Sbjct  208  MKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVT  267

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EP+DYY++A++R  K       ++ Y  GKG        P  P    G AWS+NQFR
Sbjct  268  ADKEPRDYYMIASTRMTKYNLLGKGIVRYTNGKG-----PASPVLPPAPVGWAWSLNQFR  322

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK V S S+   K+RYAINGVSHVDPETP+K
Sbjct  323  SFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLRYAINGVSHVDPETPVK  382

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKY+I+ D PP DL  +T+APNV+  T R F+EIIFEN EK +
Sbjct  383  LAEYYGVADKVFKYNIISDEPPTDLRAITIAPNVMQTTFRTFIEIIFENPEKVL  436



>ref|XP_008219681.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=554

 Score =   363 bits (933),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 221/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GRS+ RP+G+ IN K      K EP+ T
Sbjct  150  PVPYADPEDDYTVLIGDWYAKSHTALKKHLDSGRSMGRPDGVIINGKSAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NFR QGH MKLVE+EGSH +QN Y+S+D+H+G C +VLVT
Sbjct  210  MKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEMEGSHTMQNTYESLDVHLGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++P DYY+VA++RF K+  +   ++ Y  G G        P  PE   G AWS+NQFR
Sbjct  270  ADKDPMDYYMVASTRFTKKVLTGKGIMRYENGNG-----PASPELPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRT+K+V S +    K+RYAINGVSHVDPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTMKIVNSATKVDGKLRYAINGVSHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLT-KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKYD ++D PP  +  KVT+APNVVN T RNFVEIIFENHEK+I
Sbjct  385  LAEYYGVADKVFKYDTIQDEPPATVEDKVTLAPNVVNQTFRNFVEIIFENHEKSI  439



>ref|XP_004305574.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=553

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 219/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  L+K L  GRS+ RP G+ IN K+       EP+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHNSLRKQLDMGRSLGRPEGVLINGKNARGDGTDEPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY+FRVCNVGL+ S+NFR QGH+MKLVE+EGSHVVQN Y+S+D+H+G C + LVT
Sbjct  211  MKPGKTYKFRVCNVGLKNSLNFRIQGHTMKLVEMEGSHVVQNTYESLDVHLGQCFSALVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDY++VA +RF K   + + LI Y  G G        P  P    G+AWS+NQ R
Sbjct  271  ADKEPKDYWMVADTRFTKTMLTGLGLIRYTNGNG-----PANPELPLPPEGLAWSLNQAR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I ITRTIKLV S S    K+RYA+NGVSH+D ETPLK
Sbjct  326  SFRWNLTASAARPNPQGSYHYGAINITRTIKLVNSASKVDGKLRYAVNGVSHIDTETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
             AEYF V +KVFKYDI+KD+P PE   K+T+APNVVN T+R+FVEIIFENH K+I
Sbjct  386  YAEYFGVADKVFKYDIIKDDPSPEAEAKITLAPNVVNQTYRDFVEIIFENHGKSI  440



>gb|KFK38671.1| hypothetical protein AALP_AA3G145000 [Arabis alpina]
Length=554

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/295 (58%), Positives = 217/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GR++ RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPDGILINGKSGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GKTYR R+CNVGL+TS+NFR Q H +KLVE+EGSHV+QNDYDS+D+HVG C   +++
Sbjct  211  LKPGKTYRLRICNVGLKTSLNFRIQNHKLKLVEMEGSHVLQNDYDSLDVHVGQCYGTILS  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+ KDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ADQQAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQLPPGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            S+RWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NG+SH DPETPLK
Sbjct  326  SYRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYD + DNP PE +  + + PNV+N THR FVE++FENHEK++
Sbjct  386  LAEYFGIGDKVFKYDSITDNPTPEQIKSIKILPNVLNITHRTFVEVVFENHEKSV  440



>ref|XP_010271079.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=552

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 184/296 (62%), Positives = 221/296 (75%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSV-GDKLEPIA  706
            PVPF  P D++ + + DWY+KGH  LKKLL  GRS+ +P+G+ IN K G V GDK EP+ 
Sbjct  149  PVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLINGKSGKVEGDKDEPLF  208

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM+  K YR+RVCNVGL+ S+NFR QGHS+KLVE+EGSH VQN YDS+D+HVG C +VLV
Sbjct  209  TMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSVLV  268

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TA+Q PKDYY+VA++RF K   S+  +I Y  GKG        P  PE   G AWS+NQF
Sbjct  269  TANQTPKDYYMVASTRFTKYMISATRIIRYTNGKG-----PASPVLPEAPVGWAWSLNQF  323

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYG I ITRTIKLV +      K+RYAING+SHVD +TPL
Sbjct  324  RSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLRYAINGMSHVDKDTPL  383

Query  165  KLAEYFQVPEKVFKYDIMKDNPP-EDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF V +KVFKYD + D P  +   K+ + PNV+NAT RNFVEII ENHEK+I
Sbjct  384  KLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSI  439



>ref|XP_009376274.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 220/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K H  LKKLL  GR++ RP+GI IN K+     K EP+ T
Sbjct  150  PVPYADPEDEYTVMIGDWYTKSHTALKKLLDSGRTMGRPDGILINGKNAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++RVCNVGL+ S+NFR QGH +KLVE+EGSH VQN Y+S+D+HVG C ++LVT
Sbjct  210  MKPGKTYKYRVCNVGLKNSLNFRIQGHPLKLVEMEGSHTVQNTYESLDVHVGQCFSLLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+E KDYY+VA++RF K   +   +I Y  G G        P  PE   G AWS+NQFR
Sbjct  270  ADKERKDYYMVASTRFTKTVLTGKGIIRYENGNG-----PASPELPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIK+V S S    K+RYAINGVSHV+ ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKIVNSASRVNGKLRYAINGVSHVESETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLT-KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYD ++D P   +  KVT+APNVVN T R+FVEIIFENHEK+I
Sbjct  385  LAEYFGVADKVFKYDTIQDEPRATVEDKVTLAPNVVNQTFRDFVEIIFENHEKSI  439



>ref|XP_007163844.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
 gb|ESW35838.1| hypothetical protein PHAVU_001G269100g [Phaseolus vulgaris]
Length=549

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 221/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + +SDWY K H  LKK L  GRSI RP G+ IN K        +P+ T
Sbjct  148  PVPYHDPEDDYTVLISDWYTKSHTTLKKFLDSGRSIGRPEGVLINGKTAKGDGSDKPMFT  207

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG++ S+N RFQGH MKLVE+EGSHVVQN+YDS+D+HVG C +VL+T
Sbjct  208  MKPGKTYKYRICNVGMKNSLNLRFQGHLMKLVEMEGSHVVQNNYDSLDVHVGGCFSVLIT  267

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDYY+VA++RF K   +  A++ Y  GKG        P  PE   G AWS+NQF+
Sbjct  268  ADKDPKDYYIVASTRFSKTVLTGKAIMRYTNGKGA-----PSPDIPESPLGWAWSLNQFK  322

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNL+ASAARPNPQGSY Y +I+ITRTIKLV S S E  K+RYA+NGVSHVDPETPLK
Sbjct  323  TFRWNLSASAARPNPQGSYKYSKIDITRTIKLVNSVSRENGKLRYALNGVSHVDPETPLK  382

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL-TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKY+ ++D PP DL   V + PNV+N THR F+EIIFEN EK+I
Sbjct  383  LAEYFGVSDKVFKYNTIQDEPPADLGASVKIQPNVLNVTHRKFIEIIFENPEKSI  437



>ref|XP_003635547.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 ref|XP_003635599.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18839.3| unnamed protein product [Vitis vinifera]
 emb|CBI41110.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 219/295 (74%), Gaps = 9/295 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD P D++ + + DWY K H  LKK L  G SI RP+G+ IN K     DK EP+ T
Sbjct  151  PVPFDDPEDDYTVLIGDWYKKSHTVLKKKLDSGHSIGRPDGVQINGKSE---DKDEPLFT  207

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ G TYR+R+CNVG+++S+NFR QGH+MKLVELEGSH VQN YDS+D+H+G C +VLVT
Sbjct  208  MKPGLTYRYRICNVGIKSSLNFRIQGHTMKLVELEGSHTVQNVYDSLDVHLGQCYSVLVT  267

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q+PKDYY+VA++RF K+ Y++  +I Y  GKG        P  PE   G  WS+NQFR
Sbjct  268  ANQDPKDYYMVASTRFLKQVYTAKRIIRYTNGKG-----PASPELPEPPSGWIWSLNQFR  322

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I ITRTIK+V S S    K+RYAINGVSH DP TP K
Sbjct  323  SFRWNLTASAARPNPQGSYHYGFINITRTIKIVNSASTVDGKLRYAINGVSHTDPTTPPK  382

Query  162  LAEYFQVPEKVFKYDIMKDN-PPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKY+ M D+ PPE   K+ + PNV+N T R FVEIIFENHEK+I
Sbjct  383  LAEYFGVVDKVFKYNTMVDDPPPESAEKIVITPNVLNITFRTFVEIIFENHEKSI  437



>ref|XP_008374030.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=551

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 219/294 (74%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  L+K L  GRS+ARP+G+ IN K      K EP+ T
Sbjct  150  PVPYAAPEDDYTVIIGDWYTKSHSQLRKFLDSGRSMARPDGVLINGKSAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NFR QGH MKLVE+EGSH VQN YDS+D+H+G C ++LVT
Sbjct  210  MKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTYDSLDVHIGQCFSMLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDYY+VA++RF K   +   +I Y  G G      + P  P+   G AWS+NQFR
Sbjct  270  ADKEPKDYYMVASTRFTKSVLTGKGIIRYENGXG-----PVSPEVPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL+ S S    K+RYAING+SHVDPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLINSASKADGKLRYAINGISHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LA+Y+ + EKVFK+D MK +P     K+T+ PNV+N T ++FVEIIFEN EK++
Sbjct  385  LADYYGIREKVFKFDTMKVDPQSPAEKITMEPNVLNITIKDFVEIIFENPEKSL  438



>ref|XP_011025085.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=553

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 174/296 (59%), Positives = 225/296 (76%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L+DWY+K H  L+KLL  GR++ARP+G+ +N K+     K EP+  
Sbjct  150  PVPYADPEDDYTVILNDWYSKSHTALQKLLDSGRTLARPDGVLVNGKNAKGDGKDEPLFK  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+  KTY++R+CN G++ ++NFR QGH+MKLVE+EGSHVVQN Y+S+D+HVG C +VLVT
Sbjct  210  MKPEKTYKYRICNAGIKNTLNFRIQGHTMKLVEMEGSHVVQNVYESLDVHVGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q+PKDYY+VA++RF K+  ++  +I Y  GKG        P  PE   G AWS+NQFR
Sbjct  270  ANQDPKDYYMVASTRFNKQVLTAKGIIRYTNGKG-----PASPELPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I ITRTIKLV S S  G K+RYA+NGVSHV+PETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASRAGGKLRYALNGVSHVNPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL--TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKYD + D+P  ++   K+   PNV+N T RNFVEIIFENHEK++
Sbjct  385  LAEYYGVADKVFKYDTILDSPQANVANAKIVTQPNVLNLTFRNFVEIIFENHEKSM  440



>ref|XP_002882820.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59079.1| hypothetical protein ARALYDRAFT_478721 [Arabidopsis lyrata subsp. 
lyrata]
Length=551

 Score =   362 bits (929),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 218/294 (74%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D+  I ++DWY K H  LK  L  GR++  P+G+ IN K G +G    P+ T
Sbjct  150  PVPYADPEDDRTILINDWYTKSHTALKNFLDSGRTLGSPDGVLINGKSGKIGGNNAPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  210  MKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        +     P+   G AWS+NQFR
Sbjct  270  ADQVAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQASNEIPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  +K+    KVR+  NGVSHVD ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGFNGVSHVDTETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + EKVFKY+++KD P   +T +TV PNV+N T R FVE+IFENHEK++
Sbjct  385  LAEYFGMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEVIFENHEKSM  438



>ref|XP_007163845.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
 gb|ESW35839.1| hypothetical protein PHAVU_001G269200g [Phaseolus vulgaris]
Length=549

 Score =   362 bits (928),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 179/294 (61%), Positives = 215/294 (73%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K H  L+KLL  GRSI RPNG+ IN K        +P+ T
Sbjct  149  PVPYADPEDEYWVIMGDWYTKSHTSLQKLLDSGRSIGRPNGVLINGKTAKGDGSDQPLYT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M  GKTY++R+CNVGL+ ++NFR QGHS+KLVE EGSHVVQN YDS+D+HVG C  VLVT
Sbjct  209  MIPGKTYKYRLCNVGLKDALNFRIQGHSLKLVETEGSHVVQNVYDSLDVHVGQCFTVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDYY+VA++RF K   S+ A+I Y             P  P    G AWS+NQFR
Sbjct  269  ADKDPKDYYMVASTRFTKYDLSAKAIIHYTNSAA-----PASPELPPSPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK   S S  G  +RYAINGVSHVDPETPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGQINITRTIKFANSVS-RGQGLRYAINGVSHVDPETPLK  382

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKY+ + D PP DL+ +T APNV+NAT R+F+EIIFEN  KT+
Sbjct  383  LAEYYGVADKVFKYNTISDEPPVDLSSITKAPNVINATFRDFIEIIFENDGKTV  436



>emb|CAN69061.1| hypothetical protein VITISV_032605 [Vitis vinifera]
Length=562

 Score =   362 bits (929),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 181/295 (61%), Positives = 219/295 (74%), Gaps = 9/295 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD P D++ + + DWY K H  LKK L  G SI RP+G+ IN K     DK EP+ T
Sbjct  163  PVPFDDPEDDYTVLIGDWYKKSHTVLKKKLDSGHSIGRPDGVQINGKSE---DKDEPLFT  219

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ G TYR+R+CNVG+++S+NFR QGH+MKLVELEGSH VQN YDS+D+H+G C +VLVT
Sbjct  220  MKPGLTYRYRICNVGIKSSLNFRIQGHTMKLVELEGSHTVQNVYDSLDVHLGQCYSVLVT  279

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q+PKDYY+VA++RF K+ Y++  +I Y  GKG        P  PE   G  WS+NQFR
Sbjct  280  ANQDPKDYYMVASTRFLKQVYTAKRIIRYTNGKG-----PASPELPEPPSGWIWSLNQFR  334

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I ITRTIK+V S S    K+RYAINGVSH DP TP K
Sbjct  335  SFRWNLTASAARPNPQGSYHYGFINITRTIKIVNSASTVDGKLRYAINGVSHTDPTTPPK  394

Query  162  LAEYFQVPEKVFKYDIMKDN-PPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKY+ M D+ PPE   K+ + PNV+N T R FVEIIFENHEK+I
Sbjct  395  LAEYFGVVDKVFKYNTMVDDPPPESAEKIVITPNVLNITFRTFVEIIFENHEKSI  449



>ref|XP_003601601.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71852.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   362 bits (928),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 212/294 (72%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K HK LK  L  GRSI RP G+ IN K+       EP+ T
Sbjct  149  PVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CN GL+ ++NFRFQGH MKLVE EGSHVVQN YDS+D+HVG C  VLVT
Sbjct  209  MKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDYY+VA++R  K       +I Y  GKG        P  P    G AWS+NQFR
Sbjct  269  ADKEPKDYYMVASTRMTKYNLLGKGIIRYTNGKG-----PASPMLPPAPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK V S S+   K+RYAINGVSHVDPETP+K
Sbjct  324  SFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLRYAINGVSHVDPETPVK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKY+I+ D PP DL  +T+APNV+  T R F+EIIFEN  K +
Sbjct  384  LAEYYGVADKVFKYNIISDEPPIDLRAITIAPNVMQTTFRTFIEIIFENPGKVL  437



>gb|KHG27164.1| L-ascorbate oxidase [Gossypium arboreum]
Length=475

 Score =   359 bits (921),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 218/294 (74%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  PAD++ + + D++NKGH  LKK+L  GR++ R +G+ +N K      K EP+ T
Sbjct  74   PVPYADPADDYTLLVGDFFNKGHTSLKKILDSGRNLGRCDGVHLNGKVAKGDGKDEPLFT  133

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTY++R+CN G +TS+N RFQGH+MKLVE+EGSH +QNDYDS+D+HVG C +VLVT
Sbjct  134  MEAGKTYKYRICNTGTKTSLNVRFQGHTMKLVEMEGSHTMQNDYDSLDVHVGQCFSVLVT  193

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEP+DYY+VA++RF K   ++  +I Y  GKG           P    G AWS+NQFR
Sbjct  194  ANQEPRDYYVVASTRFTKREVTATGIIRYKNGKGA-----ASSELPPPPVGWAWSLNQFR  248

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLT++AARPNPQGSY YG I ITRTIKL  +      K+RYA+NGVS+V+P TPLK
Sbjct  249  TFRWNLTSNAARPNPQGSYKYGSINITRTIKLANTAQIVDGKLRYALNGVSYVEPTTPLK  308

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKYD + D PP D TKVT+AP V+N THRNFVEIIFENHE  I
Sbjct  309  LAEYYGVADKVFKYDTIPDEPPSDNTKVTLAPIVLNMTHRNFVEIIFENHETAI  362



>ref|XP_009339221.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=552

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/295 (59%), Positives = 219/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY+K H  LKK L  GR++ARP+G+ IN K      K EP+ T
Sbjct  150  PVPYAAPEDDYTVMIGDWYSKSHSQLKKFLDSGRAMARPDGVLINGKSAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NFR QGH MKLVE EGSH VQN YDS+D+H+G C AVLVT
Sbjct  210  MKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVETEGSHTVQNTYDSLDVHIGQCFAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDYY+VA++RF K   +   +I Y  GKG        P  P+   G AWS+NQFR
Sbjct  270  ADKEPKDYYMVASTRFSKSVLTGKGIIRYENGKG-----PASPEVPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL+ S S    K+RYAING+SHVDPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLINSASKADGKLRYAINGISHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPED-LTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LA+Y+ + EKVFK+D MK +P      K+T+ PNV+N T ++FVEIIFEN EK++
Sbjct  385  LADYYGIREKVFKFDTMKVDPQSTPAEKITMEPNVLNITIKDFVEIIFENPEKSL  439



>ref|XP_003601599.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71850.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 212/294 (72%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K HK LK  L  GRSI RP G+ IN K+       EP+ T
Sbjct  148  PVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYT  207

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CN GL+ ++NFRFQGH MKLVE EGSHVVQN YDS+D+HVG C  VLVT
Sbjct  208  MKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVT  267

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EP+DYY++A++R  K       ++ Y  GKG        P  P    G AWS+NQFR
Sbjct  268  ADKEPRDYYMIASTRMTKYNLVGKGIVRYTNGKG-----PASPLLPSAPVGWAWSLNQFR  322

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK V S S+   K+RYAINGVSHVDPETP+K
Sbjct  323  SFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLRYAINGVSHVDPETPVK  382

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKY+I+ D PP DL  +T+APNV+  T R F+EIIFEN  K +
Sbjct  383  LAEYYGVADKVFKYNIISDEPPTDLRAITIAPNVMQTTFRTFIEIIFENPGKVL  436



>gb|AES71848.2| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=513

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 212/294 (72%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K HK LK  L  GRSI RP G+ IN K+       EP+ T
Sbjct  112  PVPYADPEDEYWVLICDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYT  171

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CN GL+ ++NFRFQGH MKLVE EGSHVVQN YDS+D+HVG C  VLVT
Sbjct  172  MKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVT  231

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EP+DYY++A++R  K       +I Y  GKG        P  P    G AWS+NQFR
Sbjct  232  ADKEPRDYYMIASTRMTKYNLLGKGIIRYTNGKG-----PASPVLPPAPVGWAWSLNQFR  286

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK V S S+   K+ YAINGVSHVDPETP+K
Sbjct  287  SFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLCYAINGVSHVDPETPVK  346

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ + +KVFKY+I+ D PP DL  +T+APNV+  T R F+EIIFEN EK +
Sbjct  347  LAEYYGIADKVFKYNIISDEPPTDLKAITIAPNVMQTTFRTFIEIIFENPEKVL  400



>gb|KDP30647.1| hypothetical protein JCGZ_16212 [Jatropha curcas]
Length=551

 Score =   361 bits (926),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 218/294 (74%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K HK L+  L EGR + RP+G+ IN K+     K EP+  
Sbjct  150  PVPYAPPEDDYTVIINDWYTKDHKALRSFLDEGRVLGRPDGVLINGKNAKGDGKDEPLFE  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+  K Y++R+CN GL+ S+NFR QGH+M LVE+EGSH VQN Y+S+D+HVG C +VLVT
Sbjct  210  MKPEKVYKYRICNAGLKASLNFRIQGHTMMLVEMEGSHTVQNVYESLDVHVGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDYY+VA++RF K   ++  +I Y  GKG        P  PE   G AWS+NQFR
Sbjct  270  ADKEPKDYYMVASTRFLKTVLTAKGIIRYTNGKG-----PASPELPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGS+HYG I ITRTIK ++  +  G K+RYA+NGVSH +PETPLK
Sbjct  325  SFRWNLTASAARPNPQGSFHYGSINITRTIKFISQATKAGGKLRYAVNGVSHTNPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKYD +KD+PP  + + T+APNV+N T R+FVEIIFEN EKTI
Sbjct  385  LAEYFGIADKVFKYDTIKDDPPAKVEEATLAPNVMNMTFRDFVEIIFENPEKTI  438



>ref|XP_008438536.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=553

 Score =   361 bits (926),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/295 (60%), Positives = 217/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GRSIARP+G+ IN K        EP+ T
Sbjct  151  PVPYVDPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGKIAKGDGTDEPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M  GKTY++R+CNVGL+ S+NFR QGH+MKLVE+EGSH VQN Y S+D+HVG C +VLVT
Sbjct  211  MNPGKTYKYRICNVGLKISLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P+DYY+VA+SRF K       ++ Y  GK         P  PE   G AWS+NQFR
Sbjct  271  ADQDPRDYYMVASSRFTKNILVGKGIVRYTNGKA-----PASPEIPEAPRGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTA+AARPNPQGSYHYG I ITRTIK+V S ++   K+RYAINGVSH+DPETPLK
Sbjct  326  TFRWNLTANAARPNPQGSYHYGSINITRTIKIVNSATNIDGKLRYAINGVSHIDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKD-NPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF+V +KVFKYD + D    +    VT+APNVVNAT RNFVEIIFENHEK++
Sbjct  386  LAEYFEVADKVFKYDTISDEGSAKTANTVTIAPNVVNATFRNFVEIIFENHEKSL  440



>ref|XP_006352142.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=556

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/299 (61%), Positives = 224/299 (75%), Gaps = 10/299 (3%)
 Frame = -2

