BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17612_g1_i1 len=150 path=[1518:0-149]

Length=150
                                                                      Score     E

gb|EPS70060.1|  hypothetical protein M569_04703                         104   6e-26   
sp|A7VLV1.1|SGRW_PEA  RecName: Full=Protein STAY-GREEN, chloropla...    105   7e-26   Pisum sativum [garden pea]
sp|A7VLV2.1|SGRM_PEA  RecName: Full=Non-functional protein STAY-G...    105   8e-26   Pisum sativum [garden pea]
ref|XP_010055577.1|  PREDICTED: protein STAY-GREEN, chloroplastic...    104   1e-25   
gb|AFK46162.1|  unknown                                                 104   1e-25   
gb|AEE00201.1|  senescence-inducible chloroplast stay-green protein     104   1e-25   
ref|XP_003611177.1|  Senescence-inducible chloroplast stay-green ...    103   2e-25   
ref|XP_009626484.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...    103   2e-25   
gb|AEE00202.1|  senescence-inducible chloroplast stay-green protein     103   2e-25   
ref|XP_004511618.1|  PREDICTED: uncharacterized protein LOC101509366    103   2e-25   
ref|XP_009802993.1|  PREDICTED: protein STAY-GREEN, chloroplastic...    103   2e-25   
ref|XP_011071902.1|  PREDICTED: protein STAY-GREEN, chloroplastic...    103   2e-25   
gb|ABX82698.1|  stay green protein                                      103   3e-25   Capsicum annuum
ref|NP_001234723.1|  senescence-inducible chloroplast stay-green ...    103   4e-25   
gb|EYU36920.1|  hypothetical protein MIMGU_mgv1a011954mg                103   4e-25   
gb|ACU19021.1|  unknown                                                 103   4e-25   Glycine max [soybeans]
ref|NP_001236690.1|  senescence-inducible chloroplast stay-green ...    102   5e-25   
ref|XP_007158447.1|  hypothetical protein PHAVU_002G153100g             102   6e-25   
gb|ABY19382.1|  putative staygreen protein                              102   7e-25   Nicotiana tabacum [American tobacco]
ref|NP_001238357.1|  senescence-inducible chloroplast stay-green ...    102   1e-24   
gb|KDO63637.1|  hypothetical protein CISIN_1g024155mg                   101   1e-24   
ref|XP_009386177.1|  PREDICTED: protein STAY-GREEN, chloroplastic...    101   1e-24   
ref|XP_006477349.1|  PREDICTED: uncharacterized protein LOC102625350    101   2e-24   
ref|XP_009607143.1|  PREDICTED: protein STAY-GREEN, chloroplastic...    101   2e-24   
gb|KDO63636.1|  hypothetical protein CISIN_1g024155mg                   101   2e-24   
emb|CDP09832.1|  unnamed protein product                                101   2e-24   
ref|XP_009798966.1|  PREDICTED: protein STAY-GREEN, chloroplastic...    100   2e-24   
ref|XP_006358848.1|  PREDICTED: uncharacterized protein LOC102599319    100   3e-24   
ref|XP_006440495.1|  hypothetical protein CICLE_v10021651mg             100   3e-24   
gb|AFK38162.1|  unknown                                               99.4    4e-24   
ref|XP_009383276.1|  PREDICTED: protein STAY-GREEN, chloroplastic...  99.4    1e-23   
ref|XP_004298724.1|  PREDICTED: uncharacterized protein LOC101309347  99.4    1e-23   
ref|XP_010255591.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  99.0    2e-23   
ref|XP_010676587.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  99.0    2e-23   
gb|KHN25740.1|  hypothetical protein glysoja_018314                   98.2    2e-23   
ref|XP_004143940.1|  PREDICTED: uncharacterized protein LOC101206296  98.6    2e-23   
ref|XP_008437189.1|  PREDICTED: protein STAY-GREEN, chloroplastic...  98.2    2e-23   
ref|XP_006600810.1|  PREDICTED: uncharacterized protein LOC100780...  97.8    2e-23   
ref|XP_008238752.1|  PREDICTED: protein STAY-GREEN, chloroplastic...  98.6    2e-23   
ref|XP_007209458.1|  hypothetical protein PRUPE_ppa009788mg           98.6    2e-23   
ref|XP_010907484.1|  PREDICTED: protein STAY-GREEN, chloroplastic...  98.2    2e-23   
ref|XP_007209459.1|  hypothetical protein PRUPE_ppa009788mg           98.2    3e-23   
ref|XP_006364130.1|  PREDICTED: uncharacterized protein LOC102597...  97.8    3e-23   
ref|XP_002304454.1|  hypothetical protein POPTR_0003s11950g           98.2    3e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006364131.1|  PREDICTED: uncharacterized protein LOC102597...  97.8    3e-23   
ref|XP_008802150.1|  PREDICTED: protein STAY-GREEN, chloroplastic...  97.8    4e-23   
ref|XP_008802149.1|  PREDICTED: protein STAY-GREEN, chloroplastic...  97.8    4e-23   
ref|XP_011033835.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  97.8    4e-23   
ref|XP_006828903.1|  hypothetical protein AMTR_s00001p00195910        97.4    4e-23   
ref|XP_007040080.1|  Non-yellowing 1 isoform 1                        97.8    5e-23   
ref|XP_009607138.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  97.4    5e-23   
ref|XP_004252642.1|  PREDICTED: protein STAY-GREEN, chloroplastic...  97.1    5e-23   
ref|XP_009607139.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  96.7    6e-23   
gb|KHG07881.1|  Uncharacterized protein F383_35165                    97.1    7e-23   
gb|KHN09740.1|  hypothetical protein glysoja_017041                   95.9    8e-23   
emb|CBI34771.3|  unnamed protein product                              96.7    8e-23   
ref|XP_003576766.1|  PREDICTED: protein STAY-GREEN, chloroplastic...  97.1    8e-23   
ref|XP_009362832.1|  PREDICTED: LOW QUALITY PROTEIN: protein STAY...  96.3    1e-22   
ref|XP_003549871.1|  PREDICTED: uncharacterized protein LOC100783248  95.9    1e-22   
ref|XP_002509680.1|  conserved hypothetical protein                   96.3    2e-22   Ricinus communis
ref|NP_001105771.1|  senescence-inducible chloroplast stay-green ...  96.3    2e-22   Zea mays [maize]
ref|XP_010108060.1|  hypothetical protein L484_023145                 96.3    2e-22   
ref|XP_002282183.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  95.5    3e-22   Vitis vinifera
gb|KDP25538.1|  hypothetical protein JCGZ_20694                       95.5    3e-22   
gb|ACG27475.1|  senescence-inducible chloroplast stay-green prote...  95.5    3e-22   Zea mays [maize]
ref|XP_009393737.1|  PREDICTED: protein STAY-GREEN, chloroplastic...  95.1    3e-22   
gb|ADV57294.1|  senescence-inducible chloroplast non-yellowing pr...  95.5    3e-22   
ref|XP_010540355.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  95.1    3e-22   
gb|AAW82958.1|  senescence-inducible chloroplast stay-green protein   95.5    3e-22   Sorghum bicolor [broomcorn]
ref|XP_010272604.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  95.5    3e-22   
ref|NP_567673.1|  protein NON-YELLOWING 1                             95.1    3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150469.1|  senescence-inducible chloroplast stay-green ...  95.1    4e-22   Zea mays [maize]
ref|XP_002462718.1|  hypothetical protein SORBIDRAFT_02g030830        95.5    4e-22   Sorghum bicolor [broomcorn]
emb|CAN63364.1|  hypothetical protein VITISV_009841                   95.1    4e-22   Vitis vinifera
gb|KHG16300.1|  putative G-protein coupled receptor Mth-like 2        95.1    4e-22   
ref|XP_010538785.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  94.7    5e-22   
ref|XP_010272602.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  94.7    7e-22   
ref|NP_001105770.1|  senescence-inducible chloroplast stay-green ...  94.4    7e-22   Zea mays [maize]
gb|ABK22344.1|  unknown                                               94.4    8e-22   Picea sitchensis
gb|AAW82961.1|  senescence-inducible chloroplast stay-green protein   92.8    9e-22   Zoysia japonica [Japanese lawn grass]
ref|XP_011029140.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  94.0    1e-21   
gb|ACF85366.1|  unknown                                               94.0    1e-21   Zea mays [maize]
gb|AHC02487.1|  stay-green 2                                          93.6    1e-21   
ref|XP_004957449.1|  PREDICTED: uncharacterized protein LOC101765893  93.6    2e-21   
gb|KFK27451.1|  hypothetical protein AALP_AA8G384400                  93.6    2e-21   
dbj|BAJ87307.1|  predicted protein                                    93.6    2e-21   
gb|ADK56113.1|  stay-green protein                                    93.2    2e-21   
gb|AAM64476.1|  unknown                                               93.2    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867744.1|  hypothetical protein ARALYDRAFT_492573           93.2    2e-21   
emb|CDY51547.1|  BnaC03g72930D                                        93.2    2e-21   
gb|AAW82955.1|  senescence-inducible chloroplast stay-green protein   93.2    2e-21   Hordeum vulgare [barley]
ref|XP_009386178.1|  PREDICTED: protein STAY-GREEN, chloroplastic...  92.8    2e-21   
ref|XP_010448809.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  92.8    3e-21   
emb|CDY41282.1|  BnaA01g12570D                                        93.2    3e-21   
ref|XP_010422146.1|  PREDICTED: protein STAY-GREEN 2, chloroplast...  92.8    3e-21   
ref|XP_009134248.1|  PREDICTED: protein STAY-GREEN 2, chloroplast...  92.4    3e-21   
ref|XP_010433972.1|  PREDICTED: protein STAY-GREEN 1, chloroplastic   92.4    4e-21   
ref|NP_001063758.1|  Os09g0532000                                     92.4    4e-21   Oryza sativa Japonica Group [Japonica rice]
emb|CDX90810.1|  BnaA03g24900D                                        92.4    4e-21   
ref|XP_002298080.1|  hypothetical protein POPTR_0001s08470g           92.4    4e-21   Populus trichocarpa [western balsam poplar]
gb|AEO19901.1|  stay green 1                                          92.4    4e-21   
ref|XP_009136321.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  92.4    4e-21   
ref|XP_008381934.1|  PREDICTED: protein STAY-GREEN, chloroplastic...  92.4    4e-21   
gb|EAZ45459.1|  hypothetical protein OsJ_30111                        92.4    4e-21   Oryza sativa Japonica Group [Japonica rice]
sp|A2Z3E5.1|SGR_ORYSI  RecName: Full=Protein STAY-GREEN, chloropl...  92.0    5e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_010434047.1|  PREDICTED: protein STAY-GREEN 2, chloroplast...  92.0    5e-21   
ref|XP_010439263.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  92.0    5e-21   
ref|XP_009136327.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  92.0    5e-21   
ref|XP_007040081.1|  Non-yellowing 1 isoform 2                        90.9    6e-21   
ref|XP_006284321.1|  hypothetical protein CARUB_v10005494mg           91.7    6e-21   
ref|XP_009136336.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  90.9    7e-21   
gb|EMS53440.1|  hypothetical protein TRIUR3_24007                     92.0    8e-21   
ref|XP_006396833.1|  hypothetical protein EUTSA_v10028881mg           90.9    1e-20   
gb|AFK45290.1|  unknown                                               90.5    1e-20   
ref|XP_006288422.1|  hypothetical protein CARUB_v10001681mg           90.9    1e-20   
ref|XP_006288421.1|  hypothetical protein CARUB_v10001681mg           90.9    2e-20   
ref|XP_002872632.1|  hypothetical protein ARALYDRAFT_352273           92.4    2e-20   
ref|NP_192928.2|  protein STAY-GREEN2                                 90.5    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010455609.1|  PREDICTED: protein STAY-GREEN 2, chloroplast...  90.5    2e-20   
ref|XP_010529518.1|  PREDICTED: LOW QUALITY PROTEIN: protein STAY...  90.1    2e-20   
emb|CAB44329.1|  putative protein                                     92.0    2e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDY55818.1|  BnaCnng29210D                                        90.1    3e-20   
emb|CDX76349.1|  BnaA08g10510D                                        90.1    3e-20   
emb|CDY10821.1|  BnaC01g14360D                                        93.2    3e-20   
gb|KFK27452.1|  hypothetical protein AALP_AA8G384500                  90.1    3e-20   
ref|XP_009108590.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  89.7    3e-20   
ref|XP_006413601.1|  hypothetical protein EUTSA_v10025991mg           89.7    4e-20   
ref|XP_001764434.1|  predicted protein                                89.0    4e-20   
emb|CDX98778.1|  BnaA03g45630D                                        89.4    5e-20   
emb|CDY70941.1|  BnaCnng70460D                                        88.6    7e-20   
emb|CDX94137.1|  BnaC07g37710D                                        89.0    7e-20   
ref|NP_001118967.1|  uncharacterized protein                          88.6    8e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137299.1|  PREDICTED: protein STAY-GREEN 1, chloroplastic   88.6    1e-19   
ref|XP_006396832.1|  hypothetical protein EUTSA_v10029210mg           88.2    1e-19   
ref|XP_001772992.1|  predicted protein                                87.8    1e-19   
ref|XP_010455610.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  88.2    1e-19   
ref|XP_010434035.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  87.8    2e-19   
ref|XP_010422147.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  87.4    2e-19   
ref|XP_006847156.1|  hypothetical protein AMTR_s00017p00241370        85.9    3e-19   
ref|XP_010538786.1|  PREDICTED: protein STAY-GREEN 1, chloroplast...  85.9    8e-19   
ref|XP_002968798.1|  hypothetical protein SELMODRAFT_15573            84.0    1e-18   
ref|XP_002974181.1|  hypothetical protein SELMODRAFT_15575            84.0    1e-18   
ref|XP_003550881.2|  PREDICTED: uncharacterized protein LOC100780...  83.2    7e-18   
gb|KHN09739.1|  hypothetical protein glysoja_017040                   83.2    9e-18   
ref|XP_006440494.1|  hypothetical protein CICLE_v10021651mg           81.3    4e-17   
emb|CBI34772.3|  unnamed protein product                              69.3    2e-13   
ref|XP_008805855.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  70.9    2e-13   
ref|XP_003611178.1|  Senescence-inducible chloroplast stay-green ...  69.7    3e-13   
ref|XP_004144252.1|  PREDICTED: uncharacterized protein LOC101219336  67.0    4e-12   
ref|XP_010260410.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  66.6    6e-12   
ref|XP_008441591.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  66.2    7e-12   
ref|XP_010908633.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  66.2    9e-12   
ref|XP_010260412.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  65.1    2e-11   
gb|KEH35376.1|  staygreen protein                                     65.5    2e-11   
ref|XP_004289878.1|  PREDICTED: uncharacterized protein LOC101291680  65.1    3e-11   
ref|XP_003526660.1|  PREDICTED: uncharacterized protein LOC100795181  64.7    4e-11   
gb|ACU23337.1|  unknown                                               64.7    4e-11   Glycine max [soybeans]
ref|XP_004502551.1|  PREDICTED: uncharacterized protein LOC101506979  64.3    5e-11   
gb|KHN44284.1|  hypothetical protein glysoja_024504                   64.3    5e-11   
ref|XP_003523416.1|  PREDICTED: uncharacterized protein LOC100792871  63.9    6e-11   
ref|XP_009411899.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  63.9    7e-11   
emb|CDY14971.1|  BnaA10g08850D                                        63.9    7e-11   
ref|XP_008244576.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  63.5    7e-11   
ref|XP_007200333.1|  hypothetical protein PRUPE_ppa010416mg           63.5    8e-11   
ref|XP_009123047.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  63.5    8e-11   
ref|XP_009366817.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  63.5    9e-11   
ref|XP_002284727.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  63.5    9e-11   Vitis vinifera
ref|XP_009346367.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  62.8    1e-10   
ref|XP_007137500.1|  hypothetical protein PHAVU_009G132100g           63.2    1e-10   
ref|XP_006393750.1|  hypothetical protein EUTSA_v10011724mg           62.8    1e-10   
ref|XP_002520272.1|  conserved hypothetical protein                   63.2    1e-10   Ricinus communis
emb|CAN81476.1|  hypothetical protein VITISV_000606                   62.4    1e-10   Vitis vinifera
gb|KDO83502.1|  hypothetical protein CISIN_1g025286mg                 62.4    1e-10   
ref|XP_006434323.1|  hypothetical protein CICLE_v10002160mg           62.4    2e-10   
gb|KDO83503.1|  hypothetical protein CISIN_1g025286mg                 62.4    2e-10   
gb|KFK23291.1|  hypothetical protein AALP_AAs55143U000200             62.8    2e-10   
ref|XP_006434321.1|  hypothetical protein CICLE_v10002160mg           62.4    2e-10   
ref|XP_006393749.1|  hypothetical protein EUTSA_v10011724mg           62.0    2e-10   
ref|XP_010112027.1|  hypothetical protein L484_012613                 62.8    2e-10   
gb|KDO83501.1|  hypothetical protein CISIN_1g025286mg                 62.4    2e-10   
ref|XP_006472884.1|  PREDICTED: uncharacterized protein LOC102607042  62.4    2e-10   
ref|XP_001776856.1|  predicted protein                                61.2    3e-10   
emb|CBI18940.3|  unnamed protein product                              62.0    3e-10   
ref|XP_006434322.1|  hypothetical protein CICLE_v10002160mg           62.4    3e-10   
gb|KDP32897.1|  hypothetical protein JCGZ_12189                       61.6    4e-10   
ref|XP_010679284.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  62.0    4e-10   
ref|XP_011081163.1|  PREDICTED: protein STAY-GREEN, chloroplastic     61.2    4e-10   
gb|KHG15817.1|  DNA polymerase III subunit alpha                      61.2    5e-10   
ref|XP_006393751.1|  hypothetical protein EUTSA_v10011724mg           61.2    6e-10   
ref|XP_001753523.1|  predicted protein                                60.8    6e-10   
ref|XP_010523234.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  60.5    1e-09   
ref|XP_006304121.1|  hypothetical protein CARUB_v10010064mg           60.1    2e-09   
ref|XP_002893975.1|  hypothetical protein ARALYDRAFT_891373           60.1    2e-09   
ref|XP_011006299.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  59.7    3e-09   
gb|AAF79680.1|AC022314_21  F9C16.20                                   60.1    3e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47791.1|  BnaC06g00560D                                        59.7    3e-09   
ref|XP_010500128.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  59.7    3e-09   
ref|XP_010479036.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  59.7    3e-09   
ref|XP_010461432.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  59.7    3e-09   
ref|NP_564489.1|  uncharacterized protein                             59.3    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006383602.1|  hypothetical protein POPTR_0005s20690g           59.3    4e-09   
ref|XP_006383603.1|  hypothetical protein POPTR_0005s20690g           58.2    4e-09   
ref|XP_002302208.2|  hypothetical protein POPTR_0002s07630g           58.5    4e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006365914.1|  PREDICTED: uncharacterized protein LOC102586...  58.5    6e-09   
ref|XP_005650112.1|  hypothetical protein COCSUDRAFT_61770            59.3    8e-09   
ref|XP_004959924.1|  PREDICTED: uncharacterized protein LOC101781294  58.5    8e-09   
ref|XP_004237702.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  57.8    9e-09   
ref|XP_006383601.1|  hypothetical protein POPTR_0005s20690g           57.8    1e-08   
emb|CDY47161.1|  BnaA01g22870D                                        56.6    1e-08   
emb|CDP11961.1|  unnamed protein product                              57.8    1e-08   
ref|XP_010062196.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  57.4    2e-08   
gb|KCW69281.1|  hypothetical protein EUGRSUZ_F02776                   57.0    2e-08   
ref|XP_011074802.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  57.0    2e-08   
ref|XP_009602525.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  57.0    3e-08   
gb|EPS69844.1|  hypothetical protein M569_04921                       56.2    4e-08   
ref|XP_007019269.1|  F9C16.20, putative isoform 2                     56.6    4e-08   
ref|XP_009774944.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  56.6    4e-08   
ref|XP_007019268.1|  F9C16.20, putative isoform 1                     56.2    6e-08   
ref|XP_009393458.1|  PREDICTED: LOW QUALITY PROTEIN: protein STAY...  53.5    2e-07   
gb|EYU32477.1|  hypothetical protein MIMGU_mgv1a012754mg              52.4    1e-06   
ref|XP_003580904.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  52.4    1e-06   
dbj|BAJ89910.1|  predicted protein                                    52.0    2e-06   
ref|XP_002448084.1|  hypothetical protein SORBIDRAFT_06g020740        51.6    3e-06   Sorghum bicolor [broomcorn]
gb|EMT26913.1|  Pentatricopeptide repeat-containing protein           53.1    3e-06   
ref|XP_005850408.1|  hypothetical protein CHLNCDRAFT_142305           52.4    3e-06   
gb|KCW70675.1|  hypothetical protein EUGRSUZ_F03846                   49.7    3e-06   
ref|XP_003082632.1|  senescence-inducible chloroplast stay-green ...  50.8    4e-06   
ref|XP_003060977.1|  predicted protein                                51.6    5e-06   
emb|CEG00115.1|  Staygreen protein                                    50.8    5e-06   
ref|XP_002948199.1|  hypothetical protein VOLCADRAFT_103823           51.2    9e-06   
ref|XP_011102024.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  49.7    1e-05   
ref|XP_001420948.1|  predicted protein                                49.7    1e-05   Ostreococcus lucimarinus CCE9901
ref|XP_011102022.1|  PREDICTED: protein STAY-GREEN LIKE, chloropl...  48.9    2e-05   
ref|NP_001130909.1|  hypothetical protein                             48.5    2e-05   Zea mays [maize]
ref|XP_001690907.1|  predicted protein                                49.7    3e-05   Chlamydomonas reinhardtii
ref|XP_007508368.1|  predicted protein                                47.8    1e-04   
gb|KFM29124.1|  hypothetical protein F751_5480                        47.0    2e-04   
ref|XP_006653921.1|  PREDICTED: uncharacterized protein LOC102719862  46.2    3e-04   
ref|WP_029476822.1|  hypothetical protein                             43.9    6e-04   



