BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17565_g1_i1 len=298 path=[1:0-297]

Length=298
                                                                      Score     E

emb|CDP17099.1|  unnamed protein product                                184   2e-53   
ref|XP_009784607.1|  PREDICTED: probable polygalacturonase isofor...    179   1e-51   
ref|XP_009784614.1|  PREDICTED: probable polygalacturonase isofor...    179   1e-51   
ref|XP_004247394.1|  PREDICTED: probable polygalacturonase              179   3e-51   
ref|NP_001274800.1|  probable polygalacturonase-like                    177   1e-50   
ref|XP_009624281.1|  PREDICTED: probable polygalacturonase              176   2e-50   
ref|XP_006355845.1|  PREDICTED: probable polygalacturonase-like         176   2e-50   
ref|XP_009793676.1|  PREDICTED: probable polygalacturonase              176   2e-50   
ref|XP_009624502.1|  PREDICTED: probable polygalacturonase              177   3e-50   
ref|XP_004240577.1|  PREDICTED: probable polygalacturonase              174   6e-50   
ref|XP_011079616.1|  PREDICTED: probable polygalacturonase isofor...    172   6e-49   
ref|XP_011079615.1|  PREDICTED: probable polygalacturonase isofor...    172   6e-49   
gb|EYU46764.1|  hypothetical protein MIMGU_mgv1a0060621mg               162   2e-46   
ref|XP_011082629.1|  PREDICTED: probable polygalacturonase              162   2e-45   
ref|XP_010652214.1|  PREDICTED: probable polygalacturonase              162   3e-45   
emb|CBI36899.3|  unnamed protein product                                162   4e-45   
ref|XP_006380233.1|  glycoside hydrolase family 28 family protein       159   6e-44   
ref|XP_010259446.1|  PREDICTED: probable polygalacturonase              159   6e-44   
ref|XP_011007067.1|  PREDICTED: probable polygalacturonase              158   8e-44   
ref|XP_010245458.1|  PREDICTED: probable polygalacturonase isofor...    158   1e-43   
ref|XP_002314352.2|  hypothetical protein POPTR_0010s00770g             158   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_011011881.1|  PREDICTED: probable polygalacturonase isofor...    157   1e-43   
ref|XP_010245459.1|  PREDICTED: probable polygalacturonase isofor...    158   1e-43   
ref|XP_011011880.1|  PREDICTED: probable polygalacturonase isofor...    157   1e-43   
gb|KDP27854.1|  hypothetical protein JCGZ_18934                         157   2e-43   
ref|XP_009378739.1|  PREDICTED: probable polygalacturonase isofor...    157   2e-43   
ref|XP_009378738.1|  PREDICTED: probable polygalacturonase isofor...    157   3e-43   
ref|XP_010670927.1|  PREDICTED: probable polygalacturonase              156   5e-43   
gb|ACU20798.1|  unknown                                                 149   1e-42   Glycine max [soybeans]
gb|KDO71782.1|  hypothetical protein CISIN_1g012788mg                   155   2e-42   
gb|EPS59056.1|  hypothetical protein M569_15754                         151   2e-42   
ref|XP_006419481.1|  hypothetical protein CICLE_v10004942mg             155   2e-42   
ref|XP_007201026.1|  hypothetical protein PRUPE_ppa006130mg             153   3e-42   
ref|XP_002516982.1|  Polygalacturonase, putative                        154   4e-42   Ricinus communis
ref|XP_007145183.1|  hypothetical protein PHAVU_007G217500g             154   4e-42   
ref|XP_009346609.1|  PREDICTED: probable polygalacturonase isofor...    153   8e-42   
ref|XP_009346610.1|  PREDICTED: probable polygalacturonase isofor...    153   8e-42   
ref|XP_002273305.1|  PREDICTED: probable polygalacturonase              152   2e-41   Vitis vinifera
ref|XP_007163149.1|  hypothetical protein PHAVU_001G210300g             151   2e-41   
ref|XP_008386709.1|  PREDICTED: probable polygalacturonase              152   2e-41   
ref|XP_008345224.1|  PREDICTED: probable polygalacturonase isofor...    151   3e-41   
emb|CBI22951.3|  unnamed protein product                                152   3e-41   
ref|XP_004508182.1|  PREDICTED: probable polygalacturonase-like         151   3e-41   
ref|XP_008345223.1|  PREDICTED: probable polygalacturonase isofor...    151   4e-41   
gb|KHN08663.1|  Putative polygalacturonase                              149   4e-41   
gb|KHG14610.1|  putative polygalacturonase                              151   4e-41   
ref|XP_007163148.1|  hypothetical protein PHAVU_001G210300g             150   6e-41   
ref|XP_003519755.1|  PREDICTED: probable polygalacturonase              149   1e-40   
ref|XP_008438913.1|  PREDICTED: probable polygalacturonase isofor...    149   2e-40   
ref|XP_008438914.1|  PREDICTED: probable polygalacturonase isofor...    149   2e-40   
ref|XP_003609706.1|  hypothetical protein MTR_4g120730                  148   4e-40   
gb|KHN20382.1|  Putative polygalacturonase                              147   4e-40   
ref|XP_007035679.1|  Pectin lyase-like superfamily protein              149   4e-40   
ref|XP_003520745.2|  PREDICTED: probable polygalacturonase-like         148   5e-40   
gb|KHG18940.1|  putative polygalacturonase                              148   6e-40   
ref|XP_006588584.1|  PREDICTED: probable polygalacturonase-like         148   6e-40   
ref|XP_004172519.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    147   6e-40   
ref|XP_006604728.1|  PREDICTED: probable polygalacturonase-like         148   6e-40   
ref|XP_004134229.1|  PREDICTED: probable polygalacturonase-like         147   7e-40   
ref|XP_007223360.1|  hypothetical protein PRUPE_ppa005599mg             147   1e-39   
ref|XP_008223260.1|  PREDICTED: probable polygalacturonase              147   1e-39   
gb|KEH37171.1|  polygalacturonase/glycoside hydrolase family protein    145   1e-39   
gb|KEH37170.1|  polygalacturonase/glycoside hydrolase family protein    146   3e-39   
ref|XP_010048020.1|  PREDICTED: probable polygalacturonase isofor...    146   3e-39   
ref|XP_010048025.1|  PREDICTED: probable polygalacturonase isofor...    145   3e-39   
ref|XP_010558428.1|  PREDICTED: probable polygalacturonase              145   5e-39   
ref|XP_009384145.1|  PREDICTED: probable polygalacturonase              144   8e-39   
ref|XP_004487815.1|  PREDICTED: probable polygalacturonase-like         144   1e-38   
ref|XP_009346202.1|  PREDICTED: probable polygalacturonase              144   1e-38   
gb|KHN30667.1|  Putative polygalacturonase                              144   2e-38   
ref|XP_009383709.1|  PREDICTED: probable polygalacturonase              144   2e-38   
gb|KFK38140.1|  hypothetical protein AALP_AA3G074700                    143   3e-38   
ref|XP_008361956.1|  PREDICTED: probable polygalacturonase              141   4e-38   
ref|XP_003533248.1|  PREDICTED: probable polygalacturonase isofor...    143   4e-38   
ref|XP_006586911.1|  PREDICTED: probable polygalacturonase isofor...    143   4e-38   
gb|KHN26517.1|  Putative polygalacturonase                              143   4e-38   
ref|XP_010094123.1|  putative polygalacturonase                         143   4e-38   
ref|XP_003550546.2|  PREDICTED: probable polygalacturonase-like         142   8e-38   
ref|XP_008390626.1|  PREDICTED: probable polygalacturonase              143   9e-38   
ref|XP_004296881.1|  PREDICTED: probable polygalacturonase-like         141   9e-38   
ref|XP_008340766.1|  PREDICTED: probable polygalacturonase              142   9e-38   
gb|KHG12205.1|  putative polygalacturonase                              142   9e-38   
gb|KHN03332.1|  Putative polygalacturonase                              142   1e-37   
ref|XP_006584015.1|  PREDICTED: probable polygalacturonase-like i...    140   1e-37   
ref|XP_007138953.1|  hypothetical protein PHAVU_009G252200g             141   1e-37   
ref|XP_002863973.1|  polygalacturonase                                  141   1e-37   
ref|XP_003528627.1|  PREDICTED: probable polygalacturonase-like i...    141   2e-37   
gb|KHN02933.1|  Putative polygalacturonase                              140   2e-37   
ref|XP_009399272.1|  PREDICTED: probable polygalacturonase isofor...    140   3e-37   
ref|XP_007154320.1|  hypothetical protein PHAVU_003G108700g             140   3e-37   
ref|XP_009399273.1|  PREDICTED: probable polygalacturonase isofor...    140   3e-37   
ref|XP_006597720.1|  PREDICTED: probable polygalacturonase-like i...    140   4e-37   
ref|XP_006597719.1|  PREDICTED: probable polygalacturonase-like i...    140   4e-37   
ref|XP_008390608.1|  PREDICTED: probable polygalacturonase              139   7e-37   
ref|XP_006407904.1|  hypothetical protein EUTSA_v10020733mg             139   1e-36   
ref|XP_009369994.1|  PREDICTED: probable polygalacturonase isofor...    139   1e-36   
ref|XP_009369995.1|  PREDICTED: probable polygalacturonase isofor...    139   1e-36   
ref|XP_009129767.1|  PREDICTED: probable polygalacturonase              138   1e-36   
ref|NP_566292.1|  polygalacturonase-like protein                        137   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65366.1|  polygalacturonase-like protein                          137   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884608.1|  glycoside hydrolase family 28 protein              138   2e-36   
ref|NP_850525.1|  polygalacturonase-like protein                        138   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002273855.2|  PREDICTED: probable polygalacturonase              138   2e-36   Vitis vinifera
ref|XP_009151719.1|  PREDICTED: probable polygalacturonase isofor...    138   3e-36   
ref|XP_010931696.1|  PREDICTED: probable polygalacturonase              138   3e-36   
ref|XP_009412155.1|  PREDICTED: probable polygalacturonase              138   3e-36   
ref|NP_001032043.1|  pectin lyase-like superfamily protein              137   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841512.1|  hypothetical protein AMTR_s00003p00141260          138   3e-36   
gb|EEC68574.1|  hypothetical protein OsI_36908                          137   3e-36   Oryza sativa Indica Group [Indian rice]
gb|KCW46748.1|  hypothetical protein EUGRSUZ_K00562                     137   3e-36   
ref|NP_001068399.1|  Os11g0658800                                       137   3e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009151721.1|  PREDICTED: probable polygalacturonase isofor...    137   3e-36   
ref|NP_680409.1|  pectin lyase-like superfamily protein                 137   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151722.1|  PREDICTED: probable polygalacturonase isofor...    137   4e-36   
ref|XP_009151720.1|  PREDICTED: probable polygalacturonase isofor...    137   4e-36   
ref|XP_008810196.1|  PREDICTED: probable polygalacturonase isofor...    137   4e-36   
ref|XP_008810198.1|  PREDICTED: probable polygalacturonase isofor...    137   4e-36   
ref|XP_008810197.1|  PREDICTED: probable polygalacturonase isofor...    137   4e-36   
ref|XP_008810195.1|  PREDICTED: probable polygalacturonase isofor...    137   4e-36   
emb|CDY33922.1|  BnaA02g30650D                                          137   4e-36   
emb|CDY56436.1|  BnaC07g49290D                                          137   4e-36   
ref|XP_010035373.1|  PREDICTED: probable polygalacturonase              137   4e-36   
ref|XP_010679489.1|  PREDICTED: probable polygalacturonase isofor...    137   5e-36   
ref|XP_010679488.1|  PREDICTED: probable polygalacturonase isofor...    137   5e-36   
emb|CDY05643.1|  BnaC02g38940D                                          137   7e-36   
ref|XP_009383737.1|  PREDICTED: probable polygalacturonase              137   7e-36   
ref|XP_010091430.1|  putative polygalacturonase                         136   8e-36   
emb|CDX86247.1|  BnaA06g29640D                                          137   9e-36   
gb|EMS62063.1|  putative polygalacturonase                              136   1e-35   
ref|XP_006386685.1|  hypothetical protein POPTR_0002s18800g             136   1e-35   
ref|XP_009363065.1|  PREDICTED: probable polygalacturonase isofor...    136   1e-35   
ref|XP_010914507.1|  PREDICTED: probable polygalacturonase              136   1e-35   
ref|XP_008381624.1|  PREDICTED: probable polygalacturonase              136   1e-35   
ref|XP_009363066.1|  PREDICTED: probable polygalacturonase isofor...    136   1e-35   
ref|XP_008807914.1|  PREDICTED: probable polygalacturonase              135   2e-35   
ref|XP_011005969.1|  PREDICTED: probable polygalacturonase              135   2e-35   
ref|XP_008235135.1|  PREDICTED: probable polygalacturonase              135   2e-35   
ref|XP_009387922.1|  PREDICTED: probable polygalacturonase              135   2e-35   
ref|XP_002535132.1|  Polygalacturonase precursor, putative              135   2e-35   Ricinus communis
gb|KDP28345.1|  hypothetical protein JCGZ_14116                         135   2e-35   
ref|XP_004979886.1|  PREDICTED: probable polygalacturonase-like         135   3e-35   
ref|XP_010909275.1|  PREDICTED: probable polygalacturonase isofor...    135   3e-35   
ref|XP_010909269.1|  PREDICTED: probable polygalacturonase isofor...    135   3e-35   
ref|XP_007221479.1|  hypothetical protein PRUPE_ppa005310mg             135   3e-35   
ref|XP_010544928.1|  PREDICTED: probable polygalacturonase              135   4e-35   
ref|XP_008227776.1|  PREDICTED: probable polygalacturonase              135   4e-35   
ref|XP_006663646.1|  PREDICTED: probable polygalacturonase-like         134   4e-35   
gb|EMT06204.1|  Putative polygalacturonase                              135   4e-35   
ref|XP_010464263.1|  PREDICTED: probable polygalacturonase              134   4e-35   
ref|XP_006664631.1|  PREDICTED: probable polygalacturonase-like         134   5e-35   
ref|XP_010914786.1|  PREDICTED: probable polygalacturonase              134   7e-35   
gb|EMT30389.1|  Putative polygalacturonase                              134   7e-35   
gb|AFW56470.1|  polygalacturonase                                       133   1e-34   
ref|XP_002320934.2|  hypothetical protein POPTR_0014s10770g             133   1e-34   Populus trichocarpa [western balsam poplar]
ref|NP_001148987.1|  polygalacturonase precursor                        133   1e-34   Zea mays [maize]
ref|XP_006395083.1|  hypothetical protein EUTSA_v10004215mg             133   1e-34   
emb|CDX74085.1|  BnaA03g29620D                                          132   1e-34   
ref|XP_009134926.1|  PREDICTED: probable polygalacturonase              133   1e-34   
ref|XP_008661941.1|  PREDICTED: polygalacturonase isoform X1            133   1e-34   
ref|XP_011040145.1|  PREDICTED: probable polygalacturonase              133   1e-34   
emb|CDY08036.1|  BnaC03g34870D                                          132   1e-34   
ref|XP_002451220.1|  hypothetical protein SORBIDRAFT_05g025980          133   1e-34   Sorghum bicolor [broomcorn]
gb|KFK39027.1|  hypothetical protein AALP_AA3G191200                    133   2e-34   
ref|XP_010444937.1|  PREDICTED: probable polygalacturonase isofor...    132   2e-34   
ref|XP_006406800.1|  hypothetical protein EUTSA_v10020710mg             132   2e-34   
ref|XP_009135502.1|  PREDICTED: probable polygalacturonase isofor...    132   2e-34   
ref|XP_007051305.1|  Pectin lyase-like superfamily protein isoform 4    131   2e-34   
ref|XP_010237461.1|  PREDICTED: probable polygalacturonase              132   2e-34   
gb|KEH43186.1|  polygalacturonase/glycoside hydrolase family protein    132   2e-34   
ref|XP_010444882.1|  PREDICTED: probable polygalacturonase isofor...    132   2e-34   
ref|XP_010241441.1|  PREDICTED: probable polygalacturonase isofor...    132   2e-34   
emb|CDX82390.1|  BnaA03g34310D                                          132   2e-34   
ref|XP_007145093.1|  hypothetical protein PHAVU_007G209200g             132   2e-34   
ref|XP_009135501.1|  PREDICTED: probable polygalacturonase isofor...    132   2e-34   
emb|CDY54633.1|  BnaCnng27510D                                          132   3e-34   
ref|XP_010442382.1|  PREDICTED: probable polygalacturonase isofor...    132   3e-34   
ref|XP_010241442.1|  PREDICTED: probable polygalacturonase isofor...    132   3e-34   
ref|XP_007051304.1|  Pectin lyase-like superfamily protein isoform 3    132   3e-34   
ref|XP_003575492.1|  PREDICTED: probable polygalacturonase              132   3e-34   
gb|AES61557.2|  polygalacturonase/glycoside hydrolase family protein    132   3e-34   
ref|XP_010486208.1|  PREDICTED: probable polygalacturonase isofor...    131   3e-34   
ref|XP_010486207.1|  PREDICTED: probable polygalacturonase isofor...    132   3e-34   
ref|XP_008788175.1|  PREDICTED: probable polygalacturonase              132   3e-34   
ref|XP_006444619.1|  hypothetical protein CICLE_v10020035mg             132   3e-34   
ref|XP_010442381.1|  PREDICTED: probable polygalacturonase isofor...    132   4e-34   
gb|EMS65348.1|  putative polygalacturonase                              134   4e-34   
ref|XP_007051302.1|  Pectin lyase-like superfamily protein isoform 1    132   4e-34   
ref|XP_010442380.1|  PREDICTED: probable polygalacturonase isofor...    132   4e-34   
ref|XP_006604763.1|  PREDICTED: probable polygalacturonase-like i...    132   4e-34   
ref|XP_003554577.1|  PREDICTED: probable polygalacturonase-like i...    132   4e-34   
ref|XP_008676433.1|  PREDICTED: hypothetical protein isoform X2         130   4e-34   
ref|XP_010676306.1|  PREDICTED: probable polygalacturonase              131   5e-34   
gb|EMS62381.1|  putative polygalacturonase                              129   5e-34   
ref|XP_010068401.1|  PREDICTED: probable polygalacturonase              130   5e-34   
ref|XP_003591306.1|  Polygalacturonase-like protein                     132   5e-34   
ref|XP_007163248.1|  hypothetical protein PHAVU_001G218400g             131   6e-34   
ref|XP_002459610.1|  hypothetical protein SORBIDRAFT_02g007470          131   6e-34   Sorghum bicolor [broomcorn]
ref|XP_006576262.1|  PREDICTED: uncharacterized protein LOC100817...    131   7e-34   
ref|XP_006576263.1|  PREDICTED: uncharacterized protein LOC100817...    131   7e-34   
ref|NP_001241086.1|  uncharacterized protein LOC100817309 precursor     131   7e-34   
gb|ABA99544.2|  glycoside hydrolase family 28 protein, putative, ...    131   7e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008676432.1|  PREDICTED: hypothetical protein isoform X1         130   7e-34   
ref|NP_001066993.1|  Os12g0554800                                       130   7e-34   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001183080.1|  hypothetical protein precursor                     131   8e-34   
gb|KHN14175.1|  Putative polygalacturonase                              131   8e-34   
gb|KHN43408.1|  Putative polygalacturonase                              131   8e-34   
ref|XP_003626072.1|  Polygalacturonase                                  131   8e-34   
ref|XP_008807372.1|  PREDICTED: probable polygalacturonase              131   8e-34   
gb|KEH24447.1|  polygalacturonase/glycoside hydrolase family protein    131   9e-34   
ref|XP_002883030.1|  hypothetical protein ARALYDRAFT_318449             130   9e-34   
ref|XP_009146055.1|  PREDICTED: probable polygalacturonase              130   1e-33   
emb|CDX92101.1|  BnaA05g23060D                                          130   1e-33   
ref|XP_004494475.1|  PREDICTED: probable polygalacturonase-like i...    130   1e-33   
ref|XP_010271039.1|  PREDICTED: probable polygalacturonase isofor...    130   1e-33   
ref|NP_001130359.1|  hypothetical protein precursor                     130   1e-33   Zea mays [maize]
ref|XP_010271038.1|  PREDICTED: probable polygalacturonase isofor...    130   1e-33   
ref|XP_006280304.1|  hypothetical protein CARUB_v10026227mg             131   1e-33   
ref|XP_004494474.1|  PREDICTED: probable polygalacturonase-like i...    130   1e-33   
ref|XP_002876663.1|  glycoside hydrolase family 28 protein              130   1e-33   
ref|XP_004955888.1|  PREDICTED: probable polygalacturonase-like i...    130   1e-33   
ref|NP_188308.1|  pectin lyase-like superfamily protein                 130   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402409.1|  hypothetical protein EUTSA_v10005945mg             130   1e-33   
ref|XP_010053124.1|  PREDICTED: probable polygalacturonase              130   2e-33   
dbj|BAA95779.1|  polygalacturonase-like protein                         130   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512598.1|  PREDICTED: probable polygalacturonase isofor...    130   2e-33   
emb|CAB71871.1|  putative protein                                       130   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512597.1|  PREDICTED: probable polygalacturonase isofor...    130   2e-33   
gb|AAM62920.1|  polygalacturonase, putative                             130   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567126.1|  pectin lyase-like superfamily protein                 130   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006654851.1|  PREDICTED: probable polygalacturonase-like         128   2e-33   
ref|XP_003519731.2|  PREDICTED: probable polygalacturonase-like i...    130   2e-33   
ref|XP_010523877.1|  PREDICTED: probable polygalacturonase isofor...    130   2e-33   
emb|CDX67875.1|  BnaA07g19150D                                          130   2e-33   
gb|KHN00242.1|  Putative polygalacturonase                              130   2e-33   
ref|XP_009104364.1|  PREDICTED: probable polygalacturonase              130   2e-33   
ref|XP_010440353.1|  PREDICTED: probable polygalacturonase isofor...    129   2e-33   
ref|XP_010468984.1|  PREDICTED: probable polygalacturonase              130   2e-33   
ref|XP_010523874.1|  PREDICTED: probable polygalacturonase isofor...    130   2e-33   
ref|XP_006291055.1|  hypothetical protein CARUB_v10017170mg             130   2e-33   
emb|CDY25090.1|  BnaC06g18320D                                          130   2e-33   
ref|XP_010440347.1|  PREDICTED: probable polygalacturonase isofor...    129   3e-33   
emb|CDY11403.1|  BnaA09g39690D                                          129   3e-33   
emb|CDX95899.1|  BnaC05g36500D                                          129   3e-33   
ref|XP_009116889.1|  PREDICTED: probable polygalacturonase              129   3e-33   
gb|KFK35396.1|  hypothetical protein AALP_AA5G279500                    129   3e-33   
ref|XP_004288344.1|  PREDICTED: probable polygalacturonase-like         129   4e-33   