Query  882  PVPFDW-PADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIA  706
            P+PFD  PADEF + +SDWY K H  L+K L  GRS+ RP+GI IN K G    K EP+ 
Sbjct  150  PIPFDINPADEFFVLVSDWYTKSHTQLRKFLDSGRSMGRPDGIIINGKGGKGDGKDEPLF  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            +M  GKTYR+R CN G++ SIN R QGH+MKLVE+EGSHVVQN YDS+D+H+G C++VLV
Sbjct  210  SMTPGKTYRYRFCNAGMKDSINVRIQGHTMKLVEMEGSHVVQNMYDSLDIHLGQCVSVLV  269

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TAD++PKDY LVA++RF KE +++ ++I Y  G G        P  P+   G AWS+NQF
Sbjct  270  TADKDPKDYLLVASTRFTKEPHTATSIIRYTNGNG-----PASPELPKAPIGWAWSLNQF  324

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYGQI ITRTIKLV +      K+RYAINGVSHV+P TP+
Sbjct  325  RSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTAGTVDGKLRYAINGVSHVNPTTPI  384

Query  165  KLAEYFQVPEKVFKYDIMKD--NPPEDLT--KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KL EY+ V +K+FKYD+MKD   PP      K+T+APNVV  T+RNFVEIIFENHEK++
Sbjct  385  KLVEYYGVEDKIFKYDLMKDEYEPPAGKAEEKITLAPNVVKVTYRNFVEIIFENHEKSV  443



>gb|KGN63948.1| hypothetical protein Csa_1G031720 [Cucumis sativus]
Length=480

 Score =   358 bits (920),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/298 (60%), Positives = 220/298 (74%), Gaps = 12/298 (4%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GRSIARP+G+ IN +        EP+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGRIAKGDGTDEPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+  KTY++R+CNVGL+TS+NFR QGH+MKLVE+EGSH VQN Y S+D+HVG C +VLVT
Sbjct  211  MKPEKTYKYRICNVGLKTSLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDYY+VA++RF K       +I Y  GK         P  PE   G AWS+NQFR
Sbjct  271  ADKDPKDYYMVASTRFTKNILVGKGIIRYTNGKA-----PASPEIPEAPRGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTASAARPNPQGSYHYG I ITRTIK+V S ++   K+RYAINGVSHVDPETPLK
Sbjct  326  TFRWNLTASAARPNPQGSYHYGSINITRTIKIVNSATNVDGKLRYAINGVSHVDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK----VTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF+V +KVFKYD + D   E L+K    VTVAPNV+NAT RNFVEI+FEN EK++
Sbjct  386  LAEYFEVADKVFKYDTISD---EGLSKTANIVTVAPNVLNATFRNFVEIVFENQEKSL  440



>gb|EPS68478.1| hypothetical protein M569_06286, partial [Genlisea aurea]
Length=533

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/295 (60%), Positives = 219/295 (74%), Gaps = 10/295 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPF WP  E+++ + DWY KG   LKKLL  GR++ RP+G+ IN KH    D  EP+ +
Sbjct  135  PVPFPWPHAEYNVLVGDWYKKGQGSLKKLLDTGRTLGRPDGVIINGKH----DSNEPMFS  190

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
             E GKT+RFRVCNVGL+ SINFR Q H++ LVE+EGSH VQN YDS+D+H+G C +VLVT
Sbjct  191  FEAGKTHRFRVCNVGLKNSINFRIQAHTLTLVEIEGSHTVQNVYDSLDLHLGQCASVLVT  250

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ PKDYY VA++RF K   ++ A+I Y G       +   P  PE   G AWS+NQFR
Sbjct  251  ADQTPKDYYFVASTRFTKTVLTTKAIIRYNGSS-----TPASPELPEAPVGWAWSVNQFR  305

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIK V +      K+RY++NGVSH DP TPLK
Sbjct  306  SFRWNLTASAARPNPQGSYHYGKINITRTIKFVNAPGTVDGKLRYSVNGVSHTDPATPLK  365

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL-TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +K+FKYDI+KD+P  D  +K+T+AP V+NAT RNFVEIIFEN EK++
Sbjct  366  LAEYFGVGDKLFKYDIIKDDPSVDANSKITIAPIVLNATFRNFVEIIFENQEKSV  420



>ref|XP_007014661.1| SKU5 similar 12 [Theobroma cacao]
 gb|EOY32280.1| SKU5 similar 12 [Theobroma cacao]
Length=552

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/295 (59%), Positives = 219/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ I   DW++KGH  LKK+L  GR++ R +G+ IN K      K EP+ T
Sbjct  150  PVPYPDPEDDYTILAGDWFSKGHTTLKKMLDSGRNLGRCDGVHINGKVAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTY++R+CNVG++TS+N RFQGH+MKLVE+EGSH VQN Y+S+D+HVG C  VLVT
Sbjct  210  MEPGKTYKYRICNVGIKTSLNVRFQGHNMKLVEMEGSHTVQNTYESLDVHVGQCFGVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEP+DYY+VA++RF K   ++  +I Y  GKG        P  P    G AWS+NQFR
Sbjct  270  ADQEPRDYYVVASTRFTKRVITATGIIRYTNGKG-----PASPELPPAPIGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTASAARPNPQGSYHYG I+ITRTIKL  +    G K+RYAING+SHVDP TPLK
Sbjct  325  TFRWNLTASAARPNPQGSYHYGAIDITRTIKLANTAGKVGGKLRYAINGISHVDPPTPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLT-KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +K FKYDI++D+PP  ++ ++TV P VVN T+R FVEIIFEN E  I
Sbjct  385  LAEYYNVADKSFKYDILRDDPPAKISEEITVQPIVVNLTYRTFVEIIFENRETAI  439



>ref|XP_010044914.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW87034.1| hypothetical protein EUGRSUZ_B03581 [Eucalyptus grandis]
Length=552

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/296 (59%), Positives = 221/296 (75%), Gaps = 6/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG-SVGDKLEPIA  706
            PVP+  P D++ + + DWY+K H  L++ L  GR +ARP+G+ IN + G   G  ++P+ 
Sbjct  148  PVPYADPEDDYTVLIGDWYSKSHTVLRQKLDAGRPLARPDGVLINGQTGKGKGKDVKPLF  207

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM+ GKTY++R+CNVGL+ S+NFR QGH MKLVE+EGSH VQN YDS+D+HVG C +VL+
Sbjct  208  TMKPGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTYDSLDVHVGQCFSVLI  267

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TAD++P+DYY+VA++RF K   ++  +I Y  G G P +S LP  P        WS+NQF
Sbjct  268  TADKDPRDYYMVASTRFTKSVLTATGIIRYTNGNGAPASSILPKAPEGWA----WSLNQF  323

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYGQI ITRTIKLV+S S  G K+RY INGVSHV+P TPL
Sbjct  324  RSFRWNLTASAARPNPQGSYHYGQINITRTIKLVSSASSAGGKLRYGINGVSHVNPPTPL  383

Query  165  KLAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEY+ V +KVFKYD + D P  E  T VT APNV+N T R FVEII ENHEK++
Sbjct  384  KLAEYYGVADKVFKYDTIPDEPLLEKATPVTPAPNVMNITFRTFVEIILENHEKSV  439



>ref|XP_003601596.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES71847.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=549

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 212/294 (72%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K HK LK  L  GRSI RP G+ IN K+       EP+ T
Sbjct  148  PVPYADPEDEYWVLIGDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYT  207

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CN GL+ ++NFRFQGH MKLVE EGSHVVQN YDS+D+HVG C  VLVT
Sbjct  208  MKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVT  267

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EP+DYY++A++R  K       ++ Y  GKG        P  P    G AWS+NQFR
Sbjct  268  ADKEPRDYYMIASTRMTKYNLLGKGIVRYTNGKG-----PASPVLPPAPVGWAWSLNQFR  322

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK V S S+   K+ YAINGVSHVDPETP+K
Sbjct  323  SFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLCYAINGVSHVDPETPVK  382

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKY+I+ D PP DL  +T+APNV+  T R F+EIIFEN EK +
Sbjct  383  LAEYYGVADKVFKYNIISDEPPTDLKAITIAPNVMQTTFRTFIEIIFENPEKVL  436



>ref|XP_003556690.2| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=557

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 218/294 (74%), Gaps = 9/294 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  PADE+ + + DW+ K H  LK+ L  GRSI RP G+ IN K+G     LEP+ T
Sbjct  160  PVPYADPADEYWVLIGDWFGKSHTALKQKLDSGRSIGRPVGVHINGKNGG----LEPLYT  215

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTY++R+CNVGL+ S+NFR QGH +KLVE EGSHVVQN+YDS+D+HVG C  VLVT
Sbjct  216  MEPGKTYKYRICNVGLKDSLNFRIQGHPLKLVETEGSHVVQNNYDSLDVHVGQCYTVLVT  275

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDY++VA++RF K+  ++  +I Y+ G G           P    G AWS+NQFR
Sbjct  276  ADQEPKDYFMVASTRFTKKVLTATRVIRYSNGVG-----PASGGLPPAPQGWAWSINQFR  330

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKLV + S    K+RY +NGVSHVD +TPLK
Sbjct  331  SFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTVSRANGKLRYGLNGVSHVDTQTPLK  390

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKY+++ D+P      +TVAPNV+NAT R+F+E+IFEN  K I
Sbjct  391  LAEYYGVADKVFKYNLISDSPDTAFPDLTVAPNVINATFRDFIEVIFENPGKVI  444



>ref|NP_187948.1| protein SKU5-like 13 [Arabidopsis thaliana]
 dbj|BAB01745.1| BNH protein; pectinesterase-like protein; pollen-secific protein-like 
[Arabidopsis thaliana]
 gb|AAL08265.1| AT3g13400/MRP15_3 [Arabidopsis thaliana]
 gb|AAL60046.1| putative pollen specific protein [Arabidopsis thaliana]
 gb|AAM20113.1| putative pollen-specific protein [Arabidopsis thaliana]
 gb|AEE75342.1| protein SKU5-like 13 [Arabidopsis thaliana]
Length=551

 Score =   360 bits (925),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 218/294 (74%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D+  I ++DWY K H  LK  L  GR++  P+G+ IN K G +G    P+ T
Sbjct  150  PVPYADPEDDRTILINDWYAKSHTALKNFLDSGRTLGSPDGVLINGKSGKLGGNNAPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  210  MKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        +     P+   G AWS+NQFR
Sbjct  270  ADQVAKNYYMVASTRFLKKEVSTVGVMSYEGSN-----VQASSDIPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  +K+    KVR+  NGVSHVD ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVNGKVRFGFNGVSHVDTETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + EKVFKY+++KD P   +T +TV PNV+N T R FVE++FENHEK++
Sbjct  385  LAEYFGMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEVVFENHEKSM  438



>ref|XP_003601597.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=554

 Score =   360 bits (924),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 175/294 (60%), Positives = 212/294 (72%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K HK LK  L  GRSI RP G+ IN K+       EP+ T
Sbjct  153  PVPYADPEDEYWVLICDWYGKSHKTLKMELDSGRSIGRPAGVIINGKNAKGDGSDEPLYT  212

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CN GL+ ++NFRFQGH MKLVE EGSHVVQN YDS+D+HVG C  VLVT
Sbjct  213  MKPGKTYKYRICNTGLKDTLNFRFQGHGMKLVETEGSHVVQNVYDSLDVHVGQCYTVLVT  272

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EP+DYY++A++R  K       +I Y  GKG        P  P    G AWS+NQFR
Sbjct  273  ADKEPRDYYMIASTRMTKYNLLGKGIIRYTNGKG-----PASPVLPPAPVGWAWSLNQFR  327

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIK V S S+   K+ YAINGVSHVDPETP+K
Sbjct  328  SFRWNLTASAARPNPQGSYHYGQINITRTIKFVNSVSNVNGKLCYAINGVSHVDPETPVK  387

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ + +KVFKY+I+ D PP DL  +T+APNV+  T R F+EIIFEN EK +
Sbjct  388  LAEYYGIADKVFKYNIISDEPPTDLKAITIAPNVMQTTFRTFIEIIFENPEKVL  441



>ref|XP_006353286.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=558

 Score =   360 bits (924),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 178/299 (60%), Positives = 222/299 (74%), Gaps = 10/299 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPF+ P  +  + + DWY K H  LK+LL  GR++ RP G+ IN K G    K EP+ T
Sbjct  151  PVPFETPEADHMVLVGDWYTKSHTELKRLLDSGRALGRPQGVVINGKSGKGDGKDEPMFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +  GKTYRFR+CNVGL+ SIN R QGH++KLVE+EGSH VQN Y+S+D+H+G C +VLVT
Sbjct  211  VTPGKTYRFRICNVGLKDSINVRMQGHTLKLVEIEGSHTVQNVYESLDIHLGQCFSVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDY+LVA++RF K+++ +   I YA GKG        P  P+   G AWS+NQFR
Sbjct  271  ANQEPKDYFLVASTRFTKDSHVATTTIRYANGKG-----PASPELPKAPEGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKLV S      K+RYA+NGVSHVDP TP+K
Sbjct  326  SFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGQVDGKLRYALNGVSHVDPTTPIK  385

Query  162  LAEYFQVPEKVFKYDIMKD----NPPE-DLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+   +KVFKYD++KD    +P +    K+TVAPNVVNAT+RNFVEI+ ENH K++
Sbjct  386  LAEYYGAGDKVFKYDLIKDEYEPSPGQAGQDKITVAPNVVNATYRNFVEIVIENHGKSV  444



>ref|XP_007208285.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
 gb|EMJ09484.1| hypothetical protein PRUPE_ppa003733mg [Prunus persica]
Length=552

 Score =   360 bits (924),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 178/295 (60%), Positives = 219/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKKLL  GRS+ARP+G+ IN K      K EP+  
Sbjct  150  PVPYADPEDDYTVLIGDWYTKSHTQLKKLLDSGRSMARPDGVLINGKSSKGDGKDEPLFV  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NFR QGHSMKLVELEGSH VQN YDSMD+H+G C +VLVT
Sbjct  210  MKPGKTYKYRICNVGLKNSLNFRIQGHSMKLVELEGSHTVQNTYDSMDVHLGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDYY+VA++RF K   +   +I Y  GKG        P  P+   G AWS+NQFR
Sbjct  270  ADKDPKDYYMVASTRFTKSVLTGKGIIRYENGKG-----PASPELPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I I+RTIKLV S S    K+RYAING+SHVD ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINISRTIKLVNSASKVDGKLRYAINGISHVDSETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLT-KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LA+Y++V +KVFK D MKD PP     K+T+  NVVN T ++FVEIIFEN EK++
Sbjct  385  LADYYKVWDKVFKPDTMKDTPPATAADKITMVTNVVNITIKDFVEIIFENPEKSL  439



>emb|CDY49392.1| BnaC09g53590D [Brassica napus]
Length=446

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 175/295 (59%), Positives = 217/295 (74%), Gaps = 7/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LK  L  GRSI RP G+ IN K G      EPI T
Sbjct  149  PVPYADPEDDYTVLIGDWYTKTHVALKDNLDSGRSIGRPEGVLINGKAGKPDGTGEPIFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ ++NFR Q H +KLVELEGSH +QN YDS+D+HVG C  VLVT
Sbjct  209  MKPGKTYKYRICNVGLKMALNFRIQNHKIKLVELEGSHTLQNLYDSLDLHVGQCFGVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDYY+VA++RF K   +S AL+ Y GGKG        P  P+   G AWS+NQFR
Sbjct  269  ADQEPKDYYMVASTRFLKTVLTSTALLRYEGGKGA-----ASPELPKPPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSH-EGDKVRYAINGVSHVDPETPL  166
            SFRWNLTASAARPNPQGSYHYG+I ITR+IKLV +    EG K+RYA++GVSHV+ ETP+
Sbjct  324  SFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTVGKIEGKKLRYALSGVSHVETETPI  383

Query  165  KLAEYFQVPEKVFKYDIMKDNPPE-DLTKVTVAPNVVNATHRNFVEIIFENHEKT  4
            KLA+YF V +KVFKYD +KD P + D + + V PNV+N  HR+FVEI+FEN E+T
Sbjct  384  KLAQYFGVADKVFKYDTIKDEPTKVDTSDILVQPNVLNIEHRSFVEIVFENQERT  438



>ref|XP_006299973.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
 gb|EOA32871.1| hypothetical protein CARUB_v10016186mg [Capsella rubella]
Length=551

 Score =   360 bits (923),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/294 (59%), Positives = 217/294 (74%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P ++  I ++DW+ K H  LK  L  GR++  P+G+ IN K G VG K EP+ T
Sbjct  150  PVPYADPEEDNTILINDWFTKSHTALKNFLDSGRTLGSPDGVLINGKSGKVGHKNEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M  GKTY+FR+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  210  MNPGKTYKFRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  K+YY+VA++RF K+  S+V ++SY G        E     P+   G AWS+NQFR
Sbjct  270  ADQVAKNYYMVASTRFLKKEVSTVGVLSYEGSN-----VEPSTELPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL  +K+    KVR+  NGVSHVD ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNVVNGKVRFGFNGVSHVDTETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            L EYF   +KVFKY+++KD P   +T +TV PNV+N T R FVEI+FENHEK++
Sbjct  385  LVEYFGFADKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHEKSM  438



>ref|XP_010247847.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
Length=552

 Score =   360 bits (923),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 220/296 (74%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSV-GDKLEPIA  706
            PVPF  P D++ + + DWY+KGH  LKKLL  GRS+ +P+G+ IN K G V G K EP+ 
Sbjct  149  PVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLINGKSGKVEGHKDEPLF  208

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM+  K YR+RVCNVGL+ S+NFR QGHS+KLVE+EGSH VQN YDS+D+HVG C +VLV
Sbjct  209  TMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSVLV  268

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TA+Q PKDYY+VA++RF K   S+  +I Y  GKG        P  PE   G AWS+NQF
Sbjct  269  TANQXPKDYYMVASTRFTKYMISATRIIRYTNGKG-----PASPVLPEAPVGWAWSLNQF  323

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYG I ITRTIKLV +      K+RYAING+SHVD +TPL
Sbjct  324  RSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLRYAINGMSHVDKDTPL  383

Query  165  KLAEYFQVPEKVFKYDIMKDNPP-EDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF V +KVFKYD + D P  +   K+ + PNV+NAT RNFVEII ENHEK+I
Sbjct  384  KLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSI  439



>ref|XP_010247849.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nelumbo nucifera]
Length=553

 Score =   360 bits (923),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 220/296 (74%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSV-GDKLEPIA  706
            PVPF  P D++ + + DWY+KGH  LKKLL  GRS+ +P+G+ IN K G V G K EP+ 
Sbjct  150  PVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLINGKSGKVEGHKDEPLF  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM+  K YR+RVCNVGL+ S+NFR QGHS+KLVE+EGSH VQN YDS+D+HVG C +VLV
Sbjct  210  TMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSVLV  269

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TA+Q PKDYY+VA++RF K   S+  +I Y  GKG        P  PE   G AWS+NQF
Sbjct  270  TANQXPKDYYMVASTRFTKYMISATRIIRYTNGKG-----PASPVLPEAPVGWAWSLNQF  324

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYG I ITRTIKLV +      K+RYAING+SHVD +TPL
Sbjct  325  RSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLRYAINGMSHVDKDTPL  384

Query  165  KLAEYFQVPEKVFKYDIMKDNPP-EDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF V +KVFKYD + D P  +   K+ + PNV+NAT RNFVEII ENHEK+I
Sbjct  385  KLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSI  440



>ref|XP_004296148.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=522

 Score =   358 bits (920),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/295 (58%), Positives = 220/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+D P +++ + + DWY K H  LK+ L  GR++ARP+G+ IN K      K EP+ T
Sbjct  150  PVPYDTPEEDYTVLIGDWYKKSHIALKQQLDSGRTLARPDGVLINGKDAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY+FR+CN+G+++S+NFR Q H M LVE+EGSH VQN Y S+D+H+G C+AVLVT
Sbjct  210  MKAGKTYKFRICNIGVKSSLNFRIQEHWMMLVEMEGSHTVQNTYQSLDVHLGQCMAVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ PKDYY+VA++RF K   +   ++ Y  GKG           PE   G AWS+NQFR
Sbjct  270  ADQTPKDYYMVASTRFTKTVLTGKGILRYENGKG-----PADSELPEAPEGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNL++SAARPNPQGSYHYG+I ITRT+KLV + +    K+RY+INGVSHVDPETPLK
Sbjct  325  SFRWNLSSSAARPNPQGSYHYGRINITRTMKLVNAATQVDGKLRYSINGVSHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL-TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFK   +KD+PP D+ TK  + PNVV+ THR+FVEIIFENHEK++
Sbjct  385  LAEYFGVGDKVFKTGSIKDDPPADVDTKAVILPNVVDQTHRDFVEIIFENHEKSL  439



>ref|XP_003529456.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=550

 Score =   359 bits (922),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 216/294 (73%), Gaps = 10/294 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  PADE+ + + DW+ K H  LK+ L  GRSI RP+G+ IN K+G     LE + T
Sbjct  150  PVPYADPADEYWVLIGDWFGKSHTALKQTLDSGRSIGRPSGVHINGKNGG----LEALYT  205

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTY++R+CNVGL+ ++NFR QGH MKLVE EGSHVVQN YDS+D+HVG C  VLVT
Sbjct  206  MEPGKTYKYRICNVGLKEALNFRIQGHPMKLVETEGSHVVQNTYDSLDVHVGQCFTVLVT  265

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEP+DY++VA++RF K+  ++  +I Y+ G G       P P         WS+NQFR
Sbjct  266  ADQEPRDYFMVASTRFTKKVITATRVIRYSNGVGPASPLLPPAPHQGWA----WSLNQFR  321

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKLV ++S  G K+RYA+NGVSHVDPETPLK
Sbjct  322  SFRWNLTASAARPNPQGSYHYGQINITRTIKLVGTRSKIGGKLRYALNGVSHVDPETPLK  381

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK--VTVAPNVVNATHRNFVEIIFENHEK  7
            LAEY+ V +KVFKY+++ D P   +      +APNV+NAT RNF+E+I EN  K
Sbjct  382  LAEYYGVADKVFKYNLISDAPDAAIASRDPIIAPNVINATFRNFIEVILENPTK  435



>ref|XP_010247848.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nelumbo nucifera]
Length=551

 Score =   359 bits (922),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 220/296 (74%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSV-GDKLEPIA  706
            PVPF  P D++ + + DWY+KGH  LKKLL  GRS+ +P+G+ IN K G V G K EP+ 
Sbjct  148  PVPFADPEDDYTVLIGDWYSKGHSSLKKLLDTGRSLGKPDGVLINGKSGKVEGHKDEPLF  207