>gb|EPS70060.1| hypothetical protein M569_04703, partial [Genlisea aurea]
Length=227

 Score =   104 bits (260),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSKITLA+SQTIN+SQLQGWYNRLQRDEVVAEWKK+KG MSLHVH
Sbjct  74   THSDITSKITLAVSQTINNSQLQGWYNRLQRDEVVAEWKKIKGMMSLHVH  123



>sp|A7VLV1.1|SGRW_PEA RecName: Full=Protein STAY-GREEN, chloroplastic; AltName: Full=Protein 
STAYGREEN; Flags: Precursor [Pisum sativum]
 dbj|BAF76351.1| senescence-inducible chloroplast stay-green protein [Pisum sativum]
 emb|CAP04954.1| senescence-inducible chloroplast stay-green protein [Pisum sativum]
Length=261

 Score =   105 bits (261),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAISQTIN+SQLQGWYNRLQRDEVVA+WKKVKGKMSLHVH
Sbjct  81   THSDVTSKLTLAISQTINNSQLQGWYNRLQRDEVVAQWKKVKGKMSLHVH  130



>sp|A7VLV2.1|SGRM_PEA RecName: Full=Non-functional protein STAY-GREEN, chloroplastic; 
AltName: Full=Protein STAYGREEN; Flags: Precursor [Pisum 
sativum]
 dbj|BAF76352.1| senescence-inducible chloroplast stay-green protein [Pisum sativum]
 emb|CAP04955.2| senescence-inducible chloroplast stay-green protein [Pisum sativum]
Length=263

 Score =   105 bits (261),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAISQTIN+SQLQGWYNRLQRDEVVA+WKKVKGKMSLHVH
Sbjct  81   THSDVTSKLTLAISQTINNSQLQGWYNRLQRDEVVAQWKKVKGKMSLHVH  130



>ref|XP_010055577.1| PREDICTED: protein STAY-GREEN, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW72069.1| hypothetical protein EUGRSUZ_E00514 [Eucalyptus grandis]
Length=274

 Score =   104 bits (260),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSKITLAISQTIN+SQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  80   THSDVTSKITLAISQTINNSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  129



>gb|AFK46162.1| unknown [Medicago truncatula]
Length=263

 Score =   104 bits (259),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAISQTIN+SQLQGWYNRLQRDEVVA+WKKVKGKMSLHVH
Sbjct  81   THSDVTSKLTLAISQTINNSQLQGWYNRLQRDEVVAQWKKVKGKMSLHVH  130



>gb|AEE00201.1| senescence-inducible chloroplast stay-green protein [Medicago 
truncatula]
Length=263

 Score =   104 bits (259),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAISQTIN+SQLQGWYNRLQRDEVVA+WKKVKGKMSLHVH
Sbjct  81   THSDVTSKLTLAISQTINNSQLQGWYNRLQRDEVVAQWKKVKGKMSLHVH  130



>ref|XP_003611177.1| Senescence-inducible chloroplast stay-green protein [Medicago 
truncatula]
 gb|AES94135.1| senescence-inducible stay-green protein [Medicago truncatula]
Length=263

 Score =   103 bits (258),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAISQTIN+SQLQGWYNRLQRDEVVA+WKKVKGKMSLHVH
Sbjct  81   THSDVTSKLTLAISQTINNSQLQGWYNRLQRDEVVAQWKKVKGKMSLHVH  130



>ref|XP_009626484.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=259

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  76   THSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  125



>gb|AEE00202.1| senescence-inducible chloroplast stay-green protein [Medicago 
sativa]
Length=263

 Score =   103 bits (258),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAISQTIN+SQLQGWYNRLQRDEVVA+WKKVKGKMSLHVH
Sbjct  81   THSDVTSKLTLAISQTINNSQLQGWYNRLQRDEVVAQWKKVKGKMSLHVH  130



>ref|XP_004511618.1| PREDICTED: uncharacterized protein LOC101509366 [Cicer arietinum]
Length=266

 Score =   103 bits (258),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/50 (94%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGWYNRLQRDEVVA+WKKVKGKMSLHVH
Sbjct  79   THSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAQWKKVKGKMSLHVH  128



>ref|XP_009802993.1| PREDICTED: protein STAY-GREEN, chloroplastic-like [Nicotiana 
sylvestris]
Length=259

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  77   THSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  126



>ref|XP_011071902.1| PREDICTED: protein STAY-GREEN, chloroplastic-like [Sesamum indicum]
Length=264

 Score =   103 bits (257),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGWYNRLQRDEVVAEWKK+K KMSLHVH
Sbjct  77   THSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKKIKTKMSLHVH  126



>gb|ABX82698.1| stay green protein [Capsicum annuum]
 emb|CAN88917.2| chlorophyll retainer (stay green) [Capsicum annuum]
 gb|ACB56586.1| chlorophyll retainer [Capsicum annuum]
Length=266

 Score =   103 bits (256),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  77   THSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  126



>ref|NP_001234723.1| senescence-inducible chloroplast stay-green protein 1 [Solanum 
lycopersicum]
 gb|AAY98500.1| senescence-inducible chloroplast stay-green protein 1 [Solanum 
lycopersicum]
 gb|ACB56587.1| green flesh protein [Solanum lycopersicum]
 gb|ACV60215.1| green flesh protein [Solanum lycopersicum]
Length=272

 Score =   103 bits (256),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  77   THSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  126



>gb|EYU36920.1| hypothetical protein MIMGU_mgv1a011954mg [Erythranthe guttata]
Length=265

 Score =   103 bits (256),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSKITLAISQTIN+SQLQGWYNRLQRDEVVAEWKK+KGKMSLHVH
Sbjct  73   THSDITSKITLAISQTINNSQLQGWYNRLQRDEVVAEWKKIKGKMSLHVH  122



>gb|ACU19021.1| unknown [Glycine max]
Length=271

 Score =   103 bits (256),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQTIN+SQLQGWYNRLQRDEVVA+WKKVKGKMSLHVH
Sbjct  81   THSDITAKLTLAISQTINNSQLQGWYNRLQRDEVVAQWKKVKGKMSLHVH  130



>ref|NP_001236690.1| senescence-inducible chloroplast stay-green protein 2 [Glycine 
max]
 gb|AAW82960.1| senescence-inducible chloroplast stay-green protein 2 [Glycine 
max]
 gb|AHL24650.1| stay green protein D1 [Glycine max]
Length=271