ref|XP_003557344.1|  PREDICTED: probable polygalacturonase              129   4e-33   
ref|XP_003535296.2|  PREDICTED: probable polygalacturonase-like         129   4e-33   
gb|KFK35395.1|  hypothetical protein AALP_AA5G279500                    129   4e-33   
ref|XP_002875985.1|  glycoside hydrolase family 28 protein              129   4e-33   
gb|EMT32528.1|  Putative polygalacturonase                              129   4e-33   
ref|XP_003563034.1|  PREDICTED: probable polygalacturonase              129   4e-33   
gb|EAY99223.1|  hypothetical protein OsI_21181                          129   5e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_006657587.1|  PREDICTED: probable polygalacturonase-like i...    129   5e-33   
ref|XP_009767931.1|  PREDICTED: probable polygalacturonase              129   5e-33   
gb|AAT44156.1|  putative polygalacturonase                              129   5e-33   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051812.1|  Os03g0833800                                       129   5e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009603675.1|  PREDICTED: probable polygalacturonase              129   5e-33   
ref|NP_001056466.1|  Os05g0587000                                       129   5e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657586.1|  PREDICTED: probable polygalacturonase-like i...    129   5e-33   
gb|ABF99735.1|  glycoside hydrolase family 28 protein, putative, ...    128   6e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001756010.1|  predicted protein                                  128   7e-33   
ref|XP_006297458.1|  hypothetical protein CARUB_v10013478mg             128   7e-33   
ref|NP_001059282.1|  Os07g0245200                                       128   7e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EEE66877.1|  hypothetical protein OsJ_23693                          128   8e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81792.1|  hypothetical protein OsI_25505                          128   8e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_006297459.1|  hypothetical protein CARUB_v10013478mg             128   9e-33   
ref|XP_006297662.1|  hypothetical protein CARUB_v10013686mg             128   9e-33   
ref|XP_001779181.1|  predicted protein                                  127   1e-32   
ref|XP_004969187.1|  PREDICTED: probable polygalacturonase-like         128   1e-32   
ref|XP_011046019.1|  PREDICTED: probable polygalacturonase              128   1e-32   
ref|XP_006372397.1|  glycoside hydrolase family 28 family protein       127   1e-32   
ref|XP_006840361.1|  hypothetical protein AMTR_s00045p00118570          128   1e-32   
ref|XP_002986281.1|  hypothetical protein SELMODRAFT_124011             127   1e-32   
ref|XP_002988771.1|  hypothetical protein SELMODRAFT_128450             127   1e-32   
ref|XP_010548972.1|  PREDICTED: probable polygalacturonase              127   1e-32   
ref|NP_001151479.1|  polygalacturonase precursor                        127   1e-32   Zea mays [maize]
ref|XP_010413306.1|  PREDICTED: probable polygalacturonase              127   1e-32   
gb|AIU50413.1|  pectin lyase-like superfamily protein                   127   2e-32   
ref|XP_010055855.1|  PREDICTED: probable polygalacturonase              127   2e-32   
ref|XP_002463589.1|  hypothetical protein SORBIDRAFT_01g002550          127   2e-32   
ref|XP_008437386.1|  PREDICTED: probable polygalacturonase              127   2e-32   
ref|XP_010504717.1|  PREDICTED: probable polygalacturonase              127   2e-32   
ref|XP_010487555.1|  PREDICTED: probable polygalacturonase              127   2e-32   
ref|XP_010465709.1|  PREDICTED: probable polygalacturonase              127   2e-32   
ref|XP_002455965.1|  hypothetical protein SORBIDRAFT_03g028140          126   3e-32   
gb|AIU50439.1|  pectin lyase-like superfamily protein                   126   3e-32   
ref|XP_001781065.1|  predicted protein                                  126   3e-32   
ref|XP_004499965.1|  PREDICTED: probable polygalacturonase-like         126   3e-32   
gb|AIU50429.1|  pectin lyase-like superfamily protein                   126   4e-32   
gb|AIU50443.1|  pectin lyase-like superfamily protein                   126   4e-32   
ref|XP_006650856.1|  PREDICTED: probable polygalacturonase-like i...    126   4e-32   
gb|KFK26573.1|  hypothetical protein AALP_AA8G266400                    125   4e-32   
ref|XP_004245522.1|  PREDICTED: probable polygalacturonase isofor...    126   4e-32   
gb|ACN35154.1|  unknown                                                 126   4e-32   
ref|XP_006343870.1|  PREDICTED: probable polygalacturonase-like         126   5e-32   
dbj|BAJ94566.1|  predicted protein                                      126   5e-32   
gb|AIU50426.1|  pectin lyase-like superfamily protein                   125   5e-32   
gb|AIU50408.1|  pectin lyase-like superfamily protein                   125   5e-32   
gb|KDO76501.1|  hypothetical protein CISIN_1g0134022mg                  124   5e-32   
ref|XP_011073737.1|  PREDICTED: probable polygalacturonase              126   5e-32   
gb|AIU50437.1|  pectin lyase-like superfamily protein                   125   5e-32   
gb|ACN28107.1|  unknown                                                 126   5e-32   
dbj|BAJ96905.1|  predicted protein                                      126   6e-32   
ref|XP_008679595.1|  PREDICTED: polygalacturonase isoform X1            126   6e-32   
ref|XP_008239046.1|  PREDICTED: probable polygalacturonase              125   6e-32   
ref|XP_006586032.1|  PREDICTED: probable polygalacturonase-like         125   6e-32   
ref|XP_010325363.1|  PREDICTED: probable polygalacturonase isofor...    125   6e-32   
ref|XP_003551949.1|  PREDICTED: probable polygalacturonase-like         125   7e-32   
gb|KHM99685.1|  Putative polygalacturonase                              125   7e-32   
gb|KEH33635.1|  polygalacturonase/glycoside hydrolase family protein    125   7e-32   
ref|XP_006439367.1|  hypothetical protein CICLE_v10020162mg             125   7e-32   
gb|KHN28527.1|  Putative polygalacturonase                              125   7e-32   
ref|XP_003569374.1|  PREDICTED: probable polygalacturonase              125   7e-32   
gb|AIU50405.1|  pectin lyase-like superfamily protein                   125   8e-32   
ref|XP_006476397.1|  PREDICTED: probable polygalacturonase-like         125   8e-32   
emb|CDX76617.1|  BnaC08g32030D                                          125   8e-32   
gb|AIU50431.1|  pectin lyase-like superfamily protein                   125   9e-32   
ref|XP_011101030.1|  PREDICTED: probable polygalacturonase              125   1e-31   
ref|XP_007209143.1|  hypothetical protein PRUPE_ppa005818mg             125   1e-31   
ref|XP_007040496.1|  Pectin lyase-like superfamily protein              125   1e-31   
gb|KDO76502.1|  hypothetical protein CISIN_1g0134022mg                  124   1e-31   
gb|AIU50445.1|  pectin lyase-like superfamily protein                   124   1e-31   
gb|AIU50421.1|  pectin lyase-like superfamily protein                   124   1e-31   
emb|CDM83426.1|  unnamed protein product                                124   2e-31   
ref|XP_004143871.1|  PREDICTED: probable polygalacturonase-like         124   2e-31   
ref|NP_001141464.1|  uncharacterized protein LOC100273574 precursor     124   2e-31   
dbj|BAJ94644.1|  predicted protein                                      124   2e-31   
dbj|BAJ89948.1|  predicted protein                                      124   2e-31   
ref|XP_010924850.1|  PREDICTED: probable polygalacturonase              124   2e-31   
gb|ABO31369.1|  polygalacturonase                                       120   2e-31   
gb|AIU50414.1|  pectin lyase-like superfamily protein                   124   2e-31   
gb|KDP25309.1|  hypothetical protein JCGZ_20465                         124   2e-31   
emb|CDP12145.1|  unnamed protein product                                124   2e-31   
ref|XP_010055093.1|  PREDICTED: probable polygalacturonase              124   3e-31   
gb|AIU50409.1|  pectin lyase-like superfamily protein                   124   3e-31   
ref|XP_001755533.1|  predicted protein                                  123   3e-31   
ref|XP_003545367.1|  PREDICTED: probable polygalacturonase              124   3e-31   
ref|XP_007146299.1|  hypothetical protein PHAVU_006G028800g             124   3e-31   
gb|AIU50446.1|  pectin lyase-like superfamily protein                   123   4e-31   
gb|AIU50404.1|  pectin lyase-like superfamily protein                   123   4e-31   
gb|AIU50435.1|  pectin lyase-like superfamily protein                   123   4e-31   
gb|AIU50427.1|  pectin lyase-like superfamily protein                   123   5e-31   
ref|XP_009404468.1|  PREDICTED: probable polygalacturonase              123   5e-31   
ref|XP_010266478.1|  PREDICTED: probable polygalacturonase              123   5e-31   
ref|XP_002509949.1|  Polygalacturonase precursor, putative              123   6e-31   
ref|XP_009413832.1|  PREDICTED: probable polygalacturonase              123   6e-31   
gb|EYU40022.1|  hypothetical protein MIMGU_mgv1a006305mg                123   7e-31   
gb|EMS54613.1|  putative polygalacturonase                              123   7e-31   
gb|AIU50451.1|  pectin lyase-like superfamily protein                   122   7e-31   
gb|EMT19370.1|  Putative polygalacturonase                              123   7e-31   
gb|KHG15709.1|  hypothetical protein F383_10492                         123   8e-31   
gb|AIU50403.1|  pectin lyase-like superfamily protein                   122   8e-31   
gb|AIU50399.1|  pectin lyase-like superfamily protein                   122   8e-31   
gb|KHG15710.1|  hypothetical protein F383_10492                         122   8e-31   
gb|AIU50400.1|  pectin lyase-like superfamily protein                   122   8e-31   
gb|AIU50450.1|  pectin lyase-like superfamily protein                   122   8e-31   
gb|AIU50442.1|  pectin lyase-like superfamily protein                   122   9e-31   
ref|NP_194113.1|  glycoside hydrolase family 28 protein / polygal...    122   9e-31   
ref|XP_002867688.1|  glycoside hydrolase family 28 protein              122   1e-30   
ref|XP_010659126.1|  PREDICTED: probable polygalacturonase              122   1e-30   
ref|XP_009137393.1|  PREDICTED: probable polygalacturonase              122   1e-30   
emb|CDY10970.1|  BnaA03g46290D                                          122   1e-30   
ref|XP_009380525.1|  PREDICTED: probable polygalacturonase              122   1e-30   
ref|XP_010541559.1|  PREDICTED: probable polygalacturonase isofor...    122   1e-30   
ref|XP_010090841.1|  putative polygalacturonase                         123   1e-30   
gb|ACC91250.1|  glycoside hydrolase family 28 protein                   122   1e-30   
ref|XP_004298894.1|  PREDICTED: probable polygalacturonase-like         122   1e-30   
gb|AIU50397.1|  pectin lyase-like superfamily protein                   122   1e-30   
gb|KHN14635.1|  Putative polygalacturonase                              121   1e-30   
ref|XP_004491304.1|  PREDICTED: probable polygalacturonase-like         122   2e-30   
gb|AIU50417.1|  pectin lyase-like superfamily protein                   121   2e-30   
ref|XP_002960960.1|  hypothetical protein SELMODRAFT_33152              121   2e-30   
gb|AIU50424.1|  pectin lyase-like superfamily protein                   121   2e-30   
ref|XP_006837459.1|  hypothetical protein AMTR_s00107p00122980          121   2e-30   
emb|CDX94222.1|  BnaC07g38560D                                          121   2e-30   
ref|XP_004961056.1|  PREDICTED: probable polygalacturonase-like         121   2e-30   
ref|XP_010261531.1|  PREDICTED: probable polygalacturonase              121   2e-30   
ref|XP_011022938.1|  PREDICTED: probable polygalacturonase              121   2e-30   
gb|AIU50425.1|  pectin lyase-like superfamily protein                   121   2e-30   
ref|XP_008790157.1|  PREDICTED: probable polygalacturonase              121   2e-30   
gb|AIU50418.1|  pectin lyase-like superfamily protein                   121   3e-30   
ref|XP_003617307.1|  Glycoside hydrolase family 28 protein              121   3e-30   
gb|AIN44009.1|  polygalacturonase-like protein                          121   3e-30   
ref|XP_007051732.1|  Polygalacturonase, putative isoform 2              121   3e-30   
ref|XP_007051731.1|  Polygalacturonase, putative isoform 1              121   3e-30   
gb|AIU50423.1|  pectin lyase-like superfamily protein                   120   3e-30   
ref|XP_002967047.1|  hypothetical protein SELMODRAFT_408393             121   3e-30   
ref|XP_002310517.2|  glycoside hydrolase family 28 family protein       121   3e-30   
ref|XP_002441600.1|  hypothetical protein SORBIDRAFT_09g030140          120   3e-30   
gb|AIU50433.1|  pectin lyase-like superfamily protein                   120   4e-30   
ref|XP_010913844.1|  PREDICTED: probable polygalacturonase isofor...    120   4e-30   
ref|XP_007141479.1|  hypothetical protein PHAVU_008G199400g             120   4e-30   
gb|AFW81284.1|  hypothetical protein ZEAMMB73_960645                    120   4e-30   
ref|NP_001149385.1|  LOC100283011 precursor                             120   4e-30   
ref|XP_002962842.1|  hypothetical protein SELMODRAFT_78556              120   5e-30   
ref|XP_002989426.1|  hypothetical protein SELMODRAFT_129742             120   5e-30   
ref|XP_002437680.1|  hypothetical protein SORBIDRAFT_10g000660          120   5e-30   
ref|XP_010533998.1|  PREDICTED: probable polygalacturonase              118   6e-30   
gb|AIU50434.1|  pectin lyase-like superfamily protein                   118   6e-30   
ref|XP_010913831.1|  PREDICTED: probable polygalacturonase isofor...    120   6e-30   
gb|KHG21610.1|  putative polygalacturonase                              120   6e-30   
gb|KHG27846.1|  putative polygalacturonase                              120   6e-30   
gb|KHN12010.1|  Putative polygalacturonase                              120   6e-30   
gb|AIU50401.1|  pectin lyase-like superfamily protein                   120   6e-30   
gb|ABG34278.1|  polygalacturonase                                       119   7e-30   
gb|AIU50410.1|  pectin lyase-like superfamily protein                   119   7e-30   
gb|KFK28938.1|  hypothetical protein AALP_AA7G068200                    120   8e-30   
gb|AIU50415.1|  pectin lyase-like superfamily protein                   119   8e-30   
ref|XP_009396562.1|  PREDICTED: probable polygalacturonase              120   8e-30   
gb|EYU35105.1|  hypothetical protein MIMGU_mgv1a005694mg                120   8e-30   
gb|AIU50420.1|  pectin lyase-like superfamily protein                   119   8e-30   
ref|XP_001775589.1|  predicted protein                                  120   9e-30   
ref|XP_010439131.1|  PREDICTED: probable polygalacturonase              119   9e-30   
gb|AIU50416.1|  pectin lyase-like superfamily protein                   119   9e-30   
ref|XP_009395761.1|  PREDICTED: probable polygalacturonase              119   1e-29   
ref|XP_010433858.1|  PREDICTED: probable polygalacturonase              119   1e-29   
ref|XP_006283738.1|  hypothetical protein CARUB_v10004811mg             119   1e-29   
ref|XP_004964293.1|  PREDICTED: probable polygalacturonase-like i...    119   1e-29   
gb|AIU50411.1|  pectin lyase-like superfamily protein                   119   1e-29   
ref|XP_004964294.1|  PREDICTED: probable polygalacturonase-like i...    119   1e-29   
ref|XP_009389852.1|  PREDICTED: probable polygalacturonase              119   1e-29   
ref|XP_008660018.1|  PREDICTED: probable polygalacturonase              118   1e-29   
gb|AIU50402.1|  pectin lyase-like superfamily protein                   119   1e-29   
ref|XP_010448653.1|  PREDICTED: probable polygalacturonase              119   1e-29   
ref|XP_003552411.1|  PREDICTED: probable polygalacturonase              119   1e-29   
ref|XP_004964295.1|  PREDICTED: probable polygalacturonase-like i...    119   1e-29   
ref|XP_006491165.1|  PREDICTED: probable polygalacturonase-like         119   1e-29   
gb|KHG13059.1|  putative polygalacturonase                              119   1e-29   
gb|KHG11864.1|  putative polygalacturonase                              119   1e-29   
ref|XP_008343414.1|  PREDICTED: probable polygalacturonase              119   2e-29   
gb|ACG41831.1|  glycoside hydrolase, family 28                          119   2e-29   
ref|XP_010925748.1|  PREDICTED: probable polygalacturonase              119   2e-29   
ref|XP_008810829.1|  PREDICTED: probable polygalacturonase              119   2e-29   
emb|CDP04683.1|  unnamed protein product                                119   2e-29   
gb|AFW75224.1|  glycoside hydrolase, family 28                          119   2e-29   
ref|XP_004172137.1|  PREDICTED: probable polygalacturonase-like         119   2e-29   
ref|XP_004133855.1|  PREDICTED: probable polygalacturonase-like         119   2e-29   
ref|XP_006444979.1|  hypothetical protein CICLE_v10019597mg             119   2e-29   
ref|NP_001151164.1|  glycoside hydrolase, family 28 precursor           119   2e-29   
gb|ACL54166.1|  unknown                                                 119   2e-29   
ref|XP_009349812.1|  PREDICTED: probable polygalacturonase              119   2e-29   
ref|XP_007212026.1|  hypothetical protein PRUPE_ppa005015mg             119   2e-29   
ref|XP_010255225.1|  PREDICTED: probable polygalacturonase isofor...    119   2e-29   
emb|CDY03516.1|  BnaC01g15660D                                          118   2e-29   
gb|AIU50406.1|  pectin lyase-like superfamily protein                   117   2e-29   
emb|CDY47619.1|  BnaA01g13460D                                          118   2e-29   
ref|XP_009137402.1|  PREDICTED: probable polygalacturonase              118   2e-29   
gb|KDP42567.1|  hypothetical protein JCGZ_24341                         119   2e-29   
gb|KDP28587.1|  hypothetical protein JCGZ_14358                         118   3e-29   
gb|AIU50430.1|  pectin lyase-like superfamily protein                   118   3e-29   
ref|XP_010255224.1|  PREDICTED: probable polygalacturonase isofor...    118   3e-29   
ref|XP_002304552.2|  glycoside hydrolase family 28 family protein       118   3e-29   
ref|XP_010255223.1|  PREDICTED: probable polygalacturonase isofor...    118   3e-29   
ref|XP_007219266.1|  hypothetical protein PRUPE_ppa018224mg             118   3e-29   
ref|XP_003533597.1|  PREDICTED: probable polygalacturonase-like         118   3e-29   
ref|XP_011022514.1|  PREDICTED: probable polygalacturonase              118   3e-29   
ref|XP_009624373.1|  PREDICTED: probable polygalacturonase              118   4e-29   
ref|XP_007139799.1|  hypothetical protein PHAVU_008G059700g             118   4e-29   
ref|XP_009345122.1|  PREDICTED: probable polygalacturonase              118   4e-29   
gb|AIU50422.1|  pectin lyase-like superfamily protein                   117   4e-29   
ref|XP_004306749.1|  PREDICTED: probable polygalacturonase-like         118   4e-29   
ref|XP_008227649.1|  PREDICTED: probable polygalacturonase              118   4e-29   
ref|XP_004492778.1|  PREDICTED: probable polygalacturonase-like         118   5e-29   
ref|XP_010053221.1|  PREDICTED: probable polygalacturonase              117   5e-29   
ref|XP_009599786.1|  PREDICTED: probable polygalacturonase isofor...    117   5e-29   
ref|XP_009363435.1|  PREDICTED: probable polygalacturonase              117   5e-29   
ref|XP_006656549.1|  PREDICTED: probable polygalacturonase-like         117   5e-29   
gb|AIU50436.1|  pectin lyase-like superfamily protein                   117   5e-29   
gb|KHN26935.1|  Putative polygalacturonase                              117   5e-29   
ref|XP_008232996.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    117   6e-29   
gb|EPS58839.1|  hypothetical protein M569_15974                         112   6e-29   
ref|XP_006829063.1|  hypothetical protein AMTR_s00001p00258260          117   6e-29   
ref|XP_004972433.1|  PREDICTED: probable polygalacturonase-like         117   6e-29   
ref|XP_002299511.1|  hypothetical protein POPTR_0001s09790g             117   6e-29   
ref|XP_009599780.1|  PREDICTED: probable polygalacturonase isofor...    117   6e-29   
ref|XP_008438007.1|  PREDICTED: probable polygalacturonase              117   6e-29   
ref|XP_004510753.1|  PREDICTED: probable polygalacturonase-like         117   6e-29   
gb|KDP25392.1|  hypothetical protein JCGZ_20548                         117   7e-29   
ref|XP_004147365.1|  PREDICTED: probable polygalacturonase-like         117   7e-29   
ref|XP_004173333.1|  PREDICTED: probable polygalacturonase-like         116   7e-29   
gb|ABR18040.1|  unknown                                                 117   7e-29   
ref|XP_010089056.1|  putative polygalacturonase                         117   7e-29   
ref|XP_010112958.1|  putative polygalacturonase                         117   8e-29   
ref|XP_003529926.1|  PREDICTED: probable polygalacturonase-like         117   8e-29   
ref|XP_008810903.1|  PREDICTED: probable polygalacturonase              117   9e-29   
gb|AIU50448.1|  pectin lyase-like superfamily protein                   116   9e-29   
ref|XP_011029346.1|  PREDICTED: probable polygalacturonase              117   9e-29   
ref|XP_006339619.1|  PREDICTED: probable polygalacturonase-like         117   1e-28   
gb|EPS61079.1|  hypothetical protein M569_13719                         116   1e-28   
ref|XP_006581769.1|  PREDICTED: probable polygalacturonase-like i...    116   1e-28   
gb|AAP33475.1|  polygalacturonase-like protein                          117   1e-28   
gb|AFK37962.1|  unknown                                                 116   1e-28   
ref|XP_008794781.1|  PREDICTED: probable polygalacturonase isofor...    116   1e-28   
gb|AFK44529.1|  unknown                                                 116   1e-28   
ref|XP_011031186.1|  PREDICTED: probable polygalacturonase              117   1e-28   
ref|XP_008460889.1|  PREDICTED: probable polygalacturonase              117   1e-28   
gb|AIU50447.1|  pectin lyase-like superfamily protein                   116   1e-28   
ref|XP_008794779.1|  PREDICTED: probable polygalacturonase isofor...    116   1e-28   
ref|XP_008794778.1|  PREDICTED: probable polygalacturonase isofor...    116   1e-28   