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM+  K YR+RVCNVGL+ S+NFR QGHS+KLVE+EGSH VQN YDS+D+HVG C +VLV
Sbjct  208  TMKPHKXYRYRVCNVGLKXSLNFRIQGHSLKLVEMEGSHTVQNVYDSLDVHVGQCYSVLV  267

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TA+Q PKDYY+VA++RF K   S+  +I Y  GKG        P  PE   G AWS+NQF
Sbjct  268  TANQXPKDYYMVASTRFTKYMISATRIIRYTNGKG-----PASPVLPEAPVGWAWSLNQF  322

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYG I ITRTIKLV +      K+RYAING+SHVD +TPL
Sbjct  323  RSFRWNLTASAARPNPQGSYHYGAINITRTIKLVNTAGTVDGKLRYAINGMSHVDKDTPL  382

Query  165  KLAEYFQVPEKVFKYDIMKDNPP-EDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF V +KVFKYD + D P  +   K+ + PNV+NAT RNFVEII ENHEK+I
Sbjct  383  KLAEYFGVADKVFKYDSIPDEPKGKGSEKIVMGPNVLNATFRNFVEIILENHEKSI  438



>ref|XP_010093149.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53608.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=550

 Score =   359 bits (922),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 224/295 (76%), Gaps = 7/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K HK LK  L  GRS+ RP+G+ IN K G+  DK +P+ T
Sbjct  149  PVPYADPEDDYTVLIGDWYVKSHKTLKNFLDSGRSLGRPDGVLINGKSGN--DK-KPLFT  205

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NFR Q H MKLVE+EGSH VQN Y+S+D+HVG C +VLVT
Sbjct  206  MKPGKTYKYRICNVGLKDSLNFRIQDHPMKLVEMEGSHTVQNTYESLDVHVGQCFSVLVT  265

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+ PK+YY+VA++RF K   +  A+I Y  G+     S      PE   G AWS+NQFR
Sbjct  266  ADKAPKEYYMVASTRFTKTVLTGKAIIRYTNGR---KGSASLKNIPEAPVGWAWSLNQFR  322

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIK+V S S    K+RY INGVSHV+P TPLK
Sbjct  323  SFRWNLTASAARPNPQGSYHYGKIPITRTIKIVNSASRVKGKLRYGINGVSHVNPVTPLK  382

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLT-KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKYD++KD PP+ L+ +VT+APNVVN T RNFVEIIFENHEK++
Sbjct  383  LAEYYGVADKVFKYDLIKDEPPKKLSGEVTLAPNVVNQTFRNFVEIIFENHEKSL  437



>ref|XP_009124743.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   359 bits (922),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/294 (56%), Positives = 216/294 (73%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            P+P+D P D++ + + DWY K H  LKK L  GR++ RPNG+ IN K G       P+ T
Sbjct  151  PIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GK+YR R+CNVGL+TS+NFR Q H MKLVE+EGSHV+QND+DS+D+HVG C   +VT
Sbjct  211  LKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGTIVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLT++AARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NG+SH D ETPLK
Sbjct  326  SFRWNLTSNAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDLETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKY+ + +  PE    + + P+V+N THRNF+E++FENHEK++
Sbjct  386  LAEYFGIADKVFKYNSVDNPTPEQTKSIKIEPHVLNITHRNFIEVVFENHEKSV  439



>ref|XP_010552291.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=549

 Score =   359 bits (921),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 219/294 (74%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  +K LL  GR++  P+G+ IN K   +  K +P+ T
Sbjct  149  PVPYADPEDDYTVLINDWYTKSHTSIKNLLDSGRALGSPDGVLINGKSAKMDGKDQPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY+FR+CNVG ++++NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C AVLVT
Sbjct  209  MKPGKTYKFRICNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFAVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ  KDYY+VA++RF K+  +S  ++ Y GG       +     P+   G AWS+NQFR
Sbjct  269  ADQAAKDYYMVASTRFLKKEMTSTGVLRYVGGSA-----QASTVLPKAPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV S+     K+++ +NGVSH+D ETPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNSQQVVNGKLKFGLNGVSHIDTETPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYFQ+ EKVFKY+++KD P   + ++TV PNV+N T R FVE+IFEN EK++
Sbjct  384  LAEYFQMAEKVFKYNVIKDEPGAMIKQLTVEPNVLNITFRTFVEVIFENREKSM  437



>ref|XP_004137383.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=553

 Score =   359 bits (921),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 180/298 (60%), Positives = 220/298 (74%), Gaps = 12/298 (4%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GRSIARP+G+ IN +        EP+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGRIAKGDGTDEPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+  KTY++R+CNVGL+TS+NFR QGH+MKLVE+EGSH VQN Y S+D+HVG C +VLVT
Sbjct  211  MKPEKTYKYRICNVGLKTSLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDYY+VA++RF K       +I Y  GK         P  PE   G AWS+NQFR
Sbjct  271  ADKDPKDYYMVASTRFTKNILVGKGIIRYTNGKA-----PASPEIPEAPRGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTASAARPNPQGSYHYG I ITRTIK+V S ++   K+RYAINGVSHVDPETPLK
Sbjct  326  TFRWNLTASAARPNPQGSYHYGSINITRTIKIVNSATNVDGKLRYAINGVSHVDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK----VTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF+V +KVFKYD + D   E L+K    VTVAPNV+NAT RNFVEI+FEN EK++
Sbjct  386  LAEYFEVADKVFKYDTISD---EGLSKTANIVTVAPNVLNATFRNFVEIVFENQEKSL  440



>ref|XP_009376784.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=706

 Score =   363 bits (933),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 220/294 (75%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  L+K L  GRS+ARP+G+ IN K      K EP+ T
Sbjct  150  PVPYAAPEDDYTVIIGDWYTKSHSQLRKFLDSGRSMARPDGVLINGKSAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NFR QGH MKLVE+EGSH VQN YDS+D+H+G C ++LVT
Sbjct  210  MKAGKTYKYRICNVGLKNSLNFRIQGHQMKLVEMEGSHTVQNTYDSLDVHIGQCFSMLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDYY+VA++RF K   +   +I Y  GKG      + P  P+   G AWS+NQFR
Sbjct  270  ADKEPKDYYMVASTRFTKSVLTGKGIIRYENGKG-----PVSPEVPKAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKL+ S S    K+RYAING+SHVDPETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKLINSASKADGKLRYAINGISHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LA+Y+ + EKVFK+D MK +P     K+T+ PNV+N T ++FVEIIFEN EK++
Sbjct  385  LADYYGIREKVFKFDTMKVDPQSPAEKITMEPNVLNITIKDFVEIIFENPEKSL  438



>ref|XP_004165665.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Cucumis 
sativus]
Length=553

 Score =   358 bits (920),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 180/298 (60%), Positives = 220/298 (74%), Gaps = 12/298 (4%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GRSIARP+G+ IN +        EP+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHSTLKKFLDSGRSIARPDGVLINGRIAKGDGTDEPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+  KTY++R+CNVGL+TS+NFR QGH+MKLVE+EGSH VQN Y S+D+HVG C +VLVT
Sbjct  211  MKPEKTYKYRICNVGLKTSLNFRIQGHTMKLVEMEGSHTVQNVYQSLDVHVGQCFSVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDYY+VA++RF K       +I Y  GK         P  PE   G AWS+NQFR
Sbjct  271  ADKDPKDYYMVASTRFTKNILVGKGIIRYTNGKA-----PASPEIPEAPRGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTASAARPNPQGSYHYG I ITRTIK+V S ++   K+RYAINGVSHVDPETPLK
Sbjct  326  TFRWNLTASAARPNPQGSYHYGSINITRTIKIVNSATNVDGKLRYAINGVSHVDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK----VTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF+V +KVFKYD + D   E L+K    VTVAPNV+NAT RNFVEI+FEN EK++
Sbjct  386  LAEYFEVADKVFKYDTISD---EGLSKTANIVTVAPNVLNATFRNFVEIVFENQEKSL  440



>ref|XP_004505355.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=550

 Score =   357 bits (917),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 212/294 (72%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  L KLL  GRS+ RP  + +N +        +P+ T
Sbjct  150  PVPYADPEDDYTVLIGDWYTKSHTALAKLLDSGRSLGRPQAVLVNGQVAKGDGSDKPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NFR QGH MKLVE EGSH VQN YDS+D+H+G C  VLVT
Sbjct  210  MKPGKTYKYRICNVGLKNSLNFRIQGHPMKLVEFEGSHTVQNSYDSLDVHLGQCFGVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDYY+VA++RF K   +   +I Y  GKG        P  PE   G AWS+NQFR
Sbjct  270  ADKDPKDYYMVASTRFTKSIVTGKGIIRYTNGKG-----PASPELPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SF WNLTASAARPNPQGSYHYGQI ITRT+KL+ S S +  K+RYA+NG+SHVDPETPLK
Sbjct  325  SFHWNLTASAARPNPQGSYHYGQINITRTVKLINSVSRDNSKLRYALNGISHVDPETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + EKVFKYD + D P    + VT+ PNV+N  HR F+EIIFENHEK++
Sbjct  385  LAEYFGIAEKVFKYDSIPDMPQSVPSSVTLQPNVLNFKHRTFIEIIFENHEKSV  438



>emb|CAA47176.1| Bplo [Brassica napus]
Length=554

 Score =   357 bits (917),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 168/295 (57%), Positives = 219/295 (74%), Gaps = 7/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            P+P+D P D++ + + DWY K H  LKK L  GR++ RPNG+ IN K G       P+ T
Sbjct  151  PIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GK+YR R+CNVGL+TS+NFR Q H MKLVE+EGSHV+QND+DS+D+HVG C   +VT
Sbjct  211  LKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGTIVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLT++AARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NG+SH D ETPLK
Sbjct  326  SFRWNLTSNAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDLETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK-VTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKY+ + DNP  + TK + + P+V+N THRNF+E++FENHEK++
Sbjct  386  LAEYFGIADKVFKYNSV-DNPTAEQTKSIKIEPHVLNITHRNFIEVVFENHEKSV  439



>gb|EYU39761.1| hypothetical protein MIMGU_mgv1a003754mg [Erythranthe guttata]
Length=566

 Score =   358 bits (918),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 181/303 (60%), Positives = 224/303 (74%), Gaps = 13/303 (4%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG-----SVGDKL  718
            PVPFD P D++ +F+ DWY KGH  L+KLL  GRS+ RP+G+ IN K         G + 
Sbjct  155  PVPFDLPEDDYFVFVGDWYKKGHASLRKLLDGGRSLGRPDGVIINGKGSFGTGNKTGGED  214

Query  717  EPIATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCL  538
             P+ TM   KTYR+R CNVG++ S+N R QGH+MK+VE+EGSH VQN YDS+D+H+G C 
Sbjct  215  SPMFTMIAKKTYRYRFCNVGMKDSVNVRIQGHTMKIVEIEGSHTVQNVYDSLDVHLGQCY  274

Query  537  AVLVTADQEPK-DYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAW  361
            +VLVTADQ+P+ DYYLVA++RF K+  +S A+I Y GG  V       P  P    G+ W
Sbjct  275  SVLVTADQKPESDYYLVASTRFSKKALTSTAIIRYVGGGQV----PPSPELPPAPVGLPW  330

Query  360  SMNQFRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASK-SHEGDKVRYAINGVSHV  184
            S+NQFRSFRWNLTASAARPNPQGSYHYG+I+ITRTIK V    S  G K RY+INGVSHV
Sbjct  331  SINQFRSFRWNLTASAARPNPQGSYHYGKIDITRTIKFVLKPFSKVGGKRRYSINGVSHV  390

Query  183  DPETPLKLAEYFQVPEKVFKYDIMKDNPPE-DL-TKVTVAPNVVNATHRNFVEIIFENHE  10
            DPETPLKLAEY+ V +KVFKYD++KD P + DL  +V VAPNV+N T RNFVEII ENH+
Sbjct  391  DPETPLKLAEYYGVADKVFKYDMIKDQPSDSDLAAEVIVAPNVINGTFRNFVEIILENHD  450

Query  9    KTI  1
            K++
Sbjct  451  KSV  453



>ref|XP_004250092.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=555

 Score =   357 bits (916),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 178/298 (60%), Positives = 220/298 (74%), Gaps = 11/298 (4%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPF+ P  +  +   DWY K H  LK++L  GR++ RP G+ IN K G    K EP+ T
Sbjct  151  PVPFETPEADHMVLAGDWYTKSHVELKRMLDSGRALGRPTGVLINGKSGKGDGKDEPMFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +  GKTYRFR CNVG++ SIN R QGH+MKLVE+EGSH VQN Y+S+D+H+G C +VLVT
Sbjct  211  VIAGKTYRFRFCNVGMKDSINVRMQGHTMKLVEIEGSHTVQNVYESIDIHLGQCFSVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYYLV ++RF K+++ + A I YA GKG        P  P+   G AWS+NQFR
Sbjct  271  ANQEPKDYYLVVSTRFTKDSHVATATIRYANGKG-----PASPELPKAPEGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKLV S      K+RYA+NGVSHVD  TP+K
Sbjct  326  SFRWNLTASAARPNPQGSYHYGQINITRTIKLVTSAGQVDGKLRYALNGVSHVDTATPIK  385

Query  162  LAEYFQVPEKVFKYDIMKD----NPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+   +KVFKY+++KD    NP +D  K+TVAPNVVNAT+RN+VEI+ ENH KT+
Sbjct  386  LAEYYGAGDKVFKYNLIKDEYEPNPGQD--KITVAPNVVNATYRNYVEIVIENHGKTV  441



>emb|CDY24189.1| BnaC01g37690D [Brassica napus]
Length=554

 Score =   357 bits (916),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/295 (57%), Positives = 219/295 (74%), Gaps = 7/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            P+P+D P D++ + + DWY K H  LKK L  GR++ RPNG+ IN K G       P+ T
Sbjct  151  PIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GK++R R+CNVGL+TS+NFR Q H MKLVE+EGSHV+QND+DS+D+HVG C   +VT
Sbjct  211  LKPGKSHRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGTIVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLT+SAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NG+SH D ETPLK
Sbjct  326  SFRWNLTSSAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDLETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK-VTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKY+ + DNP  + TK + + P+V+N THRNF+E++FENHEK++
Sbjct  386  LAEYFGIADKVFKYNSV-DNPTAEQTKSIKIEPHVLNITHRNFIEVVFENHEKSV  439



>ref|XP_010034521.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW52299.1| hypothetical protein EUGRSUZ_J01719 [Eucalyptus grandis]
Length=551

 Score =   357 bits (915),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 174/295 (59%), Positives = 218/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LK  L  GR++ RP+G+ IN K      K EP+ T
Sbjct  149  PVPYADPKDDYTVMIGDWYTKSHTQLKSFLDSGRALGRPDGVLINGKSNKSRGKDEPLFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NFR Q H MKLVE+EGSH VQN+Y+S+D+HVG C  VLVT
Sbjct  209  MKPGKTYKYRICNVGLKNSLNFRIQDHPMKLVEMEGSHTVQNNYESLDVHVGQCFGVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD++PKDY +VA++RF K   ++ A++SY  GKG     +  P  P+   G AWS+NQFR
Sbjct  269  ADKKPKDYLMVASTRFTKTVLTTTAVVSYTNGKG-----QASPEIPKAPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I ITRTIKLV S S   DK+RYAINGVSH +P+TPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGHINITRTIKLVNSASKVNDKLRYAINGVSHEEPKTPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL-TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKY+ ++D+PP  +  KVTV PNV N T R FVEII ENHE +I
Sbjct  384  LAEYYNVVDKVFKYNAIQDDPPATVGDKVTVEPNVANITFRTFVEIILENHENSI  438



>ref|XP_010552290.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score =   357 bits (915),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 171/296 (58%), Positives = 217/296 (73%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLE-PIA  706
            PVP+  P D++ + + DWY K H  LKK L  GRS+ RP+GI IN K G      + P+ 
Sbjct  151  PVPYADPEDDYTVLIGDWYAKSHTALKKFLDSGRSLGRPDGILINGKSGKGSSGSDAPLF  210

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM+ GKTYR R+CNVG++TS+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C   +V
Sbjct  211  TMKPGKTYRVRICNVGIKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCYGTIV  270

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TADQ+PKDY +VA+SRF K   S+  ++ Y GGKG           P    G AWS+NQF
Sbjct  271  TADQDPKDYLMVASSRFLKSVISTTGVLRYDGGKG-----PASSEIPAAPVGWAWSLNQF  325

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYG+I ITRTIK V ++     K+RYA++GVSH DPETP+
Sbjct  326  RSFRWNLTASAARPNPQGSYHYGKINITRTIKFVNTQGKADGKLRYALSGVSHTDPETPV  385

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTK-VTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF + +KVFKY+I+ D+P  D TK + + PN++N THR FVE+IFENHE+++
Sbjct  386  KLAEYFGMADKVFKYNIISDSPTSDQTKTIKIEPNILNVTHRTFVEVIFENHERSV  441



>emb|CDY43353.1| BnaA01g29840D [Brassica napus]
Length=554

 Score =   356 bits (914),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 215/294 (73%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            P+P+D P D++ + + DWY K H  LKK L  GR++ RPNG+ IN K G       P+ T
Sbjct  151  PIPYDVPEDDYTVLIGDWYTKSHTQLKKFLDGGRTLGRPNGVLINGKAGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ++ GK+YR R+CNVGL+TS+NFR Q H MKLVE+EGSHV+QND+DS+D+HVG C   +VT
Sbjct  211  LKPGKSYRVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDFDSLDVHVGQCFGTIVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QE KDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+NQFR
Sbjct  271  ANQEAKDYYMVASSRFLKSVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLT++AARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NG+SH D ETPLK
Sbjct  326  SFRWNLTSNAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRYALNGISHTDLETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + +KVFKY+ + +  PE    + + P+V+N THRNF+E++FENHEK++
Sbjct  386  LAEYFGIADKVFKYNSVDNPTPEQTKSIKIEPHVLNITHRNFIEVVFENHEKSV  439



>gb|AGW80453.1| pollen-specific protein [Gossypium hirsutum]
Length=551

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/294 (57%), Positives = 218/294 (74%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  PAD++ + + D++NKGH  LKK+L  GR++ R +G+ +N K      K EP+ T
Sbjct  150  PVPYADPADDYTLLVGDFFNKGHTSLKKILDSGRNLGRCDGVHLNGKVAKGDRKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTY++R+CN G++TS+N RFQGH+MKLVE+EGSH +QNDYDS+D+HVG C +VLVT
Sbjct  210  MEAGKTYKYRICNTGIKTSLNVRFQGHTMKLVEMEGSHTMQNDYDSLDVHVGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEP+DYY+VA++RF +   ++  +I Y  GKG           P    G AWS+NQFR
Sbjct  270  ANQEPRDYYVVASTRFTRREVTATGIIRYKNGKGA-----ASSELPPPPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLT++AARPNPQGSY YG I ITRTIKL  +      K+RYA+NGVS+V+P TPLK
Sbjct  325  TFRWNLTSNAARPNPQGSYKYGSINITRTIKLANTAQKVDGKLRYALNGVSYVEPTTPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKYD + D P  D TKVT+AP V+N THRNFVEIIFENHE  I
Sbjct  385  LAEYYGVADKVFKYDTIPDEPQSDNTKVTLAPIVLNMTHRNFVEIIFENHESAI  438



>ref|XP_003607814.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90011.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=550

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 213/294 (72%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DW+ K H  L KLL  GR++ RP  + +N ++       +P+ T
Sbjct  150  PVPYADPEDDYTVLIGDWFTKSHSTLSKLLDSGRALGRPQAVLVNGQNAKGDGSDKPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ S+NF  Q H MKLVE EGSH VQN YDS+D+HVG C  VLVT
Sbjct  210  MKPGKTYKYRICNVGLKNSLNFGIQNHPMKLVEFEGSHTVQNSYDSLDVHVGQCFGVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPKDYY+VA++RF K   +   ++ YA GKG        P  PE   G AWS+NQFR
Sbjct  270  ADKEPKDYYMVASTRFTKTVITGKGIMRYANGKG-----PASPELPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRT+KL+ + S EG K+RYA+NGVSHVD ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGQINITRTVKLINTVSREGGKLRYALNGVSHVDTETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V EKVFKYD + D P    T VT+APNV+   HR F+EI+FENHEK++
Sbjct  385  LAEYYNVAEKVFKYDTIPDMPENLGTSVTLAPNVLKFKHRTFIEIVFENHEKSV  438



>ref|XP_009120150.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=554

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/295 (59%), Positives = 217/295 (74%), Gaps = 7/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LK  L  GRSI RP G+ IN K G      EPI T
Sbjct  149  PVPYPDPEDDYTVLIGDWYTKTHVALKDNLDSGRSIGRPEGVLINGKAGKPDGTGEPIFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CNVGL+ ++NFR Q H +KLVELEGSH +QN YDS+D+HVG C  VLVT
Sbjct  209  MKPGKTYKYRICNVGLKMALNFRIQNHKIKLVELEGSHTLQNLYDSLDLHVGQCFGVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDYY+VA++RF K   +S AL+ Y GGKG        P  P+   G AWS+NQFR
Sbjct  269  ADQEPKDYYMVASTRFLKTVLTSTALLRYEGGKGA-----ASPELPKPPVGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSH-EGDKVRYAINGVSHVDPETPL  166
            SFRWNLTASAARPNPQGSYHYG+I ITR+IKLV +    EG K+RYA++GVSHV+ ETP+
Sbjct  324  SFRWNLTASAARPNPQGSYHYGKINITRSIKLVNTVGKIEGKKLRYALSGVSHVETETPI  383

Query  165  KLAEYFQVPEKVFKYDIMKDNPPE-DLTKVTVAPNVVNATHRNFVEIIFENHEKT  4
            KLA+YF V +KVFKYD +KD P + D + + V PNV+N  HR+FVEI+FEN E+T
Sbjct  384  KLAQYFGVADKVFKYDTIKDEPTKVDTSNILVQPNVLNIEHRSFVEIVFENQERT  438



>gb|KHG03555.1| L-ascorbate oxidase [Gossypium arboreum]
 gb|KHG09844.1| L-ascorbate oxidase [Gossypium arboreum]
Length=551