 Score =   102 bits (255),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQTIN+SQLQGWYNRLQRDEVVA+WKKVKGKMSLHVH
Sbjct  81   THSDITAKLTLAISQTINNSQLQGWYNRLQRDEVVAQWKKVKGKMSLHVH  130



>ref|XP_007158447.1| hypothetical protein PHAVU_002G153100g [Phaseolus vulgaris]
 gb|ESW30441.1| hypothetical protein PHAVU_002G153100g [Phaseolus vulgaris]
Length=268

 Score =   102 bits (255),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQTIN+SQLQGWYNRLQRDEVVA+WKKVKGKMSLHVH
Sbjct  81   THSDITAKLTLAISQTINNSQLQGWYNRLQRDEVVAQWKKVKGKMSLHVH  130



>gb|ABY19382.1| putative staygreen protein [Nicotiana tabacum]
Length=267

 Score =   102 bits (254),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAISQTIN+SQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  77   THSDVTSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  126



>ref|NP_001238357.1| senescence-inducible chloroplast stay-green protein 1 [Glycine 
max]
 gb|AAW82959.1| senescence-inducible chloroplast stay-green protein 1 [Glycine 
max]
 gb|ACU24620.1| unknown [Glycine max]
 gb|ADV41674.1| stay-green protein [Glycine max]
 gb|AHL24651.1| stay green protein D2 [Glycine max]
 gb|KHN34989.1| hypothetical protein glysoja_004755 [Glycine soja]
Length=261

 Score =   102 bits (253),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQTIN+SQLQGWYNR QRDEVVA+WKKVKG+MSLHVH
Sbjct  81   THSDITAKLTLAISQTINNSQLQGWYNRFQRDEVVAQWKKVKGRMSLHVH  130



>gb|KDO63637.1| hypothetical protein CISIN_1g024155mg [Citrus sinensis]
Length=233

 Score =   101 bits (251),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  41   THSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  90



>ref|XP_009386177.1| PREDICTED: protein STAY-GREEN, chloroplastic-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=265

 Score =   101 bits (252),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSKITLA+S TIN +QLQGWYNRLQRDEVVAEWKKV+GKMSLHVH
Sbjct  82   THSDVTSKITLAVSNTINRAQLQGWYNRLQRDEVVAEWKKVQGKMSLHVH  131



>ref|XP_006477349.1| PREDICTED: uncharacterized protein LOC102625350 [Citrus sinensis]
Length=271

 Score =   101 bits (252),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  79   THSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  128



>ref|XP_009607143.1| PREDICTED: protein STAY-GREEN, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=265

 Score =   101 bits (251),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/50 (94%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAISQTIN+SQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  77   THSDVTSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  126



>gb|KDO63636.1| hypothetical protein CISIN_1g024155mg [Citrus sinensis]
Length=271

 Score =   101 bits (251),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  79   THSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  128



>emb|CDP09832.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   101 bits (251),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 45/50 (90%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAISQTIN+SQ+QGWYN+LQRDEVVAEWKKVKGKMSLHVH
Sbjct  83   THSDVTSKLTLAISQTINNSQIQGWYNKLQRDEVVAEWKKVKGKMSLHVH  132



>ref|XP_009798966.1| PREDICTED: protein STAY-GREEN, chloroplastic-like [Nicotiana 
sylvestris]
Length=267

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAISQTIN+SQLQGWYN+LQRDEVVAEWKKVKGKMSLHVH
Sbjct  77   THSDVTSKLTLAISQTINNSQLQGWYNKLQRDEVVAEWKKVKGKMSLHVH  126



>ref|XP_006358848.1| PREDICTED: uncharacterized protein LOC102599319 [Solanum tuberosum]
Length=272

 Score =   100 bits (250),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  77   THSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  126



>ref|XP_006440495.1| hypothetical protein CICLE_v10021651mg [Citrus clementina]
 gb|ESR53735.1| hypothetical protein CICLE_v10021651mg [Citrus clementina]
Length=271

 Score =   100 bits (249),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  79   THSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  128



>gb|AFK38162.1| unknown [Lotus japonicus]
Length=200

 Score = 99.4 bits (246),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGWYN+LQRDEVVA+WKK+KGKMSLHVH
Sbjct  81   THSDITSKLTLAISQTINNSQLQGWYNKLQRDEVVAQWKKMKGKMSLHVH  130



>ref|XP_009383276.1| PREDICTED: protein STAY-GREEN, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=260

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+KITLAIS TIN +QLQGWYNRLQRDEVVAEWKKV+GKMSLHVH
Sbjct  81   THSDITAKITLAISHTINLAQLQGWYNRLQRDEVVAEWKKVQGKMSLHVH  130



>ref|XP_004298724.1| PREDICTED: uncharacterized protein LOC101309347 [Fragaria vesca 
subsp. vesca]
Length=274

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAISQTI++SQLQGWYN+LQRDEVVAEWKKVK KMSLHVH
Sbjct  84   THSDVTSKLTLAISQTIDNSQLQGWYNKLQRDEVVAEWKKVKDKMSLHVH  133



>ref|XP_010255591.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like [Nelumbo 
nucifera]
Length=272

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS TINSSQLQGWYN+LQRDEVVAEWKKVKGKMSLHVH
Sbjct  82   THSDITAKLTLAISHTINSSQLQGWYNKLQRDEVVAEWKKVKGKMSLHVH  131



>ref|XP_010676587.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=283

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSKITLA+SQTIN+SQLQGWYN++ RDEVVAEWKKVKGKMSLHVH
Sbjct  81   THSDITSKITLAVSQTINNSQLQGWYNKVYRDEVVAEWKKVKGKMSLHVH  130



>gb|KHN25740.1| hypothetical protein glysoja_018314 [Glycine soja]
Length=242

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/49 (92%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHV  4
            THSDIT+K+TLAISQTIN+SQLQGWYNRLQRDEVVA+WKKVKGKMSLHV
Sbjct  81   THSDITAKLTLAISQTINNSQLQGWYNRLQRDEVVAQWKKVKGKMSLHV  129



>ref|XP_004143940.1| PREDICTED: uncharacterized protein LOC101206296 [Cucumis sativus]
 ref|XP_004166994.1| PREDICTED: uncharacterized protein LOC101223728 [Cucumis sativus]
 gb|KGN50158.1| hypothetical protein Csa_5G156180 [Cucumis sativus]
Length=256

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQ+IN+SQLQGWYN LQRDEVV EWKKVKGKMSLHVH
Sbjct  79   THSDITSKLTLAISQSINNSQLQGWYNWLQRDEVVGEWKKVKGKMSLHVH  128



>ref|XP_008437189.1| PREDICTED: protein STAY-GREEN, chloroplastic-like [Cucumis melo]
Length=257

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQ+IN+SQLQGWYN LQRDEVVAEWKKV+GKMSLHVH
Sbjct  79   THSDITSKLTLAISQSINNSQLQGWYNWLQRDEVVAEWKKVQGKMSLHVH  128



>ref|XP_006600810.1| PREDICTED: uncharacterized protein LOC100780387 isoform X2 [Glycine 
max]
Length=235

 Score = 97.8 bits (242),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSKITL+ISQTIN+SQLQGWYN+LQRDEVVA W+K+KGKMSLHVH
Sbjct  76   THSDITSKITLSISQTINNSQLQGWYNKLQRDEVVAHWRKIKGKMSLHVH  125



>ref|XP_008238752.1| PREDICTED: protein STAY-GREEN, chloroplastic-like [Prunus mume]
Length=277

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLA+SQTI++SQLQGWYN+LQRDEVVAEWKKVK KMSLHVH
Sbjct  82   THSDITSKLTLAVSQTIDNSQLQGWYNKLQRDEVVAEWKKVKDKMSLHVH  131



>ref|XP_007209458.1| hypothetical protein PRUPE_ppa009788mg [Prunus persica]
 gb|EMJ10657.1| hypothetical protein PRUPE_ppa009788mg [Prunus persica]
Length=274

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLA+SQTI++SQLQGWYN+LQRDEVVAEWKKVK KMSLHVH
Sbjct  82   THSDITSKLTLAVSQTIDNSQLQGWYNKLQRDEVVAEWKKVKDKMSLHVH  131



>ref|XP_010907484.1| PREDICTED: protein STAY-GREEN, chloroplastic-like [Elaeis guineensis]
Length=268

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS TIN +QL+GWYNRLQRDEVVAEWKKV+GKMSLHVH
Sbjct  81   THSDITAKLTLAISNTINRAQLKGWYNRLQRDEVVAEWKKVQGKMSLHVH  130



>ref|XP_007209459.1| hypothetical protein PRUPE_ppa009788mg [Prunus persica]
 gb|EMJ10658.1| hypothetical protein PRUPE_ppa009788mg [Prunus persica]
Length=277

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLA+SQTI++SQLQGWYN+LQRDEVVAEWKKVK KMSLHVH
Sbjct  82   THSDITSKLTLAVSQTIDNSQLQGWYNKLQRDEVVAEWKKVKDKMSLHVH  131



>ref|XP_006364130.1| PREDICTED: uncharacterized protein LOC102597935 isoform X1 [Solanum 
tuberosum]
Length=247

 Score = 97.8 bits (242),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT K+TLA+SQTIN+SQL+GWYN+LQRDEVVAEWKKVKGKMSLHVH
Sbjct  76   THSDITCKLTLAVSQTINNSQLEGWYNKLQRDEVVAEWKKVKGKMSLHVH  125



>ref|XP_002304454.1| hypothetical protein POPTR_0003s11950g [Populus trichocarpa]
 gb|EEE79433.1| hypothetical protein POPTR_0003s11950g [Populus trichocarpa]
Length=269

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQTIN+SQLQGW N+L RDEVVAEWKKVKGKMSLHVH
Sbjct  79   THSDITAKLTLAISQTINNSQLQGWSNKLYRDEVVAEWKKVKGKMSLHVH  128



>ref|XP_006364131.1| PREDICTED: uncharacterized protein LOC102597935 isoform X2 [Solanum 
tuberosum]
Length=246

 Score = 97.8 bits (242),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT K+TL +SQTIN+SQL+GWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  75   THSDITCKLTLVVSQTINNSQLEGWYNRLQRDEVVAEWKKVKGKMSLHVH  124



>ref|XP_008802150.1| PREDICTED: protein STAY-GREEN, chloroplastic-like isoform X2 
[Phoenix dactylifera]
Length=265

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS TIN +QL+GWYNRLQRDEVVAEWKKV+GKMSLHVH
Sbjct  81   THSDITAKLTLAISNTINRAQLKGWYNRLQRDEVVAEWKKVQGKMSLHVH  130



>ref|XP_008802149.1| PREDICTED: protein STAY-GREEN, chloroplastic-like isoform X1 
[Phoenix dactylifera]
Length=266

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS TIN +QL+GWYNRLQRDEVVAEWKKV+GKMSLHVH
Sbjct  81   THSDITAKLTLAISNTINRAQLKGWYNRLQRDEVVAEWKKVQGKMSLHVH  130



>ref|XP_011033835.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like [Populus 
euphratica]
Length=269

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQTIN+SQLQGW N+L RDEVVAEWKKVKGKMSLHVH
Sbjct  79   THSDITAKLTLAISQTINNSQLQGWSNKLYRDEVVAEWKKVKGKMSLHVH  128



>ref|XP_006828903.1| hypothetical protein AMTR_s00001p00195910 [Amborella trichopoda]
 gb|ERM96319.1| hypothetical protein AMTR_s00001p00195910 [Amborella trichopoda]
Length=254

 Score = 97.4 bits (241),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQTIN +QLQGWYNRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  53   THSDITAKLTLAISQTINRAQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  102



>ref|XP_007040080.1| Non-yellowing 1 isoform 1 [Theobroma cacao]
 gb|EOY24581.1| Non-yellowing 1 isoform 1 [Theobroma cacao]
Length=274

 Score = 97.8 bits (242),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGW N+L RDEVVAEWKKVKGKMSLHVH
Sbjct  80   THSDITSKLTLAISQTINNSQLQGWSNKLYRDEVVAEWKKVKGKMSLHVH  129



>ref|XP_009607138.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like isoform X1 
[Nicotiana tomentosiformis]
Length=246

 Score = 97.4 bits (241),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            TH D+TSK+TL ISQTIN+SQLQGW+NRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  79   THCDLTSKLTLTISQTINNSQLQGWHNRLQRDEVVAEWKKVKGKMSLHVH  128



>ref|XP_004252642.1| PREDICTED: protein STAY-GREEN, chloroplastic-like [Solanum lycopersicum]
Length=247

 Score = 97.1 bits (240),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT K+TLA+SQTIN+SQL+GWYNRLQRDEVVAEWKKVKGKMSLHV+
Sbjct  75   THSDITCKLTLAVSQTINNSQLEGWYNRLQRDEVVAEWKKVKGKMSLHVY  124



>ref|XP_009607139.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like isoform X2 
[Nicotiana tomentosiformis]
 ref|XP_009607140.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like isoform X2 
[Nicotiana tomentosiformis]
Length=225

 Score = 96.7 bits (239),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            TH D+TSK+TL ISQTIN+SQLQGW+NRLQRDEVVAEWKKVKGKMSLHVH
Sbjct  79   THCDLTSKLTLTISQTINNSQLQGWHNRLQRDEVVAEWKKVKGKMSLHVH  128



>gb|KHG07881.1| Uncharacterized protein F383_35165 [Gossypium arboreum]
Length=267

 Score = 97.1 bits (240),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGW N+L RDEVVAEWKKVKGKMSLHVH
Sbjct  79   THSDITSKLTLAISQTINNSQLQGWANKLYRDEVVAEWKKVKGKMSLHVH  128



>gb|KHN09740.1| hypothetical protein glysoja_017041 [Glycine soja]
Length=207

 Score = 95.9 bits (237),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            TH DITSKITL+ISQTIN+SQLQGWYN+LQRDEVVA W+K+KGKMSLHVH
Sbjct  54   THCDITSKITLSISQTINNSQLQGWYNKLQRDEVVAHWRKIKGKMSLHVH  103



>emb|CBI34771.3| unnamed protein product [Vitis vinifera]
Length=253

 Score = 96.7 bits (239),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGW NRLQRDEVVAEWKKVK +MSLHVH
Sbjct  78   THSDITSKLTLAISQTINNSQLQGWSNRLQRDEVVAEWKKVKDQMSLHVH  127