>emb|CDP17099.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WWE+F+ H LNYSRPHLVEF+ S+ VVISNLTFLNAPAWNIRPAYCS
Sbjct  157  TGNNGTIDGQGSIWWEKFNSHLLNYSRPHLVEFVGSNDVVISNLTFLNAPAWNIRPAYCS  216

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NVLVQNITVHSP +SPYT+GIVPDSS HVCIENSNISMG
Sbjct  217  NVLVQNITVHSPPESPYTSGIVPDSSEHVCIENSNISMG  255



>ref|XP_009784607.1| PREDICTED: probable polygalacturonase isoform X1 [Nicotiana sylvestris]
Length=455

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WWEQF  H+LNY+RPHLVEF+SS  VV+SNLTFLNAPAWNI P YCS
Sbjct  150  TGNNGTIDGQGSIWWEQFSAHSLNYTRPHLVEFVSSKDVVVSNLTFLNAPAWNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV+VQNITVHSP+ SPYT GIVPDSS HVCIENSNISMG
Sbjct  210  NVVVQNITVHSPANSPYTYGIVPDSSEHVCIENSNISMG  248



>ref|XP_009784614.1| PREDICTED: probable polygalacturonase isoform X2 [Nicotiana sylvestris]
Length=439

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WWEQF  H+LNY+RPHLVEF+SS  VV+SNLTFLNAPAWNI P YCS
Sbjct  134  TGNNGTIDGQGSIWWEQFSAHSLNYTRPHLVEFVSSKDVVVSNLTFLNAPAWNIHPVYCS  193

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV+VQNITVHSP+ SPYT GIVPDSS HVCIENSNISMG
Sbjct  194  NVVVQNITVHSPANSPYTYGIVPDSSEHVCIENSNISMG  232



>ref|XP_004247394.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=480

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WWE+F+ H+LNY+RPHLVEF+SSS+VVISNLT LNAP WNIRPAYCS
Sbjct  178  TGNNGTIDGQGSIWWEKFNSHSLNYTRPHLVEFVSSSNVVISNLTLLNAPGWNIRPAYCS  237

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV++QN+TV++P  SP+TNGIVPDSS HVCIENSNISMG
Sbjct  238  NVVIQNLTVYTPQDSPFTNGIVPDSSEHVCIENSNISMG  276



>ref|NP_001274800.1| probable polygalacturonase-like [Solanum tuberosum]
 gb|ABB55373.1| polygalacturonase-like protein-like [Solanum tuberosum]
Length=479

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WWE+F+ H+LNY+RPHLVEF+SS +VVISNLT LNAP WNIRPAYCS
Sbjct  177  TGNNGTIDGQGSIWWEKFNSHSLNYTRPHLVEFVSSRNVVISNLTLLNAPGWNIRPAYCS  236

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV++QN+TV++P  SP+TNGIVPDSS HVCIENSNISMG
Sbjct  237  NVVIQNLTVYTPQDSPFTNGIVPDSSEHVCIENSNISMG  275



>ref|XP_009624281.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=455

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG+VWWEQF  H+LNY+RPHLVEF+SS  VV+SNLTFLNAPAWN+   YCS
Sbjct  150  TGNNGTIDGQGSVWWEQFSAHSLNYTRPHLVEFVSSKDVVVSNLTFLNAPAWNVHLVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV+VQNITVHSPS SPYT GIVPDSS HVCIENSNISMG
Sbjct  210  NVVVQNITVHSPSNSPYTCGIVPDSSEHVCIENSNISMG  248



>ref|XP_006355845.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=457

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGT+DGQG++WWEQF  H+LNY+RPHLVEF+SS  VV+SNLTFLNAPAWNI P YCS
Sbjct  150  TGNNGTVDGQGSIWWEQFTAHSLNYTRPHLVEFVSSKDVVVSNLTFLNAPAWNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV+VQNI+VHSP+ SPYT G+VPDSS HVCIENSNISMG
Sbjct  210  NVVVQNISVHSPANSPYTYGVVPDSSEHVCIENSNISMG  248



>ref|XP_009793676.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=462

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW+ F+ H+LNY+RPHLVEF+SS  VVISNLT LNAP WNIRPAYCS
Sbjct  156  TGNNGTIDGQGSIWWDMFNSHSLNYTRPHLVEFVSSKDVVISNLTLLNAPGWNIRPAYCS  215

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV++QN+TVHSP  SPYTNGIVPDSS HVCIENSNI++G
Sbjct  216  NVVIQNLTVHSPQDSPYTNGIVPDSSEHVCIENSNITIG  254



>ref|XP_009624502.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=603

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WWE F+ H+LNY+RPHLVEF+SS +VVISNLT LNAP WNIRPAYCS
Sbjct  297  TGNNGTIDGQGSIWWEMFNSHSLNYTRPHLVEFVSSKNVVISNLTLLNAPGWNIRPAYCS  356

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV++QN+TVHSP  SPYTNGIVPDSS HVCIENSNI++G
Sbjct  357  NVIIQNLTVHSPRDSPYTNGIVPDSSEHVCIENSNITIG  395



>ref|XP_004240577.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=457

 Score =   174 bits (442),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGT+DGQG++WWEQF  H+LNY+RPHLVEF+SS  VV+SNLTFLNAPAWNI P YCS
Sbjct  150  TGNNGTVDGQGSIWWEQFTAHSLNYTRPHLVEFVSSKDVVVSNLTFLNAPAWNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV+VQNI+VHSP+ SPYT G+VPDSS HVCIE SNISMG
Sbjct  210  NVVVQNISVHSPANSPYTYGVVPDSSEHVCIETSNISMG  248



>ref|XP_011079616.1| PREDICTED: probable polygalacturonase isoform X2 [Sesamum indicum]
Length=451

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG+VWWEQ + H+LNYSRPHLVEF+ S ++V+SNLTFLNAPAWNI P YCS
Sbjct  145  TGNNGTIDGQGSVWWEQLNAHSLNYSRPHLVEFVGSDNIVVSNLTFLNAPAWNIHPVYCS  204

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
              LVQNITV SP  SPYT+GIVPDSS+HVCIENSNISMG
Sbjct  205  KFLVQNITVQSPPTSPYTSGIVPDSSDHVCIENSNISMG  243



>ref|XP_011079615.1| PREDICTED: probable polygalacturonase isoform X1 [Sesamum indicum]
Length=451

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG+VWWEQ + H+LNYSRPHLVEF+ S ++V+SNLTFLNAPAWNI P YCS
Sbjct  145  TGNNGTIDGQGSVWWEQLNAHSLNYSRPHLVEFVGSDNIVVSNLTFLNAPAWNIHPVYCS  204

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
              LVQNITV SP  SPYT+GIVPDSS+HVCIENSNISMG
Sbjct  205  KFLVQNITVQSPPTSPYTSGIVPDSSDHVCIENSNISMG  243



>gb|EYU46764.1| hypothetical protein MIMGU_mgv1a0060621mg, partial [Erythranthe 
guttata]
Length=318

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG+VWWE+   H+LNYSRPHLVE + S ++VISNLTFLNAPA NI P YCS
Sbjct  11   TGNNGTIDGQGSVWWEKLSAHSLNYSRPHLVELVWSVNIVISNLTFLNAPASNIHPVYCS  70