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 217/294 (74%), Gaps = 5/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  PAD++ I   D++NKGH  LKK+L  GR++ R +G+ IN K        EP+ T
Sbjct  150  PVPYADPADDYTIIAGDFFNKGHTTLKKILESGRNLGRCDGVHINGKVAKGDGSDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTY++R+CN GL+TS+N RFQGH+MKLVE+EGSH VQNDY+S+D+HVG C +VLVT
Sbjct  210  MEAGKTYKYRICNAGLKTSLNVRFQGHNMKLVEMEGSHTVQNDYESLDVHVGQCFSVLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEP DY++VA++RF K+  ++  +I Y  GKG        P  P    G AWS+NQFR
Sbjct  270  ADQEPMDYFVVASTRFTKQEVTATGVIRYTNGKGA-----PSPKLPPPPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            +FRWNLTASAARPNPQGSY YG + ITRTIKL  +      K+RYAING S+V+P TPLK
Sbjct  325  TFRWNLTASAARPNPQGSYKYGSVNITRTIKLANTAQKVDGKLRYAINGASYVEPTTPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V +KVFKYD + D+PP ++TK+T+ P V+N THRNF+EIIFEN E  I
Sbjct  385  LAEYYGVADKVFKYDTIPDDPPAEITKITMEPVVLNLTHRNFMEIIFENRETAI  438



>ref|XP_010093150.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB53609.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=535

 Score =   354 bits (908),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/295 (59%), Positives = 214/295 (73%), Gaps = 5/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ I + DWY + H  L+K L  GRS+ RP+G+ IN K        EP+ T
Sbjct  132  PVPYADPEDDYTILIGDWYTESHSTLRKFLDIGRSLGRPDGVLINGKSAKSDGSDEPLFT  191

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GK Y++R+CNVGL+ S+NFR QGH +KLVE+EGSH VQN Y+S+D+HVG C AVLVT
Sbjct  192  MKPGKIYKYRICNVGLKNSLNFRIQGHPLKLVEMEGSHTVQNTYESLDVHVGQCFAVLVT  251

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+ PKDY +VA++RF K   +   +I Y   K     +   P   E   G AWS+NQFR
Sbjct  252  ADKAPKDYLVVASTRFTKNVLTGKGIIRYTNAK----PAPPSPDVVEAPVGWAWSLNQFR  307

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLT+SAARPNPQGSYHYG+I ITRTIKLV S      K+RYAINGVSHVDP TPLK
Sbjct  308  SFRWNLTSSAARPNPQGSYHYGKINITRTIKLVNSAVRVQGKLRYAINGVSHVDPYTPLK  367

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL-TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+QV +KVFKYDI+ D PP +   K+TVA NVVN T RNFVEIIFENHEK++
Sbjct  368  LAEYYQVADKVFKYDIISDEPPANAGDKITVATNVVNQTFRNFVEIIFENHEKSL  422



>ref|XP_008374029.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=552

 Score =   354 bits (908),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 176/295 (60%), Positives = 217/295 (74%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P DE+ + + DWY K H  LKKLL  GR++ RP+ I IN K+     K EP+ T
Sbjct  150  PVPYADPEDEYTVMIGDWYTKSHTALKKLLDSGRTMGRPDXILINGKNAKGDGKDEPLFT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++RVCNVG + S+NFR QGH +KLVE+EGSH VQN Y+S+D+H+G C ++LVT
Sbjct  210  MKPGKTYKYRVCNVGFKNSLNFRIQGHPLKLVEMEGSHTVQNTYESLDVHLGQCFSLLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+E KDYY+VA++RF K   +   +I Y    G        P  PE   G AWS+NQFR
Sbjct  270  ADKERKDYYMVASTRFTKTVLTGKGIIRYENXNG-----PASPELPEAPVGWAWSLNQFR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIK+V S S    K+RYAINGVS+V+ ETPLK
Sbjct  325  SFRWNLTASAARPNPQGSYHYGKINITRTIKIVNSASXVNGKLRYAINGVSYVESETPLK  384

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLT-KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LA+YF V +KVFKYD ++D PP  +  KVT+APNVVN T R FVEIIFENHEK+I
Sbjct  385  LAQYFGVADKVFKYDTIQDEPPATVEDKVTLAPNVVNQTFRXFVEIIFENHEKSI  439



>gb|EYU39505.1| hypothetical protein MIMGU_mgv1a003980mg [Erythranthe guttata]
Length=551

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/295 (58%), Positives = 215/295 (73%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFDWP +E+ +   DWY K H  LK+ +  G++I R +G+ IN K G       P+ T
Sbjct  149  PVPFDWPEEEYIVLTGDWYRKSHTELKRHMDNGKTIGRTDGVIINGKQGKGDGSDPPMFT  208

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M  GKTYR+R CNVG++ S+N R QGH+MKLVE+EGSH VQN YDS+D+H+G C +VLVT
Sbjct  209  MIPGKTYRYRFCNVGMKNSLNVRIQGHTMKLVEIEGSHTVQNVYDSLDVHMGQCYSVLVT  268

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+PKDYYLV+++RF K    + A I Y G           P  PE   G AWS+NQFR
Sbjct  269  ADQKPKDYYLVSSTRFTKTVLMTTATIRYTGSN-----EPASPVLPEAPTGWAWSLNQFR  323

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIK V +      K+RYAING+SH++ +TPLK
Sbjct  324  SFRWNLTASAARPNPQGSYHYGKINITRTIKFVNTAGTVDRKLRYAINGLSHMNTDTPLK  383

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL-TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ + ++VFKYDI+ D+PP D+ TKVT+APNV+    RNFVEIIFENHEK++
Sbjct  384  LAEYYGIQDQVFKYDIITDDPPADVGTKVTIAPNVITGIFRNFVEIIFENHEKSV  438



>ref|XP_004234818.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=556

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/299 (60%), Positives = 224/299 (75%), Gaps = 10/299 (3%)
 Frame = -2

Query  882  PVPFDW-PADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIA  706
            P+PFD  PADEF + +SDWY K H  L+K L  GRS+ RP+G+ IN K G+   K EP+ 
Sbjct  150  PIPFDINPADEFFVLVSDWYTKSHTQLRKFLDSGRSMGRPDGVIINGKGGNGDGKDEPMF  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            +M  GKTYR+R CN G + SIN R QGH+MKLVE+EGSHVVQN YDS+D+H+G C++VLV
Sbjct  210  SMTPGKTYRYRFCNAGNKDSINVRIQGHTMKLVEIEGSHVVQNMYDSLDIHLGQCVSVLV  269

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TAD++PKDY LVA++RF KE +++ ++I Y  GKG        P  P+   G AWS+NQF
Sbjct  270  TADKDPKDYLLVASTRFTKEPHTATSIIRYTNGKG-----PASPELPKAPIGWAWSLNQF  324

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYGQI ITRTIKLV +      K+RYA NG+SHV+P TP+
Sbjct  325  RSFRWNLTASAARPNPQGSYHYGQINITRTIKLVNTAGTVDGKLRYAFNGISHVNPTTPI  384

Query  165  KLAEYFQVPEKVFKYDIMKD--NPPEDLT--KVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEY+ V +KVFKYD+MKD   PP      K+T+APNVV   +RN+VEIIFENHEK++
Sbjct  385  KLAEYYGVEDKVFKYDLMKDEYEPPAGKAEEKITLAPNVVKVIYRNYVEIIFENHEKSV  443



>ref|XP_009417950.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=560

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/296 (58%), Positives = 213/296 (72%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVPF  PAD++ + + DWY K HK L KLL  GR+I RP G+ IN + G  S G    P+
Sbjct  158  PVPFADPADDYTVLIGDWYTKSHKILAKLLDSGRTIGRPAGVLINGRSGKDSTGKDDPPL  217

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             TME GKTYR+R+CNVG++ ++NFR Q HSMKLVE++GSH +QN Y+S+D+HVG CL+ L
Sbjct  218  FTMEAGKTYRYRICNVGMKVTLNFRIQSHSMKLVEMDGSHTMQNVYESLDIHVGQCLSAL  277

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            V A Q PKDYY+VA+SRF K T ++  LI YAG       +      P    G AWS NQ
Sbjct  278  VEATQAPKDYYMVASSRFTKYTLTASGLIRYAGSN-----TPPSQDLPAAPVGWAWSFNQ  332

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +RSFRWNLTASAARPNPQGSYHYG I+ITRTIKLV S  H   K RYA+N VSH D  TP
Sbjct  333  WRSFRWNLTASAARPNPQGSYHYGSIDITRTIKLVNSVGHVNGKRRYALNAVSHQDTATP  392

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEYF + +KVFKY+I+ D+PP     + +APNV+NAT RNF+EIIFEN E+++
Sbjct  393  LKLAEYFGIADKVFKYNIIGDDPPASTAPIKIAPNVMNATFRNFIEIIFENPERSM  448



>ref|XP_011077090.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=558

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 220/295 (75%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            P+PF+ P  EF++ + DWY+KGH  LKK L  GRS+ RP+G+ IN K G+   K   I  
Sbjct  151  PIPFNSPEAEFNVLVGDWYSKGHVTLKKFLDSGRSLGRPDGVVINGKSGNEAPKWNLIP-  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
               GKTYR+R+CNVG++ S+N R QGH+MKLVE+EGSH VQN YDS+D+H+G C +VLVT
Sbjct  210  ---GKTYRYRICNVGMKNSVNVRIQGHTMKLVEIEGSHTVQNVYDSLDIHLGQCNSVLVT  266

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ PKDY  V ++RF K   ++   I Y G   +P ++ELP  P     GIAWS+NQFR
Sbjct  267  ADQTPKDYAFVVSTRFTKTVLTTTGTIHYEGSN-IPASTELPAAPGNAPEGIAWSINQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            S RWNLTASAARPNPQGSYHYG+I ITRTIK+V S S   DK+RYA+NGVSH DPETPLK
Sbjct  326  SLRWNLTASAARPNPQGSYHYGKINITRTIKIVNSASRGEDKLRYAVNGVSHTDPETPLK  385

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK-VTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V +KVFKYD++KD P  D    +T+APNVVN T RNF+EIIFENHEK+I
Sbjct  386  LAEYFGVSDKVFKYDLIKDEPSADAEDHITIAPNVVNGTFRNFIEIIFENHEKSI  440



>ref|XP_009412658.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=545

 Score =   352 bits (902),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 215/294 (73%), Gaps = 8/294 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPF  PAD++ + +SDWY K HK L  LL  GRSI  P G+ IN   G  G    P+ T
Sbjct  148  PVPFADPADDYTVLISDWYTKSHKALAGLLDAGRSIGNPAGVLIN---GLTGKDNAPLFT  204

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTYR+R+CNVGL+ S+NFR Q H MKLVE++GSH VQNDY+S+D+HVG CL+VLVT
Sbjct  205  MEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQNDYESLDVHVGQCLSVLVT  264

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QE KDYY+VA++RF K + S+  +I YAG           P  P+   G AWS NQ+R
Sbjct  265  ANQEAKDYYMVASTRFTKYSLSATGIIRYAG-----SVVPPSPELPKAPVGWAWSFNQWR  319

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            S RWNLTASAARPNPQGSYHYG I ITRTI+L +S      K R+A+NGVSHVDP TPLK
Sbjct  320  SLRWNLTASAARPNPQGSYHYGGINITRTIRLASSVGLVNGKRRFALNGVSHVDPPTPLK  379

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ + +KVFKYD + D+PPE    +TVAPNV+NAT+R+++EII EN E++I
Sbjct  380  LAEYYGIADKVFKYDSISDDPPETNAPITVAPNVLNATYRDYIEIILENPERSI  433



>gb|KFK27206.1| hypothetical protein AALP_AA8G349600 [Arabis alpina]
Length=559

 Score =   352 bits (902),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 171/295 (58%), Positives = 217/295 (74%), Gaps = 7/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            P+P+  P D++ + + DWY K H  LK  L  GRSI RP G+ IN K G      EPI T
Sbjct  154  PIPYADPEDDYTVLIGDWYTKTHVTLKNNLDSGRSIGRPAGVLINGKSGKPDGTGEPIFT  213

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTYR+R+CNVG++ ++NFR Q H +KLVELEGSH +QN YDS+D+HVG C  VLVT
Sbjct  214  MKPGKTYRYRICNVGMKMALNFRIQNHKIKLVELEGSHTLQNLYDSLDLHVGQCFGVLVT  273

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDYY+VA++RF K   +S A++ Y GGKG        P  P+   G AWS+NQFR
Sbjct  274  ADQEPKDYYMVASTRFLKSVLTSTAILRYEGGKGA-----ASPQLPKSPVGWAWSLNQFR  328

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVAS-KSHEGDKVRYAINGVSHVDPETPL  166
            SFRWNLT++AARPNPQGSYHYG+I ITR+IKLV +    +G K+RYA++GVSHV+ +TP+
Sbjct  329  SFRWNLTSNAARPNPQGSYHYGKINITRSIKLVNTIGKDDGKKLRYALSGVSHVETDTPV  388

Query  165  KLAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKT  4
            KLA+YF V +KVFKYD +KD P   + +K+ V PNV+N  HR FVEI+FENHEKT
Sbjct  389  KLAQYFGVADKVFKYDTIKDEPTAAETSKILVQPNVLNIEHRAFVEIVFENHEKT  443



>gb|KHG05644.1| L-ascorbate oxidase [Gossypium arboreum]
Length=535

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/295 (58%), Positives = 221/295 (75%), Gaps = 7/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  PAD++ +   D++NKG+  LKK+L  GR++ R +G+ IN K        EP+ T
Sbjct  134  PVPYADPADDYTLIAGDFFNKGYTSLKKVLLSGRNLGRCDGVHINGKVAKGDGNDEPLFT  193

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTY++R+CN G++TS+N RFQGH+MKLVE+EGSH VQNDY+S+D+HVG C +VLVT
Sbjct  194  MEAGKTYKYRICNAGIKTSLNVRFQGHTMKLVEMEGSHTVQNDYESLDVHVGQCFSVLVT  253

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDY++VA++RF K    +  +I Y  GKG        P  P      AWS+NQFR
Sbjct  254  ANQEPKDYFVVASTRFTKREVIATGVIRYNNGKGA-----PSPKLPPPPVSWAWSLNQFR  308

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGD-KVRYAINGVSHVDPETPL  166
            +FRWNLTASAARPNPQGSY YG I ITRTIKL A+ +H+ D K+RYA+NGVS+V+P TPL
Sbjct  309  TFRWNLTASAARPNPQGSYKYGSINITRTIKL-ANTAHKVDGKLRYALNGVSYVEPTTPL  367

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEY+ V +KVFKYD + D+PP ++TKVT+ P V+N THRNF+EIIFEN E  I
Sbjct  368  KLAEYYNVADKVFKYDNIPDDPPAEITKVTMEPIVLNMTHRNFIEIIFENRETAI  422



>ref|XP_009384956.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=550

 Score =   350 bits (897),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/296 (58%), Positives = 212/296 (72%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVPFD PAD++ + + DWY K HK L +LL  GRSI  P G+ IN   G  + G    P+
Sbjct  148  PVPFDDPADDYTVLIGDWYTKSHKVLAQLLDAGRSIGNPAGVIINGSPGKDAAGKDDAPL  207

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             TME GKTYR+R+CNVGL+ S+NFR Q H MKLVE++GSH VQNDY S+D+HVG C +VL
Sbjct  208  FTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQNDYKSLDIHVGQCFSVL  267

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTA+QEPKDYY+VA++RF K   ++  +I YAG           P  P G  G AWS NQ
Sbjct  268  VTANQEPKDYYMVASTRFTKYMRTATGIIRYAGSS-----VPPSPELPAGPVGWAWSFNQ  322

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +RSFRWNLTASAARPNPQGSYHYG I ITRTIKL +S      K R+A+NG SHV+  TP
Sbjct  323  WRSFRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGKRRFALNGASHVESPTP  382

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEY+ V +KVFKYD + D PPE    +TVAPNV+NAT R+++EII EN E++I
Sbjct  383  LKLAEYYGVADKVFKYDTIGDEPPESSATITVAPNVLNATFRDYIEIILENPERSI  438



>ref|XP_009420229.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   349 bits (896),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/296 (58%), Positives = 215/296 (73%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVPFD PAD++ + + DWY K HK L  +L  GRSI  P G+ +N   G  + G    P+
Sbjct  149  PVPFDDPADDYTVLIGDWYTKSHKVLAGILDAGRSIGNPAGVLMNGLSGKDATGKDDPPL  208

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             TME GKTYR+R+CNVGL+ S+NFR QGH MKLVE++GSH VQNDY+S+D+HVG CL+VL
Sbjct  209  FTMEAGKTYRYRICNVGLKLSLNFRIQGHLMKLVEMDGSHTVQNDYESLDVHVGQCLSVL  268

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTA+QEPKDYY+VA++RF K   ++  ++ YAG K         P  P G  G AWS+NQ
Sbjct  269  VTANQEPKDYYMVASTRFTKYMRTATGVVRYAGSK-----VPPSPELPAGPVGWAWSLNQ  323

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +RS RWNLTASAARPNPQGSYHYG I ITRTIKL +S      K R+ +NGVSHVD  TP
Sbjct  324  WRSLRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGKRRFGLNGVSHVDSPTP  383

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEY+ + +KVFKYD + D PP     +TVAPNV+NAT+R+++EII EN E++I
Sbjct  384  LKLAEYYGISDKVFKYDSIGDEPPASGASITVAPNVLNATYRDYIEIILENPERSI  439



>ref|XP_009384957.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=556

 Score =   349 bits (896),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 173/296 (58%), Positives = 212/296 (72%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVPFD PAD++ + + DWY K HK L +LL  GRSI  P G+ IN   G  + G    P+
Sbjct  154  PVPFDDPADDYTVLIGDWYTKSHKVLAQLLDAGRSIGNPAGVIINGSPGKDAAGKDDAPL  213

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             TME GKTYR+R+CNVGL+ S+NFR Q H MKLVE++GSH VQNDY S+D+HVG C +VL
Sbjct  214  FTMEAGKTYRYRICNVGLKVSLNFRIQSHLMKLVEMDGSHTVQNDYKSLDIHVGQCFSVL  273

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTA+QEPKDYY+VA++RF K   ++  +I YAG           P  P G  G AWS NQ
Sbjct  274  VTANQEPKDYYMVASTRFTKYMRTATGIIRYAGSS-----VPPSPELPAGPVGWAWSFNQ  328

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +RSFRWNLTASAARPNPQGSYHYG I ITRTIKL +S      K R+A+NG SHV+  TP
Sbjct  329  WRSFRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGKRRFALNGASHVESPTP  388

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEY+ V +KVFKYD + D PPE    +TVAPNV+NAT R+++EII EN E++I
Sbjct  389  LKLAEYYGVADKVFKYDTIGDEPPESSATITVAPNVLNATFRDYIEIILENPERSI  444



>ref|XP_009399915.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   349 bits (895),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 215/296 (73%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVPFD PAD++ + + DWY K HK L+K+L  GR++ RP G+ IN   G    G    P+
Sbjct  148  PVPFDDPADDYTVLIGDWYTKSHKILEKILDAGRAVGRPAGLLINGHSGKNGAGKDEPPL  207

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             TME  KTYR+R+CN+G++ ++NFR Q HSM LVE++GSH VQN+YDS+D+HVG CL+VL
Sbjct  208  FTMEAKKTYRYRICNIGMKVTLNFRIQSHSMTLVEMDGSHTVQNNYDSLDIHVGQCLSVL  267

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTA+Q P+DYY+VA+SRF K   +   ++ YAG +     +      PE   G AWS NQ
Sbjct  268  VTANQSPRDYYMVASSRFTKYMLTVTGIVRYAGSQ-----TPPSQDLPEAPAGWAWSFNQ  322

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +RSFRWNLTASAARPNPQGSYHYG I ITRTI+LV +  +   K RYA+NGVSH D +TP
Sbjct  323  WRSFRWNLTASAARPNPQGSYHYGSINITRTIRLVNTIGNVDGKRRYALNGVSHQDTDTP  382

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEY+ + +KVFKYDI+ D PP D  ++ +APNVVN T R FVEIIFEN E+++
Sbjct  383  LKLAEYYGIADKVFKYDIISDEPPADGAQIKLAPNVVNTTFRTFVEIIFENPERSM  438



>ref|XP_009402422.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   349 bits (895),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/296 (57%), Positives = 211/296 (71%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVPFD PAD++ + + DWY K HK L  +L  GRSI  P GI +N   G  + G    P+
Sbjct  148  PVPFDDPADDYTVLIGDWYTKSHKALAGILDAGRSIGNPTGILMNGSPGKNAAGKDDAPL  207

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
              ME GKTYR+R+CNVGL+ S+NFR Q H MKLVE++GSH VQNDY+S+D+HVG CL+VL
Sbjct  208  FAMEAGKTYRYRICNVGLKVSLNFRIQNHLMKLVEMDGSHTVQNDYESLDVHVGQCLSVL  267

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTA+QEPKDYY+VA++RF K   ++  ++ YAG              P G  G AWS NQ
Sbjct  268  VTANQEPKDYYMVASTRFTKYMLTATGIVRYAGSN-----VPPSSELPAGPVGWAWSFNQ  322

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +RSFRWNLTASAARPNPQGSYHYG I ITRTIKL +S      K R+A+NGVSHV+ ETP
Sbjct  323  WRSFRWNLTASAARPNPQGSYHYGSINITRTIKLASSVGLVNGKRRFALNGVSHVETETP  382

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEY+ + +KVFKYD + D PP     +T APNV+NAT R+++EII EN E++I
Sbjct  383  LKLAEYYGIADKVFKYDSISDEPPAASATITAAPNVLNATFRDYIEIILENPERSI  438



>ref|XP_003529457.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=552

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/295 (57%), Positives = 213/295 (72%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ +   DW+ K H  L+KLL  GRS+ RP  + +N ++       +P+ T
Sbjct  151  PVPYADPEDDYTVLAGDWFTKSHSTLRKLLDGGRSLGRPQAVLLNGQNAKGDGTDKPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M  GKTY++R+CNVGL+ +INFR Q H MKLVE+EGSH VQN Y+S+D+H+G C  VLVT
Sbjct  211  MIPGKTYKYRICNVGLKNTINFRIQNHPMKLVEMEGSHTVQNTYNSLDVHLGQCFGVLVT  270

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K   +   ++ Y  GK         P  PE   G AWS+NQFR
Sbjct  271  ANQEPKDYYMVASTRFTKSILTGKGIMRYTTGKA-----PPSPEIPEAPVGWAWSLNQFR  325

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQ+ ITRT+K + S S +  K+RYAINGVSHVD ETP+K
Sbjct  326  SFRWNLTASAARPNPQGSYHYGQVNITRTVKFINSVSRDSGKLRYAINGVSHVDGETPIK  385

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK-VTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF VPEKVFKYDI+ DNP +D+ K V + PNV+   HR F+EIIFEN EK++
Sbjct  386  LAEYFGVPEKVFKYDIISDNPSQDVGKNVVLQPNVIRFKHRTFIEIIFENPEKSV  440



>gb|EEC79422.1| hypothetical protein OsI_20394 [Oryza sativa Indica Group]
Length=466