>ref|XP_003576766.1| PREDICTED: protein STAY-GREEN, chloroplastic-like [Brachypodium 
distachyon]
Length=288

 Score = 97.1 bits (240),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+++TLA+S TIN++QLQGWYNRLQRDEVVAEWKKV+G MSLHVH
Sbjct  90   THSDVTARLTLAVSHTINAAQLQGWYNRLQRDEVVAEWKKVRGSMSLHVH  139



>ref|XP_009362832.1| PREDICTED: LOW QUALITY PROTEIN: protein STAY-GREEN, chloroplastic-like 
[Pyrus x bretschneideri]
Length=275

 Score = 96.3 bits (238),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAISQTI++SQLQGWYNRLQRDEVVA+WKKVK KMSLHVH
Sbjct  77   THSDVTSKLTLAISQTIDNSQLQGWYNRLQRDEVVAQWKKVKNKMSLHVH  126



>ref|XP_003549871.1| PREDICTED: uncharacterized protein LOC100783248 [Glycine max]
Length=232

 Score = 95.9 bits (237),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            TH DITSKITL+ISQTIN+SQLQGWYN+LQRDEVVA W+K+KGKMSLHVH
Sbjct  79   THCDITSKITLSISQTINNSQLQGWYNKLQRDEVVAHWRKIKGKMSLHVH  128



>ref|XP_002509680.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51067.1| conserved hypothetical protein [Ricinus communis]
Length=273

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+K+TLAISQTIN+SQLQGWYN+L RDEVVAEWKKVK KMSLHVH
Sbjct  79   THSDVTAKLTLAISQTINNSQLQGWYNKLYRDEVVAEWKKVKEKMSLHVH  128



>ref|NP_001105771.1| senescence-inducible chloroplast stay-green protein 2 [Zea mays]
 gb|AAW82957.1| senescence-inducible chloroplast stay-green protein 2 [Zea mays]
Length=274

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+++TLA+S TIN +QLQGWYNRLQRDEVVAEWKKV+G+MSLHVH
Sbjct  84   THSDVTARLTLAVSHTINRAQLQGWYNRLQRDEVVAEWKKVRGRMSLHVH  133



>ref|XP_010108060.1| hypothetical protein L484_023145 [Morus notabilis]
 gb|EXC17792.1| hypothetical protein L484_023145 [Morus notabilis]
Length=307

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAISQTIN+ QLQGWYN+LQRDEVVAEWKKVKGKMSLHVH
Sbjct  92   THSDVTSKLTLAISQTINNPQLQGWYNKLQRDEVVAEWKKVKGKMSLHVH  141



>ref|XP_002282183.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like [Vitis vinifera]
Length=274

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGW NRLQRDEVVAEWKKVK +MSLHVH
Sbjct  78   THSDITSKLTLAISQTINNSQLQGWSNRLQRDEVVAEWKKVKDQMSLHVH  127



>gb|KDP25538.1| hypothetical protein JCGZ_20694 [Jatropha curcas]
Length=273

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+++TLAISQTIN+SQLQGW N+L RDEVVAEWKKVKGKMSLHVH
Sbjct  77   THSDITARLTLAISQTINNSQLQGWANKLYRDEVVAEWKKVKGKMSLHVH  126



>gb|ACG27475.1| senescence-inducible chloroplast stay-green protein 1 [Zea mays]
 tpg|DAA62450.1| TPA: senescence-inducible chloroplast stay-green protein 2 [Zea 
mays]
Length=276

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+++TLA+S TIN +QLQGWYNRLQRDEVVAEWKKV+G+MSLHVH
Sbjct  84   THSDVTARLTLAVSHTINRAQLQGWYNRLQRDEVVAEWKKVRGRMSLHVH  133



>ref|XP_009393737.1| PREDICTED: protein STAY-GREEN, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=253

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSK+TLAIS TIN +QLQGW NRLQRDEVVAEW KV+GKMSLHVH
Sbjct  74   THSDLTSKLTLAISHTINRAQLQGWCNRLQRDEVVAEWNKVQGKMSLHVH  123



>gb|ADV57294.1| senescence-inducible chloroplast non-yellowing protein 1 [Festuca 
arundinacea]
Length=277

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+++TLA+S TI+++QLQGWYNRLQRDEVVAEWKKV+G MSLHVH
Sbjct  83   THSDVTARLTLAVSHTIHAAQLQGWYNRLQRDEVVAEWKKVRGAMSLHVH  132



>ref|XP_010540355.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like [Tarenaya 
hassleriana]
Length=264

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+++TLAIS +IN+SQLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  78   THSDITARLTLAISHSINNSQLQGWANRLYRDEVVAEWKKVKGKMSLHVH  127



>gb|AAW82958.1| senescence-inducible chloroplast stay-green protein [Sorghum 
bicolor]
Length=295

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+ +TLA+S TIN +QLQGWYNRLQRDEVVAEWKKV+G+MSLHVH
Sbjct  101  THSDVTASLTLAVSHTINRAQLQGWYNRLQRDEVVAEWKKVRGRMSLHVH  150



>ref|XP_010272604.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010272605.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like isoform X3 
[Nelumbo nucifera]
Length=276

 Score = 95.5 bits (236),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS TINSSQL+GWY++LQRDEVVAEWKKVKGKMSLHVH
Sbjct  83   THSDITAKLTLAISHTINSSQLEGWYHKLQRDEVVAEWKKVKGKMSLHVH  132



>ref|NP_567673.1| protein NON-YELLOWING 1 [Arabidopsis thaliana]
 sp|O82741.1|SGR1_ARATH RecName: Full=Protein STAY-GREEN 1, chloroplastic; AltName: Full=Protein 
NON-YELLOWING 1; AltName: Full=Protein STAYGREEN 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA19807.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79247.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL36256.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20154.1| unknown protein [Arabidopsis thaliana]
 gb|AAW82962.1| senescence-inducible chloroplast stay-green protein 1 [Arabidopsis 
thaliana]
 gb|ABD77557.1| non-yellowing protein 1 [Arabidopsis thaliana]
 gb|AEE84681.1| non-yellowing protein 1 [Arabidopsis thaliana]
Length=268

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+SQLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  85   THSDITAKLTLAISQSINNSQLQGWANRLYRDEVVAEWKKVKGKMSLHVH  134



>ref|NP_001150469.1| senescence-inducible chloroplast stay-green protein 1 [Zea mays]
 gb|ACG39204.1| senescence-inducible chloroplast stay-green protein 1 [Zea mays]
Length=282

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+ +TLA+S TIN +QLQGWYNRLQRDEVVAEWKKV+G+MSLHVH
Sbjct  94   THSDVTASLTLAVSHTINRAQLQGWYNRLQRDEVVAEWKKVRGRMSLHVH  143



>ref|XP_002462718.1| hypothetical protein SORBIDRAFT_02g030830 [Sorghum bicolor]
 gb|EER99239.1| hypothetical protein SORBIDRAFT_02g030830 [Sorghum bicolor]
Length=295

 Score = 95.5 bits (236),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+ +TLA+S TIN +QLQGWYNRLQRDEVVAEWKKV+G+MSLHVH
Sbjct  101  THSDVTASLTLAVSHTINRAQLQGWYNRLQRDEVVAEWKKVRGRMSLHVH  150



>emb|CAN63364.1| hypothetical protein VITISV_009841 [Vitis vinifera]
Length=274

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTIN+SQLQGW NRLQRDEVVA+WKKVK +MSLHVH
Sbjct  78   THSDITSKLTLAISQTINNSQLQGWSNRLQRDEVVAZWKKVKDQMSLHVH  127



>gb|KHG16300.1| putative G-protein coupled receptor Mth-like 2 [Gossypium arboreum]
Length=278

 Score = 95.1 bits (235),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQTIN++QLQGW N+L RDEVVAEWKKVKGKMSLHVH
Sbjct  79   THSDITAKLTLAISQTINNTQLQGWSNKLYRDEVVAEWKKVKGKMSLHVH  128



>ref|XP_010538785.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like isoform X1 
[Tarenaya hassleriana]
Length=263

 Score = 94.7 bits (234),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+++TLAIS +IN+SQLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  78   THSDVTARLTLAISHSINNSQLQGWANRLYRDEVVAEWKKVKGKMSLHVH  127



>ref|XP_010272602.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like isoform X1 
[Nelumbo nucifera]
Length=327

 Score = 94.7 bits (234),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS TINSSQL+GWY++LQRDEVVAEWKKVKGKMSLHVH
Sbjct  83   THSDITAKLTLAISHTINSSQLEGWYHKLQRDEVVAEWKKVKGKMSLHVH  132



>ref|NP_001105770.1| senescence-inducible chloroplast stay-green protein 1 [Zea mays]
 gb|AAW82956.1| senescence-inducible chloroplast stay-green protein 1 [Zea mays]
Length=281

 Score = 94.4 bits (233),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+ +TLA+S TIN +QLQGWYNRLQRDEVVAEWKKV+G+MSLHVH
Sbjct  93   THSDVTASLTLAVSHTINRAQLQGWYNRLQRDEVVAEWKKVRGRMSLHVH  142



>gb|ABK22344.1| unknown [Picea sitchensis]
Length=293

 Score = 94.4 bits (233),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+KITLAISQTIN  QLQGWYNRLQRDEV+A+WKK +GKMSLHVH
Sbjct  119  THSDITAKITLAISQTINKDQLQGWYNRLQRDEVIAQWKKSQGKMSLHVH  168



>gb|AAW82961.1| senescence-inducible chloroplast stay-green protein, partial 
[Zoysia japonica]
Length=187

 Score = 92.8 bits (229),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+K+TLA+S TI+++QLQGWYNRLQRDEVVAEW+KV+G MSLHVH
Sbjct  5    THSDVTAKLTLAVSHTIHAAQLQGWYNRLQRDEVVAEWRKVRGNMSLHVH  54



>ref|XP_011029140.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like [Populus 
euphratica]
Length=270

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+K+TLAISQTIN+SQLQGW N+L RDEVVAEWKKVKGKMSLHVH
Sbjct  79   THSDMTAKLTLAISQTINNSQLQGWSNKLYRDEVVAEWKKVKGKMSLHVH  128



>gb|ACF85366.1| unknown [Zea mays]
 gb|ACG34928.1| senescence-inducible chloroplast stay-green protein 1 [Zea mays]
 tpg|DAA40618.1| TPA: Senescence-inducible chloroplast stay-green protein 1 [Zea 
mays]
 tpg|DAA41843.1| TPA: Senescence-inducible chloroplast stay-green protein 1 [Zea 
mays]
Length=284

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+ +TLA+S TIN +QLQGWYNRLQRDEVVAEWKKV+G+MSLHVH
Sbjct  96   THSDVTASLTLAVSHTINRAQLQGWYNRLQRDEVVAEWKKVRGRMSLHVH  145



>gb|AHC02487.1| stay-green 2 [Brassica napus]
Length=276

 Score = 93.6 bits (231),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+SQLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  81   THSDITAKLTLAISQSINNSQLQGWANRLLRDEVVAEWKKVKGKMSLHVH  130



>ref|XP_004957449.1| PREDICTED: uncharacterized protein LOC101765893 [Setaria italica]
Length=286

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+ +TLA+S TIN +QLQGWYNRLQRDEVVAEWKKV+G+MSLHVH
Sbjct  98   THSDVTASLTLAVSHTINRAQLQGWYNRLQRDEVVAEWKKVRGRMSLHVH  147



>gb|KFK27451.1| hypothetical protein AALP_AA8G384400 [Arabis alpina]
Length=270

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+K+TLAISQ+IN+SQLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  77   THSDVTAKLTLAISQSINNSQLQGWGNRLYRDEVVAEWKKVKGKMSLHVH  126



>dbj|BAJ87307.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92838.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=281

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+++TLA+S TI+++QLQGWYNRLQRDEVVAEWKKV+G MSLHVH
Sbjct  84   THSDVTARLTLAVSHTIHAAQLQGWYNRLQRDEVVAEWKKVQGAMSLHVH  133



>gb|ADK56113.1| stay-green protein [Bambusa emeiensis]
Length=266

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+++TLA+S TIN +QLQGWYN+LQRDEVVAEWKKV+G+MSLHVH
Sbjct  84   THSDVTARLTLAVSHTINRAQLQGWYNKLQRDEVVAEWKKVQGRMSLHVH  133



>gb|AAM64476.1| unknown [Arabidopsis thaliana]
Length=268

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+SQLQGW NRL RDEVVAEW KVKGKMSLHVH
Sbjct  85   THSDITAKLTLAISQSINNSQLQGWANRLYRDEVVAEWXKVKGKMSLHVH  134



>ref|XP_002867744.1| hypothetical protein ARALYDRAFT_492573 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44003.1| hypothetical protein ARALYDRAFT_492573 [Arabidopsis lyrata subsp. 
lyrata]
Length=267

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  84   THSDITAKLTLAISHSINNSQLQGWANRLYRDEVVAEWKKVKGKMSLHVH  133



>emb|CDY51547.1| BnaC03g72930D [Brassica napus]
Length=274

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+SQLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  81   THSDITAKLTLAISQSINNSQLQGWANRLFRDEVVAEWKKVKGKMSLHVH  130



>gb|AAW82955.1| senescence-inducible chloroplast stay-green protein [Hordeum 
vulgare]
Length=281

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+++TLA+S TI+++QLQGWYNRLQRDEVVAEWKKV+G MSLHVH
Sbjct  84   THSDVTARLTLAVSHTIHAAQLQGWYNRLQRDEVVAEWKKVQGAMSLHVH  133



>ref|XP_009386178.1| PREDICTED: protein STAY-GREEN, chloroplastic-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=263

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 2/50 (4%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSKITLA+S TIN +Q  GWYNRLQRDEVVAEWKKV+GKMSLHVH
Sbjct  82   THSDVTSKITLAVSNTINRAQ--GWYNRLQRDEVVAEWKKVQGKMSLHVH  129



>ref|XP_010448809.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like [Camelina 
sativa]
Length=267

 Score = 92.8 bits (229),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW NRL RDEVVAEWKKVKG+MSLHVH
Sbjct  84   THSDITAKLTLAISHSINNSQLQGWANRLYRDEVVAEWKKVKGQMSLHVH  133