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             +LVQNIT++SP +SPYT+GIVPDSS HVCIENSNISMG
Sbjct  71   KLLVQNITIYSPPESPYTSGIVPDSSEHVCIENSNISMG  109



>ref|XP_011082629.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=451

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW+Q + H+LN SRPHLVEFI S  VVISNLTFLNAP W+I P YCS
Sbjct  196  TGNNGTIDGQGSIWWDQMNAHSLNNSRPHLVEFIGSDTVVISNLTFLNAPGWSIHPVYCS  255

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            ++LVQNITV+SP  SPYT+GIVPDSS HVCIENSNIS G
Sbjct  256  DLLVQNITVYSPPDSPYTSGIVPDSSEHVCIENSNISTG  294



>ref|XP_010652214.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=456

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG+VWWE F  H+LNYSRPH+VEFISS+ ++ISNLTFLN+PAWNI P YCS
Sbjct  150  TGNNGTIDGQGSVWWENFSSHSLNYSRPHIVEFISSNDIIISNLTFLNSPAWNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV VQNIT ++P +SP T+G+VPDSS ++CIE+SNISMG
Sbjct  210  NVWVQNITAYAPPESPRTSGVVPDSSEYICIEDSNISMG  248



>emb|CBI36899.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG+VWWE F  H+LNYSRPH+VEFISS+ ++ISNLTFLN+PAWNI P YCS
Sbjct  171  TGNNGTIDGQGSVWWENFSSHSLNYSRPHIVEFISSNDIIISNLTFLNSPAWNIHPVYCS  230

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV VQNIT ++P +SP T+G+VPDSS ++CIE+SNISMG
Sbjct  231  NVWVQNITAYAPPESPRTSGVVPDSSEYICIEDSNISMG  269



>ref|XP_006380233.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|ERP58030.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=450

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW+ F+ H+LNYSRPHLVEF SS +VV+SNLTFLNAPA++I P YCS
Sbjct  150  TGDNGTIDGQGSVWWDWFESHSLNYSRPHLVEFTSSDYVVVSNLTFLNAPAYSIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV+VQNI+V +P +SPYT GIVPDSSN+VCIE+S I +G
Sbjct  210  NVVVQNISVSAPGESPYTTGIVPDSSNNVCIEDSRIEVG  248



>ref|XP_010259446.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
 ref|XP_010259447.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=458

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WWE F+ H+LNYSRPHLVEFI  + V++SN+TFLN+PAW+I P YCS
Sbjct  150  TGDNGTIDGQGSIWWEWFNSHSLNYSRPHLVEFIGCNDVIVSNITFLNSPAWSIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV VQNIT+H+P +SPYT+GIVPDSS++VCIE+ NIS+G
Sbjct  210  NVQVQNITIHAPPESPYTSGIVPDSSDNVCIEDCNISVG  248



>ref|XP_011007067.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=453

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW+ F+ H+LNYSRPHLVEF SS HVV+SNLTFLNAPA+NI P YCS
Sbjct  148  TGDNGTIDGQGSVWWDWFESHSLNYSRPHLVEFTSSDHVVVSNLTFLNAPAYNIHPVYCS  207

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NVLVQNI+V +P +SPYT GIV DSSN+VCIE+S I +G
Sbjct  208  NVLVQNISVSAPGESPYTIGIVSDSSNNVCIEDSLIKVG  246



>ref|XP_010245458.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=462

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WWE F+ H+LNYSRPHLVEFI  ++VV+SN+TFLN+PAW+I P YCS
Sbjct  153  TGDNGTIDGQGSIWWEWFNSHSLNYSRPHLVEFIGCNNVVVSNITFLNSPAWSIHPVYCS  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV VQNITVH+P +SPYT+GIVPDSS+++CIE+ NI++G
Sbjct  213  NVQVQNITVHAPPESPYTSGIVPDSSDNICIEDCNINVG  251



>ref|XP_002314352.2| hypothetical protein POPTR_0010s00770g [Populus trichocarpa]
 gb|EEF00523.2| hypothetical protein POPTR_0010s00770g [Populus trichocarpa]
Length=453

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW+ F+ H+LNYSRPHLVEF SS  VV+SNLTFLNAPA+NI P YCS
Sbjct  148  TGDNGTIDGQGSVWWDWFESHSLNYSRPHLVEFTSSDLVVVSNLTFLNAPAYNIHPVYCS  207

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NVLVQNI+V +P +SPYT GIVPDSSN+VCIE+S I +G
Sbjct  208  NVLVQNISVSAPGESPYTIGIVPDSSNNVCIEDSLIKVG  246



>ref|XP_011011881.1| PREDICTED: probable polygalacturonase isoform X2 [Populus euphratica]
Length=424

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW+ F+ H+LNYSRPHLVEF SS +VV+SNLTFLNAPA++I P YCS
Sbjct  124  TGDNGTIDGQGSVWWDWFESHSLNYSRPHLVEFTSSDYVVVSNLTFLNAPAYSIHPVYCS  183

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV+VQNI+V +P +SPYT GIVPDSSN+VCIE+S I +G
Sbjct  184  NVVVQNISVSAPGESPYTIGIVPDSSNNVCIEDSRIEVG  222



>ref|XP_010245459.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=458

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WWE F+ H+LNYSRPHLVEFI  ++VV+SN+TFLN+PAW+I P YCS
Sbjct  149  TGDNGTIDGQGSIWWEWFNSHSLNYSRPHLVEFIGCNNVVVSNITFLNSPAWSIHPVYCS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV VQNITVH+P +SPYT+GIVPDSS+++CIE+ NI++G
Sbjct  209  NVQVQNITVHAPPESPYTSGIVPDSSDNICIEDCNINVG  247



>ref|XP_011011880.1| PREDICTED: probable polygalacturonase isoform X1 [Populus euphratica]
Length=450

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW+ F+ H+LNYSRPHLVEF SS +VV+SNLTFLNAPA++I P YCS
Sbjct  150  TGDNGTIDGQGSVWWDWFESHSLNYSRPHLVEFTSSDYVVVSNLTFLNAPAYSIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV+VQNI+V +P +SPYT GIVPDSSN+VCIE+S I +G
Sbjct  210  NVVVQNISVSAPGESPYTIGIVPDSSNNVCIEDSRIEVG  248



>gb|KDP27854.1| hypothetical protein JCGZ_18934 [Jatropha curcas]
Length=453

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW+ F+ H+LNYSRPH+VEFI S  VV+SNLTFLNAPA+NI P YCS
Sbjct  148  TGDNGTIDGQGSVWWDWFNSHSLNYSRPHIVEFIESERVVVSNLTFLNAPAYNIHPVYCS  207

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NVLVQN+++ +P +SPYT GIVPDSSN+VCIE+S I MG
Sbjct  208  NVLVQNMSISAPPESPYTIGIVPDSSNNVCIEDSIIEMG  246



>ref|XP_009378739.1| PREDICTED: probable polygalacturonase isoform X2 [Pyrus x bretschneideri]
Length=453

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWWEQF  HALNYSRPHLVEF    +V +SNLT LN+PAW+I P YC 
Sbjct  149  TGDNGTIDGQGFVWWEQFSYHALNYSRPHLVEFTRCENVTVSNLTLLNSPAWHIHPTYCR  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NIT+H+   SPYTNGIVPDSS HVCIEN NISMG
Sbjct  209  NVQVLNITLHASPASPYTNGIVPDSSEHVCIENCNISMG  247



>ref|XP_009378738.1| PREDICTED: probable polygalacturonase isoform X1 [Pyrus x bretschneideri]
Length=465

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWWEQF  HALNYSRPHLVEF    +V +SNLT LN+PAW+I P YC 
Sbjct  161  TGDNGTIDGQGFVWWEQFSYHALNYSRPHLVEFTRCENVTVSNLTLLNSPAWHIHPTYCR  220

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NIT+H+   SPYTNGIVPDSS HVCIEN NISMG
Sbjct  221  NVQVLNITLHASPASPYTNGIVPDSSEHVCIENCNISMG  259



>ref|XP_010670927.1| PREDICTED: probable polygalacturonase [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG+ WW+ F  H LN+SRPHLVE + S  VV+SNLTFLNAPA+NI P YCS
Sbjct  150  TGNNGTIDGQGSFWWDSFRSHTLNHSRPHLVEIVESLGVVVSNLTFLNAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +VLVQNI+ ++PS SPYT G+VPDSS+H+CIEN NISMG
Sbjct  210  HVLVQNISAYAPSSSPYTIGVVPDSSDHMCIENCNISMG  248



>gb|ACU20798.1| unknown [Glycine max]
Length=186

 Score =   149 bits (375),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NG IDGQG+VWW+    H+LNYSRPH++E + S +++ISNLTFLN+PAW+I P YCS
Sbjct  33   TGDNGIIDGQGSVWWDLISTHSLNYSRPHIIELVGSDNIIISNLTFLNSPAWSIHPVYCS  92

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            N+ +Q ITV +P+K PYT+GIVPDSS HVCI+N NIS G
Sbjct  93   NIQIQKITVQAPTKFPYTSGIVPDSSEHVCIDNCNISTG  131



>gb|KDO71782.1| hypothetical protein CISIN_1g012788mg [Citrus sinensis]
Length=456

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW+ F   +LNYSRPHLVEFISS +VV+SNLTFLNAPA+NI P YCS
Sbjct  150  TGDNGTIDGQGSVWWDWFSSQSLNYSRPHLVEFISSENVVVSNLTFLNAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNI+VH+P +SPYT GIVPDSS++VCIE+  I+MG
Sbjct  210  NVHIQNISVHAPPESPYTVGIVPDSSDNVCIEDCIIAMG  248



>gb|EPS59056.1| hypothetical protein M569_15754, partial [Genlisea aurea]
Length=288

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            +GNNGTIDGQG VWWE+   H+LNYSRP LVE ISS ++V+SNLTFLNAPAWNI P YC 
Sbjct  2    SGNNGTIDGQGWVWWEKLYAHSLNYSRPDLVELISSDNIVVSNLTFLNAPAWNIHPVYCR  61

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             +LVQNITV++P  SP T+GIVPDSS +VCIE  N+S G
Sbjct  62   KILVQNITVYAPPDSPKTSGIVPDSSEYVCIERCNVSTG  100



>ref|XP_006419481.1| hypothetical protein CICLE_v10004942mg [Citrus clementina]
 ref|XP_006419482.1| hypothetical protein CICLE_v10004942mg [Citrus clementina]
 ref|XP_006489018.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
 gb|ESR32721.1| hypothetical protein CICLE_v10004942mg [Citrus clementina]
 gb|ESR32722.1| hypothetical protein CICLE_v10004942mg [Citrus clementina]
Length=456

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW+ F   +LNYSRPHLVEFISS +VV+SNLTFLNAPA+NI P YCS
Sbjct  150  TGDNGTIDGQGSVWWDWFSSQSLNYSRPHLVEFISSENVVVSNLTFLNAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNI+VH+P +SPYT GIVPDSS++VCIE+  I+MG
Sbjct  210  NVHIQNISVHAPPESPYTVGIVPDSSDNVCIEDCIIAMG  248



>ref|XP_007201026.1| hypothetical protein PRUPE_ppa006130mg [Prunus persica]
 gb|EMJ02225.1| hypothetical protein PRUPE_ppa006130mg [Prunus persica]
Length=426

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWWEQF  HALNYSRPHLVEF    +V ISNLT LN+PAWNI PAYC 
Sbjct  120  TGDNGTIDGQGSVWWEQFSSHALNYSRPHLVEFTGCDNVTISNLTLLNSPAWNIHPAYCR  179

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
             V V NITVH+   SPYT+GIVPDSS +VCIEN NISM
Sbjct  180  YVQVLNITVHASPASPYTSGIVPDSSENVCIENCNISM  217



>ref|XP_002516982.1| Polygalacturonase, putative [Ricinus communis]
 gb|EEF45596.1| Polygalacturonase, putative [Ricinus communis]
Length=454

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW+ F+ H+LNYSRPHLVEFI S  +V+SNLTFLNAPA+NI P YCS
Sbjct  148  TGDNGTIDGQGSVWWDWFNSHSLNYSRPHLVEFIESERIVVSNLTFLNAPAYNIHPVYCS  207

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NVLVQN+++ +P +SP T GIVPDSSN+VCIE S I MG
Sbjct  208  NVLVQNMSLSAPPESPQTIGIVPDSSNNVCIEESIIKMG  246



>ref|XP_007145183.1| hypothetical protein PHAVU_007G217500g [Phaseolus vulgaris]
 gb|ESW17177.1| hypothetical protein PHAVU_007G217500g [Phaseolus vulgaris]
Length=453

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NG IDGQG+VWW+    H+LNYSRPH++E + S ++VISNLTFLN+PAW+I P YCS
Sbjct  147  TGDNGIIDGQGSVWWDLIRTHSLNYSRPHIIELVGSDNIVISNLTFLNSPAWSIHPVYCS  206

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNIT H+P++ PYT+GIVPDSS+HVCI+NSNIS G
Sbjct  207  NVRIQNITAHAPTEFPYTSGIVPDSSDHVCIDNSNISTG  245



>ref|XP_009346609.1| PREDICTED: probable polygalacturonase isoform X1 [Pyrus x bretschneideri]
 ref|XP_009346611.1| PREDICTED: probable polygalacturonase isoform X1 [Pyrus x bretschneideri]
 ref|XP_009346613.1| PREDICTED: probable polygalacturonase isoform X1 [Pyrus x bretschneideri]
 ref|XP_009346614.1| PREDICTED: probable polygalacturonase isoform X1 [Pyrus x bretschneideri]
Length=454

 Score =   153 bits (386),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWWEQF  HALNYSRPHLVEF    +V +SNLT LN+PAW+I P YCS
Sbjct  150  TGDNGTIDGQGSVWWEQFSYHALNYSRPHLVEFTGCENVTVSNLTLLNSPAWHIHPTYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            N+ V NIT+H+   SPYT+GIVPDSS +VCIEN NISMG
Sbjct  210  NMQVLNITLHAFHASPYTSGIVPDSSENVCIENCNISMG  248



>ref|XP_009346610.1| PREDICTED: probable polygalacturonase isoform X2 [Pyrus x bretschneideri]
Length=454

 Score =   153 bits (386),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWWEQF  HALNYSRPHLVEF    +V +SNLT LN+PAW+I P YCS
Sbjct  150  TGDNGTIDGQGSVWWEQFSYHALNYSRPHLVEFTGCENVTVSNLTLLNSPAWHIHPTYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            N+ V NIT+H+   SPYT+GIVPDSS +VCIEN NISMG
Sbjct  210  NMQVLNITLHAFHASPYTSGIVPDSSENVCIENCNISMG  248



>ref|XP_002273305.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
 ref|XP_010649564.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=457

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG+VWW+ F  H+LNYSRPHLVEF++S++VV+SNLTFLNAPA+NI P YCS
Sbjct  150  TGDNGTINGQGSVWWDWFTSHSLNYSRPHLVEFLASTNVVVSNLTFLNAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV VQNI+V++P +SPYT GIVPDSS+  CIE+ +I+MG
Sbjct  210  NVRVQNISVYAPPESPYTVGIVPDSSDSTCIEDCSIAMG  248



>ref|XP_007163149.1| hypothetical protein PHAVU_001G210300g [Phaseolus vulgaris]
 gb|ESW35143.1| hypothetical protein PHAVU_001G210300g [Phaseolus vulgaris]
Length=406

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG++WW  F  H+LNYSRP+LVEF+ S  V+ISNLTF++APAW I P YCS
Sbjct  94   TGDNGTINGQGSIWWTLFSSHSLNYSRPNLVEFVDSVDVIISNLTFVDAPAWGIHPVYCS  153

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNIT  +P +SPYT+GIVPDSS +VCIENSNIS G
Sbjct  154  NVQIQNITSRAPPESPYTSGIVPDSSKYVCIENSNISTG  192



>ref|XP_008386709.1| PREDICTED: probable polygalacturonase [Malus domestica]
 ref|XP_008359428.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=454

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWWEQF  HALNYSRPHLVEF    +V +SNLT LN+PAW+I P YCS
Sbjct  150  TGDNGTIDGQGSVWWEQFSYHALNYSRPHLVEFTGCENVTVSNLTLLNSPAWHIHPTYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NIT+H+   SPYT+GIVPDSS +VCIEN NIS+G
Sbjct  210  NVQVLNITLHAFHASPYTSGIVPDSSENVCIENCNISVG  248



>ref|XP_008345224.1| PREDICTED: probable polygalacturonase isoform X2 [Malus domestica]
Length=453

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWWEQF  HALNYSRPHLVEF    +V +SNLT LN+PAW+I P YC 
Sbjct  149  TGDNGTIDGQGFVWWEQFSYHALNYSRPHLVEFTRCENVTVSNLTLLNSPAWHIHPTYCR  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NIT+H+   SP T+G+VPDSS HVCIEN NISMG
Sbjct  209  NVQVLNITLHASPASPXTSGVVPDSSEHVCIENCNISMG  247



>emb|CBI22951.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG+VWW+ F  H+LNYSRPHLVEF++S++VV+SNLTFLNAPA+NI P YCS
Sbjct  148  TGDNGTINGQGSVWWDWFTSHSLNYSRPHLVEFLASTNVVVSNLTFLNAPAYNIHPVYCS  207

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV VQNI+V++P +SPYT GIVPDSS+  CIE+ +I+MG
Sbjct  208  NVRVQNISVYAPPESPYTVGIVPDSSDSTCIEDCSIAMG  246