 Score =   344 bits (883),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 209/294 (71%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+  + + DWY K H  + K+L  G+S  RP+G+ IN K G       P+ T
Sbjct  65   PVPFDPPADDHMVLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVINGKSGKAAAD-PPMFT  123

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E GKTYR RVCNVG++ S+NFR QGH MKLVE+EGSH VQ+ YDS+D+HVGHCL+VLV 
Sbjct  124  VEAGKTYRLRVCNVGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVLVD  183

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DYY VA++RF  E  S  A+I YAG       +   P  PE   G AWS+NQ+R
Sbjct  184  ADQKPGDYYAVASTRFIHEAKSVSAVIRYAGSS-----TPPSPAVPEPPAGWAWSINQWR  238

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTI+L+ S+ H   K++Y  NGVSHVD ETPLK
Sbjct  239  SFRWNLTASAARPNPQGSYHYGQINITRTIRLMVSRGHIDGKLKYGFNGVSHVDAETPLK  298

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V + VF+Y+ M D PP     + V PNV+ A  R F+EIIFEN EK++
Sbjct  299  LAEYFNVTDGVFRYNQMTDVPPAVNGPLHVVPNVITAEFRTFIEIIFENPEKSM  352



>ref|XP_004149657.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/296 (59%), Positives = 213/296 (72%), Gaps = 14/296 (5%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEG-RSIARPNGITINAKHGSVGDKLEPIA  706
            PVP+  P D++ + + DWY K H  LK++L  G RSIARP G+ IN K        EP+ 
Sbjct  150  PVPYADPEDDYTVLIGDWYTKSHTTLKQILDNGHRSIARPEGVLINGKTAKGDGTDEPLF  209

Query  705  TMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLV  526
            TM+  KTY++RVCNVGL+TS+NFRFQGH+MKLVE+EGSH VQNDY S+D+HVG C +VLV
Sbjct  210  TMKPEKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCFSVLV  269

Query  525  TADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            TA+QEPKDYY+VA++RF K       +I Y  GKG        P  P+   G AWS+NQF
Sbjct  270  TANQEPKDYYMVASTRFIKNVLIGKGIIRYTNGKG-----PASPEIPKAPMGWAWSLNQF  324

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            R+F       +  PNPQGSYHYG I ITRTIKL  S +    K+RYAINGVSHVDPETPL
Sbjct  325  RTF-------SLEPNPQGSYHYGSINITRTIKLFNSATKVDGKLRYAINGVSHVDPETPL  377

Query  165  KLAEYFQVPEKVFKYDIMKD-NPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF++ EKVFKYD++ D  P E  T VT+APNVVNAT RNF+EIIFENHEK++
Sbjct  378  KLAEYFEIAEKVFKYDMISDEGPTEGATAVTIAPNVVNATFRNFIEIIFENHEKSL  433



>emb|CDY54363.1| BnaC06g07290D [Brassica napus]
Length=545

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/280 (58%), Positives = 204/280 (73%), Gaps = 6/280 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY K H  LK  L  GR+I RP+GI IN K G      +P+ T
Sbjct  154  PVPYADPEDDYTVLINDWYTKTHTQLKNFLDSGRTIGRPDGILINGKAGKGDGSDQPLFT  213

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +++GKTYR R+CNVGL+ S+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C  V +T
Sbjct  214  LKQGKTYRIRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVTLT  273

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K   ++  L+ Y GGKG+          P    G AWS+NQFR
Sbjct  274  ANQEPKDYYMVASTRFLKNALTTTGLLRYEGGKGL-----ASSQLPAAPVGWAWSLNQFR  328

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH+DPETPLK
Sbjct  329  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLRYALNGVSHIDPETPLK  388

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK-VTVAPNVVNATH  46
            LAEYF V +KVFKYD + DNP  D  K + + PNV+N T 
Sbjct  389  LAEYFGVTDKVFKYDSISDNPTSDQIKNIKIEPNVLNITQ  428



>gb|EEE64155.1| hypothetical protein OsJ_18987 [Oryza sativa Japonica Group]
Length=513

 Score =   343 bits (881),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 209/294 (71%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+  + + DWY K H  + K+L  G+S  RP+G+ IN K G       P+ T
Sbjct  155  PVPFDPPADDHMVLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVINGKSGKAAAD-PPMFT  213

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E GKTYR RVCNVG++ S+NFR QGH MKLVE+EGSH VQ+ YDS+D+HVGHCL+VLV 
Sbjct  214  VEAGKTYRLRVCNVGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVLVD  273

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DYY VA++RF  E  S  A+I YAG       +   P  PE   G AWS+NQ+R
Sbjct  274  ADQKPGDYYAVASTRFIHEAKSVSAVIRYAGSS-----TPPSPAVPEPPAGWAWSINQWR  328

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTI+L+ S+ H   K++Y  NGVSHVD ETPLK
Sbjct  329  SFRWNLTASAARPNPQGSYHYGQINITRTIRLMVSRGHIDGKLKYGFNGVSHVDAETPLK  388

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V + VF+Y+ M D PP     + V PNV+ A  R F+EIIFEN EK++
Sbjct  389  LAEYFNVTDGVFRYNQMTDVPPAVNGPLHVVPNVITAEFRTFIEIIFENPEKSM  442



>gb|AAT01329.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 gb|AAT01403.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
Length=556

 Score =   344 bits (882),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 209/294 (71%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+  + + DWY K H  + K+L  G+S  RP+G+ IN K G       P+ T
Sbjct  155  PVPFDPPADDHMVLIGDWYTKDHAAMAKMLDAGKSFGRPHGVVINGKSGKAAAD-PPMFT  213

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E GKTYR RVCNVG++ S+NFR QGH MKLVE+EGSH VQ+ YDS+D+HVGHCL+VLV 
Sbjct  214  VEAGKTYRLRVCNVGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVLVD  273

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DYY VA++RF  E  S  A+I YAG       +   P  PE   G AWS+NQ+R
Sbjct  274  ADQKPGDYYAVASTRFIHEAKSVSAVIRYAGSS-----TPPSPAVPEPPAGWAWSINQWR  328

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTI+L+ S+ H   K++Y  NGVSHVD ETPLK
Sbjct  329  SFRWNLTASAARPNPQGSYHYGQINITRTIRLMVSRGHIDGKLKYGFNGVSHVDAETPLK  388

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF V + VF+Y+ M D PP     + V PNV+ A  R F+EIIFEN EK++
Sbjct  389  LAEYFNVTDGVFRYNQMTDVPPAVNGPLHVVPNVITAEFRTFIEIIFENPEKSM  442



>ref|XP_008782736.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 206/296 (70%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVP+  PADEF+I   DWY K HK L   L  GRSI RP G+ IN KHG  + G    P+
Sbjct  148  PVPYADPADEFNILAGDWYTKSHKVLAGRLDSGRSIGRPAGVLINGKHGKDASGKDEPPM  207

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             TME GKTYRFRVCN+G++ S+NFR Q HS++LVE+EGSHVVQN YDS+D+H+G C +V 
Sbjct  208  FTMEAGKTYRFRVCNIGIKDSLNFRIQKHSLRLVEMEGSHVVQNTYDSLDLHIGQCFSVF  267

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTADQ+P DYY++ ++RF K +    A++ YAG              P    G AWS NQ
Sbjct  268  VTADQQPGDYYILMSTRFTKYSCGGSAIVRYAGSNA-----PPSKDLPPAPSGWAWSFNQ  322

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +RSFRWNLTASAARPNPQGSYHYGQI ITRTIKL         K RYAINGVSH +P TP
Sbjct  323  WRSFRWNLTASAARPNPQGSYHYGQINITRTIKLRGGTGLVNGKRRYAINGVSHENPVTP  382

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKL+EY+ + +K FKY I+ D PP   + +T+APNV+N T R F+E+I EN E++I
Sbjct  383  LKLSEYYGIADKEFKYSIIGDEPPNGKSLITIAPNVINCTFRTFIEVILENPERSI  438



>ref|XP_003566121.2| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=540

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/294 (56%), Positives = 210/294 (71%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+  + + DWY K H  + +LL EGRS  RP G+ IN + G       P+ T
Sbjct  139  PVPFDPPADDLQVLIGDWYTKDHAVMARLLDEGRSFGRPAGVLINGRGGKEAAD-PPLFT  197

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
             E GKTYR R+CNVG+++++NFR QGH MKLVE++GSH VQ+ YDS+D+HVGHCL+VLV 
Sbjct  198  FEAGKTYRLRICNVGIKSTLNFRIQGHDMKLVEMDGSHTVQDMYDSLDVHVGHCLSVLVD  257

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DYY+VA++RF  +  S  A+I YAG       +   P  PE   G AWS+NQ+R
Sbjct  258  ADQKPGDYYVVASTRFISDKSSVSAVIRYAGSN-----TPPAPNVPEPPAGWAWSLNQWR  312

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL+ ++ H   K++Y  NGVSHVD +TPLK
Sbjct  313  SFRWNLTASAARPNPQGSYHYGQINITRTIKLLVTRGHLEGKLKYGFNGVSHVDADTPLK  372

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            L EYF V + VFKY+ M D PP  +  + V PNV+ A  R F+E++FEN EK++
Sbjct  373  LLEYFNVTDPVFKYNQMADVPPAVMGPLQVVPNVITAEFRTFIEVVFENPEKSM  426



>ref|XP_010938086.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   341 bits (874),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 164/296 (55%), Positives = 209/296 (71%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVP+  PA+EF++   DWY K HK L +LL  GR + RP G+ IN KHG  + G    P+
Sbjct  148  PVPYADPAEEFNVLAGDWYTKSHKVLARLLDSGRGVGRPAGVLINGKHGKDASGKDEPPM  207

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             TME GKTYR+RVCNVG++TS++FR Q H+++LVE+EGSH +QN YDS+D+H+G C +V 
Sbjct  208  FTMEAGKTYRYRVCNVGIKTSLSFRIQKHALRLVEMEGSHTIQNVYDSLDIHIGQCFSVF  267

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTADQ+P DYY+V ++RF K      A+I YAG       +   P  P    G AWS NQ
Sbjct  268  VTADQQPGDYYMVISTRFTKYNCGGTAIIRYAGSN-----TPPSPDLPPAPSGWAWSFNQ  322

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +RSFRWNLTASAARPNPQGSYHYG I ITRTI+L  S      K RYA+NGVSH +P TP
Sbjct  323  WRSFRWNLTASAARPNPQGSYHYGSINITRTIRLRGSTGLVNGKRRYALNGVSHENPATP  382

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKL+EY+ + EK FKY+I+ D PP D + + ++PNVVN T R F+EII EN E++I
Sbjct  383  LKLSEYYGIAEKEFKYNIIGDEPPADKSTIVISPNVVNCTFRTFIEIILENPERSI  438



>ref|XP_009600428.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=520

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/296 (57%), Positives = 205/296 (69%), Gaps = 38/296 (13%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD P +EF +F+SDWY K HK L+ +L EGRSI RP GI IN K+G    K EP+ +
Sbjct  148  PVPFDSPEEEFSVFVSDWYTKSHKTLRSILDEGRSIGRPEGIIINGKNGKGDGKDEPMFS  207

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M  GKTYR+R CNVG++ SIN RFQGH+MKLVE+EGSH VQN Y+S+D+H+G CL+VLVT
Sbjct  208  MVSGKTYRYRFCNVGMKDSINVRFQGHTMKLVEMEGSHTVQNMYESLDIHLGQCLSVLVT  267

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQEPKDY+LVA+SRF KE + + A I Y                               
Sbjct  268  ADQEPKDYFLVASSRFTKEPHIATATIRYT------------------------------  297

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
                   ASAARPNPQGSYHYGQI ITRTI+LV++      K RYAINGVSHVDP TP+K
Sbjct  298  ------NASAARPNPQGSYHYGQINITRTIRLVSTAGDVDGKRRYAINGVSHVDPTTPIK  351

Query  162  LAEYFQVPEKVFKYDIMKDN--PPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAE + V +KVFKYD++KD    P    K+T+APNVVNAT+RNFVEII ENHEK++
Sbjct  352  LAELYGVADKVFKYDLIKDEYIAPSGNEKITLAPNVVNATYRNFVEIILENHEKSV  407



>ref|XP_010921259.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=550

 Score =   340 bits (872),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 208/296 (70%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVP+  PADEF+I   +WY K HK L + L  GR I RP G+ IN KHG  + G    P+
Sbjct  148  PVPYTDPADEFNILAGEWYTKSHKVLARFLDSGRGIGRPAGVLINGKHGKDASGKDEPPM  207

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             T+E GKTYRFRVCN+G++ S+NFR Q H+++LVE+EGSHVVQN YDS+D+H+G C +V 
Sbjct  208  FTVEAGKTYRFRVCNIGIKNSLNFRIQKHALRLVEMEGSHVVQNMYDSLDLHIGQCFSVF  267

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTADQ+P DYY++A++RF K      A+I YAG       +      P G  G AWS NQ
Sbjct  268  VTADQQPGDYYILASTRFTKYKCDGSAIIRYAGSN-----TPPSKDLPPGPSGWAWSFNQ  322

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +RSFRWNLTASAARPNPQGSYHYGQI ITRTI+L         K RYAINGVSH +P TP
Sbjct  323  WRSFRWNLTASAARPNPQGSYHYGQINITRTIRLRGGTGLVNGKRRYAINGVSHDNPVTP  382

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
             KL+EYF + +K FKY+I+ D PP   + +T+APNVVN T R F+EII EN E++I
Sbjct  383  FKLSEYFGIADKEFKYNIIGDEPPTGKSPITIAPNVVNCTFRTFIEIILENPERSI  438



>ref|XP_007157831.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
 gb|ESW29825.1| hypothetical protein PHAVU_002G101800g [Phaseolus vulgaris]
Length=553

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/295 (57%), Positives = 209/295 (71%), Gaps = 6/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ +   DWY K H  L KLL  GR++ RP  + +N ++       +P+ T
Sbjct  152  PVPYADPEDDYTVLAGDWYTKSHSTLAKLLDSGRALGRPQALLVNGQNAKGDGTDKPLFT  211

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M  GKTY++R+CNVGL+ SINFR Q H MKLVE+EGSH VQN YDS+D+H+G C  VLVT
Sbjct  212  MLPGKTYKYRLCNVGLKNSINFRIQNHQMKLVEMEGSHTVQNVYDSLDVHLGQCFGVLVT  271

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQE KDYY+VA++RF K   +   +I YA GKG        P  PE   G AWS+NQFR
Sbjct  272  ADQEAKDYYIVASTRFTKTVLTGKGIIRYANGKG-----PASPEIPEAPVGWAWSLNQFR  326

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRT+K V S S +  K+RYAINGVSHVD +TPLK
Sbjct  327  SFRWNLTASAARPNPQGSYHYGQINITRTLKFVNSVSRDNGKLRYAINGVSHVDGDTPLK  386

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL-TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            L++Y+ +  K FK D + D P  DL + VT+APNV+   +R F+EIIFENHEK++
Sbjct  387  LSDYYGIGSKFFKNDTIPDQPAADLGSAVTLAPNVMKFEYRTFIEIIFENHEKSV  441



>ref|XP_004970369.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=557

 Score =   339 bits (870),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 171/294 (58%), Positives = 206/294 (70%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+F + +SDWY K H  L K L  G+ I RP G+ IN K+        P+  
Sbjct  156  PVPFDTPADDFPVLVSDWYTKDHTVLAKNLDSGKGIGRPAGLVINGKNEKDASN-PPMYN  214

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTYRFRVCN+G++ S N R Q H +KLVE+EGSH VQN YDS+D+H+G CL+ LVT
Sbjct  215  MEAGKTYRFRVCNLGIKASFNVRIQKHILKLVEMEGSHTVQNTYDSLDLHIGQCLSFLVT  274

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ P DY LVA++RF KE  +  A+I Y G       +  P   PE   G AWS+NQ+R
Sbjct  275  ADQAPGDYLLVASTRFIKEVSTITAVIRYKGSN-----TPPPSQLPEAPSGWAWSINQWR  329

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL  SK     K RYA+NGVSHVD ETPLK
Sbjct  330  SFRWNLTASAARPNPQGSYHYGQINITRTIKLATSKGKVDGKERYALNGVSHVDTETPLK  389

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF   + VF+Y+IM D PP   T + +APNV++A  R F+E++FEN EK+I
Sbjct  390  LAEYFNATDGVFQYNIMGDVPPAAGTPIKMAPNVISAEFRTFIEVVFENPEKSI  443



>ref|XP_008788020.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   339 bits (869),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 170/296 (57%), Positives = 209/296 (71%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVPF  PA EF++   DW+ K HK L + L  GR +  P G+ IN + G  + G    P+
Sbjct  149  PVPFAPPAQEFNVLAGDWFTKSHKVLARQLDAGRGLGLPAGVLINGRLGKDAAGRDEPPM  208

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             TM+ G  YRFR CNVGL+TS+NFR Q HS+KLVE+EGSH VQN YDS+D+HVG CL+VL
Sbjct  209  FTMQAGNVYRFRFCNVGLKTSLNFRLQKHSLKLVEMEGSHTVQNLYDSLDVHVGQCLSVL  268

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTADQ P DYYLVA++RF KE  ++ A++ YAG           P  P+G  G AWS NQ
Sbjct  269  VTADQAPGDYYLVASTRFTKEILAATAVLRYAGSNA-----PPSPVIPDGPSGWAWSFNQ  323

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +R+FRWNLTASAARPNPQGSYHYGQI ITRTIKLV   S    K R+ ING+SHVDP+TP
Sbjct  324  WRTFRWNLTASAARPNPQGSYHYGQINITRTIKLVNGHSVVDGKRRHFINGISHVDPDTP  383

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEYF + +  F+Y++M D PP     VT+APNV+ A  R F+EIIFEN E++I
Sbjct  384  LKLAEYFNLSKPAFEYNLMGDVPPAPDAPVTLAPNVITAEFRTFIEIIFENTERSI  439



>ref|XP_003607816.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES90013.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=545

 Score =   338 bits (868),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 170/294 (58%), Positives = 206/294 (70%), Gaps = 9/294 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  PADE+ + + DWY K H  L+K L  GRS+ RP+G+ I  K  S     EP+  
Sbjct  148  PVPYADPADEYWVLMGDWYGKSHTQLQKFLDSGRSMGRPDGVHIMGKSNSA----EPLYK  203

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTY++R+CNVGL+ S+NFR Q H MKLVE+EGSH VQN YDS+D+HVG C +VLVT
Sbjct  204  MEPGKTYKYRLCNVGLKDSLNFRIQDHPMKLVEMEGSHTVQNVYDSLDVHVGQCFSVLVT  263

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            AD+EPK Y +VA++RF K   ++ A+ISY  G G        P  P    G AWS+NQ R
Sbjct  264  ADKEPKQYKMVASTRFTKTVLTTTAVISYTNGNG-----PASPVLPPAPVGWAWSLNQVR  318

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKLV +  +   K+RY +NGVSH D ETPLK
Sbjct  319  SFRWNLTASAARPNPQGSYHYGQINITRTIKLVNNPFNIDGKLRYTLNGVSHEDDETPLK  378

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ V  KVF+YD+  DNPP  +  + V  NV+N T R FVEIIFEN  K I
Sbjct  379  LAEYYGVANKVFQYDLTSDNPPAVIGNLRVEANVLNVTFRTFVEIIFENPTKVI  432



>ref|XP_008793387.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=550

 Score =   338 bits (867),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 164/296 (55%), Positives = 204/296 (69%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVP+  PADEF++   DWY K HK L +LL  GR I RP G+ IN KHG  + G    P+
Sbjct  148  PVPYADPADEFNVLAGDWYTKSHKVLARLLDRGRGIGRPAGVLINGKHGKDASGKDEPPM  207

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             TME GKTYR+RVCNVG++TS+N R Q H ++LVE+EGSH +QN YDS+D+H G C +V 
Sbjct  208  FTMEAGKTYRYRVCNVGIKTSLNLRIQKHKLRLVEMEGSHTIQNVYDSLDLHTGQCFSVF  267

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTADQ+P DYY+V ++RF K      A+I YAG           P  P    G AWS NQ
Sbjct  268  VTADQQPGDYYMVISTRFTKYNCGGTAIIRYAGSN-----MPPSPDLPPSPSGWAWSFNQ  322

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +RSFRWNLTASAARPNPQGSYHYG I ITRTI+L  S      K RYA+NGVSH +P TP
Sbjct  323  WRSFRWNLTASAARPNPQGSYHYGSINITRTIRLRGSTGLVNGKRRYALNGVSHENPATP  382

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKL+EY+ + +K FKY+I+ D PP D + + +APNV+  T R F+EII EN E++I
Sbjct  383  LKLSEYYSITDKEFKYNIIGDEPPADKSPIVIAPNVIKCTFRTFIEIILENPERSI  438



>ref|XP_008804666.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=551

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/296 (58%), Positives = 208/296 (70%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVPFD PA+EF++   DW+ K HK L   L  GRS+  P G+ IN + G  + G    P+
Sbjct  149  PVPFDPPAEEFNVLAGDWFTKSHKVLAGQLDAGRSVGHPAGVLINGRRGKDAAGHDEPPM  208

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             TM+ G  YRFR CNVGL+TS+NFR Q H +KLVE+EGSH VQN Y S+D+HVG CL+VL
Sbjct  209  FTMQAGDVYRFRFCNVGLKTSLNFRIQKHPLKLVEMEGSHTVQNLYTSLDVHVGQCLSVL  268

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTADQ P DYYLVA++RF K+  ++ A++ YAG       +   P  PEG  G AWS NQ
Sbjct  269  VTADQAPGDYYLVASTRFTKKVLTATAVLRYAGSN-----TPPSPVIPEGPTGWAWSFNQ  323

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +R+FRWNLTASAARPNPQGSYHYGQI ITR+I+LV   S    K R  INGVSHVDP+TP
Sbjct  324  WRTFRWNLTASAARPNPQGSYHYGQINITRSIRLVNGHSIVDGKRRNFINGVSHVDPDTP  383

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEYF +   VFKY +M D PP   T VT+APNV+    R F+EIIFEN EK+I
Sbjct  384  LKLAEYFNLSNPVFKYSLMGDAPPAPDTPVTLAPNVIAVEFRTFIEIIFENTEKSI  439



>gb|KHN20513.1| L-ascorbate oxidase like [Glycine soja]
Length=516

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/276 (60%), Positives = 206/276 (75%), Gaps = 9/276 (3%)
 Frame = -2