>emb|CDY41282.1| BnaA01g12570D [Brassica napus]
Length=332

 Score = 93.2 bits (230),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  148  THSDITAKLTLAISHSINNSQLQGWANRLYRDEVVAEWKKVKGKMSLHVH  197



>ref|XP_010422146.1| PREDICTED: protein STAY-GREEN 2, chloroplastic-like [Camelina 
sativa]
Length=276

 Score = 92.8 bits (229),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+SQLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  82   THSDITAKLTLAISQSINNSQLQGWANRLFRDEVVAEWKKVKGKMSLHVH  131



>ref|XP_009134248.1| PREDICTED: protein STAY-GREEN 2, chloroplastic-like [Brassica 
rapa]
Length=274

 Score = 92.4 bits (228),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+SQLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  81   THSDITAKLTLAISQSINNSQLQGWANRLFRDEVVAEWKKVKGKMSLHVH  130



>ref|XP_010433972.1| PREDICTED: protein STAY-GREEN 1, chloroplastic [Camelina sativa]
Length=268

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW NRL RDEVVAEWKKVKG+MSLHVH
Sbjct  85   THSDITAKLTLAISHSINNSQLQGWANRLYRDEVVAEWKKVKGQMSLHVH  134



>ref|NP_001063758.1| Os09g0532000 [Oryza sativa Japonica Group]
 sp|Q652K1.1|SGR_ORYSJ RecName: Full=Protein STAY-GREEN, chloroplastic; AltName: Full=Protein 
STAYGREEN; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD46019.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD46266.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAW82954.1| senescence-inducible chloroplast stay-green protein [Oryza sativa 
Japonica Group]
 dbj|BAF25672.1| Os09g0532000 [Oryza sativa Japonica Group]
 dbj|BAG97378.1| unnamed protein product [Oryza sativa Japonica Group]
Length=274

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+++TLA+S TIN +QLQGWYN+LQRDEVVAEWKKV+G MSLHVH
Sbjct  87   THSDVTARLTLAVSHTINRAQLQGWYNKLQRDEVVAEWKKVQGHMSLHVH  136



>emb|CDX90810.1| BnaA03g24900D [Brassica napus]
Length=262

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+SQLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  82   THSDITAKLTLAISQSINNSQLQGWANRLFRDEVVAEWKKVKGKMSLHVH  131



>ref|XP_002298080.1| hypothetical protein POPTR_0001s08470g [Populus trichocarpa]
 gb|EEE82885.1| hypothetical protein POPTR_0001s08470g [Populus trichocarpa]
Length=270

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+K+TLAISQTIN+SQLQGW N+L RDEVVAEWKKVKG MSLHVH
Sbjct  79   THSDMTAKLTLAISQTINNSQLQGWSNKLYRDEVVAEWKKVKGNMSLHVH  128



>gb|AEO19901.1| stay green 1 [Pyrus x bretschneideri]
Length=283

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTI++SQLQGWY++LQRDEVVA+WKKVK KMSLHVH
Sbjct  81   THSDITSKLTLAISQTIDNSQLQGWYSKLQRDEVVAQWKKVKNKMSLHVH  130



>ref|XP_009136321.1| PREDICTED: protein STAY-GREEN 1, chloroplastic isoform X1 [Brassica 
rapa]
 gb|ADA58359.1| non-yellowing protein 1 [Brassica rapa subsp. oleifera]
Length=289

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW NRL RDEVVAEWKKVKG MSLHVH
Sbjct  105  THSDITAKLTLAISNSINNSQLQGWANRLYRDEVVAEWKKVKGNMSLHVH  154



>ref|XP_008381934.1| PREDICTED: protein STAY-GREEN, chloroplastic-like [Malus domestica]
Length=283

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSK+TLAISQTI++SQLQGWY++LQRDEVVA+WKKVK KMSLHVH
Sbjct  81   THSDITSKLTLAISQTIDNSQLQGWYSKLQRDEVVAQWKKVKDKMSLHVH  130



>gb|EAZ45459.1| hypothetical protein OsJ_30111 [Oryza sativa Japonica Group]
Length=284

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+++TLA+S TIN +QLQGWYN+LQRDEVVAEWKKV+G MSLHVH
Sbjct  87   THSDVTARLTLAVSHTINRAQLQGWYNKLQRDEVVAEWKKVQGHMSLHVH  136



>sp|A2Z3E5.1|SGR_ORYSI RecName: Full=Protein STAY-GREEN, chloroplastic; AltName: Full=Protein 
STAYGREEN; Flags: Precursor [Oryza sativa Indica Group]
 gb|EAZ09856.1| hypothetical protein OsI_32148 [Oryza sativa Indica Group]
Length=274

 Score = 92.0 bits (227),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+++TLA+S TIN +QLQGWYN+LQRDEVVAEWKKV+G MSLHVH
Sbjct  87   THSDVTARLTLAVSHTINRAQLQGWYNKLQRDEVVAEWKKVQGHMSLHVH  136



>ref|XP_010434047.1| PREDICTED: protein STAY-GREEN 2, chloroplastic-like [Camelina 
sativa]
Length=276

 Score = 92.0 bits (227),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+SQLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  82   THSDITAKLTLAISQSINNSQLQGWANRLFRDEVVAEWKKVKGKMSLHVH  131



>ref|XP_010439263.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like [Camelina 
sativa]
Length=268

 Score = 92.0 bits (227),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW NRL RDEVVAEWKKVKG+MSLHVH
Sbjct  84   THSDITAKLTLAISHSINNSQLQGWANRLYRDEVVAEWKKVKGQMSLHVH  133



>ref|XP_009136327.1| PREDICTED: protein STAY-GREEN 1, chloroplastic isoform X2 [Brassica 
rapa]
Length=268

 Score = 92.0 bits (227),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW NRL RDEVVAEWKKVKG MSLHVH
Sbjct  84   THSDITAKLTLAISNSINNSQLQGWANRLYRDEVVAEWKKVKGNMSLHVH  133



>ref|XP_007040081.1| Non-yellowing 1 isoform 2, partial [Theobroma cacao]
 gb|EOY24582.1| Non-yellowing 1 isoform 2, partial [Theobroma cacao]
Length=193

 Score = 90.9 bits (224),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = -1

Query  144  SDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            SDITSK+TLAISQTIN+SQLQGW N+L RDEVVAEWKKVKGKMSLHVH
Sbjct  1    SDITSKLTLAISQTINNSQLQGWSNKLYRDEVVAEWKKVKGKMSLHVH  48



>ref|XP_006284321.1| hypothetical protein CARUB_v10005494mg [Capsella rubella]
 gb|EOA17219.1| hypothetical protein CARUB_v10005494mg [Capsella rubella]
Length=268

 Score = 91.7 bits (226),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW NRL RDEVVAEWKKVKG+MSLHVH
Sbjct  84   THSDITAKLTLAISHSINNSQLQGWANRLYRDEVVAEWKKVKGQMSLHVH  133



>ref|XP_009136336.1| PREDICTED: protein STAY-GREEN 1, chloroplastic isoform X3 [Brassica 
rapa]
Length=222

 Score = 90.9 bits (224),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW NRL RDEVVAEWKKVKG MSLHVH
Sbjct  38   THSDITAKLTLAISNSINNSQLQGWANRLYRDEVVAEWKKVKGNMSLHVH  87



>gb|EMS53440.1| hypothetical protein TRIUR3_24007 [Triticum urartu]
Length=344

 Score = 92.0 bits (227),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+++TLA+S TI+++QLQGWYNRLQRDEVVAEWKKV+G MSLHVH
Sbjct  84   THSDVTARLTLAVSHTIHAAQLQGWYNRLQRDEVVAEWKKVQGAMSLHVH  133



>ref|XP_006396833.1| hypothetical protein EUTSA_v10028881mg [Eutrema salsugineum]
 gb|ESQ38286.1| hypothetical protein EUTSA_v10028881mg [Eutrema salsugineum]
Length=273

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+SQLQGW N+L RDEVVAEWKKVKGKMSLHVH
Sbjct  81   THSDITAKLTLAISQSINNSQLQGWANKLFRDEVVAEWKKVKGKMSLHVH  130



>gb|AFK45290.1| unknown [Lotus japonicus]
Length=241

 Score = 90.5 bits (223),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSKITLAIS  IN+SQLQGWYNRLQRDEVVA+ +K+KG MSLHVH
Sbjct  75   THSDITSKITLAISHNINNSQLQGWYNRLQRDEVVAQRRKIKGNMSLHVH  124



>ref|XP_006288422.1| hypothetical protein CARUB_v10001681mg [Capsella rubella]
 gb|EOA21320.1| hypothetical protein CARUB_v10001681mg [Capsella rubella]
Length=275

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+ QLQGW NRL RDEVVAEWKKVK KMSLHVH
Sbjct  81   THSDITAKLTLAISQSINNCQLQGWANRLFRDEVVAEWKKVKSKMSLHVH  130



>ref|XP_006288421.1| hypothetical protein CARUB_v10001681mg [Capsella rubella]
 gb|EOA21319.1| hypothetical protein CARUB_v10001681mg [Capsella rubella]
Length=272

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+ QLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  81   THSDITAKLTLAISQSINNCQLQGWANRLFRDEVVAEWKKVKGKMSLHVH  130



>ref|XP_002872632.1| hypothetical protein ARALYDRAFT_352273 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48891.1| hypothetical protein ARALYDRAFT_352273 [Arabidopsis lyrata subsp. 
lyrata]
Length=466

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+SQLQGW N+L RDE+VAEWKKVKGKMSLHVH
Sbjct  81   THSDITAKLTLAISQSINNSQLQGWANKLFRDEIVAEWKKVKGKMSLHVH  130


 Score = 87.4 bits (215),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+ +TLAIS +IN+SQLQGW NRL RDEVVAEW+KVK KMSLHVH
Sbjct  275  THSDITANLTLAISHSINNSQLQGWGNRLYRDEVVAEWRKVKSKMSLHVH  324



>ref|NP_192928.2| protein STAY-GREEN2 [Arabidopsis thaliana]
 sp|Q66WT5.1|SGR2_ARATH RecName: Full=Protein STAY-GREEN 2, chloroplastic; AltName: Full=Protein 
NON-YELLOWING 2; AltName: Full=Protein STAYGREEN 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAU05981.1| STAY-GREEN2 protein [Arabidopsis thaliana]
 gb|ABD77556.1| non-yellowing protein 2 [Arabidopsis thaliana]
 gb|AEE83068.1| protein STAY-GREEN2 [Arabidopsis thaliana]
Length=271

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+SQLQGW N+L RDEVV EWKKVKGKMSLHVH
Sbjct  81   THSDITAKLTLAISQSINNSQLQGWANKLFRDEVVGEWKKVKGKMSLHVH  130



>ref|XP_010455609.1| PREDICTED: protein STAY-GREEN 2, chloroplastic-like [Camelina 
sativa]
Length=276

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+SQLQGW  RL RDEVVAEWKKVKGKMSLHVH
Sbjct  82   THSDITAKLTLAISQSINNSQLQGWATRLFRDEVVAEWKKVKGKMSLHVH  131



>ref|XP_010529518.1| PREDICTED: LOW QUALITY PROTEIN: protein STAY-GREEN 1, chloroplastic 
[Tarenaya hassleriana]
Length=269

 Score = 90.1 bits (222),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDI++K+TLAIS +IN+SQLQGW NRL RDEVVAEWK VKGKMSLHVH
Sbjct  74   THSDISAKLTLAISHSINNSQLQGWANRLYRDEVVAEWKXVKGKMSLHVH  123



>emb|CAB44329.1| putative protein [Arabidopsis thaliana]
 emb|CAB78234.1| putative protein [Arabidopsis thaliana]
Length=466

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAISQ+IN+SQLQGW N+L RDEVV EWKKVKGKMSLHVH
Sbjct  81   THSDITAKLTLAISQSINNSQLQGWANKLFRDEVVGEWKKVKGKMSLHVH  130


 Score = 88.6 bits (218),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW NRL RDEVVAEW+KVK  MSLHVH
Sbjct  274  THSDITAKLTLAISHSINNSQLQGWANRLYRDEVVAEWRKVKSNMSLHVH  323



>emb|CDY55818.1| BnaCnng29210D [Brassica napus]
Length=264

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW N+L RDEVVAEWKKVKGKMSLHVH
Sbjct  83   THSDITAKLTLAISHSINNSQLQGWANKLYRDEVVAEWKKVKGKMSLHVH  132



>emb|CDX76349.1| BnaA08g10510D [Brassica napus]
Length=273

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW N+L RDEVVAEWKKVKGKMSLHVH
Sbjct  83   THSDITAKLTLAISHSINNSQLQGWANKLYRDEVVAEWKKVKGKMSLHVH  132



>emb|CDY10821.1| BnaC01g14360D [Brassica napus]
Length=999

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  814  THSDITAKLTLAISHSINNSQLQGWANRLYRDEVVAEWKKVKGKMSLHVH  863



>gb|KFK27452.1| hypothetical protein AALP_AA8G384500 [Arabis alpina]
Length=276

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+K+TLAISQ+IN+SQLQGW N+L RDEVVAEWKKVKGKMSLHVH
Sbjct  81   THSDVTAKLTLAISQSINNSQLQGWANKLFRDEVVAEWKKVKGKMSLHVH  130



>ref|XP_009108590.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like [Brassica 
rapa]
Length=254

 Score = 89.7 bits (221),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW N+L RDEVVAEWKKVKGKMSLHVH
Sbjct  83   THSDITAKLTLAISHSINNSQLQGWANKLYRDEVVAEWKKVKGKMSLHVH  132



>ref|XP_006413601.1| hypothetical protein EUTSA_v10025991mg [Eutrema salsugineum]
 gb|ESQ55054.1| hypothetical protein EUTSA_v10025991mg [Eutrema salsugineum]
Length=266

 Score = 89.7 bits (221),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW N++ RDEVVAEWKKVKGKMSLHVH
Sbjct  83   THSDITAKLTLAISHSINNSQLQGWANKIYRDEVVAEWKKVKGKMSLHVH  132



>ref|XP_001764434.1| predicted protein [Physcomitrella patens]
 gb|EDQ70701.1| predicted protein [Physcomitrella patens]
Length=228