>ref|XP_004508182.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=461

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDG G  WWE F  H+LNYSRPHLVEF++S+ VV+SNLTFLNAPA+NI P YCS
Sbjct  149  TGNNGTIDGMGLTWWESFKSHSLNYSRPHLVEFVASNDVVVSNLTFLNAPAYNIHPVYCS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + NI++ +P +SPYT GIVPDSS+HVCIE+  I+ G
Sbjct  209  NVHIHNISIFAPPESPYTVGIVPDSSDHVCIEDCTIATG  247



>ref|XP_008345223.1| PREDICTED: probable polygalacturonase isoform X1 [Malus domestica]
Length=465

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWWEQF  HALNYSRPHLVEF    +V +SNLT LN+PAW+I P YC 
Sbjct  161  TGDNGTIDGQGFVWWEQFSYHALNYSRPHLVEFTRCENVTVSNLTLLNSPAWHIHPTYCR  220

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NIT+H+   SP T+G+VPDSS HVCIEN NISMG
Sbjct  221  NVQVLNITLHASPASPXTSGVVPDSSEHVCIENCNISMG  259



>gb|KHN08663.1| Putative polygalacturonase [Glycine soja]
Length=339

 Score =   149 bits (376),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NG IDGQG+VWW+    H+LNYSRPH++E + S +++ISNLTFLN+PAW+I P YCS
Sbjct  33   TGDNGIIDGQGSVWWDLISTHSLNYSRPHIIELVGSDNIIISNLTFLNSPAWSIHPVYCS  92

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            N+ +Q ITV +P+K PYT+GIVPDSS HVCI+N NIS G
Sbjct  93   NIQIQKITVQAPTKFPYTSGIVPDSSEHVCIDNCNISTG  131



>gb|KHG14610.1| putative polygalacturonase [Gossypium arboreum]
Length=452

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWWE F  H+LNY+RPHLVEF+SS +V++SN++ LNAPA+NI P YCS
Sbjct  148  TGDNGTIDGQGSVWWEWFISHSLNYTRPHLVEFVSSEYVLVSNISLLNAPAYNIHPVYCS  207

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + NI+V++P +SPYT GIVPDSS+++CIE+ NISMG
Sbjct  208  NVHIHNISVYAPPESPYTVGIVPDSSDNICIEDCNISMG  246



>ref|XP_007163148.1| hypothetical protein PHAVU_001G210300g [Phaseolus vulgaris]
 gb|ESW35142.1| hypothetical protein PHAVU_001G210300g [Phaseolus vulgaris]
Length=482

 Score =   150 bits (380),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG++WW  F  H+LNYSRP+LVEF+ S  V+ISNLTF++APAW I P YCS
Sbjct  170  TGDNGTINGQGSIWWTLFSSHSLNYSRPNLVEFVDSVDVIISNLTFVDAPAWGIHPVYCS  229

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNIT  +P +SPYT+GIVPDSS +VCIENSNIS G
Sbjct  230  NVQIQNITSRAPPESPYTSGIVPDSSKYVCIENSNISTG  268



>ref|XP_003519755.1| PREDICTED: probable polygalacturonase [Glycine max]
Length=455

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NG IDGQG+VWW+    H+LNYSRPH++E + S +++ISNLTFLN+PAW+I P YCS
Sbjct  149  TGDNGIIDGQGSVWWDLISTHSLNYSRPHIIELVGSDNIIISNLTFLNSPAWSIHPVYCS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            N+ +Q ITV +P+K PYT+GIVPDSS HVCI+N NIS G
Sbjct  209  NIQIQKITVQAPTKFPYTSGIVPDSSEHVCIDNCNISTG  247



>ref|XP_008438913.1| PREDICTED: probable polygalacturonase isoform X1 [Cucumis melo]
Length=458

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG++G IDGQG VWW  F  H+LNYSRPHLVEF  S +VV+SNLTFLN PA+NI P YCS
Sbjct  152  TGDDGVIDGQGLVWWNWFSSHSLNYSRPHLVEFEDSQYVVVSNLTFLNTPAYNIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NI+V++PS+SPYT GIVPDSS+HVCIE  NI+ G
Sbjct  212  NVYVYNISVYAPSESPYTVGIVPDSSDHVCIEGCNIATG  250



>ref|XP_008438914.1| PREDICTED: probable polygalacturonase isoform X2 [Cucumis melo]
Length=457

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG++G IDGQG VWW  F  H+LNYSRPHLVEF  S +VV+SNLTFLN PA+NI P YCS
Sbjct  151  TGDDGVIDGQGLVWWNWFSSHSLNYSRPHLVEFEDSQYVVVSNLTFLNTPAYNIHPVYCS  210

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NI+V++PS+SPYT GIVPDSS+HVCIE  NI+ G
Sbjct  211  NVYVYNISVYAPSESPYTVGIVPDSSDHVCIEGCNIATG  249



>ref|XP_003609706.1| hypothetical protein MTR_4g120730 [Medicago truncatula]
 gb|AES91903.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=459

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDG G+ WWE F  H+LNYSRPHLVE ++S+ VV+SNLTFLNAPA+NI P YC 
Sbjct  149  TGNNGTIDGMGSTWWESFSSHSLNYSRPHLVELVASTDVVVSNLTFLNAPAYNIHPVYCR  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + NI++ +P +SPYT GIVPDSS+HVCIE+  I+ G
Sbjct  209  NVHIHNISIFAPPESPYTVGIVPDSSDHVCIEDCTIATG  247



>gb|KHN20382.1| Putative polygalacturonase [Glycine soja]
Length=413

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WWE F  ++LNYSRP+L+EF+ S  ++ISNLTFL++PAW I P +CS
Sbjct  83   TGDNGTIDGQGSIWWELFSSNSLNYSRPNLIEFVDSVDIIISNLTFLDSPAWGIHPVHCS  142

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNIT  +P++ PYT+GIVPDSS +VCIENSNIS G
Sbjct  143  NVQIQNITSRAPAEFPYTSGIVPDSSRYVCIENSNISTG  181



>ref|XP_007035679.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY06605.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=608

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWWE F  H+LNYSRP LVEF+SS ++++SN+TFLNAPA+NI P YCS
Sbjct  304  TGDNGTIDGQGSVWWEWFMSHSLNYSRPQLVEFVSSDYILVSNITFLNAPAYNIHPVYCS  363

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + NI+V++P  SP+T GIVPDSS++VCIE+ +ISMG
Sbjct  364  NVHIHNISVYAPPASPFTVGIVPDSSDNVCIEDCSISMG  402



>ref|XP_003520745.2| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=475

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WWE F  ++LNYSRP+L+EF+ S  ++ISNLTFL++PAW I P +CS
Sbjct  145  TGDNGTIDGQGSIWWELFSSNSLNYSRPNLIEFVDSVDIIISNLTFLDSPAWGIHPVHCS  204

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNIT  +P++ PYT+GIVPDSS +VCIENSNIS G
Sbjct  205  NVQIQNITSRAPAEFPYTSGIVPDSSRYVCIENSNISTG  243



>gb|KHG18940.1| putative polygalacturonase [Gossypium arboreum]
Length=457

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWWE F  H+LNY+RPHLVEF+SS  V +SN+TFLNAPA+NI P YCS
Sbjct  150  TGDNGTIDGQGSVWWEWFTSHSLNYTRPHLVEFVSSKDVHVSNITFLNAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + N++V++P  SPYT GIVPDSS++VCIE+ NIS G
Sbjct  210  NVHIHNVSVYAPPGSPYTVGIVPDSSDNVCIEDCNISTG  248



>ref|XP_006588584.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=456

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+N  IDGQG+VWW+    H+LNYSRPH++E + S ++ ISNLTFLN+PAW+I P YCS
Sbjct  149  TGDNAIIDGQGSVWWDLIGTHSLNYSRPHIIELVGSDNITISNLTFLNSPAWSIHPVYCS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +Q ITVH+P++ PYT+GIVPDSS HVCI NSNIS G
Sbjct  209  NVQIQKITVHAPTEFPYTSGIVPDSSEHVCIYNSNISTG  247



>ref|XP_004172519.1| PREDICTED: LOW QUALITY PROTEIN: probable polygalacturonase-like, 
partial [Cucumis sativus]
Length=452

 Score =   147 bits (372),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG++G IDGQG VWW  F  H+LNYSRPHLVEF  S +VV+SNLTFLN PA+NI P YCS
Sbjct  146  TGDDGVIDGQGLVWWNWFSSHSLNYSRPHLVEFEDSQYVVVSNLTFLNTPAYNIHPVYCS  205

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NI+V +PS+SPYT GIVPDSS+HVCIE  NI+ G
Sbjct  206  NVYVYNISVSAPSESPYTVGIVPDSSDHVCIEGCNIATG  244



>ref|XP_006604728.1| PREDICTED: probable polygalacturonase-like [Glycine max]
 gb|KHN43488.1| Putative polygalacturonase [Glycine soja]
Length=482

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW+ F+ ++LNY+RP+L+EF+ S  V+ISNLTFL++PAW I P YCS
Sbjct  167  TGDNGTIDGQGSIWWKLFNSNSLNYTRPNLIEFVDSVDVIISNLTFLDSPAWGIHPVYCS  226

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNIT  +P++ PYT+GIVPDSS +VCIENSNIS G
Sbjct  227  NVQIQNITYRAPAEFPYTSGIVPDSSQNVCIENSNISTG  265



>ref|XP_004134229.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
 gb|KGN57141.1| hypothetical protein Csa_3G165090 [Cucumis sativus]
Length=457

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG++G IDGQG VWW  F  H+LNYSRPHLVEF  S +VV+SNLTFLN PA+NI P YCS
Sbjct  151  TGDDGVIDGQGLVWWNWFSSHSLNYSRPHLVEFEDSQYVVVSNLTFLNTPAYNIHPVYCS  210

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NI+V +PS+SPYT GIVPDSS+HVCIE  NI+ G
Sbjct  211  NVYVYNISVSAPSESPYTVGIVPDSSDHVCIEGCNIATG  249



>ref|XP_007223360.1| hypothetical protein PRUPE_ppa005599mg [Prunus persica]
 gb|EMJ24559.1| hypothetical protein PRUPE_ppa005599mg [Prunus persica]
Length=452

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG+VWW+ F    LNYSRPHLVEF+SS +VV+SNLTF+NAPA+NI P YCS
Sbjct  150  TGDNGTINGQGSVWWDWFSSQTLNYSRPHLVEFVSSKYVVVSNLTFVNAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NI+V +P +SPYT GIVPDSS++VCIE+ +I MG
Sbjct  210  NVHVHNISVSAPPESPYTVGIVPDSSDNVCIEDCSIGMG  248



>ref|XP_008223260.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=452

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG+VWW+ F    LNYSRPHLVEF+SS +VV+SNLTF+NAPA+NI P YCS
Sbjct  150  TGDNGTINGQGSVWWDWFSSQTLNYSRPHLVEFVSSKYVVVSNLTFVNAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NI+V +P +SPYT GIVPDSS++VCIE+ +I MG
Sbjct  210  NVHVHNISVSAPPESPYTVGIVPDSSDNVCIEDCSIGMG  248



>gb|KEH37171.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=387

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDG G VWW+ +  H+LN+SRPHLVE ISS  VV+SNLTFLNAPA++I P YCS
Sbjct  81   TGNNGTIDGNGMVWWDSYKSHSLNHSRPHLVEIISSDFVVVSNLTFLNAPAYSIHPVYCS  140

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNI++ +P +SPYT GIVPDSSN+VCIE+  +S+G
Sbjct  141  NVHIQNISISTPPESPYTAGIVPDSSNNVCIEDCFVSIG  179



>gb|KEH37170.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=452

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDG G VWW+ +  H+LN+SRPHLVE ISS  VV+SNLTFLNAPA++I P YCS
Sbjct  146  TGNNGTIDGNGMVWWDSYKSHSLNHSRPHLVEIISSDFVVVSNLTFLNAPAYSIHPVYCS  205

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNI++ +P +SPYT GIVPDSSN+VCIE+  +S+G
Sbjct  206  NVHIQNISISTPPESPYTAGIVPDSSNNVCIEDCFVSIG  244



>ref|XP_010048020.1| PREDICTED: probable polygalacturonase isoform X1 [Eucalyptus 
grandis]
 gb|KCW88986.1| hypothetical protein EUGRSUZ_A01315 [Eucalyptus grandis]
Length=456

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+ WW+ F  H+LNYSRPHLVEF+ + HVV+SN+TFLNAPA+NI P YCS
Sbjct  150  TGDNGTIDGQGSFWWDLFTSHSLNYSRPHLVEFVEAKHVVVSNITFLNAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+++ +  +SP T GIVPDSS++VCIE+ +ISMG
Sbjct  210  DVHIQNVSISASPESPQTVGIVPDSSDNVCIEDCSISMG  248



>ref|XP_010048025.1| PREDICTED: probable polygalacturonase isoform X2 [Eucalyptus 
grandis]
Length=455

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+ WW+ F  H+LNYSRPHLVEF+ + HVV+SN+TFLNAPA+NI P YCS
Sbjct  149  TGDNGTIDGQGSFWWDLFTSHSLNYSRPHLVEFVEAKHVVVSNITFLNAPAYNIHPVYCS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+++ +  +SP T GIVPDSS++VCIE+ +ISMG
Sbjct  209  DVHIQNVSISASPESPQTVGIVPDSSDNVCIEDCSISMG  247



>ref|XP_010558428.1| PREDICTED: probable polygalacturonase [Tarenaya hassleriana]
Length=443

 Score =   145 bits (365),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW+QF+ H+L YSRPHLVEF+SS  V++SNLTFLNAPA+ I   YCS
Sbjct  152  TGDNGTIDGQGSVWWDQFNSHSLKYSRPHLVEFVSSESVIVSNLTFLNAPAYAIHSVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V VQ ++V S  +SPYT G+VPDSS++VCIENS+I+ G
Sbjct  212  HVHVQKVSVRSSLESPYTVGVVPDSSDNVCIENSSINTG  250



>ref|XP_009384145.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   144 bits (364),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG+VWWE F  H LNYSRPHL+EF+SS  +VISNLTFLN PAW+I P Y S
Sbjct  149  TGNNGIIDGQGSVWWEWFRTHTLNYSRPHLLEFVSSCDIVISNLTFLNPPAWSIHPVYSS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV VQNI + + S SPYTNG+VPDS +  CIE+ +IS+G
Sbjct  209  NVTVQNIVIQASSDSPYTNGVVPDSCSSFCIEDCSISVG  247



>ref|XP_004487815.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=454

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDG G +WW+ ++ H+LN+SRPHLVE ISS+ VV+SNLTFLNAPA++I P YCS
Sbjct  146  TGNNGTIDGMGMIWWDLYNSHSLNHSRPHLVEIISSNFVVVSNLTFLNAPAYSIHPVYCS  205

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNI++ +P  SPYT GIVPDSS++VCIE+  +SMG
Sbjct  206  NVHIQNISISTPPDSPYTVGIVPDSSDNVCIEDCIVSMG  244



>ref|XP_009346202.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=456

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW+ F   +LNYSRPHLVEF+ S +VV+SNLTF+NAPA+NI P YCS
Sbjct  150  TGDNGTIDGQGTVWWDWFSSQSLNYSRPHLVEFVMSKYVVVSNLTFVNAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NI+V +P  SP+T GIVPDSS+ VCIE+ +I MG
Sbjct  210  NVHVHNISVSAPPDSPHTVGIVPDSSDIVCIEDCSIGMG  248



>gb|KHN30667.1| Putative polygalacturonase [Glycine soja]
Length=457

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +2

Query  8    NNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCSNV  187
            +N  IDGQG+VWW+    H+LNYSRPH++E + S ++ ISNLTFLN+PAW+I P YCSNV
Sbjct  152  DNAIIDGQGSVWWDLIGTHSLNYSRPHIIELVGSDNITISNLTFLNSPAWSIHPVYCSNV  211

Query  188  LVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             +Q ITVH+P++ PYT+GIVPDSS HVCI NSNIS G
Sbjct  212  QIQKITVHAPTEFPYTSGIVPDSSEHVCIYNSNISTG  248



>ref|XP_009383709.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=452

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG +WWE F   +LNYSRPHL+E ++ + +V+SNLTFLN+PAW+I P YC 
Sbjct  151  TGDNGTIDGQGLIWWEWFSSQSLNYSRPHLLELVNCNDIVVSNLTFLNSPAWSIHPVYCR  210

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNIT+H+ S SPYTNGIVPDS +++CIE+ +I +G
Sbjct  211  NVEIQNITIHASSDSPYTNGIVPDSCSNLCIEDCSIDVG  249



>gb|KFK38140.1| hypothetical protein AALP_AA3G074700 [Arabis alpina]
Length=447

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L YSRPHL+EFISS +VV+SNLTFLNAPA+ I   Y S
Sbjct  153  TGDNGTIDGQGLVWWDRFTSHSLKYSRPHLIEFISSKNVVVSNLTFLNAPAYTIHSIYSS  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I  HS  +SPYT GIVPDSS++VCI+NSNI+MG
Sbjct  213  HVYISKILAHSSPESPYTIGIVPDSSDNVCIQNSNINMG  251



>ref|XP_008361956.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=362

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG+VWW+ F   +LNYSRPHLVEF+ S +VV+SNLTF+NAPA+NI P YCS
Sbjct  56   TGDNGTINGQGSVWWDWFSSKSLNYSRPHLVEFVMSKYVVVSNLTFVNAPAYNIHPVYCS  115

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NI+V +P  SP+T GIVPDSS+ VCIE+ +I MG
Sbjct  116  NVHVHNISVSAPPDSPHTVGIVPDSSDIVCIEDCSIGMG  154



>ref|XP_003533248.1| PREDICTED: probable polygalacturonase isoform X1 [Glycine max]
Length=452