Query  828  YNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIATMEKGKTYRFRVCNVGLRT  649
            +++ H  LK+ L  GRSI RP G+ IN K+G     LEP+ TME GKTY++R+CNVGL+ 
Sbjct  137  FSRLHTALKQKLDSGRSIGRPVGVHINGKNGG----LEPLYTMEPGKTYKYRICNVGLKD  192

Query  648  SINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVTADQEPKDYYLVATSRFFK  469
            S+NFR QGH +KLVE EGSHVVQN+YDS+D+HVG C  VLVTADQEPKDY++VA++RF K
Sbjct  193  SLNFRIQGHPLKLVETEGSHVVQNNYDSLDVHVGQCYTVLVTADQEPKDYFMVASTRFTK  252

Query  468  ETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFRSFRWNLTASAARPNPQGS  289
            +  ++  +I Y+ G G           P    G AWS+NQFRSFRWNLTASAARPNPQGS
Sbjct  253  KVLTATRVIRYSNGVG-----PASGGLPPAPQGWAWSLNQFRSFRWNLTASAARPNPQGS  307

Query  288  YHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLKLAEYFQVPEKVFKYDIMK  109
            YHYGQI ITRTIKLV + S    K+RY +NGVSHVD +TPLKLAEY+ V +KVFKY+++ 
Sbjct  308  YHYGQINITRTIKLVNTVSRANGKLRYGLNGVSHVDTQTPLKLAEYYGVADKVFKYNLIS  367

Query  108  DNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            D+P      +TVAPNV+NAT R+F+E+IFEN  K I
Sbjct  368  DSPDTAFPDLTVAPNVINATFRDFIEVIFENPGKVI  403



>gb|AFK44839.1| unknown [Medicago truncatula]
Length=375

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 194/265 (73%), Gaps = 5/265 (2%)
 Frame = -2

Query  795  LTEGRSIARPNGITINAKHGSVGDKLEPIATMEKGKTYRFRVCNVGLRTSINFRFQGHSM  616
            L  GRSI RP G+ IN K+       EP+ TM+ GKTY++R+CN GL+ ++NFRFQGH M
Sbjct  3    LDSGRSIGRPAGVIINGKNAKGDGSDEPLYTMKPGKTYKYRICNTGLKDTLNFRFQGHGM  62

Query  615  KLVELEGSHVVQNDYDSMDMHVGHCLAVLVTADQEPKDYYLVATSRFFKETYSSVALISY  436
            KLVE EGSHVVQN YDS+D+HVG C  VLVTAD+EPKDYY+VA++R  K       +I Y
Sbjct  63   KLVETEGSHVVQNVYDSLDVHVGQCYTVLVTADKEPKDYYMVASTRMTKYNLLGKGIIRY  122

Query  435  AGGKGVppaselpppppegipgiAWSMNQFRSFRWNLTASAARPNPQGSYHYGQIEITRT  256
              GKG        P  P    G AWS+NQFRSFRWNLTASAARPNPQGSYHYGQI ITRT
Sbjct  123  TNGKG-----PASPMLPPAPVGWAWSLNQFRSFRWNLTASAARPNPQGSYHYGQISITRT  177

Query  255  IKLVASKSHEGDKVRYAINGVSHVDPETPLKLAEYFQVPEKVFKYDIMKDNPPEDLTKVT  76
            IK V S S+   K+RYAINGVSHVDPETP+KLAEY+ V +KVFKY+I+ D PP DL  +T
Sbjct  178  IKFVNSVSNVNGKLRYAINGVSHVDPETPVKLAEYYGVADKVFKYNIISDEPPIDLRAIT  237

Query  75   VAPNVVNATHRNFVEIIFENHEKTI  1
            +APNV+  T R F+EIIFEN  K +
Sbjct  238  IAPNVMQTTFRTFIEIIFENPGKVL  262



>emb|CDM84722.1| unnamed protein product [Triticum aestivum]
Length=556

 Score =   337 bits (863),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 162/294 (55%), Positives = 210/294 (71%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+F + + DWY K H  L K L  G+ I RP G+ IN K+        P+  
Sbjct  155  PVPFDPPADDFGVLVGDWYTKDHTVLAKNLDTGKGIGRPAGLLINGKNEKDASN-PPMFN  213

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E GKTYRFRVCNVG++T++N R QGH +KLVE+EGSH VQN+YDSMD+H+G CL+ L T
Sbjct  214  VEAGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNEYDSMDVHIGQCLSFLST  273

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q+P DY+ +A++RF K   +  A++ Y G       +      P+   G AWS+NQ+R
Sbjct  274  ANQKPGDYFFIASTRFIKGVSTITAVMRYKGSN-----TPPAAKLPDAPDGWAWSINQWR  328

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL +S+     K RYA+NGVSH DPETPLK
Sbjct  329  SFRWNLTASAARPNPQGSYHYGQINITRTIKLSSSRGKVDGKERYALNGVSHTDPETPLK  388

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF   + VF+Y+++ D PP++ T + VAP+V+ A HR ++EI+FEN EK+I
Sbjct  389  LAEYFNATKGVFEYNLVTDTPPKEGTPIKVAPSVITAEHRTYIEIVFENPEKSI  442



>ref|NP_001132891.1| uncharacterized protein LOC100194388 [Zea mays]
 gb|ACF81925.1| unknown [Zea mays]
Length=421

 Score =   332 bits (851),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 165/294 (56%), Positives = 198/294 (67%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+F + + DWY K H  L K L  G+ I RP G+ IN K+        P+  
Sbjct  20   PVPFDTPADDFPVLVGDWYTKDHTVLAKNLDAGKGIGRPAGLVINGKNEKDASN-PPMYN  78

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E GKTYRFRVCNVG++ S N R Q H MKLVE+EGSH +QNDYDS+D+H+G CL+ LVT
Sbjct  79   VEAGKTYRFRVCNVGIKASFNIRIQNHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFLVT  138

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DY L  ++RF KE  S  A+I Y G          P   PE   G AWS+NQ R
Sbjct  139  ADQKPGDYLLAVSTRFIKEVNSITAVIRYKGSNA-----PPPAKVPESPSGWAWSINQCR  193

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL   +     K R+  NGVSHVDPETP+K
Sbjct  194  SFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRGKVDGKERFGFNGVSHVDPETPVK  253

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF   + VF+YDI+ D PP       +APNV+ A  R F+E++FEN EK+I
Sbjct  254  LAEYFNTTDGVFQYDIIGDVPPSKSAPTKMAPNVIRAEFRTFIEVVFENPEKSI  307



>ref|XP_009416330.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   336 bits (862),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 164/296 (55%), Positives = 207/296 (70%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVPF  P D++ + + DWY K HK L  +L  G  I  P G+ IN + G  + G    P+
Sbjct  150  PVPFADPTDDYTVLIGDWYAKSHKALAAILDAGHGIGNPAGVLINGRTGKDASGKDDTPL  209

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             TME GKTYR+R+CNVG++ S+NFR Q H MKLVE++GSH VQNDY+S+D+HVG CL+VL
Sbjct  210  FTMEAGKTYRYRICNVGMKVSLNFRMQNHRMKLVEMDGSHTVQNDYESLDVHVGQCLSVL  269

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTA+QEPKDYY+VA++RF K   ++  +I YAG           P  P    G AWS NQ
Sbjct  270  VTANQEPKDYYMVASTRFTKYMRTATGVIRYAGSS-----VPPSPELPAAPVGWAWSFNQ  324

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +RSFRWNLTASAARPNPQGSYHYG I ITRTIKL +S      K R+A+NGVSHV+  TP
Sbjct  325  WRSFRWNLTASAARPNPQGSYHYGGINITRTIKLASSVGLVNGKRRFALNGVSHVESPTP  384

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEY+ + +KVFKYD + D PP     +T  PNV+NAT+R ++EII EN E++I
Sbjct  385  LKLAEYYGIADKVFKYDSINDEPPAASAPITATPNVLNATYRTYIEIILENPERSI  440



>gb|EMT02825.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=556

 Score =   336 bits (862),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 162/294 (55%), Positives = 210/294 (71%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+F + + DWY K H  L K L  G+ I RP G+ IN K+        P+  
Sbjct  155  PVPFDPPADDFGVLVGDWYTKDHTVLAKNLDTGKGIGRPAGLLINGKNEKDASN-PPMFN  213

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E+GKTYRFRVCNVG++T++N R QGH +KLVE+EGSH VQN+YDSMD+H+G CL+ L T
Sbjct  214  VEEGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNEYDSMDVHIGQCLSFLST  273

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q+P DY+ +A++RF K   +  A++ Y G       +      P+   G AWS+NQ+R
Sbjct  274  ANQKPGDYFFIASTRFIKGVSTITAVMRYKGSN-----TPPAAKLPDAPDGWAWSINQWR  328

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL  S+     K RYA+NGVSH DPETPLK
Sbjct  329  SFRWNLTASAARPNPQGSYHYGQINITRTIKLSPSRGKVDGKERYALNGVSHTDPETPLK  388

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF   + VF+Y+++ D PP++ T + VAP+V+ A HR ++EI+FEN EK+I
Sbjct  389  LAEYFNATKGVFEYNLVTDTPPKEGTPIKVAPSVITAEHRTYIEIVFENPEKSI  442



>ref|XP_003567221.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=557

 Score =   336 bits (861),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 211/294 (72%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+F + + DWY K    L+K +  G+SI RP G+ IN K+        P+  
Sbjct  156  PVPFDPPADDFSVLVGDWYTKDFAVLEKHIDTGKSIGRPAGLLINGKNEKDASN-PPMYN  214

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E GKTYRFRVCNVG+++S+N R QGH +KLVE+EGSH VQN+YDS+D+HVG CL+ LVT
Sbjct  215  VEAGKTYRFRVCNVGIKSSLNVRVQGHMIKLVEMEGSHTVQNEYDSLDVHVGQCLSFLVT  274

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q+P DY LVA++RF KE  +  A+I Y G           P  PE   G AWS+NQ+R
Sbjct  275  ANQKPGDYLLVASTRFIKEVSTITAIIRYKGSS-----VPASPKLPEAPNGWAWSINQWR  329

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL  S++    K RYA+NGVSHVDP+TP K
Sbjct  330  SFRWNLTASAARPNPQGSYHYGQINITRTIKLSTSRAKVDGKERYALNGVSHVDPDTPPK  389

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF     VF+Y+++ D PP++ T + VAPN++ A  R F+E++FEN EK+I
Sbjct  390  LAEYFNATTGVFEYNLIGDTPPKEGTPIKVAPNILTAEFRTFIEVVFENPEKSI  443



>ref|NP_001151662.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG43714.1| L-ascorbate oxidase precursor [Zea mays]
Length=559

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 204/294 (69%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+F + + DWY K H  L K L  G+ I RP G+ IN K+        P+  
Sbjct  158  PVPFDTPADDFPVLIGDWYTKDHAVLAKNLDAGKGIGRPAGLVINGKNEKDASN-PPMYN  216

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E GKTYRFRVCNVG++ S N R Q H MKLVE+EGSH +QNDYDS+D+H+G CL+ LVT
Sbjct  217  VEAGKTYRFRVCNVGIKASFNVRIQDHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFLVT  276

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DY LVA++RF KE  S+ A+I Y G          P   PEG  G AWS+NQ R
Sbjct  277  ADQKPGDYLLVASTRFIKEKSSTTAVIRYKGSSA-----PPPAKLPEGPSGWAWSINQCR  331

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL   +     K R+  NGVSHVDPETP+K
Sbjct  332  SFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRGKVDGKERFGFNGVSHVDPETPVK  391

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF   + VFKY+++ D PP +     +APNV++A  R F+E++FEN EK+I
Sbjct  392  LAEYFNASDGVFKYNLIGDVPPSNTAPTKMAPNVISAEFRTFIEVVFENPEKSI  445



>gb|ACN34077.1| unknown [Zea mays]
 gb|AFW84771.1| L-ascorbate oxidase [Zea mays]
Length=559

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 204/294 (69%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+F + + DWY K H  L K L  G+ I RP G+ IN K+        P+  
Sbjct  158  PVPFDTPADDFPVLIGDWYTKDHAVLAKNLDAGKGIGRPAGLVINGKNEKDASN-PPMYN  216

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E GKTYRFRVCNVG++ S N R Q H MKLVE+EGSH +QNDYDS+D+H+G CL+ LVT
Sbjct  217  VEAGKTYRFRVCNVGIKASFNVRIQDHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFLVT  276

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DY LVA++RF KE  S+ A+I Y G          P   PEG  G AWS+NQ R
Sbjct  277  ADQKPGDYLLVASTRFIKEKSSTTAVIRYKGSSA-----PPPAKLPEGPSGWAWSINQCR  331

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL   +     K R+  NGVSHVDPETP+K
Sbjct  332  SFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRGKVDGKERFGFNGVSHVDPETPVK  391

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF   + VFKY+++ D PP +     +APNV++A  R F+E++FEN EK+I
Sbjct  392  LAEYFNASDGVFKYNLIGDVPPSNTAPTKMAPNVISAEFRTFIEVVFENPEKSI  445



>ref|XP_009383852.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/297 (55%), Positives = 212/297 (71%), Gaps = 9/297 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAK---HGSVGDKLEP  712
            PVPFD PAD++ + + DWY K HK L K L  GRSI  P+G+ IN K   HGS G   +P
Sbjct  150  PVPFDPPADDYTVLVGDWYAKDHKALAKTLDMGRSIGLPSGVLINGKSGKHGS-GKDDKP  208

Query  711  IATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAV  532
            +  ME GK YR+R+CN G++ SINFR QGH+M+LVE++GSH +QN YDS+D+HVG C +V
Sbjct  209  LFVMEAGKVYRYRICNTGIKASINFRIQGHTMELVEMDGSHTMQNMYDSLDIHVGQCFSV  268

Query  531  LVTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMN  352
            LVTAD+ PKDYYLVA++RF ++  ++ A++ YAG       +      P+G  G  WS+N
Sbjct  269  LVTADRAPKDYYLVASTRFLRKEITATAVVRYAGSN-----TPPSAVLPKGPTGWGWSLN  323

Query  351  QFRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPET  172
            Q+RSFRWNLTASAARPNPQGSYHYG I ITRTIKL +S+  +G K+R+ +NG+SHVD +T
Sbjct  324  QWRSFRWNLTASAARPNPQGSYHYGSINITRTIKLSSSRVVDGGKIRFTLNGLSHVDTDT  383

Query  171  PLKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            PLK  EYF V +K FKY+++ D PP      T+APNV+    R +VEII EN E+ +
Sbjct  384  PLKHGEYFGVGDKFFKYNLIGDVPPASKAPFTLAPNVITIEFRTYVEIILENPERNL  440



>emb|CDY50029.1| BnaA06g00300D [Brassica napus]
Length=540

 Score =   335 bits (858),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/274 (58%), Positives = 200/274 (73%), Gaps = 6/274 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + ++DWY + H  LK  L  GR+I RP+GI IN K G      +P+ T
Sbjct  152  PVPYADPEDDYTVLINDWYTESHTQLKNFLDSGRTIGRPDGILINGKAGKGDGSDQPLFT  211

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +++GKTYR R+CNVGL+ S+NFR Q H MKLVE+EGSHV+QNDYDS+D+HVG C  V++T
Sbjct  212  LKQGKTYRIRICNVGLKASLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVILT  271

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+QEPKDYY+VA++RF K   ++  L+ Y GGKG+          P    G AWS+NQFR
Sbjct  272  ANQEPKDYYIVASTRFLKNALTTTGLLRYEGGKGL-----ASSQLPAAPVGWAWSLNQFR  326

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+RYA+NGVSH+D ETPLK
Sbjct  327  SFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDSKLRYALNGVSHIDLETPLK  386

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTK-VTVAPN  64
            LAEYF V +KVFKYD + DNP  D  K + + PN
Sbjct  387  LAEYFGVTDKVFKYDSISDNPTSDQIKNIKIEPN  420



>gb|ACF86554.2| unknown [Zea mays]
 gb|AFW82337.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 203/296 (69%), Gaps = 6/296 (2%)
 Frame = -2

Query  882  PVPFDWPADE--FHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPI  709
            PVPFD P  E    + + DWY K H+ L + L  G+S+ RP G+ IN K G   +   P+
Sbjct  153  PVPFDQPPPESDHAVLIGDWYTKDHEVLARQLDAGKSVGRPAGVLINGKGGKDLEAAAPM  212

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             T E GKTYR RVCN G++ S+NFR QGH MKLVELEGSH +Q+ YDS+D+HVGHCL+VL
Sbjct  213  LTFEAGKTYRLRVCNTGIKASLNFRIQGHDMKLVELEGSHTLQDVYDSLDVHVGHCLSVL  272

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            V ADQ P DYY+VA++RF  +  S+ A+I YAG  G        P   E   G AWS+NQ
Sbjct  273  VDADQAPGDYYMVASTRFIHDAKSASAVIRYAGSSGA----PPAPNMTEPPAGWAWSINQ  328

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
             RSFRWNLTASAARPNPQGSYHYGQI ITRTIK++ S+ H   K+RY  NG+SH D ETP
Sbjct  329  ARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDGKLRYGFNGISHRDTETP  388

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEYF V + VF Y+ M D PP     + V PNV+ A  R F+EI+FEN EK+I
Sbjct  389  LKLAEYFNVTDGVFSYNQMGDVPPAVNGPLHVIPNVITAEFRTFIEIVFENPEKSI  444



>gb|EMS66047.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=570

 Score =   335 bits (858),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/294 (55%), Positives = 207/294 (70%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+F   + DWY K H  L K L  G+ I RP G+ IN K+        P+  
Sbjct  180  PVPFDPPADDFGALVGDWYTKDHTVLAKNLDTGKGIGRPAGLLINGKNEKDASN-PPMYN  238

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E GKTYRFRVCNVG++T++N R QGH +KLVE+EGSH VQN+YDSMD+H+G CL+ L T
Sbjct  239  VEAGKTYRFRVCNVGIKTTLNVRIQGHVLKLVEMEGSHTVQNEYDSMDVHIGQCLSFLTT  298

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q+P DY+ +A++RF K   +  A+I Y G       +      P+   G AWS+NQ+R
Sbjct  299  ANQKPGDYFFIASTRFIKGVSTITAVIRYKGSN-----TPPAAKLPDAPDGWAWSINQWR  353

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL  S+     K RYA+NGVSH DPETPLK
Sbjct  354  SFRWNLTASAARPNPQGSYHYGQINITRTIKLSPSRGKVDGKERYALNGVSHTDPETPLK  413

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF   + VF+Y+++ D PP++ T + VAP+V+   HR ++EI+FEN EK+I
Sbjct  414  LAEYFNATKGVFEYNLVTDTPPKEGTPIKVAPSVITTEHRTYIEIVFENPEKSI  467



>ref|XP_009392060.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=639

 Score =   336 bits (862),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 168/296 (57%), Positives = 209/296 (71%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVPF  PAD++ + + DWY K HK L +LL  GR+I RP+GI IN + G  S G    P+
Sbjct  237  PVPFADPADDYTVLVGDWYTKSHKNLARLLDAGRTIGRPSGILINGRPGKDSTGKDDPPL  296

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             TM+ GKTYR+RVCNVG++ S+NFR Q H+MKLVE++GSH VQN YDS+D+HVG CL+VL
Sbjct  297  FTMKSGKTYRYRVCNVGMKVSLNFRIQSHAMKLVEMDGSHTVQNVYDSLDVHVGQCLSVL  356

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTA QE +DYY+VA+SRF K   S+  +I YAG       +   P  P    G AWS NQ
Sbjct  357  VTAHQEHRDYYMVASSRFTKYALSATGVIRYAGSN-----TPPSPDLPAAPSGWAWSFNQ  411

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +RSFR NLTASAARPNPQGSYHYG I ITRTIKLV S      K RYA+N VSH D  TP
Sbjct  412  WRSFRLNLTASAARPNPQGSYHYGSINITRTIKLVNSVGLVDGKRRYALNAVSHSDAATP  471

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEY+ + +KVFKYD + D P      + + PNVVNAT+R F+EI+FEN ++++
Sbjct  472  LKLAEYYGIADKVFKYDTIADEPAASDAPIKIVPNVVNATYRTFIEIVFENPDRSM  527



>dbj|BAK05994.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score =   334 bits (856),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/294 (55%), Positives = 207/294 (70%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+  + + DW+ K H  +  LL  GRS  RP G+ IN K G       P+ T
Sbjct  159  PVPFDPPADDLQVVIGDWFTKDHAVMASLLDAGRSFGRPAGVLINGKGGKEATN-PPMFT  217

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
             E  KTYR R+CNVG+++S+NFR QGH MKLVE++GSH +Q+ YDS+D+HVG CL+VLV 
Sbjct  218  WEAAKTYRLRICNVGIKSSLNFRIQGHDMKLVEIDGSHTLQDSYDSLDVHVGQCLSVLVD  277

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DY +VA++RF  +  S  A++ YAG       +   P  PE   G AWS+NQ+R
Sbjct  278  ADQKPADYLMVASTRFMADASSVSAVVRYAGSN-----TPPAPNVPEPPAGWAWSLNQWR  332

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL+ ++ H   K++Y  NGVSHVD +TPLK
Sbjct  333  SFRWNLTASAARPNPQGSYHYGQINITRTIKLLVTRGHIDGKLKYGFNGVSHVDADTPLK  392

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF + ++VFKY+ M D PP     + VAPNV+ A  R F+E++FEN EK++
Sbjct  393  LAEYFNISDQVFKYNQMADTPPAVNGPMHVAPNVITAEFRTFIEVVFENPEKSM  446



>ref|XP_002456532.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
 gb|EES01652.1| hypothetical protein SORBIDRAFT_03g037970 [Sorghum bicolor]
Length=558

 Score =   334 bits (856),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 204/294 (69%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+F + + DWY K H  L K L  G+ I RP+G+ IN K+        P+  
Sbjct  157  PVPFDRPADDFPVLVGDWYTKDHAVLAKNLDAGKGIGRPSGLVINGKNEKDAAN-PPMYN  215

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E GKTYRFR+CNVG++ SIN   Q H MKLVE+EGSH +QNDYDS+D+HVG CL+VLVT
Sbjct  216  VEAGKTYRFRICNVGMKASINIGIQNHIMKLVEMEGSHTMQNDYDSLDIHVGQCLSVLVT  275

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DY LVA++RF KE  ++ A+I Y G          P   PE   G AWS+NQ R
Sbjct  276  ADQKPGDYLLVASTRFIKEVSTTTAVIRYKGASA-----PPPAKLPESPSGWAWSINQAR  330

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTI+L   +     K R+ INGVSHVDPETP+K
Sbjct  331  SFRWNLTASAARPNPQGSYHYGQINITRTIRLGIGRGKVDGKERFGINGVSHVDPETPVK  390