 Score = 89.0 bits (219),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDITSKITLAIS  IN +QL+GWY++LQRDEVVAEWK+V+GKMSLHVH
Sbjct  36   THSDITSKITLAISSEINKAQLKGWYSKLQRDEVVAEWKRVQGKMSLHVH  85



>emb|CDX98778.1| BnaA03g45630D [Brassica napus]
Length=266

 Score = 89.4 bits (220),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW NRL RDEVVAEWKKVKG MSLHVH
Sbjct  83   THSDITAKLTLAISHSINNSQLQGWANRLYRDEVVAEWKKVKGDMSLHVH  132



>emb|CDY70941.1| BnaCnng70460D [Brassica napus]
Length=246

 Score = 88.6 bits (218),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN SQLQGW NRL RDEVVAEWKKVK KMSLHVH
Sbjct  54   THSDITAKLTLAISHSINISQLQGWANRLYRDEVVAEWKKVKSKMSLHVH  103



>emb|CDX94137.1| BnaC07g37710D [Brassica napus]
Length=266

 Score = 89.0 bits (219),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQL+GW NRL RDEVVAEWKKVKG MSLHVH
Sbjct  83   THSDITAKLTLAISHSINNSQLEGWANRLYRDEVVAEWKKVKGDMSLHVH  132



>ref|NP_001118967.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE83069.1| uncharacterized protein AT4G11911 [Arabidopsis thaliana]
Length=273

 Score = 88.6 bits (218),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQLQGW NRL RDEVVAEW+KVK  MSLHVH
Sbjct  81   THSDITAKLTLAISHSINNSQLQGWANRLYRDEVVAEWRKVKSNMSLHVH  130



>ref|XP_009137299.1| PREDICTED: protein STAY-GREEN 1, chloroplastic [Brassica rapa]
Length=264

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS +IN+SQL+GW NRL RDEVVAEWKKVKG MSLHVH
Sbjct  83   THSDITAKLTLAISHSINNSQLEGWANRLYRDEVVAEWKKVKGDMSLHVH  132



>ref|XP_006396832.1| hypothetical protein EUTSA_v10029210mg [Eutrema salsugineum]
 gb|ESQ38285.1| hypothetical protein EUTSA_v10029210mg [Eutrema salsugineum]
Length=273

 Score = 88.2 bits (217),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+K+TLA+S +IN+SQLQGW NRL RDEVVAEWKKVK KMSLHVH
Sbjct  81   THSDVTAKLTLAVSHSINNSQLQGWANRLYRDEVVAEWKKVKSKMSLHVH  130



>ref|XP_001772992.1| predicted protein [Physcomitrella patens]
 gb|EDQ62217.1| predicted protein [Physcomitrella patens]
Length=229

 Score = 87.8 bits (216),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+TSKITLAIS+ IN +QL+GWY++LQRDEVVAEW+KV+GKMSLHVH
Sbjct  41   THSDVTSKITLAISREINKAQLKGWYSKLQRDEVVAEWRKVQGKMSLHVH  90



>ref|XP_010455610.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like [Camelina 
sativa]
Length=274

 Score = 88.2 bits (217),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDI+S +TLAISQ+IN+SQLQGW N+L RDEVVAEW+KVK KMSLHVH
Sbjct  81   THSDISSNLTLAISQSINNSQLQGWTNKLYRDEVVAEWRKVKSKMSLHVH  130



>ref|XP_010434035.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like [Camelina 
sativa]
Length=275

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDI+S +TLAISQ+IN+SQLQGW N+L RDEVVAEW+KVK KMSLHVH
Sbjct  81   THSDISSNLTLAISQSINNSQLQGWTNKLYRDEVVAEWRKVKSKMSLHVH  130



>ref|XP_010422147.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like [Camelina 
sativa]
Length=274

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDI+S +TLAISQ+IN+SQLQGW N+L RDEVVAEW+KVK KMSLHVH
Sbjct  81   THSDISSNLTLAISQSINNSQLQGWTNKLYRDEVVAEWRKVKSKMSLHVH  130



>ref|XP_006847156.1| hypothetical protein AMTR_s00017p00241370 [Amborella trichopoda]
 gb|ERN08737.1| hypothetical protein AMTR_s00017p00241370 [Amborella trichopoda]
Length=170

 Score = 85.9 bits (211),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+ + LAIS +IN +QLQGWYN+LQRD V+AEWKKV+GKMSLHVH
Sbjct  43   THSDITADLNLAISHSINRNQLQGWYNKLQRDYVIAEWKKVQGKMSLHVH  92



>ref|XP_010538786.1| PREDICTED: protein STAY-GREEN 1, chloroplastic-like isoform X2 
[Tarenaya hassleriana]
Length=261

 Score = 85.9 bits (211),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 2/50 (4%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T+++TLAIS +IN+SQ  GW NRL RDEVVAEWKKVKGKMSLHVH
Sbjct  78   THSDVTARLTLAISHSINNSQ--GWANRLYRDEVVAEWKKVKGKMSLHVH  125



>ref|XP_002968798.1| hypothetical protein SELMODRAFT_15573, partial [Selaginella moellendorffii]
 gb|EFJ29914.1| hypothetical protein SELMODRAFT_15573, partial [Selaginella moellendorffii]
Length=161

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS+ IN +Q+ GWY+RLQRDEV+AEWK+ KG+MSLHVH
Sbjct  37   THSDITAKLTLAISREINKAQIMGWYSRLQRDEVLAEWKQTKGEMSLHVH  86



>ref|XP_002974181.1| hypothetical protein SELMODRAFT_15575, partial [Selaginella moellendorffii]
 gb|EFJ25136.1| hypothetical protein SELMODRAFT_15575, partial [Selaginella moellendorffii]
Length=161

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT+K+TLAIS+ IN +Q+ GWY+RLQRDEV+AEWK+ KG+MSLHVH
Sbjct  37   THSDITAKLTLAISREINKAQIMGWYSRLQRDEVLAEWKQTKGEMSLHVH  86



>ref|XP_003550881.2| PREDICTED: uncharacterized protein LOC100780387 isoform X1 [Glycine 
max]
Length=262

 Score = 83.2 bits (204),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 49/77 (64%), Gaps = 27/77 (35%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQ---------------------------LQGWYNRLQRDE  52
            THSDITSKITL+ISQTIN+SQ                           LQGWYN+LQRDE
Sbjct  76   THSDITSKITLSISQTINNSQGMPQLMDGGCDSYKNRAWTNTGLDTRQLQGWYNKLQRDE  135

Query  51   VVAEWKKVKGKMSLHVH  1
            VVA W+K+KGKMSLHVH
Sbjct  136  VVAHWRKIKGKMSLHVH  152



>gb|KHN09739.1| hypothetical protein glysoja_017040 [Glycine soja]
Length=271

 Score = 83.2 bits (204),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 49/77 (64%), Gaps = 27/77 (35%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQ---------------------------LQGWYNRLQRDE  52
            THSDITSKITL+ISQTIN+SQ                           LQGWYN+LQRDE
Sbjct  76   THSDITSKITLSISQTINNSQGMPQLMDGGCDSYKNRAWTNTGLDTRQLQGWYNKLQRDE  135

Query  51   VVAEWKKVKGKMSLHVH  1
            VVA W+K+KGKMSLHVH
Sbjct  136  VVAHWRKIKGKMSLHVH  152



>ref|XP_006440494.1| hypothetical protein CICLE_v10021651mg [Citrus clementina]
 gb|ESR53734.1| hypothetical protein CICLE_v10021651mg [Citrus clementina]
Length=234

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 39/41 (95%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKV  28
            THSDITSK+TLAISQTIN+SQLQGWYNRLQRDEVVAEWKKV
Sbjct  79   THSDITSKLTLAISQTINNSQLQGWYNRLQRDEVVAEWKKV  119



>emb|CBI34772.3| unnamed protein product [Vitis vinifera]
Length=129

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVV  46
            THSD+TSK+TLAISQTIN+SQLQGWYNRLQRDE++
Sbjct  78   THSDMTSKLTLAISQTINNSQLQGWYNRLQRDEIL  112



>ref|XP_008805855.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Phoenix dactylifera]
Length=269

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            TH D T+ +TLA+S  I++ +L+GW   LQRD+VVAEWKKVK +MSLHVH
Sbjct  136  THCDFTANLTLAVSNCISNDKLRGWQTTLQRDDVVAEWKKVKEEMSLHVH  185



>ref|XP_003611178.1| Senescence-inducible chloroplast stay-green protein [Medicago 
truncatula]
Length=168

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/30 (97%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -1

Query  90  QLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
           QLQGWYNRLQRDEVVA+WKKVKGKMSLHVH
Sbjct  6   QLQGWYNRLQRDEVVAQWKKVKGKMSLHVH  35



>ref|XP_004144252.1| PREDICTED: uncharacterized protein LOC101219336 [Cucumis sativus]
 ref|XP_004165908.1| PREDICTED: uncharacterized protein LOC101229994 [Cucumis sativus]
 gb|KGN47507.1| hypothetical protein Csa_6G349840 [Cucumis sativus]
Length=244

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWYN   +D+VVAEWKKVK +M LHVH
Sbjct  85   SHCDFTANLTLTISDVINLDQLRGWYN---KDDVVAEWKKVKDEMCLHVH  131



>ref|XP_010260410.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic isoform X1 
[Nelumbo nucifera]
Length=253

 Score = 66.6 bits (161),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H DIT+ +TL++S  IN  QL+GWYN   +D+VVAEWKKVK +M LHVH
Sbjct  93   SHCDITADLTLSVSNAINLDQLRGWYN---KDDVVAEWKKVKEEMFLHVH  139



>ref|XP_008441591.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Cucumis melo]
Length=244

 Score = 66.2 bits (160),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWYN   +D+VVAEWKKVK +M LHVH
Sbjct  85   SHCDFTANLTLTISDVINLDQLRGWYN---KDDVVAEWKKVKDEMYLHVH  131



>ref|XP_010908633.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Elaeis guineensis]
Length=250

 Score = 66.2 bits (160),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            TH D T+ +TLA+S +I+S +L+ W   LQRD+VVAEWKKVK ++SLHVH
Sbjct  89   THCDFTANLTLAVSNSISSDKLRSWQTTLQRDDVVAEWKKVKKEISLHVH  138



>ref|XP_010260412.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic isoform X2 
[Nelumbo nucifera]
Length=213

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H DIT+ +TL++S  IN  QL+GWYN   +D+VVAEWKKVK +M LHVH
Sbjct  53   SHCDITADLTLSVSNAINLDQLRGWYN---KDDVVAEWKKVKEEMFLHVH  99



>gb|KEH35376.1| staygreen protein [Medicago truncatula]
Length=269

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D+T+ +TLA+S  I   QL+GWY   ++D+VVAEWKKVK +M LHVH
Sbjct  94   SHCDLTANLTLAVSNVIKLEQLRGWY---EKDDVVAEWKKVKNEMCLHVH  140



>ref|XP_004289878.1| PREDICTED: uncharacterized protein LOC101291680 [Fragaria vesca 
subsp. vesca]
Length=253

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY+   +D+VVAEWK+V G+M LH+H
Sbjct  93   SHCDFTANLTLTISNVINLEQLKGWYS---KDDVVAEWKRVNGEMCLHIH  139



>ref|XP_003526660.1| PREDICTED: uncharacterized protein LOC100795181 [Glycine max]
 gb|KHN46966.1| hypothetical protein glysoja_018333 [Glycine soja]
Length=251

 Score = 64.7 bits (156),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TLA+S  IN  QL+GWY   ++D+VVAEWKKV+  M LHVH
Sbjct  95   SHCDFTANLTLAVSNVINLEQLRGWY---EKDDVVAEWKKVQNDMCLHVH  141



>gb|ACU23337.1| unknown [Glycine max]
Length=251

 Score = 64.7 bits (156),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TLA+S  IN  QL+GWY   ++D+VVAEWKKV+  M LHVH
Sbjct  95   SHCDFTANLTLAVSNVINLEQLRGWY---EKDDVVAEWKKVQNDMCLHVH  141



>ref|XP_004502551.1| PREDICTED: uncharacterized protein LOC101506979 [Cicer arietinum]
Length=247

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D+T+ +TLA+S  I   QL+GWY   ++D+VVAEWKKVK  M LHVH
Sbjct  90   SHCDLTANLTLAVSNVIKLEQLRGWY---EKDDVVAEWKKVKNDMCLHVH  136



>gb|KHN44284.1| hypothetical protein glysoja_024504 [Glycine soja]
Length=254

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TLA+S  IN  QL+GWY   ++D+VVAEWKKV+  M LHVH
Sbjct  98   SHCDFTANLTLAVSNVINLEQLRGWY---EKDDVVAEWKKVQNDMCLHVH  144



>ref|XP_003523416.1| PREDICTED: uncharacterized protein LOC100792871 [Glycine max]
Length=254

 Score = 63.9 bits (154),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TLA+S  IN  QL+GWY   ++D+VVAEWKKV+  M LHVH
Sbjct  98   SHCDFTANLTLAVSNVINLEQLRGWY---EKDDVVAEWKKVQNDMCLHVH  144



>ref|XP_009411899.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=248

 Score = 63.9 bits (154),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            TH D T+ +TLA+S  ++S++L GW   L  D+VVAEWKK+K +MSLHVH
Sbjct  87   THCDFTANLTLAVSSNMHSNKLMGWQTTLHWDDVVAEWKKIKEEMSLHVH  136



>emb|CDY14971.1| BnaA10g08850D [Brassica napus]
Length=257

 Score = 63.9 bits (154),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY   QRD+VVAEWKKV  +M LH+H
Sbjct  100  SHCDFTANLTLTISNIINLDQLEGWY---QRDDVVAEWKKVNDEMRLHIH  146



>ref|XP_008244576.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Prunus mume]
Length=249

 Score = 63.5 bits (153),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY+   +D+VVAEWK+V G+M LH+H
Sbjct  89   SHCDFTANLTLTISNVINLDQLKGWYS---KDDVVAEWKRVNGEMCLHIH  135



>ref|XP_007200333.1| hypothetical protein PRUPE_ppa010416mg [Prunus persica]
 gb|EMJ01532.1| hypothetical protein PRUPE_ppa010416mg [Prunus persica]
Length=250

 Score = 63.5 bits (153),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY+   +D+VVAEWK+V G+M LH+H
Sbjct  90   SHCDFTANLTLTISNVINLDQLKGWYS---KDDVVAEWKRVNGEMCLHIH  136