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDG G VWW+ +  H+LN+SRPHLVEF++S +VV+SNLTFLNAPA++I P YCS
Sbjct  146  TGNNGTIDGMGMVWWDWYSTHSLNHSRPHLVEFVASDYVVVSNLTFLNAPAYSIHPVYCS  205

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+++ +P +SPYT GIVPDSS++VCIE+  ++MG
Sbjct  206  HVHIQNVSISTPPESPYTVGIVPDSSDNVCIEDCIVAMG  244



>ref|XP_006586911.1| PREDICTED: probable polygalacturonase isoform X2 [Glycine max]
Length=472

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDG G VWW+ +  H+LN+SRPHLVEF++S +VV+SNLTFLNAPA++I P YCS
Sbjct  166  TGNNGTIDGMGMVWWDWYSTHSLNHSRPHLVEFVASDYVVVSNLTFLNAPAYSIHPVYCS  225

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+++ +P +SPYT GIVPDSS++VCIE+  ++MG
Sbjct  226  HVHIQNVSISTPPESPYTVGIVPDSSDNVCIEDCIVAMG  264



>gb|KHN26517.1| Putative polygalacturonase [Glycine soja]
Length=473

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDG G VWW+ +  H+LN+SRPHLVEF++S +VV+SNLTFLNAPA++I P YCS
Sbjct  167  TGNNGTIDGMGMVWWDWYSTHSLNHSRPHLVEFVASDYVVVSNLTFLNAPAYSIHPVYCS  226

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+++ +P +SPYT GIVPDSS++VCIE+  ++MG
Sbjct  227  HVHIQNVSISTPPESPYTVGIVPDSSDNVCIEDCIVAMG  265



>ref|XP_010094123.1| putative polygalacturonase [Morus notabilis]
 gb|EXC39742.1| putative polygalacturonase [Morus notabilis]
Length=476

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW+ F   +LNYSRPH+VEF+ S  VV+SNLTFLNAPA+NI P YCS
Sbjct  170  TGDNGTIDGQGSVWWDWFSSGSLNYSRPHIVEFVDSESVVVSNLTFLNAPAYNIHPVYCS  229

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V V NI+V +PS SPYT GIVPDSS  VCIE+  IS G
Sbjct  230  GVHVHNISVSTPSDSPYTIGIVPDSSYDVCIEDCTISTG  268



>ref|XP_003550546.2| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=449

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDG G  WWE F  H+LNYSRPHL+E ++S+ VV+SNLTFLNAPA++I P YCS
Sbjct  148  TGNNGIIDGMGLGWWELFSSHSLNYSRPHLIELVASNRVVVSNLTFLNAPAYSIHPVYCS  207

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + N+++ +P +SPYT GIVPDSS+HVCIE+  I+ G
Sbjct  208  NVHIHNVSISAPQESPYTIGIVPDSSDHVCIEDCVIATG  246



>ref|XP_008390626.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=612

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG+VWW+ F   +LNYSRPHLVEF+ S HVV+SNLTF+NAPA+NI P YCS
Sbjct  306  TGDNGTINGQGSVWWDWFSSQSLNYSRPHLVEFVMSKHVVVSNLTFVNAPAYNIHPVYCS  365

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NI+V +P  SP+T GIVPDSS+ VCIE+  I MG
Sbjct  366  NVHVLNISVSAPPDSPHTVGIVPDSSDTVCIEDCIIGMG  404



>ref|XP_004296881.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=420

 Score =   141 bits (356),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG+VWW+ F  H LN+SRPHLVE +SS  VV+SNLTF+N+PA+NI P YCS
Sbjct  150  TGDNGTINGQGSVWWDWFSSHTLNHSRPHLVEIVSSKDVVVSNLTFVNSPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + NI+V +P +SPYT GIVPDSSN+VCI++ +I MG
Sbjct  210  NVHIHNISVSAPPESPYTVGIVPDSSNNVCIQDCSIGMG  248



>ref|XP_008340766.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=456

 Score =   142 bits (357),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG+VWW+ F   +LNYSRPHLVEF+ S +VV+SNLTF+NAPA+NI P YCS
Sbjct  150  TGDNGTINGQGSVWWDWFSSKSLNYSRPHLVEFVMSKYVVVSNLTFVNAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NI+V +P  SP+T GIVPDSS+ VCIE+ +I MG
Sbjct  210  NVHVHNISVSAPPDSPHTVGIVPDSSDIVCIEDCSIGMG  248



>gb|KHG12205.1| putative polygalacturonase [Gossypium arboreum]
Length=454

 Score =   142 bits (357),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWWE F  H+LNYS PHLVEF+SS  +++SN+TFLNAPA+NI P YCS
Sbjct  150  TGDNGTIDGQGSVWWEWFTSHSLNYSCPHLVEFMSSESILVSNITFLNAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V + +ITV++   SPYT GIVPDSS+++CIE+ +ISMG
Sbjct  210  HVHIHHITVYASPGSPYTVGIVPDSSDNICIEDCSISMG  248



>gb|KHN03332.1| Putative polygalacturonase [Glycine soja]
Length=460

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDG G  WWE F  H+LNYSRPHL+E ++S+ VV+SNLTFLNAPA++I P YCS
Sbjct  159  TGNNGIIDGMGLGWWELFSSHSLNYSRPHLIELVASNRVVVSNLTFLNAPAYSIHPVYCS  218

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + N+++ +P +SPYT GIVPDSS+HVCIE+  I+ G
Sbjct  219  NVHIHNVSISAPQESPYTIGIVPDSSDHVCIEDCVIATG  257



>ref|XP_006584015.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=394

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDG G  WWE F  H+LNYSRPHL+E ++S HVV+SNLTFLNAPA++I P YCS
Sbjct  93   TGNNGNIDGMGFAWWELFSSHSLNYSRPHLIELVASDHVVVSNLTFLNAPAYSIHPVYCS  152

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + N+++ +P +SP T GIVPDSS+HVCIE+  I+ G
Sbjct  153  NVHIHNVSISAPPESPNTVGIVPDSSDHVCIEDCVIATG  191



>ref|XP_007138953.1| hypothetical protein PHAVU_009G252200g [Phaseolus vulgaris]
 gb|ESW10947.1| hypothetical protein PHAVU_009G252200g [Phaseolus vulgaris]
Length=452

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDG G VWWE +  H+LN+SRPHLVE ++S +VV+SNLTFLNAPA++I P YCS
Sbjct  146  TGNNGTIDGMGMVWWEWYSSHSLNHSRPHLVEIVASDYVVVSNLTFLNAPAYSIHPVYCS  205

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+++ +P +SPYT GIVPDSS +VCIE+  + MG
Sbjct  206  HVHIQNVSISTPPESPYTVGIVPDSSEYVCIEDCIVGMG  244



>ref|XP_002863973.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40232.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=447

 Score =   141 bits (355),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F+ H+L YSRPHLVEF+SS +V++SNLTFLNAPA+ I   YCS
Sbjct  150  TGDNGTIDGQGLVWWDRFNSHSLEYSRPHLVEFVSSGNVIVSNLTFLNAPAYTIHSVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            N+ +  +T ++  +SPYT GIVPDSS +VCI++S+I+MG
Sbjct  210  NLYIHRVTANTSPESPYTIGIVPDSSENVCIQDSSINMG  248



>ref|XP_003528627.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=449

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDG G  WWE F  H+LNYSRPHL+E ++S HVV+SNLTFLNAPA++I P YCS
Sbjct  148  TGNNGNIDGMGFAWWELFSSHSLNYSRPHLIELVASDHVVVSNLTFLNAPAYSIHPVYCS  207

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + N+++ +P +SP T GIVPDSS+HVCIE+  I+ G
Sbjct  208  NVHIHNVSISAPPESPNTVGIVPDSSDHVCIEDCVIATG  246



>gb|KHN02933.1| Putative polygalacturonase [Glycine soja]
Length=449

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDG G  WWE F  H+LNYSRPHL+E ++S HVV+SNLTFLNAPA++I P YCS
Sbjct  148  TGNNGNIDGMGFAWWELFSSHSLNYSRPHLIELVASDHVVVSNLTFLNAPAYSIHPVYCS  207

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + N+++ +P +SP T GIVPDSS+HVCIE+  I+ G
Sbjct  208  NVHIHNVSISAPPESPNTVGIVPDSSDHVCIEDCVIATG  246



>ref|XP_009399272.1| PREDICTED: probable polygalacturonase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=463

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG+VWWE F  H LNYSRPHL+E +SSS +V+SNLTFLN PAW+I P Y S
Sbjct  161  TGNNGAIDGQGSVWWEWFRSHTLNYSRPHLLELVSSSDIVVSNLTFLNPPAWSIHPVYSS  220

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNI +H+ S SPYT+GIVPDS ++  IE+ +IS+G
Sbjct  221  NVTIQNIIIHASSDSPYTDGIVPDSCSNFHIEDCSISVG  259



>ref|XP_007154320.1| hypothetical protein PHAVU_003G108700g [Phaseolus vulgaris]
 gb|ESW26314.1| hypothetical protein PHAVU_003G108700g [Phaseolus vulgaris]
Length=449

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGN+G IDG G  WWE F+ H+LNYSRPH++E ++S HVV+SNLTFLNAPA++I P YCS
Sbjct  148  TGNSGIIDGMGLAWWELFNSHSLNYSRPHIIELVASDHVVVSNLTFLNAPAYSIHPVYCS  207

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + N+++ +P +SPYT G+VPDSS+H+CIE+  I  G
Sbjct  208  NVHIYNVSISAPPESPYTIGMVPDSSDHICIEDCVIETG  246



>ref|XP_009399273.1| PREDICTED: probable polygalacturonase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG+VWWE F  H LNYSRPHL+E +SSS +V+SNLTFLN PAW+I P Y S
Sbjct  149  TGNNGAIDGQGSVWWEWFRSHTLNYSRPHLLELVSSSDIVVSNLTFLNPPAWSIHPVYSS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QNI +H+ S SPYT+GIVPDS ++  IE+ +IS+G
Sbjct  209  NVTIQNIIIHASSDSPYTDGIVPDSCSNFHIEDCSISVG  247



>ref|XP_006597720.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=452

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDG G VWW+ +  H+LN+SRPHLVE ++S +VV+SNLTFLNAPA++I P YCS
Sbjct  146  TGNNGTIDGMGMVWWDWYSTHSLNHSRPHLVEIVASDYVVVSNLTFLNAPAYSIHPVYCS  205

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+++ +P +SPYT GIVPDSS++VCIE+  ++MG
Sbjct  206  HVHIQNVSISTPPESPYTVGIVPDSSDNVCIEDCIVAMG  244



>ref|XP_006597719.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=471

 Score =   140 bits (353),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDG G VWW+ +  H+LN+SRPHLVE ++S +VV+SNLTFLNAPA++I P YCS
Sbjct  165  TGNNGTIDGMGMVWWDWYSTHSLNHSRPHLVEIVASDYVVVSNLTFLNAPAYSIHPVYCS  224

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+++ +P +SPYT GIVPDSS++VCIE+  ++MG
Sbjct  225  HVHIQNVSISTPPESPYTVGIVPDSSDNVCIEDCIVAMG  263



>ref|XP_008390608.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=456

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG+VWW+ F   +LNYSRPHLVEF+ S  VV+SNLTF+NAPA+NI P YCS
Sbjct  150  TGDNGTINGQGSVWWDWFSSQSLNYSRPHLVEFVMSKXVVVSNLTFVNAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NI+V +P  SP+T GIVPDSS+ VCIE+  I MG
Sbjct  210  NVHVLNISVSAPPDSPHTVGIVPDSSDTVCIEDCIIGMG  248



>ref|XP_006407904.1| hypothetical protein EUTSA_v10020733mg [Eutrema salsugineum]
 gb|ESQ49357.1| hypothetical protein EUTSA_v10020733mg [Eutrema salsugineum]
Length=444

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L Y+RPHLVEFISS +V++SNLTFLNAPA++I   Y S
Sbjct  153  TGDNGTIDGQGLVWWDRFTSHSLKYNRPHLVEFISSENVIVSNLTFLNAPAYSIHSIYSS  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I+ HS   SPYT GIVPDSS++VCI+NS I+MG
Sbjct  213  HVYIHKISAHSSPHSPYTIGIVPDSSDNVCIQNSTINMG  251



>ref|XP_009369994.1| PREDICTED: probable polygalacturonase isoform X1 [Pyrus x bretschneideri]
Length=456

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG+VWW+ F   +LNYSRPHLVEF+ S +VV+SNLTF+NAPA+NI P YCS
Sbjct  150  TGDNGTINGQGSVWWDWFSSQSLNYSRPHLVEFVMSKYVVVSNLTFINAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NI+V +P  SP+T GIVPDSS+ VCIE+  I +G
Sbjct  210  NVHVLNISVSAPPDSPHTVGIVPDSSDTVCIEDCIIGVG  248



>ref|XP_009369995.1| PREDICTED: probable polygalacturonase isoform X2 [Pyrus x bretschneideri]
Length=456

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG+VWW+ F   +LNYSRPHLVEF+ S +VV+SNLTF+NAPA+NI P YCS
Sbjct  150  TGDNGTINGQGSVWWDWFSSQSLNYSRPHLVEFVMSKYVVVSNLTFINAPAYNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V NI+V +P  SP+T GIVPDSS+ VCIE+  I +G
Sbjct  210  NVHVLNISVSAPPDSPHTVGIVPDSSDTVCIEDCIIGVG  248



>ref|XP_009129767.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=444

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG +WW++F+ H+L +SRPHLVEF+SS  V +SNLTFLNAPA+ I   YCS
Sbjct  146  TGDNGTIDGQGLLWWDRFNSHSLKHSRPHLVEFVSSEDVTVSNLTFLNAPAYTIHSVYCS  205

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  +T  +  +SPYT GIVPDSSN+VCI++S+ISMG
Sbjct  206  HVYINKVTATTSPESPYTIGIVPDSSNNVCIQDSSISMG  244



>ref|NP_566292.1| polygalacturonase-like protein [Arabidopsis thaliana]
 ref|NP_850526.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF63821.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74454.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AEE74455.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=377

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L Y+RPHL+EF+SS +V++SNLTFLNAPA++I   Y S
Sbjct  83   TGDNGTIDGQGLVWWDRFTSHSLKYNRPHLIEFLSSENVIVSNLTFLNAPAYSIYSIYSS  142

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I  HS  KSPYT GIVPDSS++VCI+NS I++G
Sbjct  143  HVYIHKILAHSSPKSPYTIGIVPDSSDYVCIQNSTINVG  181



>gb|AAM65366.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=377

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L Y+RPHL+EF+SS +V++SNLTFLNAPA++I   Y S
Sbjct  83   TGDNGTIDGQGLVWWDRFTSHSLKYNRPHLIEFLSSENVIVSNLTFLNAPAYSIYSIYSS  142

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I  HS  KSPYT GIVPDSS++VCI+NS I++G
Sbjct  143  HVYIHKILAHSSPKSPYTIGIVPDSSDYVCIQNSTINVG  181



>ref|XP_002884608.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60867.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=446

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L Y+RPHL+EF+SS +V++SNLTFLNAPA+ I   Y S
Sbjct  152  TGDNGTIDGQGLVWWDRFTSHSLKYNRPHLIEFLSSKNVIVSNLTFLNAPAYTIHSIYSS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I  HS  +SPYT GIVPDSSN+VCI+NS I++G
Sbjct  212  HVYIHKILAHSSPESPYTIGIVPDSSNYVCIQNSTINVG  250



>ref|NP_850525.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAM13029.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91335.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74456.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=446

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L Y+RPHL+EF+SS +V++SNLTFLNAPA++I   Y S
Sbjct  152  TGDNGTIDGQGLVWWDRFTSHSLKYNRPHLIEFLSSENVIVSNLTFLNAPAYSIYSIYSS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I  HS  KSPYT GIVPDSS++VCI+NS I++G
Sbjct  212  HVYIHKILAHSSPKSPYTIGIVPDSSDYVCIQNSTINVG  250



>ref|XP_002273855.2| PREDICTED: probable polygalacturonase [Vitis vinifera]
 ref|XP_010652335.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
 emb|CBI37055.3| unnamed protein product [Vitis vinifera]
Length=466

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW  F +  LNY+RPHLVEFI+S+ VVISN+TFLN+P W I P YCS
Sbjct  152  TGDNGTIDGQGSIWWNWFQKKTLNYTRPHLVEFINSTGVVISNVTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V++QN+T+ +P  SP T+GI PDSSN VCIE+  IS G
Sbjct  212  QVIIQNVTILAPLDSPNTDGIDPDSSNDVCIEDCYISTG  250



>ref|XP_009151719.1| PREDICTED: probable polygalacturonase isoform X1 [Brassica rapa]
Length=475

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG  WW++F+ H+L YSRPHLVEF+SS +V++SNLTFLNAP + I   YCS
Sbjct  177  TGDNGTIDGQGLFWWDRFNSHSLKYSRPHLVEFVSSENVIVSNLTFLNAPEYTIHSVYCS  236

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  +T ++  +SPYT GIVPDSS++VCI++S I+MG
Sbjct  237  HVYIHRVTANTSPESPYTVGIVPDSSDNVCIQDSTINMG  275



>ref|XP_010931696.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=455

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW     H LN+SRPHLVE +SS+ +VISNLTFLN+PAW+I P YCS
Sbjct  149  TGDNGTIDGQGSVWWGWLHSHTLNFSRPHLVELVSSNDIVISNLTFLNSPAWSIHPVYCS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV VQNIT+H+ S S +T+GIVPDS +++CIE+ +I++
Sbjct  209  NVEVQNITIHTSSNSLFTSGIVPDSCSNICIEDCSINV  246