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF   + VF+YD++ D PP       +APNV+ A  R F+E++FEN EK+I
Sbjct  391  LAEYFNATDGVFQYDLIGDVPPAKSAPTKMAPNVLRAEFRTFIEVVFENPEKSI  444



>ref|NP_001151772.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG44269.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   333 bits (855),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 167/296 (56%), Positives = 203/296 (69%), Gaps = 6/296 (2%)
 Frame = -2

Query  882  PVPFDWPADE--FHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPI  709
            PVPFD P  E    + + DWY K H+ L + L  G+S+ RP G+ IN K G   +   P+
Sbjct  153  PVPFDQPPPESDHAVLIGDWYTKDHEVLARQLDAGKSVGRPAGVLINGKGGKDLEAAAPM  212

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             T E GKTYR RVCN G++ S+NFR QGH MKLVELEGSH +Q+ YDS+D+HVGHCL+VL
Sbjct  213  LTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSHTLQDVYDSLDVHVGHCLSVL  272

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            V ADQ P DYY+VA++RF  +  S+ A+I YAG  G        P   E   G AWS+NQ
Sbjct  273  VDADQAPGDYYMVASTRFIHDAKSASAVIRYAGSSGA----PPAPNMTEPPAGWAWSINQ  328

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
             RSFRWNLTASAARPNPQGSYHYGQI ITRTIK++ S+ H   K+RY  NG+SH D ETP
Sbjct  329  ARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDGKLRYGFNGISHRDTETP  388

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEYF V + VF Y+ M D PP     + V PNV+ A  R F+EI+FEN EK+I
Sbjct  389  LKLAEYFNVTDGVFSYNQMGDVPPAVNGPLHVIPNVITAEFRTFIEIVFENPEKSI  444



>dbj|BAK07214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/294 (55%), Positives = 210/294 (71%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+F   + DWY K H+ L K L  G+ I RP G+ IN K+        P+  
Sbjct  156  PVPFDPPADDFSALVGDWYTKDHEVLAKNLDTGKGIGRPAGLLINGKNEKDASN-PPMYN  214

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E GKTYRFRVCNVG++T++N R QGH +KLVE+EGSH VQN+YDS+D+H+G CL+ L T
Sbjct  215  VETGKTYRFRVCNVGIKTTLNVRIQGHVVKLVEMEGSHTVQNEYDSLDVHIGQCLSFLTT  274

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q+P DY+L+A++RF K   +  A++ Y G       S   P  PE   G AWS+NQ+R
Sbjct  275  ANQKPGDYFLIASTRFIKGVNTITAVMRYKGSN-----SPPSPKLPEAPAGWAWSINQWR  329

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL  S+     K RYA+NGVSH D ETPLK
Sbjct  330  SFRWNLTASAARPNPQGSYHYGQINITRTIKLSTSRGKVDGKERYALNGVSHADAETPLK  389

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF   + VF+Y+++ D PP++ T + +APNV+ A HR ++E++FEN E++I
Sbjct  390  LAEYFNATKGVFEYNLITDTPPKEGTPIKLAPNVITAEHRTYIEVVFENPERSI  443



>ref|XP_009387378.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=550

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/294 (55%), Positives = 204/294 (69%), Gaps = 7/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGS--VGDKLEPI  709
            PVPFD PAD++ + + DWY K HK L  +L  GRSI  P+G+ IN K G    G   +P+
Sbjct  148  PVPFDPPADDYTVLIGDWYAKDHKALAGILDAGRSIGLPDGVIINGKTGKDRTGKDGKPL  207

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
              ME GK YR+R+CN G+R S+NFR QGHSM+LVE++GSH +QN YDS+D+HVG C +VL
Sbjct  208  FVMESGKVYRYRICNTGIRASLNFRIQGHSMELVEIDGSHTMQNLYDSLDVHVGQCYSVL  267

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTA+Q P DYYLVA++RF K+  ++  ++ YAG K            P+   G AWS NQ
Sbjct  268  VTANQAPGDYYLVASTRFMKKELTATGIVRYAGSK-----VPPSAVLPKAPTGWAWSFNQ  322

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +RSFRWNLTASAARPNPQGS+HYG I ITRTIK   S++  G K R+A+NGVSHVD +TP
Sbjct  323  WRSFRWNLTASAARPNPQGSFHYGSINITRTIKFANSRAVVGGKSRFALNGVSHVDVDTP  382

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEK  7
            LK  EYF V +K FKY++  D P E    V +APNV+    R FVE+IFEN EK
Sbjct  383  LKHLEYFGVADKFFKYNLTGDEPREGSGPVNLAPNVITVEFRTFVEVIFENPEK  436



>ref|XP_010922850.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   332 bits (851),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 163/296 (55%), Positives = 207/296 (70%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHG--SVGDKLEPI  709
            PVPF  PA+EF++   DW+ +GHK L + L  GR +  P G+ IN + G  + G    P+
Sbjct  149  PVPFAPPAEEFNVLAGDWFTRGHKVLARKLDAGRRLGLPAGVLINGRSGRNAAGHDDLPM  208

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             TM+ G  YRFR CNVGL+ S+NFR Q HS+KLVE+EGSH VQN YDS+D+HVG C++VL
Sbjct  209  FTMQAGNVYRFRFCNVGLKASLNFRIQKHSLKLVEMEGSHTVQNLYDSLDVHVGQCMSVL  268

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            VTADQ P DYYLVA++RF K+ +++ A++ YAG              P G  G AWS NQ
Sbjct  269  VTADQAPGDYYLVASTRFTKKVHTATAVLRYAGSNS-----PPSRVIPRGPSGWAWSFNQ  323

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +R+FRWNLTASAARPNPQGSYHYGQI ITRTI+LV   +    K+RY ING+SHV+ +TP
Sbjct  324  WRTFRWNLTASAARPNPQGSYHYGQINITRTIRLVNGHNVVDGKLRYFINGISHVESDTP  383

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEYF     VFKY++M D PP     +T+ PNV+ A  R F+EIIFEN E++I
Sbjct  384  LKLAEYFNASSPVFKYNLMGDVPPAPDAPLTLVPNVITAEFRTFIEIIFENTERSI  439



>gb|ADK47981.1| L-ascorbate oxidase-like protein [Cynodon dactylon]
Length=550

 Score =   331 bits (849),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 208/294 (71%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PV FD PAD+F + + DWY K H  L K L  G+ I RP G+ IN K+        P+  
Sbjct  149  PVLFDAPADDFPVLVGDWYTKDHTVLAKHLDAGKGIGRPAGLIINGKNDKDAAS-APMYN  207

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
             E GKTYRFRVCNVG++ S+N R  GH++KLVE+EGSH VQN YDS+D+HVG CL+ LVT
Sbjct  208  FEAGKTYRFRVCNVGIKASLNVRVPGHNLKLVEMEGSHTVQNMYDSLDVHVGQCLSFLVT  267

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DY+LV ++RF KE  +  ALI Y G       +   P  PEG  G AWS+NQ+R
Sbjct  268  ADQKPADYFLVVSTRFIKEVSTITALIRYKGSS-----TPPSPKLPEGPSGWAWSINQWR  322

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL  S+     K RYA+NGVSHVD ETPLK
Sbjct  323  SFRWNLTASAARPNPQGSYHYGQINITRTIKLSTSRGKVDGKERYALNGVSHVDAETPLK  382

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF   + VF+Y+++ D PP+  T + +APNV++A  R F+E++FEN EK+I
Sbjct  383  LAEYFNATDGVFQYNLISDVPPKAGTPIKLAPNVLSAEFRTFIEVVFENPEKSI  436



>ref|XP_009411781.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=548

 Score =   331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 158/294 (54%), Positives = 203/294 (69%), Gaps = 8/294 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD++ + + DWY K HK L ++L  GRSI  P G+ IN K    G   EP+  
Sbjct  151  PVPFDPPADDYTVMIGDWYTKDHKTLARILDTGRSIGLPAGVLINGK---AGKDDEPLFV  207

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GK YR+RVCN+G +TS+NFR QGHSM LVE++GSH +QN Y+S+D+HVG C +VLVT
Sbjct  208  MEAGKVYRYRVCNIGTKTSLNFRIQGHSMLLVEMDGSHTMQNTYESLDIHVGQCFSVLVT  267

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            A+Q P DYY+VA++RF ++  ++  +I Y+G   +P       P         WS+NQ+R
Sbjct  268  ANQAPGDYYMVASTRFLRKELTATGVIRYSGSHTLPSPVLPKAPSGWA-----WSLNQWR  322

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYG I+ITRTIKL +S++    K RY +NGVSHV+ +TPLK
Sbjct  323  SFRWNLTASAARPNPQGSYHYGSIDITRTIKLASSRAIIAGKNRYTLNGVSHVEADTPLK  382

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF +  K FKY++  D PP       +A NV+    R FVEIIFEN EK +
Sbjct  383  LAEYFGIGGKSFKYNLTSDEPPSGGAPAILATNVITIEFRTFVEIIFENPEKNV  436



>ref|XP_008672229.1| PREDICTED: uncharacterized protein LOC100194388 isoform X1 [Zea 
mays]
 gb|ACN27218.1| unknown [Zea mays]
 tpg|DAA57111.1| TPA: hypothetical protein ZEAMMB73_564948 [Zea mays]
Length=557

 Score =   331 bits (848),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 165/294 (56%), Positives = 198/294 (67%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD+F + + DWY K H  L K L  G+ I RP G+ IN K+        P+  
Sbjct  156  PVPFDTPADDFPVLVGDWYTKDHTVLAKNLDAGKGIGRPAGLVINGKNEKDASN-PPMYN  214

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E GKTYRFRVCNVG++ S N R Q H MKLVE+EGSH +QNDYDS+D+H+G CL+ LVT
Sbjct  215  VEAGKTYRFRVCNVGIKASFNIRIQNHIMKLVEMEGSHTMQNDYDSLDLHIGQCLSFLVT  274

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DY L  ++RF KE  S  A+I Y G          P   PE   G AWS+NQ R
Sbjct  275  ADQKPGDYLLAVSTRFIKEVNSITAVIRYKGSNA-----PPPAKVPESPSGWAWSINQCR  329

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL   +     K R+  NGVSHVDPETP+K
Sbjct  330  SFRWNLTASAARPNPQGSYHYGQINITRTIKLAMGRGKVDGKERFGFNGVSHVDPETPVK  389

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF   + VF+YDI+ D PP       +APNV+ A  R F+E++FEN EK+I
Sbjct  390  LAEYFNTTDGVFQYDIIGDVPPSKSAPTKMAPNVIRAEFRTFIEVVFENPEKSI  443



>ref|XP_008466955.1| PREDICTED: L-ascorbate oxidase homolog, partial [Cucumis melo]
Length=281

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/240 (67%), Positives = 188/240 (78%), Gaps = 6/240 (3%)
 Frame = -2

Query  717  EPIATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCL  538
            EP+ TM+ GKTY++RVCNVGL++S+NFRFQGH+MKLVE+EGSH VQNDY S+D+HVG C 
Sbjct  1    EPLFTMKPGKTYKYRVCNVGLKSSLNFRFQGHTMKLVEMEGSHTVQNDYQSLDVHVGQCF  60

Query  537  AVLVTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWS  358
            +VLVTA+QE KDYY+VA++RF K       ++ Y  GKG        P  PE   G AWS
Sbjct  61   SVLVTANQESKDYYMVASTRFIKNVLVGKGIVRYTDGKG-----PASPEIPEAPVGWAWS  115

Query  357  MNQFRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDP  178
            +NQFR+FRWNLTASAARPNPQGSYHYG I ITRTIKLV S S    K+RYAINGVSHVDP
Sbjct  116  LNQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASKVDGKLRYAINGVSHVDP  175

Query  177  ETPLKLAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            ETPLKLAEYF + +KVFKYD + D    E  T VTVAPNVVNAT R+F+EIIFENHEK++
Sbjct  176  ETPLKLAEYFGIADKVFKYDTISDEGLAEGATTVTVAPNVVNATFRDFIEIIFENHEKSL  235



>ref|XP_006644902.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=555

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 206/294 (70%), Gaps = 6/294 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PA ++ + + DWY K H  L K L  G+SI RP G+ IN K+        P+ T
Sbjct  154  PVPFDEPAGDYPVLVGDWYTKDHTVLAKNLEAGKSIGRPAGLVINGKNEKDASN-PPMYT  212

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GK YR+RVCNVG++TS+N R Q H +KLVE+EGSH VQN YDS+D+HV  C++ LV 
Sbjct  213  MEAGKVYRYRVCNVGIKTSLNVRIQSHIIKLVEMEGSHTVQNTYDSLDVHVAQCVSFLVA  272

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DY LVA++RF KET S  A+I Y G       +   P  PEG  G AWS+NQ+R
Sbjct  273  ADQKPGDYLLVASTRFMKETSSITAIIRYNGSN-----TPASPKLPEGPSGWAWSINQWR  327

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SFRWNLTASAARPNPQGSYHYGQI ITRTI+L A ++  G K R+AINGVSHVD ETPLK
Sbjct  328  SFRWNLTASAARPNPQGSYHYGQINITRTIRLSAGRAKVGGKERFAINGVSHVDAETPLK  387

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEYF     VF+Y+++ D PP     V +APNV+    R F+E++FEN EK+I
Sbjct  388  LAEYFNATAGVFEYNLIGDVPPAAGAAVKLAPNVIQTEFRTFIEVVFENPEKSI  441



>ref|XP_008449954.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=446

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/239 (68%), Positives = 186/239 (78%), Gaps = 6/239 (3%)
 Frame = -2

Query  714  PIATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLA  535
            P+ TM+ GKTY++RVCNVGL+TS+NFRFQGH+MKLVE+EGSH VQNDY S+D+HVG C +
Sbjct  100  PLFTMKPGKTYKYRVCNVGLKTSLNFRFQGHTMKLVEMEGSHTVQNDYKSLDVHVGQCFS  159

Query  534  VLVTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSM  355
            VLVTADQEPKDYY+VA++RF K       ++ Y  GKG        P  P    G AWS+
Sbjct  160  VLVTADQEPKDYYMVASTRFIKSALVGKGIVRYTNGKG-----PASPELPNAPMGWAWSL  214

Query  354  NQFRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPE  175
            NQFR+FRWNLTASAARPNPQGSYHYG I ITRTIKLV S S    K+RYAINGVSHVDPE
Sbjct  215  NQFRTFRWNLTASAARPNPQGSYHYGSINITRTIKLVNSASKVDGKLRYAINGVSHVDPE  274

Query  174  TPLKLAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            TPLKLAEYF V +KVFKYD + D    E  T VTVAPNVVN T RNF+EIIFENHEK++
Sbjct  275  TPLKLAEYFGVTDKVFKYDTISDEGLAEGATTVTVAPNVVNTTFRNFIEIIFENHEKSL  333



>ref|XP_006445540.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 ref|XP_006489004.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR58780.1| hypothetical protein CICLE_v10018007mg [Citrus clementina]
 gb|KDO54549.1| hypothetical protein CISIN_1g046746mg [Citrus sinensis]
Length=561

 Score =   328 bits (840),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/302 (50%), Positives = 217/302 (72%), Gaps = 14/302 (5%)
 Frame = -2

Query  882  PVPFD-WPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSV-------G  727
            PVP++ +  D+F + + DWY + H  L K L  G+ + +P+G+ IN K G +       G
Sbjct  152  PVPYNRFVEDDFTLLIGDWYTRSHVELGKQLDSGKLLGKPDGVLINGKSGRLDYDSDGKG  211

Query  726  DKLEPIATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVG  547
            D  EP+ TM+ GK Y++R+CNVG++TS+NFR QGH+MKLVE+EGSHVVQN+Y+S+D+HVG
Sbjct  212  DN-EPLFTMKAGKVYKYRICNVGVKTSLNFRIQGHTMKLVEMEGSHVVQNEYESLDVHVG  270

Query  546  HCLAVLVTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgi  367
             C  VLVTA+Q+PKDYYL+A++RF +   ++ A++ Y+  KG+        P        
Sbjct  271  QCFTVLVTANQDPKDYYLIASTRFTRTVITTTAIVRYSDSKGLASPDLPKAPVGWD----  326

Query  366  AWSMNQFRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSH  187
             WS+NQFRSFRWNLTASAARPNPQGS+HYG I I RTI+L  +      KVR+A+NGVS+
Sbjct  327  -WSLNQFRSFRWNLTASAARPNPQGSFHYGGIPINRTIRLANTAHLVNGKVRFAVNGVSY  385

Query  186  VDPETPLKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEK  7
            V+ ETPLK AEY+ +PE+VFKY+++ D P +++  VT+ PNV++AT++ F+EI+ EN + 
Sbjct  386  VNSETPLKFAEYYGIPEEVFKYNVISDKPADEIENVTLQPNVMDATYKAFMEIVLENRQN  445

Query  6    TI  1
            T+
Sbjct  446  TM  447



>gb|EEE55579.1| hypothetical protein OsJ_03867 [Oryza sativa Japonica Group]
Length=550

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/295 (57%), Positives = 207/295 (70%), Gaps = 7/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PA ++ + + DWY K H  L K L  G+SI RP G+ IN K+        P+ T
Sbjct  148  PVPFDEPAGDYPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVINGKNEKDASN-PPMYT  206

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GK YRFRVCNVG++TS+N R QGHS+KLVE+EGSH VQN YDS+D+HV  C++ LVT
Sbjct  207  MEAGKVYRFRVCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNSYDSLDVHVAQCVSFLVT  266

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DY LVA++RF KE  +  A++ Y G       +   P  PEG  G AWS+NQ+R
Sbjct  267  ADQKPGDYLLVASTRFLKEYSAITAIVRYNGSN-----TPASPKLPEGPSGWAWSINQWR  321

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHV-DPETPL  166
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL  SK     K R+A+NGVSHV D +TPL
Sbjct  322  SFRWNLTASAARPNPQGSYHYGQINITRTIKLCTSKGKVDGKERFALNGVSHVDDAQTPL  381

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF     VF+Y+++ D PP       +APNV++A  R F+E++FEN EK+I
Sbjct  382  KLAEYFNASSGVFEYNLIGDVPPATTVPQKLAPNVISAEFRTFIEVVFENPEKSI  436



>ref|NP_001044620.1| Os01g0816700 [Oryza sativa Japonica Group]
 dbj|BAB64824.1| putative L-ascorbate oxidase [Oryza sativa Japonica Group]
 dbj|BAF06534.1| Os01g0816700 [Oryza sativa Japonica Group]
Length=553

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/295 (57%), Positives = 207/295 (70%), Gaps = 7/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PA ++ + + DWY K H  L K L  G+SI RP G+ IN K+        P+ T
Sbjct  151  PVPFDEPAGDYPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVINGKNEKDASN-PPMYT  209

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GK YRFRVCNVG++TS+N R QGHS+KLVE+EGSH VQN YDS+D+HV  C++ LVT
Sbjct  210  MEAGKVYRFRVCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNSYDSLDVHVAQCVSFLVT  269

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DY LVA++RF KE  +  A++ Y G       +   P  PEG  G AWS+NQ+R
Sbjct  270  ADQKPGDYLLVASTRFLKEYSAITAIVRYNGSN-----TPASPKLPEGPSGWAWSINQWR  324

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHV-DPETPL  166
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL  SK     K R+A+NGVSHV D +TPL
Sbjct  325  SFRWNLTASAARPNPQGSYHYGQINITRTIKLCTSKGKVDGKERFALNGVSHVDDAQTPL  384

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF     VF+Y+++ D PP       +APNV++A  R F+E++FEN EK+I
Sbjct  385  KLAEYFNASSGVFEYNLIGDVPPATTVPQKLAPNVISAEFRTFIEVVFENPEKSI  439



>gb|EEC71702.1| hypothetical protein OsI_04207 [Oryza sativa Indica Group]
Length=565

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 167/295 (57%), Positives = 207/295 (70%), Gaps = 7/295 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PA ++ + + DWY K H  L K L  G+SI RP G+ IN K+        P+ T
Sbjct  148  PVPFDEPAGDYPVLVGDWYTKDHTVLAKNLDAGKSIGRPAGLVINGKNEKDASN-PPMYT  206

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GK YRFRVCNVG++TS+N R QGHS+KLVE+EGSH VQN YDS+D+HV  C++ LVT
Sbjct  207  MEAGKVYRFRVCNVGIKTSLNVRIQGHSLKLVEMEGSHTVQNSYDSLDVHVAQCVSFLVT  266

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
            ADQ+P DY LVA++RF KE  +  A++ Y G       +   P  PEG  G AWS+NQ+R
Sbjct  267  ADQKPGDYLLVASTRFLKEYSAITAIVRYNGSN-----TPASPKLPEGPSGWAWSINQWR  321

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHV-DPETPL  166
            SFRWNLTASAARPNPQGSYHYGQI ITRTIKL  SK     K R+A+NGVSHV D +TPL
Sbjct  322  SFRWNLTASAARPNPQGSYHYGQINITRTIKLCTSKGKVDGKERFALNGVSHVDDAQTPL  381

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEYF     VF+Y+++ D PP       +APNV++A  R F+E++FEN EK+I
Sbjct  382  KLAEYFNASSGVFEYNLIGDVPPATTVPQKLAPNVISAEFRTFIEVVFENPEKSI  436



>ref|XP_004961713.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=556

 Score =   326 bits (836),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/282 (57%), Positives = 201/282 (71%), Gaps = 6/282 (2%)
 Frame = -2

Query  846  IFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIATMEKGKTYRFRVC  667
            + + DWY K H+ + ++L  GRS+ RP G+ IN K G       P+ T E GKTYRFRVC
Sbjct  166  VLIGDWYTKDHEVMARMLDAGRSVGRPEGVLINGK-GGPDAAAAPMFTFEAGKTYRFRVC  224

Query  666  NVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVTADQEPKDYYLVA  487
            N G++ S+NFR QGH MKLVE+EGSH VQ+ YDS+D+HVGHCL+VLV ADQ+P DYY+VA
Sbjct  225  NTGIKASLNFRIQGHDMKLVEMEGSHTVQDMYDSLDVHVGHCLSVLVDADQKPGDYYMVA  284

Query  486  TSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFRSFRWNLTASAAR  307
            ++RF  +  S +A+I YAG       +   P  PE   G AWS+NQ+RSFRWNLTASAAR
Sbjct  285  STRFIHDARSVMAVIRYAGSN-----TPPSPNVPEPPAGWAWSINQWRSFRWNLTASAAR  339

Query  306  PNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLKLAEYFQVPEKVF  127
            PNPQGSYHYGQI ITRTIKL+ S+ H   K++Y  NGVSH D ETPLKLAEYF V + VF
Sbjct  340  PNPQGSYHYGQINITRTIKLMVSRGHIDGKLKYGFNGVSHRDTETPLKLAEYFNVTDGVF  399