>ref|XP_009123047.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Brassica rapa]
Length=257

 Score = 63.5 bits (153),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY   QRD+VVAEWKKV  +M LH+H
Sbjct  100  SHCDFTANLTLTISNIINLDQLEGWY---QRDDVVAEWKKVNDEMRLHIH  146



>ref|XP_009366817.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic-like [Pyrus 
x bretschneideri]
Length=249

 Score = 63.5 bits (153),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL +S  IN  QL+GWY++   D+VVAEWKKV G+M LH+H
Sbjct  90   SHCDFTANLTLKVSNVINLDQLKGWYSK---DDVVAEWKKVNGEMCLHIH  136



>ref|XP_002284727.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Vitis vinifera]
Length=251

 Score = 63.5 bits (153),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  I+  QL+GWYN   +D+VVAEWK+VKG+  LHVH
Sbjct  91   SHCDFTANLTLTISNIISLDQLKGWYN---KDDVVAEWKEVKGEKCLHVH  137



>ref|XP_009346367.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009346378.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic-like [Pyrus 
x bretschneideri]
Length=178

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY++   D+VVAEWKKV G+M LH+H
Sbjct  19   SHCDFTANLTLKISNVINLDQLKGWYSK---DDVVAEWKKVNGEMCLHIH  65



>ref|XP_007137500.1| hypothetical protein PHAVU_009G132100g [Phaseolus vulgaris]
 gb|ESW09494.1| hypothetical protein PHAVU_009G132100g [Phaseolus vulgaris]
Length=248

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TLA+S  I   QL+GWY   ++D+VVAEWKKVK +M LHVH
Sbjct  92   SHCDFTANLTLAVSNVIRLEQLRGWY---EKDDVVAEWKKVKNEMCLHVH  138



>ref|XP_006393750.1| hypothetical protein EUTSA_v10011724mg [Eutrema salsugineum]
 gb|ESQ31036.1| hypothetical protein EUTSA_v10011724mg [Eutrema salsugineum]
Length=188

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY   ++D+VVAEWKKVK ++ LH+H
Sbjct  100  SHCDFTANLTLTISNVINLDQLEGWY---KKDDVVAEWKKVKDELRLHIH  146



>ref|XP_002520272.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42058.1| conserved hypothetical protein [Ricinus communis]
Length=249

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 40/50 (80%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+++TL IS  IN  QL+GWY+   +D+VVAEWKK++G+++LH+H
Sbjct  88   SHCDFTAELTLTISNVINLDQLRGWYS---KDDVVAEWKKLEGQLALHIH  134



>emb|CAN81476.1| hypothetical protein VITISV_000606 [Vitis vinifera]
Length=208

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  I+  QL+GWYN   +D+VVAEWK+VKG+  LHVH
Sbjct  48   SHCDFTANLTLTISNIISLDQLKGWYN---KDDVVAEWKEVKGEKCLHVH  94



>gb|KDO83502.1| hypothetical protein CISIN_1g025286mg [Citrus sinensis]
Length=178

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY    +D+VVAEWKKV+  M LHVH
Sbjct  94   SHCDFTANLTLTISNVINLEQLRGWY---IKDDVVAEWKKVRDDMCLHVH  140



>ref|XP_006434323.1| hypothetical protein CICLE_v10002160mg [Citrus clementina]
 gb|ESR47563.1| hypothetical protein CICLE_v10002160mg [Citrus clementina]
Length=192

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY    +D+VVAEWKKV+  M LHVH
Sbjct  108  SHCDFTANLTLTISNVINLEQLRGWY---IKDDVVAEWKKVRDDMCLHVH  154



>gb|KDO83503.1| hypothetical protein CISIN_1g025286mg [Citrus sinensis]
Length=193

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY    +D+VVAEWKKV+  M LHVH
Sbjct  94   SHCDFTANLTLTISNVINLEQLRGWY---IKDDVVAEWKKVRDDMCLHVH  140



>gb|KFK23291.1| hypothetical protein AALP_AAs55143U000200 [Arabis alpina]
Length=255

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY   ++D+VVAEWKKVK ++ LH+H
Sbjct  99   SHCDFTANLTLTISNVINLDQLEGWY---KKDDVVAEWKKVKDELRLHIH  145



>ref|XP_006434321.1| hypothetical protein CICLE_v10002160mg [Citrus clementina]
 gb|ESR47561.1| hypothetical protein CICLE_v10002160mg [Citrus clementina]
Length=207

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY    +D+VVAEWKKV+  M LHVH
Sbjct  108  SHCDFTANLTLTISNVINLEQLRGWY---IKDDVVAEWKKVRDDMCLHVH  154



>ref|XP_006393749.1| hypothetical protein EUTSA_v10011724mg [Eutrema salsugineum]
 gb|ESQ31035.1| hypothetical protein EUTSA_v10011724mg [Eutrema salsugineum]
Length=164

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY   ++D+VVAEWKKVK ++ LH+H
Sbjct  100  SHCDFTANLTLTISNVINLDQLEGWY---KKDDVVAEWKKVKDELRLHIH  146



>ref|XP_010112027.1| hypothetical protein L484_012613 [Morus notabilis]
 gb|EXC32446.1| hypothetical protein L484_012613 [Morus notabilis]
Length=266

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY++   D+VVAEWKKV G+M LHVH
Sbjct  103  SHCDFTANLTLTISHVINLEQLRGWYSK---DDVVAEWKKVNGEMCLHVH  149



>gb|KDO83501.1| hypothetical protein CISIN_1g025286mg [Citrus sinensis]
Length=255

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY    +D+VVAEWKKV+  M LHVH
Sbjct  94   SHCDFTANLTLTISNVINLEQLRGWY---IKDDVVAEWKKVRDDMCLHVH  140



>ref|XP_006472884.1| PREDICTED: uncharacterized protein LOC102607042 [Citrus sinensis]
Length=255

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY    +D+VVAEWKKV+  M LHVH
Sbjct  94   SHCDFTANLTLTISNVINLEQLRGWY---IKDDVVAEWKKVRDDMCLHVH  140



>ref|XP_001776856.1| predicted protein [Physcomitrella patens]
 gb|EDQ58259.1| predicted protein [Physcomitrella patens]
Length=129

 Score = 61.2 bits (147),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T ++ L+I  + N  QL  WY RL RDE+VAEW +++ ++SLHVH
Sbjct  4    THSDVTGELLLSIGPSFNRRQLTDWYTRLMRDEIVAEW-RIREQISLHVH  52



>emb|CBI18940.3| unnamed protein product [Vitis vinifera]
Length=232

 Score = 62.0 bits (149),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  I+  QL+GWYN   +D+VVAEWK+VKG+  LHVH
Sbjct  72   SHCDFTANLTLTISNIISLDQLKGWYN---KDDVVAEWKEVKGEKCLHVH  118



>ref|XP_006434322.1| hypothetical protein CICLE_v10002160mg [Citrus clementina]
 gb|ESR47562.1| hypothetical protein CICLE_v10002160mg [Citrus clementina]
Length=269

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY    +D+VVAEWKKV+  M LHVH
Sbjct  108  SHCDFTANLTLTISNVINLEQLRGWY---IKDDVVAEWKKVRDDMCLHVH  154



>gb|KDP32897.1| hypothetical protein JCGZ_12189 [Jatropha curcas]
Length=250

 Score = 61.6 bits (148),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY+   +D+VVAEWKK++G++ LH+H
Sbjct  89   SHCDFTANLTLTISNVINLDQLRGWYS---KDDVVAEWKKLEGQLGLHIH  135



>ref|XP_010679284.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=264

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QLQGWY+   +D+VVAEWK +KGKM L VH
Sbjct  103  SHCDFTANLTLTISNIINVDQLQGWYS---KDDVVAEWKNLKGKMCLVVH  149



>ref|XP_011081163.1| PREDICTED: protein STAY-GREEN, chloroplastic [Sesamum indicum]
Length=219

 Score = 61.2 bits (147),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 36/63 (57%), Gaps = 13/63 (21%)
 Frame = -1

Query  150  THSDITSKITLAISQT-------------INSSQLQGWYNRLQRDEVVAEWKKVKGKMSL  10
            TH D T+     IS               +   Q+QGWY+RLQRDEVV EWKK+KGKM L
Sbjct  68   THCDFTTNTCQVISSVYFLILDLGESNSIVKWLQVQGWYSRLQRDEVVGEWKKIKGKMCL  127

Query  9    HVH  1
            HVH
Sbjct  128  HVH  130



>gb|KHG15817.1| DNA polymerase III subunit alpha [Gossypium arboreum]
Length=252

 Score = 61.2 bits (147),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWYN    D+VVAEWKKVK  M L+VH
Sbjct  90   SHCDFTANLTLTISNVINLDQLKGWYN---NDDVVAEWKKVKETMFLNVH  136



>ref|XP_006393751.1| hypothetical protein EUTSA_v10011724mg [Eutrema salsugineum]
 gb|ESQ31037.1| hypothetical protein EUTSA_v10011724mg [Eutrema salsugineum]
Length=256

 Score = 61.2 bits (147),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY   ++D+VVAEWKKVK ++ LH+H
Sbjct  100  SHCDFTANLTLTISNVINLDQLEGWY---KKDDVVAEWKKVKDELRLHIH  146



>ref|XP_001753523.1| predicted protein [Physcomitrella patens]
 gb|EDQ81746.1| predicted protein [Physcomitrella patens]
Length=209

 Score = 60.8 bits (146),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSD+T  + L+I  ++N  QL  WY RL RDE+VAEW+  + ++SLHVH
Sbjct  47   THSDVTGDLLLSIGPSLNQQQLADWYTRLMRDEIVAEWRGSE-QISLHVH  95



>ref|XP_010523234.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Tarenaya hassleriana]
Length=255

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL +++ IN  QL+GWY   ++D+VVAEWKKV  ++ LHVH
Sbjct  99   SHCDFTANLTLTVAKVINLDQLEGWY---KKDDVVAEWKKVNDELRLHVH  145



>ref|XP_006304121.1| hypothetical protein CARUB_v10010064mg [Capsella rubella]
 gb|EOA37019.1| hypothetical protein CARUB_v10010064mg [Capsella rubella]
Length=256

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY   ++D+VVAEWKKV  ++ LH+H
Sbjct  100  SHCDFTADLTLTISNVINLDQLEGWY---KKDDVVAEWKKVNDELRLHIH  146



>ref|XP_002893975.1| hypothetical protein ARALYDRAFT_891373 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70234.1| hypothetical protein ARALYDRAFT_891373 [Arabidopsis lyrata subsp. 
lyrata]
Length=258

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY   ++D+VVAEWKKV  ++ LH+H
Sbjct  102  SHCDFTANLTLTISNVINLDQLEGWY---KKDDVVAEWKKVNDELRLHIH  148



>ref|XP_011006299.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Populus euphratica]
Length=250

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY+   +D+VVAEWKK++G+++L VH
Sbjct  96   SHCDFTADLTLTISNVINLDQLRGWYS---KDDVVAEWKKLEGQLALLVH  142



>gb|AAF79680.1|AC022314_21 F9C16.20 [Arabidopsis thaliana]
Length=299

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY   ++D+VVAEWKKV  ++ LH+H
Sbjct  104  SHCDFTANLTLTISNVINLDQLEGWY---KKDDVVAEWKKVNDELRLHIH  150



>emb|CDY47791.1| BnaC06g00560D [Brassica napus]
Length=257

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY   ++D+VVAEWKKV  ++ LH+H
Sbjct  100  SHCDFTANLTLTISNVINLDQLEGWY---KKDDVVAEWKKVNDELRLHIH  146



>ref|XP_010500128.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic-like [Camelina 
sativa]
Length=259

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS+ IN  QL+GWY   ++D+VVAEWKKV  ++ LH+H
Sbjct  103  SHCDYTADLTLTISKVINLDQLEGWY---KKDDVVAEWKKVNDELRLHIH  149



>ref|XP_010479036.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Camelina sativa]
Length=259

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS+ IN  QL+GWY   ++D+VVAEWKKV  ++ LH+H
Sbjct  103  SHCDYTADLTLTISKVINLDQLEGWY---KKDDVVAEWKKVNDELRLHIH  149



>ref|XP_010461432.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic-like [Camelina 
sativa]
Length=260

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS+ IN  QL+GWY   ++D+VVAEWKKV  ++ LH+H
Sbjct  104  SHCDYTADLTLTISKVINLDQLEGWY---KKDDVVAEWKKVNDELRLHIH  150



>ref|NP_564489.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q94AQ9.1|SGRL_ARATH RecName: Full=Protein STAY-GREEN LIKE, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK76544.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14392.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32011.1| uncharacterized protein AT1G44000 [Arabidopsis thaliana]
Length=260

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY   ++D+VVAEWKKV  ++ LH+H
Sbjct  104  SHCDFTANLTLTISNVINLDQLEGWY---KKDDVVAEWKKVNDELRLHIH  150



>ref|XP_006383602.1| hypothetical protein POPTR_0005s20690g [Populus trichocarpa]
 gb|ERP61399.1| hypothetical protein POPTR_0005s20690g [Populus trichocarpa]
Length=250

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY+   +D+VVAEWKK++G ++L VH
Sbjct  96   SHCDFTADLTLTISNVINLDQLRGWYS---KDDVVAEWKKLEGHLALLVH  142



>ref|XP_006383603.1| hypothetical protein POPTR_0005s20690g [Populus trichocarpa]
 gb|ERP61400.1| hypothetical protein POPTR_0005s20690g [Populus trichocarpa]
Length=173

 Score = 58.2 bits (139),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY+   +D+VVAEWKK++G ++L VH
Sbjct  19   SHCDFTADLTLTISNVINLDQLRGWYS---KDDVVAEWKKLEGHLALLVH  65



>ref|XP_002302208.2| hypothetical protein POPTR_0002s07630g [Populus trichocarpa]
 gb|EEE81481.2| hypothetical protein POPTR_0002s07630g [Populus trichocarpa]
Length=238

 Score = 58.5 bits (140),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY+   +D+VV EWKK++G+++LH H
Sbjct  92   SHCDFTADLTLIISNVINLDQLRGWYS---KDDVVVEWKKLEGQLALHAH  138