>ref|XP_009412155.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=459

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGT+DGQG VWWE F+ H LNY+RPHL+E + S  VVISNLTF+N+P W I P YCS
Sbjct  155  TGGNGTVDGQGCVWWEWFNNHTLNYTRPHLIELMYSKGVVISNLTFINSPFWAIHPVYCS  214

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             VLVQN+T+ +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  215  QVLVQNVTILAPPDSPNTDGIDPDSSDNVCIEDCYISTG  253



>ref|NP_001032043.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 dbj|BAF01664.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED95785.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=447

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F+ H+L YSRPHLVEF+S+ +V++SNLTFLNAPA+ I   YC 
Sbjct  150  TGDNGTIDGQGLVWWDRFNSHSLEYSRPHLVEFVSAENVIVSNLTFLNAPAYTIHSVYCR  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            N+ +  +T ++  +SPYT GIVPDSS +VCI+ S+I+MG
Sbjct  210  NLYIHRVTANTCPESPYTIGIVPDSSENVCIQESSINMG  248



>ref|XP_006841512.1| hypothetical protein AMTR_s00003p00141260 [Amborella trichopoda]
 gb|ERN03187.1| hypothetical protein AMTR_s00003p00141260 [Amborella trichopoda]
Length=471

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW+ F+  +LNYSRPHLVE  SS  VVISNLTFLNAPAW+I P YCS
Sbjct  167  TGDNGTIDGQGSVWWDWFNSGSLNYSRPHLVEITSSEDVVISNLTFLNAPAWSIHPVYCS  226

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NVL+QNI V +   S +T+GIVPDS   VCIE+S +S+G
Sbjct  227  NVLIQNIAVRAAPNS-HTDGIVPDSCTGVCIEDSVVSVG  264



>gb|EEC68574.1| hypothetical protein OsI_36908 [Oryza sativa Indica Group]
Length=449

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG+VWW+    H LN+SRPH+VEF+ S  VVISNLTFLN+PAW+I P YCS
Sbjct  144  TGNNGVIDGQGSVWWDWLHSHELNHSRPHIVEFLHSEEVVISNLTFLNSPAWSIHPVYCS  203

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V N+T+ +   +P T+GIVPDS ++VCIE+S+IS+G
Sbjct  204  NVKVHNVTIKTSLDAPLTDGIVPDSCSNVCIEDSSISVG  242



>gb|KCW46748.1| hypothetical protein EUGRSUZ_K00562 [Eucalyptus grandis]
Length=444

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG++WWE+F    L+Y+RPHLVE ++S+ VVISNLTFLN+P W I P YCS
Sbjct  128  TGENGTIDGQGSMWWERFRNKTLDYTRPHLVELMNSTGVVISNLTFLNSPFWTIHPVYCS  187

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+VQN+T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  188  HVIVQNVTIRAPLDSPNTDGIDPDSSDDVCIEDCYISTG  226



>ref|NP_001068399.1| Os11g0658800 [Oryza sativa Japonica Group]
 gb|ABA95183.1| glycoside hydrolase family 28 protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28762.1| Os11g0658800 [Oryza sativa Japonica Group]
 gb|EEE52511.1| hypothetical protein OsJ_34717 [Oryza sativa Japonica Group]
Length=449

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG+VWW+    H LN+SRPH+VEF+ S  VVISNLTFLN+PAW+I P YCS
Sbjct  144  TGNNGVIDGQGSVWWDWLHSHELNHSRPHIVEFLHSEEVVISNLTFLNSPAWSIHPVYCS  203

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV V N+T+ +   +P T+GIVPDS ++VCIE+S+IS+G
Sbjct  204  NVKVHNVTIKTSLDAPLTDGIVPDSCSNVCIEDSSISVG  242



>ref|XP_009151721.1| PREDICTED: probable polygalacturonase isoform X3 [Brassica rapa]
Length=446

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG  WW++F+ H+L YSRPHLVEF+SS +V++SNLTFLNAP + I   YCS
Sbjct  148  TGDNGTIDGQGLFWWDRFNSHSLKYSRPHLVEFVSSENVIVSNLTFLNAPEYTIHSVYCS  207

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  +T ++  +SPYT GIVPDSS++VCI++S I+MG
Sbjct  208  HVYIHRVTANTSPESPYTVGIVPDSSDNVCIQDSTINMG  246



>ref|NP_680409.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 gb|AAM14020.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91751.1| unknown protein [Arabidopsis thaliana]
 gb|AED95784.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=449

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F+ H+L YSRPHLVEF+S+ +V++SNLTFLNAPA+ I   YC 
Sbjct  152  TGDNGTIDGQGLVWWDRFNSHSLEYSRPHLVEFVSAENVIVSNLTFLNAPAYTIHSVYCR  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            N+ +  +T ++  +SPYT GIVPDSS +VCI+ S+I+MG
Sbjct  212  NLYIHRVTANTCPESPYTIGIVPDSSENVCIQESSINMG  250



>ref|XP_009151722.1| PREDICTED: probable polygalacturonase isoform X4 [Brassica rapa]
Length=444

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG  WW++F+ H+L YSRPHLVEF+SS +V++SNLTFLNAP + I   YCS
Sbjct  146  TGDNGTIDGQGLFWWDRFNSHSLKYSRPHLVEFVSSENVIVSNLTFLNAPEYTIHSVYCS  205

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  +T ++  +SPYT GIVPDSS++VCI++S I+MG
Sbjct  206  HVYIHRVTANTSPESPYTVGIVPDSSDNVCIQDSTINMG  244



>ref|XP_009151720.1| PREDICTED: probable polygalacturonase isoform X2 [Brassica rapa]
Length=449

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG  WW++F+ H+L YSRPHLVEF+SS +V++SNLTFLNAP + I   YCS
Sbjct  151  TGDNGTIDGQGLFWWDRFNSHSLKYSRPHLVEFVSSENVIVSNLTFLNAPEYTIHSVYCS  210

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  +T ++  +SPYT GIVPDSS++VCI++S I+MG
Sbjct  211  HVYIHRVTANTSPESPYTVGIVPDSSDNVCIQDSTINMG  249



>ref|XP_008810196.1| PREDICTED: probable polygalacturonase isoform X2 [Phoenix dactylifera]
Length=456

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW  F  H LN+SRPHLVE +SS+ VVISNLTFLN+PAW+I P YCS
Sbjct  150  TGDNGTIDGQGSVWWGWFHTHTLNFSRPHLVELVSSNDVVISNLTFLNSPAWSIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV ++ IT+ + SKS +T+GIVPDS +++CIE+ +I++
Sbjct  210  NVEIRKITIRTSSKSLFTSGIVPDSCSYICIEDCSINV  247



>ref|XP_008810198.1| PREDICTED: probable polygalacturonase isoform X4 [Phoenix dactylifera]
Length=451

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW  F  H LN+SRPHLVE +SS+ VVISNLTFLN+PAW+I P YCS
Sbjct  145  TGDNGTIDGQGSVWWGWFHTHTLNFSRPHLVELVSSNDVVISNLTFLNSPAWSIHPVYCS  204

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV ++ IT+ + SKS +T+GIVPDS +++CIE+ +I++
Sbjct  205  NVEIRKITIRTSSKSLFTSGIVPDSCSYICIEDCSINV  242



>ref|XP_008810197.1| PREDICTED: probable polygalacturonase isoform X3 [Phoenix dactylifera]
Length=455

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW  F  H LN+SRPHLVE +SS+ VVISNLTFLN+PAW+I P YCS
Sbjct  149  TGDNGTIDGQGSVWWGWFHTHTLNFSRPHLVELVSSNDVVISNLTFLNSPAWSIHPVYCS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV ++ IT+ + SKS +T+GIVPDS +++CIE+ +I++
Sbjct  209  NVEIRKITIRTSSKSLFTSGIVPDSCSYICIEDCSINV  246



>ref|XP_008810195.1| PREDICTED: probable polygalacturonase isoform X1 [Phoenix dactylifera]
Length=460

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW  F  H LN+SRPHLVE +SS+ VVISNLTFLN+PAW+I P YCS
Sbjct  154  TGDNGTIDGQGSVWWGWFHTHTLNFSRPHLVELVSSNDVVISNLTFLNSPAWSIHPVYCS  213

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV ++ IT+ + SKS +T+GIVPDS +++CIE+ +I++
Sbjct  214  NVEIRKITIRTSSKSLFTSGIVPDSCSYICIEDCSINV  251



>emb|CDY33922.1| BnaA02g30650D [Brassica napus]
Length=444

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG +WW++F+ H+L +SRPHLVEF+SS  V +SNLTFLNAPA+ I   YCS
Sbjct  146  TGDNGTIDGQGLLWWDRFNSHSLKHSRPHLVEFVSSEDVTVSNLTFLNAPAYTIHSVYCS  205

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  +T  +  +SPYT GIVPDSS++VCI++S+ISMG
Sbjct  206  HVYINKVTATTSPESPYTIGIVPDSSDNVCIQDSSISMG  244



>emb|CDY56436.1| BnaC07g49290D [Brassica napus]
Length=474

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG  WW++F+ H+L YSRPHLVEF+SS +V++SNLTFLNAP + I   YCS
Sbjct  176  TGDNGTIDGQGLFWWDRFNSHSLKYSRPHLVEFVSSENVIVSNLTFLNAPEYTIHSVYCS  235

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  +T ++  +SPYT GIVPDSS++VCI++S I+MG
Sbjct  236  HVYIHRVTANTSPESPYTVGIVPDSSDNVCIQDSTINMG  274



>ref|XP_010035373.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 ref|XP_010035375.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 ref|XP_010035376.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW46747.1| hypothetical protein EUGRSUZ_K00562 [Eucalyptus grandis]
Length=468

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG++WWE+F    L+Y+RPHLVE ++S+ VVISNLTFLN+P W I P YCS
Sbjct  152  TGENGTIDGQGSMWWERFRNKTLDYTRPHLVELMNSTGVVISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+VQN+T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  212  HVIVQNVTIRAPLDSPNTDGIDPDSSDDVCIEDCYISTG  250



>ref|XP_010679489.1| PREDICTED: probable polygalacturonase isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTI+GQG +WW  F   +LNY+RPHL+EFI+S+ +VISNLTFLN+P WNI P YCS
Sbjct  161  TGENGTIEGQGNIWWGWFHNKSLNYTRPHLIEFINSTELVISNLTFLNSPFWNIHPVYCS  220

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V+VQN+T+ +P  SP T+GI PDSSN VCIE+  IS G
Sbjct  221  KVIVQNLTIRAPYDSPNTDGIDPDSSNDVCIEDCYISTG  259



>ref|XP_010679488.1| PREDICTED: probable polygalacturonase isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=460

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTI+GQG +WW  F   +LNY+RPHL+EFI+S+ +VISNLTFLN+P WNI P YCS
Sbjct  162  TGENGTIEGQGNIWWGWFHNKSLNYTRPHLIEFINSTELVISNLTFLNSPFWNIHPVYCS  221

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V+VQN+T+ +P  SP T+GI PDSSN VCIE+  IS G
Sbjct  222  KVIVQNLTIRAPYDSPNTDGIDPDSSNDVCIEDCYISTG  260



>emb|CDY05643.1| BnaC02g38940D [Brassica napus]
Length=478

 Score =   137 bits (344),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG +WW++F+ H+L +SRPHLVEF+SS +V++SNLTFLNAPA+ I   YCS
Sbjct  180  TGDNGTIDGQGLLWWDRFNSHSLKHSRPHLVEFVSSENVIVSNLTFLNAPAYTIHSVYCS  239

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  +T  +  +SPYT GIVPDSS++VCI++S+I+MG
Sbjct  240  HVYINKVTATTSPESPYTIGIVPDSSDNVCIQDSSINMG  278



>ref|XP_009383737.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=456

 Score =   137 bits (344),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWWE F    LNYSRPHL+E +SSS +VISNLTFLN PAW+I P Y S
Sbjct  153  TGDNGTIDGQGSVWWEWFHSQTLNYSRPHLLELVSSSDIVISNLTFLNPPAWSIHPVYSS  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV +QN+ +H  S S YTNGIVPDS ++ CI + +IS+G
Sbjct  213  NVEIQNVKIHCSSASSYTNGIVPDSCSNCCILDCSISVG  251



>ref|XP_010091430.1| putative polygalacturonase [Morus notabilis]
 gb|EXB44467.1| putative polygalacturonase [Morus notabilis]
Length=468

 Score =   136 bits (343),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW+ FD   LNY+RPHLVEFI+S+ +VISNLTF+N+P W I P YCS
Sbjct  151  TGDNGTIDGQGSIWWDWFDNKTLNYTRPHLVEFINSTGIVISNLTFINSPFWAIHPVYCS  210

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V V+N+ + +P +SP T+GI PDSS++VCIE+  IS G
Sbjct  211  QVTVRNVRILAPPESPNTDGIDPDSSDNVCIEDCYISTG  249



>emb|CDX86247.1| BnaA06g29640D [Brassica napus]
Length=501

 Score =   137 bits (344),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG  WW++F+ H+L YSRPHLVEF+SS +V++SN+TFLNAP + I   YCS
Sbjct  203  TGDNGTIDGQGLFWWDRFNSHSLKYSRPHLVEFVSSENVIVSNITFLNAPEYTIHSVYCS  262

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  +T ++  +SPYT GIVPDSS++VCI++S I+MG
Sbjct  263  HVYIHRVTANTSPESPYTVGIVPDSSDNVCIQDSTINMG  301



>gb|EMS62063.1| putative polygalacturonase [Triticum urartu]
Length=463

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG +DGQG +WW  F  + LNYSRPHLVEF  S  +VISNLTFL++PAW I P YCS
Sbjct  158  TGNNGIVDGQGLIWWNWFRSNKLNYSRPHLVEFEDSEEIVISNLTFLDSPAWGIHPVYCS  217

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV ++N+T+ +   +P TNGIVPDS +++CIE+S IS+G
Sbjct  218  NVTIRNVTIETELDAPLTNGIVPDSCSNMCIEDSRISVG  256



>ref|XP_006386685.1| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
 ref|XP_002301554.2| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
 gb|ERP64482.1| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
 gb|EEE80827.2| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
Length=449

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW+ F    LNY+RPHLVEF++++ VVISNLTF+N+P W I P YCS
Sbjct  152  TGDNGTIDGQGSIWWDWFRNQTLNYTRPHLVEFMNTTGVVISNLTFINSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V+VQN+T+ +P  SP T+GI PDSS+ VC+E+  +S G
Sbjct  212  QVIVQNVTILAPLDSPNTDGIDPDSSDDVCVEDCYVSTG  250



>ref|XP_009363065.1| PREDICTED: probable polygalacturonase isoform X1 [Pyrus x bretschneideri]
Length=482

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW+ F    LNY+RPHL+E I+S+ VVISNLTFLN+P W I P YCS
Sbjct  167  TGDNGTIDGQGSIWWDWFHSKTLNYTRPHLLELINSTGVVISNLTFLNSPFWTIHPVYCS  226

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+T+ +P KSP T+GI PDSS++VCIE+  IS G
Sbjct  227  HVTIQNLTILAPLKSPNTDGIDPDSSDNVCIEDCYISTG  265



>ref|XP_010914507.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=455

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW     H LN+SRPHLVE +SS+ +VISNL FLN+PAW+I P YC 
Sbjct  149  TGDNGTIDGQGSVWWGWLRSHTLNFSRPHLVELVSSNDIVISNLIFLNSPAWSIHPVYCG  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV V+NIT+H+ S S +T+GIVPDS ++VCIE+ +IS+
Sbjct  209  NVEVRNITIHTSSDSSFTSGIVPDSCSNVCIEDCSISV  246



>ref|XP_008381624.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=479

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW+ F    LNY+RPHL+E I+S+ VVISNLTFLN+P W I P YCS
Sbjct  164  TGDNGTIDGQGSIWWDWFHSKTLNYTRPHLLELINSTGVVISNLTFLNSPFWTIHPVYCS  223

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+T+ +P KSP T+GI PDSS++VCIE+  IS G
Sbjct  224  HVTIQNLTILAPLKSPNTDGIDPDSSDNVCIEDCYISTG  262



>ref|XP_009363066.1| PREDICTED: probable polygalacturonase isoform X2 [Pyrus x bretschneideri]
Length=467

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW+ F    LNY+RPHL+E I+S+ VVISNLTFLN+P W I P YCS
Sbjct  152  TGDNGTIDGQGSIWWDWFHSKTLNYTRPHLLELINSTGVVISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+T+ +P KSP T+GI PDSS++VCIE+  IS G
Sbjct  212  HVTIQNLTILAPLKSPNTDGIDPDSSDNVCIEDCYISTG  250



>ref|XP_008807914.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008807915.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=469

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW+ F  H LNY+RPHL+E + S+ VVISNLTF N+P W I P YCS
Sbjct  152  TGDNGTIDGQGIVWWDWFQNHTLNYTRPHLIELMYSTEVVISNLTFKNSPFWAIHPIYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             VLVQN+T+ +P  SP T+GI PDSS +VCIE+  IS G
Sbjct  212  QVLVQNVTILAPLDSPNTDGIDPDSSTNVCIEDCYISTG  250



>ref|XP_011005969.1| PREDICTED: probable polygalacturonase [Populus euphratica]
 ref|XP_011005971.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=465

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW+ F    LNY+RPHLVEF++++ VVISNLTF+N+P W I P YCS
Sbjct  152  TGDNGTIDGQGSIWWDWFRNQTLNYTRPHLVEFMNTTGVVISNLTFINSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V+VQN+T+ +P  SP T+GI PDSS+ VC+E+  +S G
Sbjct  212  QVIVQNVTILAPLDSPNTDGIDPDSSDDVCVEDCYVSTG  250