Query  126  KYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
             Y+ M D PP     ++V PNV+ A  R F+EIIFEN EK++
Sbjct  400  SYNQMGDVPPAVNGPLSVIPNVITAEFRTFIEIIFENPEKSM  441



>ref|NP_001151961.1| pollen-specific protein NTP303 precursor [Zea mays]
 gb|ACG45153.1| pollen-specific protein NTP303 precursor [Zea mays]
Length=559

 Score =   326 bits (836),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 167/298 (56%), Positives = 203/298 (68%), Gaps = 12/298 (4%)
 Frame = -2

Query  882  PVPFDWPADEFH--IFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLE--  715
            PVPFD P  E    + + DWY K H+ L + +  G+ + RP G+ IN K G     LE  
Sbjct  155  PVPFDQPPPENDHVVLIGDWYTKDHEVLARQIDAGKGVGRPAGVLINGKGGK---DLEAA  211

Query  714  PIATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLA  535
            P  T E GKTYR RVCN G++ S+NFR QGH MKLVELEGSH +QN YDS+D+HVGHCL+
Sbjct  212  PAFTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSHTLQNTYDSLDVHVGHCLS  271

Query  534  VLVTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSM  355
            VLV ADQ+P DYY+VA++RF  +  S+ A+I YAG           P   E   G AWS+
Sbjct  272  VLVDADQKPGDYYMVASTRFIHDAKSASAVIRYAGSS-----VPPAPNMTEPPAGWAWSI  326

Query  354  NQFRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPE  175
            NQ RSFRWNLTASAARPNPQGSYHYGQI ITRTIK++ S+ H   K+RY  NG+SH DPE
Sbjct  327  NQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDGKLRYGFNGISHRDPE  386

Query  174  TPLKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            TP+KLAEYF V + VF Y+ M D PP     + V PNV+ A  R F+EI+FEN EK+I
Sbjct  387  TPVKLAEYFNVTDGVFSYNQMGDVPPAVNGPLHVIPNVITAEFRTFIEIVFENPEKSI  444



>gb|ACN26659.1| unknown [Zea mays]
 gb|AFW78430.1| pollen-specific protein NTP303 [Zea mays]
Length=559

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/298 (56%), Positives = 202/298 (68%), Gaps = 12/298 (4%)
 Frame = -2

Query  882  PVPFDWPADEFH--IFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLE--  715
            PVPFD P  E    + + DWY K H+ L + +  G+ + RP G+ IN K G     LE  
Sbjct  155  PVPFDQPPPENDHVVLIGDWYTKDHEVLARQIDAGKGVGRPAGVLINGKGGK---DLEAA  211

Query  714  PIATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLA  535
            P  T E GKTYR RVCN G++ S+NFR QGH MKLVELEGSH +QN YDS+D+HVGHCL+
Sbjct  212  PAFTFEAGKTYRLRVCNTGIKASLNFRIQGHYMKLVELEGSHTLQNTYDSLDVHVGHCLS  271

Query  534  VLVTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSM  355
            VLV ADQ+P DYY+VA++RF  +  S+ A+I YAG           P   E   G AWS+
Sbjct  272  VLVDADQKPGDYYMVASTRFIHDAKSASAVIRYAGSSA-----PPSPNMTEPPAGWAWSI  326

Query  354  NQFRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPE  175
            NQ RSFRWNLTASAARPNPQGSYHYGQI ITRTIK++ S+ H   K+RY  NG+SH DPE
Sbjct  327  NQARSFRWNLTASAARPNPQGSYHYGQINITRTIKVMVSRGHIDGKLRYGFNGISHRDPE  386

Query  174  TPLKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            TP+KLAEYF   + VF Y+ M D PP     + V PNV+ A  R F+EI+FEN EK+I
Sbjct  387  TPVKLAEYFNATDGVFSYNQMGDVPPAVNGPLHVIPNVITAEFRTFIEIVFENPEKSI  444



>ref|XP_006838146.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
 gb|ERN00715.1| hypothetical protein AMTR_s00106p00093220 [Amborella trichopoda]
Length=546

 Score =   323 bits (828),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 162/295 (55%), Positives = 210/295 (71%), Gaps = 8/295 (3%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PAD++ + + DWY   H  L++ L  GRSI +P+G+ IN  +       +P+  
Sbjct  147  PVPFDDPADDYTVLIGDWYASDHNTLRRRLDSGRSIGQPDGVLINGMNKP-NKANKPLFN  205

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            ME GKTYR+R+CNVGL+TS+NFR QGH++KLVE+EGSH VQN Y+S+D+HVG C +VLVT
Sbjct  206  MEPGKTYRYRICNVGLKTSLNFRIQGHTLKLVEIEGSHTVQNIYESLDVHVGQCYSVLVT  265

Query  522  ADQEPKDYYLVATSRFF-KETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQF  346
            A++ P+DYY+VA++RF  K T+++ ALI Y G K        P   P    G+AWS+NQF
Sbjct  266  ANKVPRDYYIVASTRFTNKYTHTATALIHYTGSK-----KPAPLMLPPAPTGVAWSLNQF  320

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGS+HYGQI ITRTIKL  S      K+RYA+NGVS+V P TPL
Sbjct  321  RSFRWNLTASAARPNPQGSFHYGQINITRTIKLSNSVGFVKSKLRYAMNGVSYVRPSTPL  380

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLAEY+ V  +VF    + D PP    ++ +AP VV    R+F+EI+FEN EK+I
Sbjct  381  KLAEYYGVAARVFDTKAIADMPPAS-PQIKLAPAVVKGNFRDFIEIVFENREKSI  434



>ref|XP_010931432.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=551

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/296 (55%), Positives = 205/296 (69%), Gaps = 7/296 (2%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGS--VGDKLEPI  709
            PVPF  PA+EF +   DW+   HK L + L  GR +  P G+ IN + G    G    P+
Sbjct  149  PVPFAPPAEEFDVLAGDWFTASHKLLARKLDAGRGLGLPAGVLINGRPGRPVTGHDDPPM  208

Query  708  ATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVL  529
             T++ G  YRFR CNVGL+TS+NFR Q HS+KLVE+EGSH +QN YDS+D+HVG CL+VL
Sbjct  209  FTVQAGNVYRFRFCNVGLKTSLNFRIQKHSLKLVEMEGSHTIQNLYDSLDVHVGQCLSVL  268

Query  528  VTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQ  349
            V ADQ P DYYLV ++RF K+ +++ A++ YAG       +   P  PEG  G AWS NQ
Sbjct  269  VVADQGPGDYYLVVSTRFTKKIHTATAVLRYAGSN-----TPPSPVIPEGPSGWAWSFNQ  323

Query  348  FRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETP  169
            +R+FRWNLTASAARPNPQGSYHYG+I ITRTIKL+   +    K R+ INGVSHVDP+TP
Sbjct  324  WRTFRWNLTASAARPNPQGSYHYGEINITRTIKLLNGHTVVDGKRRHFINGVSHVDPDTP  383

Query  168  LKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LKLAEYF +   VF Y++M D PP     V +APNV+ A  R F+EIIFEN E++I
Sbjct  384  LKLAEYFNLSNPVFNYNLMGDVPPALDIPVKLAPNVITAEFRTFIEIIFENTERSI  439



>ref|XP_002441281.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
 gb|EES19711.1| hypothetical protein SORBIDRAFT_09g023770 [Sorghum bicolor]
Length=559

 Score =   321 bits (822),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 164/298 (55%), Positives = 206/298 (69%), Gaps = 12/298 (4%)
 Frame = -2

Query  882  PVPFDWPADEFH--IFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLE--  715
            PVPFD P  E    + + DWY K H+ L + L  G+S+ RP G+ IN K G     LE  
Sbjct  155  PVPFDQPPPENDHVVLIGDWYTKDHEVLARQLDAGKSVGRPAGVVINGKGGK---DLESA  211

Query  714  PIATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLA  535
            P+ T + GKTYR RVCN G++ S+NFR QGH M LVELEGSH +Q+ YDS+D+HVGHCL+
Sbjct  212  PLFTFDAGKTYRLRVCNTGIKASLNFRIQGHHMTLVELEGSHTLQDVYDSLDVHVGHCLS  271

Query  534  VLVTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSM  355
            VLVTADQ+P DYY+VA++RF  +  S+ A++ YAG       +  P   PE   G AWS+
Sbjct  272  VLVTADQKPGDYYMVASTRFIHDAKSARAVVRYAGSS-----APPPAEMPEPPAGWAWSI  326

Query  354  NQFRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPE  175
            NQ RS RWNLT+SAARPNPQGSYHYGQI ITRTI+++ S+ H   K+RY  NGVSH DPE
Sbjct  327  NQARSIRWNLTSSAARPNPQGSYHYGQINITRTIRVMVSRGHIDGKLRYGFNGVSHRDPE  386

Query  174  TPLKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            TP+KLAEYF V + VF Y+ M D PP     + V PNV+ A  R F+EI+FEN EK++
Sbjct  387  TPVKLAEYFNVTDGVFSYNQMGDVPPAVNGPLHVVPNVITAEFRTFIEIVFENPEKSL  444



>ref|XP_006386039.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
 gb|ERP63836.1| multi-copper oxidase type 1 family protein, partial [Populus 
trichocarpa]
Length=534

 Score =   315 bits (807),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 162/296 (55%), Positives = 199/296 (67%), Gaps = 27/296 (9%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + L+DWY   H  L+K L  GRS+ARPNG+ IN K+       EP+ T
Sbjct  129  PVPYVDPEDDYTVILNDWYTSSHSTLRKYLDSGRSLARPNGVLINGKNAKGDGNDEPLFT  188

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            M+ GKTY++R+CN GL+ ++NFR QGH+MKLVE+EGSHVVQN Y+ +D+HVG C +VL  
Sbjct  189  MKPGKTYKYRICNAGLKNTLNFRIQGHTMKLVEMEGSHVVQNVYEPLDVHVGQCFSVL--  246

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
                              E  +S  +I Y  GKG        P  PE   G AWS+NQFR
Sbjct  247  ------------------EVLTSKGIIRYTNGKG-----PASPELPEAPVGWAWSLNQFR  283

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            SF WNLTASAARPNPQGSYHYG I ITRTIKLV S S  G K+ YAINGVSHV+PETPLK
Sbjct  284  SFHWNLTASAARPNPQGSYHYGSINITRTIKLVNSASRAGGKLCYAINGVSHVNPETPLK  343

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDL--TKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LAEY+ +  KVFKYD + D P  ++   KV   PNV+N T RNFVEI+FENHEK++
Sbjct  344  LAEYYGIAHKVFKYDTIPDMPLANIASAKVVTHPNVINQTFRNFVEIVFENHEKSM  399



>emb|CDY43352.1| BnaA01g29830D [Brassica napus]
Length=509

 Score =   313 bits (803),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/239 (62%), Positives = 189/239 (79%), Gaps = 5/239 (2%)
 Frame = -2

Query  717  EPIATMEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCL  538
            +P+ TM+ GKTY++R+CNVG ++++NFR QGH MKLVE+EGSHV+QNDYDS+D+HVG C 
Sbjct  163  KPLFTMKPGKTYKYRICNVGFKSTLNFRIQGHKMKLVEMEGSHVLQNDYDSLDVHVGQCF  222

Query  537  AVLVTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWS  358
            AVLVTADQE K YY+VA++RF K+  S+V ++SY G        +     P+   G AWS
Sbjct  223  AVLVTADQEAKSYYMVASTRFLKKEVSTVGVMSYEGSN-----VQPSNVLPKAPVGWAWS  277

Query  357  MNQFRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDP  178
            +NQFRSFRWNLTASAARPNPQGSYHYG+I ITRTIKL  +K+    KVR+ +NGVSHVD 
Sbjct  278  LNQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLANTKNLVDGKVRFGLNGVSHVDT  337

Query  177  ETPLKLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            ETPLKLAEYF++ EKVFKY+++KD P   +T +TV PNV+N T R FVEI+FENHE+++
Sbjct  338  ETPLKLAEYFEMSEKVFKYNVIKDEPAAKITTLTVEPNVLNITFRTFVEIVFENHERSM  396



>gb|EMT12555.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=440

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/282 (54%), Positives = 194/282 (69%), Gaps = 6/282 (2%)
 Frame = -2

Query  846  IFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIATMEKGKTYRFRVC  667
            + + DW+ K H  +  LL  GR+  RP G+ IN + G       P+ T E  KTY+ R+C
Sbjct  51   VLIGDWFTKDHAVMASLLDAGRNFGRPAGVLINGRGGKEAAN-PPMFTWEAAKTYQLRIC  109

Query  666  NVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVTADQEPKDYYLVA  487
            NVG++TS+NFR QGH MKLVE++GSH VQ  Y+S+D+HVG C+AVLV ADQ+P DY +VA
Sbjct  110  NVGIKTSLNFRIQGHDMKLVEMDGSHTVQGMYESLDVHVGQCMAVLVDADQKPADYLMVA  169

Query  486  TSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFRSFRWNLTASAAR  307
            ++RF     S  A+I YAG       +      PE   G AWS+NQ+RSFRWNLTASAAR
Sbjct  170  STRFMAGPSSVSAVIRYAGSN-----TPPAANVPEPPAGWAWSINQWRSFRWNLTASAAR  224

Query  306  PNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLKLAEYFQVPEKVF  127
            PNPQGSYHYGQI ITRTIKL+ ++ H   K++Y  NGVSHVD +TPLKLAEYF V ++VF
Sbjct  225  PNPQGSYHYGQINITRTIKLMVTRGHVEGKLKYGFNGVSHVDGDTPLKLAEYFNVSDQVF  284

Query  126  KYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KY+ M D PP     + V PNV+ A  R F+E++FEN EK++
Sbjct  285  KYNQMGDEPPAVNGPMHVVPNVITAEFRTFIEVVFENPEKSM  326



>ref|XP_006850531.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
 gb|ERN12112.1| hypothetical protein AMTR_s00159p00040990 [Amborella trichopoda]
Length=543

 Score =   295 bits (755),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 150/295 (51%), Positives = 205/295 (69%), Gaps = 13/295 (4%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVPFD PA+++ + + DWY K HK L+K L + +S+ +P G+ IN + G   + L    T
Sbjct  149  PVPFDPPAEDYTLLIGDWYTKSHKELRKRLDDSKSLGKPCGVLINGRTGKNAETL----T  204

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
            +E GKTYR R+ NVG++TS+NFR +GH++ LVE+EGSH VQN Y+S+D+HVG   +VLVT
Sbjct  205  VEPGKTYRIRISNVGIKTSLNFRIEGHALLLVEIEGSHTVQNVYESLDVHVGQSYSVLVT  264

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGG-KGVppaselpppppegipgiAWSMNQF  346
            A+Q  KDY +VA++RF K   +  A++ Y+G  +GV  A+   P          +S+NQF
Sbjct  265  ANQAVKDYQIVASTRFTKYILTGTAVLHYSGATEGVSDAALSGPTGVA------FSLNQF  318

Query  345  RSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPL  166
            RSFRWNLTASAARPNPQGSYHYG I I RTIKL +S      K+RYAINGVS+    TPL
Sbjct  319  RSFRWNLTASAARPNPQGSYHYGSIPIVRTIKLASSIGKIEGKLRYAINGVSYKQASTPL  378

Query  165  KLAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            KLA+Y+++ ++V+    M D+PPE+  K     NVV+  HR+F+EI+FEN EKT+
Sbjct  379  KLADYYEMGKEVWCDKCMPDSPPEEEMKEET--NVVDGVHRDFIEIVFENREKTV  431



>gb|ABV89619.1| Sku5-like 11 [Brassica rapa]
Length=553

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 148/299 (49%), Positives = 191/299 (64%), Gaps = 16/299 (5%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            PVP+  P D++ + + DWY K H  LKK L  GR+I RP+GI IN K G       P+ T
Sbjct  151  PVPYADPEDDYTVLIGDWYTKSHTQLKKFLDGGRTIGRPDGIVINGKSGKGDGSDAPLFT  210

Query  702  MEKGKTYRFRVCNVGLRTSIN----FRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLA  535
            ++       R+  +G  T ++    FR Q H MKLVE +     +             L 
Sbjct  211  LKPE-----RLTGLGSVTWVSDIYHFRIQNHKMKLVEWKDRTFFKRL-RLSRRSRWPVLW  264

Query  534  VLVTADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSM  355
             +VTA+QEPKDYY+VA+SRF K   ++  L+ Y GGKG           P G  G AWS+
Sbjct  265  HIVTANQEPKDYYMVASSRFLKTVITTTGLLRYEGGKG-----PASSQLPAGPVGWAWSL  319

Query  354  NQFRSFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPE  175
            NQFRSFRWNLTASAARPNPQGSYHYG+I ITRTIKLV ++     K+R+A+NGVSH +PE
Sbjct  320  NQFRSFRWNLTASAARPNPQGSYHYGKINITRTIKLVNTQGKVDGKLRFALNGVSHTEPE  379

Query  174  TPLKLAEYFQVPEKVFKYDIMKDNP-PEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            TPLKLAEYF + +KVFKYD + D+P PE +  + + PNV+N THR FVE++FENHEK++
Sbjct  380  TPLKLAEYFGISDKVFKYDTITDDPTPEQIKNIKIEPNVLNITHRTFVEVVFENHEKSV  438



>ref|XP_007047154.1| SKU5 similar 17 isoform 3 [Theobroma cacao]
 gb|EOX91311.1| SKU5 similar 17 isoform 3 [Theobroma cacao]
Length=406

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 192/294 (65%), Gaps = 14/294 (5%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            P+P+  P  +F + + DWY   HK L++ L  G+S+  P+G+ IN +        +   +
Sbjct  20   PIPYANPDGDFTLLIGDWYKTSHKTLQQTLDSGKSLPFPDGVLINGQ-------TQTTFS  72

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
             E+GKTY FR+ NVGL TS+NFR QGH+MKLVE+EGSHV+QN YDS+D+HVG  + VLVT
Sbjct  73   GEQGKTYMFRISNVGLSTSLNFRIQGHTMKLVEVEGSHVIQNLYDSLDVHVGQSVTVLVT  132

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
             +Q PKDYY+VA++RF K   ++ A++ Y   +         P P        WSM Q R
Sbjct  133  LNQPPKDYYIVASTRFTKTVLTATAVLHYTNSQ----TPVSGPLPAAPAYQYHWSMQQAR  188

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            ++RWNLT++AARPNPQGS+HYG+I  T+TI L  S S    K+RY +NGVS V+P+TPLK
Sbjct  189  TYRWNLTSNAARPNPQGSFHYGKITTTKTIVLANSGSLINGKLRYTVNGVSFVNPDTPLK  248

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LA+YF +P  VF    ++D P       TVA +VV  +  +F+E++F+N+E T+
Sbjct  249  LADYFNIP-GVFSMSSIQDLPSGG--AATVATSVVPTSLHDFIEVVFQNNENTM  299



>emb|CBI18560.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   274 bits (700),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/294 (48%), Positives = 195/294 (66%), Gaps = 14/294 (5%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            P+PF  PA +F + + DWY   HK L++ L  G+ +  P+G+ IN +  S         +
Sbjct  149  PIPFPDPAGDFTLLVGDWYKTSHKTLQQTLDSGKPLPFPDGVLINGQTSSS-------FS  201

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
             ++GKTY FR+ NVGL TSINFR QGH+MKLVE+EGSH +QN YDS+D+HVG  +AVLVT
Sbjct  202  GDQGKTYMFRISNVGLSTSINFRIQGHTMKLVEVEGSHTLQNTYDSLDVHVGQSIAVLVT  261

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
             DQ PKDYY+VA++RF K+  ++ A++ Y             P P      I WSM Q R
Sbjct  262  LDQLPKDYYIVASTRFTKQILTATAVLHYTNSH----TPVSGPVPAGPTYQIHWSMKQAR  317

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            ++RWNLTASAARPNPQGS+HYG+I  +RTI LV S      K RYA+NGVS+++ +TPLK
Sbjct  318  TYRWNLTASAARPNPQGSFHYGKITPSRTIMLVNSAPRLNGKQRYAVNGVSYINADTPLK  377

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LA+YF +P  VF  + ++D P    + ++ +  V+ A H +F+E++F+N+E TI
Sbjct  378  LADYFNIP-GVFSVNSIQDLPSGGSSFLSTS--VMAANHHDFIEVVFQNNENTI  428



>ref|XP_002270831.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
Length=536

 Score =   274 bits (700),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/294 (48%), Positives = 195/294 (66%), Gaps = 14/294 (5%)
 Frame = -2

Query  882  PVPFDWPADEFHIFLSDWYNKGHKGLKKLLTEGRSIARPNGITINAKHGSVGDKLEPIAT  703
            P+PF  PA +F + + DWY   HK L++ L  G+ +  P+G+ IN +  S         +
Sbjct  150  PIPFPDPAGDFTLLVGDWYKTSHKTLQQTLDSGKPLPFPDGVLINGQTSSS-------FS  202

Query  702  MEKGKTYRFRVCNVGLRTSINFRFQGHSMKLVELEGSHVVQNDYDSMDMHVGHCLAVLVT  523
             ++GKTY FR+ NVGL TSINFR QGH+MKLVE+EGSH +QN YDS+D+HVG  +AVLVT
Sbjct  203  GDQGKTYMFRISNVGLSTSINFRIQGHTMKLVEVEGSHTLQNTYDSLDVHVGQSIAVLVT  262

Query  522  ADQEPKDYYLVATSRFFKETYSSVALISYAGGKGVppaselpppppegipgiAWSMNQFR  343
             DQ PKDYY+VA++RF K+  ++ A++ Y             P P      I WSM Q R
Sbjct  263  LDQLPKDYYIVASTRFTKQILTATAVLHYTNSH----TPVSGPVPAGPTYQIHWSMKQAR  318

Query  342  SFRWNLTASAARPNPQGSYHYGQIEITRTIKLVASKSHEGDKVRYAINGVSHVDPETPLK  163
            ++RWNLTASAARPNPQGS+HYG+I  +RTI LV S      K RYA+NGVS+++ +TPLK
Sbjct  319  TYRWNLTASAARPNPQGSFHYGKITPSRTIMLVNSAPRLNGKQRYAVNGVSYINADTPLK  378

Query  162  LAEYFQVPEKVFKYDIMKDNPPEDLTKVTVAPNVVNATHRNFVEIIFENHEKTI  1
            LA+YF +P  VF  + ++D P    + ++ +  V+ A H +F+E++F+N+E TI
Sbjct  379  LADYFNIP-GVFSVNSIQDLPSGGSSFLSTS--VMAANHHDFIEVVFQNNENTI  429



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1819952291484