BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17608_g1_i1 len=605 path=[583:0-375 959:376-378 962:379-402
986:403-604]

Length=605
                                                                      Score     E

ref|XP_006347536.1|  PREDICTED: probable serine/threonine-protein...  52.4    7e-06   
ref|XP_009621428.1|  PREDICTED: neurofilament heavy polypeptide-like  52.0    1e-05   
ref|XP_009629935.1|  PREDICTED: probable serine/threonine-protein...  50.1    6e-05   
ref|XP_006347319.1|  PREDICTED: probable serine/threonine-protein...  49.3    1e-04   
gb|AAD42902.1|AF161330_1  unknown                                     48.9    1e-04   Solanum chacoense
ref|XP_009778860.1|  PREDICTED: pollen-specific leucine-rich repe...  48.9    2e-04   
ref|XP_009785453.1|  PREDICTED: neurofilament heavy polypeptide-l...  47.8    3e-04   



>ref|XP_006347536.1| PREDICTED: probable serine/threonine-protein kinase kinX-like 
[Solanum tuberosum]
Length=113

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = -2

Query  484  MGACASMPKDLKKQDAAIP-EAPVTPKKPDVPLIPEQENKDMDGEETMKEEPLVDLS  317
            MGACAS PKDL K+ A IP E P TPKK +      +E K  DGEET KEEPLVD S
Sbjct  1    MGACASRPKDLDKEFAPIPAEEPATPKKTEQEAPAPEEKK--DGEETKKEEPLVDAS  55



>ref|XP_009621428.1| PREDICTED: neurofilament heavy polypeptide-like [Nicotiana tomentosiformis]
Length=128

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 39/59 (66%), Gaps = 6/59 (10%)
 Frame = -2

Query  484  MGACASMPKDLKKQDAAIP---EAPVTPKKPDVPLIPEQENKDMDGEETMKEEPLVDLS  317
            MGACAS PKDL +  A  P   E P TPKK +   +P QE KD  GEET KEEPLVD+S
Sbjct  1    MGACASRPKDLDRDLAPAPVPAEDPATPKKSEGGSVP-QEKKD--GEETKKEEPLVDVS  56



>ref|XP_009629935.1| PREDICTED: probable serine/threonine-protein kinase kinX [Nicotiana 
tomentosiformis]
Length=119

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 37/58 (64%), Gaps = 4/58 (7%)
 Frame = -2

Query  484  MGACASMPKDLKKQDAAIP--EAPVTPKKPDVPLIPEQENKDMDGEETMKEEPLVDLS  317
            MGACAS PKDL K  A  P  E  VTPKK +      QE KD  GEET KEEPLVD+S
Sbjct  1    MGACASRPKDLDKDLAPAPAEEPAVTPKKSEQETPAPQEKKD--GEETKKEEPLVDIS  56



>ref|XP_006347319.1| PREDICTED: probable serine/threonine-protein kinase kinX-like 
[Solanum tuberosum]
Length=106

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 37/59 (63%), Gaps = 9/59 (15%)
 Frame = -2

Query  484  MGACASMPKDLKKQDAAIP---EAPVTPKKPDVPLIPEQENKDMDGEETMKEEPLVDLS  317
            MGACAS PKDL +  A  P   E  VTPK   VP    QE KD  GEET KEEPL+D+S
Sbjct  1    MGACASRPKDLDRDLAPAPVPVEESVTPKADAVP----QEKKD--GEETKKEEPLIDVS  53



>gb|AAD42902.1|AF161330_1 unknown [Solanum chacoense]
Length=109

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 37/59 (63%), Gaps = 9/59 (15%)
 Frame = -2

Query  484  MGACASMPKDLKKQDAAIP---EAPVTPKKPDVPLIPEQENKDMDGEETMKEEPLVDLS  317
            MGACAS PKDL +  A  P   E  VTPK   VP    QE KD  GEET KEEPL+D+S
Sbjct  1    MGACASRPKDLDRDLAPAPVPAEESVTPKADAVP----QEKKD--GEETKKEEPLIDVS  53



>ref|XP_009778860.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Nicotiana sylvestris]
Length=118

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 38/59 (64%), Gaps = 6/59 (10%)
 Frame = -2

Query  484  MGACASMPKDLKKQDAAIP---EAPVTPKKPDVPLIPEQENKDMDGEETMKEEPLVDLS  317
            MGACAS PKDL +  A  P   E P TPKK +   +P QE K  DGEET KEE LVD+S
Sbjct  1    MGACASRPKDLDRDLAPAPVPAEDPATPKKSEGDSVP-QEKK--DGEETKKEEALVDVS  56



>ref|XP_009785453.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009785454.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Nicotiana 
sylvestris]
Length=118

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 37/58 (64%), Gaps = 4/58 (7%)
 Frame = -2

Query  484  MGACASMPKDLKKQDAAIP--EAPVTPKKPDVPLIPEQENKDMDGEETMKEEPLVDLS  317
            MGACAS PKDL K  A  P  E  VTPKK +      QE KD  GEET +EEPLVD+S
Sbjct  1    MGACASRPKDLAKDLAPAPAEEHAVTPKKSEQETPAPQEKKD--GEETKEEEPLVDVS  56



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 772903297860