>ref|XP_006365914.1| PREDICTED: uncharacterized protein LOC102586926 isoform X1 [Solanum 
tuberosum]
 ref|XP_006365915.1| PREDICTED: uncharacterized protein LOC102586926 isoform X2 [Solanum 
tuberosum]
Length=253

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TLAIS  I   QL+GWYN   +D+VVAEW +VKG + L VH
Sbjct  92   SHCDFTANLTLAISNNIQYDQLKGWYN---KDDVVAEWTEVKGNLFLDVH  138



>ref|XP_005650112.1| hypothetical protein COCSUDRAFT_61770 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25568.1| hypothetical protein COCSUDRAFT_61770 [Coccomyxa subellipsoidea 
C-169]
Length=328

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWK-KVKGKMSLHVH  1
            TH+D+T ++ L+I    N +Q+ GWY RL RDEV+AEW    +G+ SLHVH
Sbjct  54   THNDLTGQLRLSIGSAYNRAQVSGWYTRLIRDEVLAEWIFDGEGQASLHVH  104



>ref|XP_004959924.1| PREDICTED: uncharacterized protein LOC101781294 [Setaria italica]
Length=265

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 3/53 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKG---KMSLHVH  1
            TH D T+ +TLA++  ++S QL+ W + LQRD+VVAEWK+  G     +LHVH
Sbjct  97   THCDFTANLTLAVTGPMSSEQLRSWQSTLQRDDVVAEWKEAAGGEMTTTLHVH  149



>ref|XP_004237702.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Solanum lycopersicum]
 ref|XP_010320005.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Solanum lycopersicum]
Length=242

 Score = 57.8 bits (138),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  I   QL+GWYN   +D+VVAEW +VKG + L VH
Sbjct  81   SHCDFTANLTLTISNNIQYDQLKGWYN---KDDVVAEWTEVKGNLFLDVH  127



>ref|XP_006383601.1| hypothetical protein POPTR_0005s20690g [Populus trichocarpa]
 gb|ERP61398.1| hypothetical protein POPTR_0005s20690g [Populus trichocarpa]
Length=234

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY+   +D+VVAEWKK++G ++L VH
Sbjct  96   SHCDFTADLTLTISNVINLDQLRGWYS---KDDVVAEWKKLEGHLALLVH  142



>emb|CDY47161.1| BnaA01g22870D [Brassica napus]
Length=114

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  90  QLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            LQGW N++ RDEVVAEWKKV+GK+SLHVH
Sbjct  46  PLQGWANKIYRDEVVAEWKKVRGKISLHVH  75



>emb|CDP11961.1| unnamed protein product [Coffea canephora]
Length=261

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GWY+   +D+VVAEW +VKG + L VH
Sbjct  100  SHCDFTANLTLTISNIINLDQLRGWYS---KDDVVAEWTEVKGNLFLDVH  146



>ref|XP_010062196.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW69282.1| hypothetical protein EUGRSUZ_F02776 [Eucalyptus grandis]
Length=247

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ + L IS  I+  QL+GWY   ++D+VVAEWK V  +M LH+H
Sbjct  89   SHCDFTANLNLTISNVISLDQLRGWY---EKDDVVAEWKSVNKEMCLHIH  135



>gb|KCW69281.1| hypothetical protein EUGRSUZ_F02776 [Eucalyptus grandis]
Length=222

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ + L IS  I+  QL+GWY   ++D+VVAEWK V  +M LH+H
Sbjct  89   SHCDFTANLNLTISNVISLDQLRGWY---EKDDVVAEWKSVNKEMCLHIH  135



>ref|XP_011074802.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Sesamum indicum]
Length=248

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  I   QL+GWYN   +D+VVAEW +V G + L+VH
Sbjct  86   SHCDFTANLTLTISNIIQRDQLKGWYN---KDDVVAEWTEVNGILCLNVH  132



>ref|XP_009602525.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Nicotiana 
tomentosiformis]
Length=260

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  I   QL+GWYN   +D+VVAEW +VKG + L VH
Sbjct  100  SHCDFTANLTLTISNNIQYDQLKGWYN---KDDVVAEWTEVKGNLFLDVH  146



>gb|EPS69844.1| hypothetical protein M569_04921, partial [Genlisea aurea]
Length=225

 Score = 56.2 bits (134),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D+T+ +TL IS  I+  QL+GWYN   +D+VVAEW +V  K+ L+VH
Sbjct  66   SHCDLTANLTLTISNIIHREQLEGWYN---KDDVVAEWTEVDEKLFLNVH  112



>ref|XP_007019269.1| F9C16.20, putative isoform 2 [Theobroma cacao]
 gb|EOY16494.1| F9C16.20, putative isoform 2 [Theobroma cacao]
Length=268

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GW     +D+VVAEWKKV+  M L+VH
Sbjct  106  SHCDFTANLTLTISNVINLDQLKGW---CHKDDVVAEWKKVRETMLLNVH  152



>ref|XP_009774944.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Nicotiana 
sylvestris]
Length=263

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  I   QL+GWYN   +D+VVAEW +VKG + L +H
Sbjct  103  SHCDFTANLTLTISNNIQYDQLKGWYN---KDDVVAEWTEVKGNLFLDIH  149



>ref|XP_007019268.1| F9C16.20, putative isoform 1 [Theobroma cacao]
 gb|EOY16493.1| F9C16.20, putative isoform 1 [Theobroma cacao]
Length=291

 Score = 56.2 bits (134),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  IN  QL+GW     +D+VVAEWKKV+  M L+VH
Sbjct  129  SHCDFTANLTLTISNVINLDQLKGW---CHKDDVVAEWKKVRETMLLNVH  175



>ref|XP_009393458.1| PREDICTED: LOW QUALITY PROTEIN: protein STAY-GREEN LIKE, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=172

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 6/50 (12%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            TH D T+ +TLA+S  ++S ++      L RD+VVAEWKK+K +MSLHVH
Sbjct  20   THCDFTANLTLAVSNGMHSQKV------LHRDDVVAEWKKIKEEMSLHVH  63



>gb|EYU32477.1| hypothetical protein MIMGU_mgv1a012754mg [Erythranthe guttata]
Length=241

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL++S  I  +QL GWY+   +D+VVAEW  V G + L+VH
Sbjct  80   SHCDFTANLTLSVSNIIQRNQLTGWYS---KDDVVAEWTDVNGDLFLNVH  126



>ref|XP_003580904.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic [Brachypodium 
distachyon]
Length=243

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 11/57 (19%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVK-------GKMSLHVH  1
            +H D T+ +TLA+S+TI S QL+ W    QRD+V AEWK++        G+M+LH+H
Sbjct  82   SHCDFTANLTLAVSETITSDQLRRW----QRDDVFAEWKEMSSTTTSGGGEMTLHLH  134



>dbj|BAJ89910.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=248

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 9/57 (16%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVK-------GKMSLHVH  1
            +H D T+ +TLA+S+TI S QL+ W  R  RD+V AEWK++        G+M+LH+H
Sbjct  84   SHCDFTANLTLAVSETITSEQLRRWGWR--RDDVFAEWKEMTCTGGPGGGEMTLHLH  138



>ref|XP_002448084.1| hypothetical protein SORBIDRAFT_06g020740 [Sorghum bicolor]
 gb|EES12412.1| hypothetical protein SORBIDRAFT_06g020740 [Sorghum bicolor]
Length=268

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 9/59 (15%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSS-QLQGWYNRLQRDEVVAEWKKV--------KGKMSLHVH  1
            TH D T+ +TLA+S  + +S QL+ W + LQRD+VVAEWK+V        + +M+L VH
Sbjct  87   THCDFTANLTLAVSGPMTTSEQLRSWQSTLQRDDVVAEWKEVTTAANAGGEREMTLQVH  145



>gb|EMT26913.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=1036

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 9/57 (16%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVK-------GKMSLHVH  1
            +H D T+ +TLA+S+TI S QL+ W  R  RD+V AEWK++        G+M+LH+H
Sbjct  671  SHCDFTANLTLAVSETITSEQLRRWGWR--RDDVFAEWKEMTCTGGPGGGEMTLHLH  725



>ref|XP_005850408.1| hypothetical protein CHLNCDRAFT_142305 [Chlorella variabilis]
 gb|EFN58306.1| hypothetical protein CHLNCDRAFT_142305 [Chlorella variabilis]
Length=369

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWK  34
            TH+D+T  + L+I    N  QL GWY R+ RDE++AEW+
Sbjct  73   THNDVTGSLQLSIGHEYNRRQLDGWYTRILRDEILAEWQ  111



>gb|KCW70675.1| hypothetical protein EUGRSUZ_F03846 [Eucalyptus grandis]
Length=103

 Score = 49.7 bits (117),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 4/50 (8%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D  S +TL IS  I+  QL+ WY   ++D+VVAEWK V  +M LHVH
Sbjct  19   SHCDF-SNLTLTISNVISLDQLRRWY---EKDDVVAEWKSVNKEMCLHVH  64



>ref|XP_003082632.1| senescence-inducible chloroplast stay-green protein (ISS) [Ostreococcus 
tauri]
Length=244

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKK  31
            TH+D+T  +TL +  T N  Q   WY RL RDEV+AEW++
Sbjct  71   THNDVTRNLTLTVGTTFNDEQTSVWYTRLLRDEVLAEWRE  110



>ref|XP_003060977.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54627.1| predicted protein [Micromonas pusilla CCMP1545]
Length=370

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 4/50 (8%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            TH+D+T ++TL++++  + +Q   WY RL RDEV+AEW+       LHVH
Sbjct  112  THNDLTRQLTLSVARDFDGAQTALWYTRLLRDEVLAEWR----DDGLHVH  157



>emb|CEG00115.1| Staygreen protein [Ostreococcus tauri]
Length=258

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKK  31
            TH+D+T  +TL +  T N  Q   WY RL RDEV+AEW++
Sbjct  85   THNDVTRNLTLTVGTTFNDEQTSVWYTRLLRDEVLAEWRE  124



>ref|XP_002948199.1| hypothetical protein VOLCADRAFT_103823 [Volvox carteri f. nagariensis]
 gb|EFJ50606.1| hypothetical protein VOLCADRAFT_103823 [Volvox carteri f. nagariensis]
Length=652

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKV-KGKMSLHVH  1
            TH+DIT  + L I    N  Q+ G+Y RL RDEVVAEW  V     +LHV+
Sbjct  42   THNDITGNLRLTIGPEYNMKQISGFYTRLLRDEVVAEWVNVGSSGFALHVY  92



>ref|XP_011102024.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic-like isoform 
X2 [Sesamum indicum]
Length=240

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  ++  QL+GW +   +D+VVAEW  V G + L+VH
Sbjct  83   SHCDFTANLTLTISNLVHPDQLKGWNS---KDDVVAEWTDVNGDLFLNVH  129



>ref|XP_001420948.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 ref|XP_001422946.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99241.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01305.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=259

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKK  31
            TH+D+T  +TL +    N  Q   WY RL RDEV+AEW++
Sbjct  87   THNDVTRNLTLTVGDAFNDDQTSIWYTRLLRDEVLAEWRE  126



>ref|XP_011102022.1| PREDICTED: protein STAY-GREEN LIKE, chloroplastic-like isoform 
X1 [Sesamum indicum]
Length=248

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 3/50 (6%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            +H D T+ +TL IS  ++  QL+GW +   +D+VVAEW  V G + L+VH
Sbjct  83   SHCDFTANLTLTISNLVHPDQLKGWNS---KDDVVAEWTDVNGDLFLNVH  129



>ref|NP_001130909.1| hypothetical protein [Zea mays]
 gb|ACF79295.1| unknown [Zea mays]
 gb|ACF82862.1| unknown [Zea mays]
 tpg|DAA36832.1| TPA: hypothetical protein ZEAMMB73_466441 [Zea mays]
Length=232

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 5/50 (10%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            TH D+T+ +TL +   ++S QL+   + LQRD+VVAEWK+  G+M+L VH
Sbjct  79   THCDLTANLTLGV---MSSEQLRK--STLQRDDVVAEWKETAGEMTLQVH  123



>ref|XP_001690907.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP05353.1| predicted protein [Chlamydomonas reinhardtii]
Length=504

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGK-MSLHVH  1
            TH+DIT  + L I    N  Q+ G+Y RL RDEV+AEW  V     +LHV+
Sbjct  104  THNDITGNLRLTIGADYNQQQISGFYTRLLRDEVIAEWVAVGASGYALHVY  154



>ref|XP_007508368.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20472.1| predicted protein [Bathycoccus prasinos]
Length=369

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWK  34
            TH+D+T  +TL++S+  N +Q   WY +L RDEV+AEW+
Sbjct  157  THNDLTRHLTLSVSKEFNETQTSIWYTKLLRDEVLAEWR  195



>gb|KFM29124.1| hypothetical protein F751_5480 [Auxenochlorella protothecoides]
Length=329

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 32/65 (49%), Gaps = 15/65 (23%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEW---------------KKVKGKM  16
            TH+DIT  + L+I    N  QL   Y RL RDEV+AEW                + +  M
Sbjct  70   THNDITGNLFLSIGPCYNQRQLSRLYTRLLRDEVLAEWLPHGGDLHAVAGPGTAQPRQAM  129

Query  15   SLHVH  1
            SLHVH
Sbjct  130  SLHVH  134



>ref|XP_006653921.1| PREDICTED: uncharacterized protein LOC102719862 [Oryza brachyantha]
Length=264

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 7/52 (13%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVK--GKMSLHVH  1
            TH D T+ +TLA+S TI S +      RL+ D+V AEWK+ +  G M+LHVH
Sbjct  93   THCDFTANLTLAVSDTIASDR-----RRLRADDVFAEWKQQQDAGGMALHVH  139



>ref|WP_029476822.1| hypothetical protein [Dehalococcoidia bacterium SCGC AB-539-J10]
Length=153

 Score = 43.9 bits (102),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  THSDITSKITLAISQTINSSQLQGWYNRLQRDEVVAEWKKVKGKMSLHVH  1
            THSDIT ++ L+I    N+ Q+   Y RL RDEV+AE+ + +  +   V+
Sbjct  31   THSDITGQLFLSIGNEYNTKQISRLYTRLMRDEVLAEFAEEEDGLVFRVY  80



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524054700018