>ref|XP_008235135.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=454

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWWEQF  HALNYSRPHLVEF    +V ISNLT LN+PAWNI PAYC 
Sbjct  150  TGDNGTIDGQGSVWWEQFSSHALNYSRPHLVEFTGCDNVTISNLTLLNSPAWNIHPAYCR  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVC  271
             V V NITVH+   SPYT+GIVP S N  C
Sbjct  210  YVQVLNITVHASPASPYTSGIVPGSLNIFC  239



>ref|XP_009387922.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=456

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTI+GQG+VWW+ F+ H LNY+RPHL+E I S+ VVISNLTF+N+P W I P YCS
Sbjct  152  TGGNGTINGQGSVWWDWFNNHILNYTRPHLIELIYSTGVVISNLTFINSPFWAIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             VL+QN+T+ +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  212  QVLIQNVTILAPPDSPNTDGIDPDSSSNVCIEDCYISTG  250



>ref|XP_002535132.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF27252.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=476

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW  F   +LNY+RPHLVE ++SS +VISNLTF+N+P W I P YCS
Sbjct  162  TGDNGTIDGQGSIWWTWFKTESLNYTRPHLVELMNSSGIVISNLTFINSPFWTIHPVYCS  221

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V+VQN+T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  222  KVIVQNVTIRAPLDSPNTDGIDPDSSDDVCIEDCFISTG  260



>gb|KDP28345.1| hypothetical protein JCGZ_14116 [Jatropha curcas]
Length=466

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW+ F    LN++RPHLVE ++SS +VISNLTF+N+P W I P YCS
Sbjct  152  TGDNGTIDGQGSIWWDWFKTETLNFTRPHLVELMNSSGIVISNLTFINSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V+VQN+T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  212  QVIVQNVTIRAPLDSPNTDGIDPDSSDDVCIEDCFISTG  250



>ref|XP_004979886.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=453

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG+VWW+    H LN+SRPHL+EF+ S  +VISNLTFLN+PAW+I P YCS
Sbjct  148  TGNNGVIDGQGSVWWQWLRSHELNHSRPHLLEFLHSEKIVISNLTFLNSPAWSIHPVYCS  207

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV V N+T+ +   +P T+GIVPDS ++VCIE+S +S+
Sbjct  208  NVKVHNVTIKTALDAPLTDGIVPDSCSNVCIEDSTVSV  245



>ref|XP_010909275.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
 ref|XP_010909282.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
Length=438

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW+ F    LN++RPHLVE + S+ VVISNLTF+N+P W I P YCS
Sbjct  122  TGDNGTIDGQGSIWWDWFHNKTLNFTRPHLVELMYSTKVVISNLTFINSPFWTIHPVYCS  181

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NVLV+N+T+ +P  SP T+GI PDS+N+VCIE+  IS G
Sbjct  182  NVLVRNVTILAPLDSPNTDGIDPDSANNVCIEDCYISTG  220



>ref|XP_010909269.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
Length=467

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW+ F    LN++RPHLVE + S+ VVISNLTF+N+P W I P YCS
Sbjct  151  TGDNGTIDGQGSIWWDWFHNKTLNFTRPHLVELMYSTKVVISNLTFINSPFWTIHPVYCS  210

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NVLV+N+T+ +P  SP T+GI PDS+N+VCIE+  IS G
Sbjct  211  NVLVRNVTILAPLDSPNTDGIDPDSANNVCIEDCYISTG  249



>ref|XP_007221479.1| hypothetical protein PRUPE_ppa005310mg [Prunus persica]
 gb|EMJ22678.1| hypothetical protein PRUPE_ppa005310mg [Prunus persica]
Length=467

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW  F    LNY+RPHLVE ++S+ +VISNLTFLN+P W I P YCS
Sbjct  153  TGDNGTIDGQGSIWWNWFHNKTLNYTRPHLVELMNSTGIVISNLTFLNSPFWTIHPVYCS  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V VQN+T+ +P KSP T+GI PDSS++VCIE+  IS G
Sbjct  213  HVTVQNVTIIAPPKSPNTDGIDPDSSDNVCIEDCYISTG  251



>ref|XP_010544928.1| PREDICTED: probable polygalacturonase [Tarenaya hassleriana]
Length=472

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG+VWW+ F    LNY+RPHLVE ++S+ VV+SNLTFLN+P WNI P YCS
Sbjct  155  TGENGTIDGQGSVWWDWFRNGELNYTRPHLVELVNSTGVVVSNLTFLNSPFWNIHPVYCS  214

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+N+T+ +P +SP T+G+ PDSSN VCIE+  I  G
Sbjct  215  DVVVKNLTILAPLESPNTDGVDPDSSNDVCIEDCYIVTG  253



>ref|XP_008227776.1| PREDICTED: probable polygalacturonase [Prunus mume]
 ref|XP_008227777.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=467

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW  F    LNY+RPHLVE ++S+ +VISNLTFLN+P W I P YCS
Sbjct  153  TGDNGTIDGQGSIWWNWFHNKTLNYTRPHLVELMNSTGIVISNLTFLNSPFWTIHPVYCS  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V VQN+T+ +P KSP T+GI PDSS++VCIE+  IS G
Sbjct  213  HVTVQNVTIIAPPKSPNTDGIDPDSSDNVCIEDCYISTG  251



>ref|XP_006663646.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=449

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG +DGQG++WW+    H LN+SRPH+VEF++S  +V+SNLTFLN+PAW+I P YCS
Sbjct  144  TGNNGVVDGQGSIWWDWLQSHELNHSRPHIVEFMNSQQIVVSNLTFLNSPAWSIHPVYCS  203

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV V N+T+ +   +P T+GIVPDS ++VCIE+S+IS+
Sbjct  204  NVKVHNVTIKTSLDAPLTDGIVPDSCSNVCIEDSSISV  241



>gb|EMT06204.1| Putative polygalacturonase [Aegilops tauschii]
Length=532

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG+VWW+    H LN+SRPHLVEF+ S  +VISNLTFLN+PAW+I P YCS
Sbjct  227  TGNNGLIDGQGSVWWDWLRSHELNHSRPHLVEFLYSEEIVISNLTFLNSPAWSIHPVYCS  286

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV V N+T+ +   +P T+GIVPDS  +VCIE+S IS+
Sbjct  287  NVKVHNVTIKTLLDAPLTDGIVPDSCLNVCIEDSTISV  324



>ref|XP_010464263.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010464264.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=449

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L Y+RPHL+EFI S +V++SNLTFLNAPA+ I   Y S
Sbjct  152  TGDNGTIDGQGLVWWDRFTSHSLKYNRPHLIEFILSENVIVSNLTFLNAPAYTIHSIYSS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I  HS  +SPYT GIVPDSS++VCI+NS I++G
Sbjct  212  HVYIHKILAHSSPESPYTIGIVPDSSDNVCIQNSTINVG  250



>ref|XP_006664631.1| PREDICTED: probable polygalacturonase-like, partial [Oryza brachyantha]
Length=408

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG  WW  F  + LNYSRPHLVEF+ S  +VISNLT LN+PAW I P +CS
Sbjct  103  TGNNGIIDGQGLTWWNWFRSNKLNYSRPHLVEFVDSEDIVISNLTLLNSPAWGIHPVFCS  162

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NVLV N+T+ S   +P T+GIVPDS +++CIE+S+IS+
Sbjct  163  NVLVHNVTIQSSLDAPLTDGIVPDSCSNMCIEDSSISV  200



>ref|XP_010914786.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=470

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTI+GQG VWW+ F  H LNY+RPHL+E + S+ VVISNLTF N+P W I P YCS
Sbjct  153  TGDNGTINGQGIVWWDWFQNHTLNYTRPHLIELMYSTEVVISNLTFKNSPFWAIHPVYCS  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             VLVQN+T+ +P  SP T+GI PDSS +VCIE+  IS G
Sbjct  213  QVLVQNVTILAPLDSPNTDGIDPDSSTNVCIEDCYISTG  251



>gb|EMT30389.1| Putative polygalacturonase [Aegilops tauschii]
Length=449

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGN+G +DGQG +WW  F  + LNYSRPHLVEF  S  +VISNLTFL++PAW I P YCS
Sbjct  144  TGNSGIVDGQGLIWWNWFRSNKLNYSRPHLVEFEDSEEIVISNLTFLDSPAWGIHPVYCS  203

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV ++N+T+ +   +P TNGIVPDS +++CIE+S IS+G
Sbjct  204  NVTIRNVTIETGLDAPLTNGIVPDSCSNMCIEDSRISVG  242



>gb|AFW56470.1| polygalacturonase [Zea mays]
Length=458

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG+ WW  F  + LNYSRPHLVEF+ S  +VISN+TFLN+PAW+I P YCS
Sbjct  150  TGNNGTIDGQGSTWWNWFRSNKLNYSRPHLVEFVDSEQIVISNITFLNSPAWSIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV+V ++T+ +   +P  +GIVPDS +++CIE+S+IS+
Sbjct  210  NVVVHSVTIQTSLDAPLNHGIVPDSCSNMCIEDSSISV  247



>ref|XP_002320934.2| hypothetical protein POPTR_0014s10770g [Populus trichocarpa]
 gb|EEE99249.2| hypothetical protein POPTR_0014s10770g [Populus trichocarpa]
Length=463

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW  F    L+Y+RPHLVE ++++ VVISNLTFLN+P W I P YCS
Sbjct  152  TGDNGTIDGQGSIWWNWFRNETLDYTRPHLVELMNTTGVVISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V+VQN+T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  212  QVIVQNVTILAPLDSPNTDGIDPDSSDDVCIEDCYISTG  250



>ref|NP_001148987.1| polygalacturonase precursor [Zea mays]
 gb|ACG33729.1| polygalacturonase [Zea mays]
Length=458

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG+ WW  F  + LNYSRPHLVEF+ S  +VISN+TFLN+PAW+I P YCS
Sbjct  150  TGNNGTIDGQGSTWWNWFRSNKLNYSRPHLVEFVDSEQIVISNITFLNSPAWSIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV+V ++T+ +   +P  +GIVPDS +++CIE+S+IS+
Sbjct  210  NVVVHSVTIQTSLDAPLNHGIVPDSCSNMCIEDSSISV  247



>ref|XP_006395083.1| hypothetical protein EUTSA_v10004215mg [Eutrema salsugineum]
 gb|ESQ32369.1| hypothetical protein EUTSA_v10004215mg [Eutrema salsugineum]
Length=447

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG +WW++F+  +L +SRPHLVEF+SS +V++SNLTFLNAPA+ I   YCS
Sbjct  150  TGDNGTIDGQGLLWWDRFNSQSLEHSRPHLVEFVSSENVIVSNLTFLNAPAYTIHSVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  +T ++  +SPYT GIVPDSS +VCI++S I+MG
Sbjct  210  HVYIHKVTANTSPQSPYTIGIVPDSSENVCIQDSIINMG  248



>emb|CDX74085.1| BnaA03g29620D [Brassica napus]
Length=380

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L Y+RPHLVEFISS  + ISN+TFLNAP + +   Y S
Sbjct  83   TGDNGTIDGQGLVWWDRFASHSLKYNRPHLVEFISSEDITISNVTFLNAPCYTVHAIYSS  142

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I  HS   SPYT GIVPDSS++VCI+NS I+MG
Sbjct  143  HVYIHKILAHSSPGSPYTIGIVPDSSDNVCIQNSTINMG  181



>ref|XP_009134926.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=449

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L Y+RPHLVEFISS  + ISN+TFLNAP + +   Y S
Sbjct  152  TGDNGTIDGQGLVWWDRFTSHSLKYNRPHLVEFISSQDITISNVTFLNAPCYTVHAIYSS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I  HS   SPYT GIVPDSS++VCI+NS I+MG
Sbjct  212  HVYIDKILAHSSPGSPYTIGIVPDSSDNVCIQNSTINMG  250



>ref|XP_008661941.1| PREDICTED: polygalacturonase isoform X1 [Zea mays]
Length=449

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG+ WW  F  + LNYSRPHLVEF+ S  +VISN+TFLN+PAW+I P YCS
Sbjct  141  TGNNGTIDGQGSTWWNWFRSNKLNYSRPHLVEFVDSEQIVISNITFLNSPAWSIHPVYCS  200

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV+V ++T+ +   +P  +GIVPDS +++CIE+S+IS+
Sbjct  201  NVVVHSVTIQTSLDAPLNHGIVPDSCSNMCIEDSSISV  238



>ref|XP_011040145.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=469

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WW  F    L+Y+RPHLVE ++++ VVISNLTFLN+P W I P YCS
Sbjct  152  TGDNGTIDGQGSIWWNWFRNETLDYTRPHLVELMNTTGVVISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V+VQN+T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  212  QVIVQNVTILAPLDSPNTDGIDPDSSDDVCIEDCYISTG  250



>emb|CDY08036.1| BnaC03g34870D [Brassica napus]
Length=377

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L Y+RPHLVEFISS  + ISN+TFLNAP + +   Y S
Sbjct  83   TGDNGTIDGQGLVWWDRFTSHSLKYNRPHLVEFISSQDITISNVTFLNAPCYTVHAIYSS  142

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I  HS   SPYT GIVPDSS++VCI+NS I+MG
Sbjct  143  HVYIHKILAHSSPGSPYTIGIVPDSSDNVCIQNSTINMG  181



>ref|XP_002451220.1| hypothetical protein SORBIDRAFT_05g025980 [Sorghum bicolor]
 gb|EES10208.1| hypothetical protein SORBIDRAFT_05g025980 [Sorghum bicolor]
Length=448

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG VWW+    H LN+SRPHL+EF+ S  +VISNLTFLN+PAW+I P YCS
Sbjct  143  TGNNGVIDGQGLVWWQWLLSHELNHSRPHLLEFLYSEDIVISNLTFLNSPAWSIHPVYCS  202

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV V N+T+ +   +P T+GIVPDS +++CIE+S IS+
Sbjct  203  NVKVHNVTIETSLDAPLTDGIVPDSCSNLCIEDSTISV  240



>gb|KFK39027.1| hypothetical protein AALP_AA3G191200 [Arabis alpina]
Length=453

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGT DGQGA WWE  +   LNYSRPH++EF+SS H++ISN+TFLNAP+ NI P YCS
Sbjct  149  TGDNGTFDGQGAAWWEWLETGTLNYSRPHIIEFVSSKHILISNVTFLNAPSINIHPVYCS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V ++ + + +   SPY  G+VPDSSN+VCIE+S I++G
Sbjct  209  QVHIRKVLIETSIDSPYVLGVVPDSSNNVCIEDSTINVG  247



>ref|XP_010444937.1| PREDICTED: probable polygalacturonase isoform X2 [Camelina sativa]
Length=379

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L Y+RPHL+EFI S +V++SNLTFLNAPA  I   Y S
Sbjct  83   TGDNGTIDGQGLVWWDRFTSHSLKYNRPHLIEFILSENVIVSNLTFLNAPAHTIHSVYSS  142

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I  HS  +SPYT GIVPDSS++VCI+NS I++G
Sbjct  143  HVYIHKILAHSSPESPYTIGIVPDSSDNVCIQNSTINVG  181



>ref|XP_006406800.1| hypothetical protein EUTSA_v10020710mg [Eutrema salsugineum]
 gb|ESQ48253.1| hypothetical protein EUTSA_v10020710mg [Eutrema salsugineum]
Length=454

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGT DGQGA WWE  +   LNYSRPH++EF+SS H++ISNLTFLNAP+ NI P YCS
Sbjct  149  TGDNGTFDGQGAAWWEWLESGTLNYSRPHIIEFVSSKHILISNLTFLNAPSVNIHPVYCS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V ++ + + +   SPY  G+VPDSS++VC+E+S I++G
Sbjct  209  QVHIRKVLIETSVDSPYVLGVVPDSSDNVCVEDSTINVG  247



>ref|XP_009135502.1| PREDICTED: probable polygalacturonase isoform X2 [Brassica rapa]
Length=418

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGT DGQGAVWWE F+   LNYSRPH++E +SS +++ISNLTFLNAP+ NI P YCS
Sbjct  113  TGDNGTFDGQGAVWWEWFESGTLNYSRPHIIELVSSKNILISNLTFLNAPSVNIHPVYCS  172

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V ++ + + +   SPY  G+VPDSS++VCIE+S I++G
Sbjct  173  HVHIRKVLIETTVDSPYVLGVVPDSSDNVCIEDSTINVG  211



>ref|XP_007051305.1| Pectin lyase-like superfamily protein isoform 4 [Theobroma cacao]
 gb|EOX95462.1| Pectin lyase-like superfamily protein isoform 4 [Theobroma cacao]
Length=360

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGT+DGQG+VWW  F    LNY+RPHLVE ++S+ V+I+NLTFLN+P W I P YCS
Sbjct  44   TGDNGTVDGQGSVWWNWFRSKTLNYTRPHLVELMNSTGVLITNLTFLNSPFWTIHPVYCS  103

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V VQN+T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  104  HVTVQNVTILAPLDSPNTDGIDPDSSDDVCIEDCYISTG  142



>ref|XP_010237461.1| PREDICTED: probable polygalacturonase [Brachypodium distachyon]
Length=454

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG I+GQG++WW+    H LN+SRPHLVEF+ S  +VISNLTFLN+PAW+I P YCS
Sbjct  149  TGNNGVINGQGSIWWDWLHSHELNHSRPHLVEFLHSEEIVISNLTFLNSPAWSIHPVYCS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
             V V N+T+ + S +P T+GIVPDSS++V IE+S IS+
Sbjct  209  KVKVHNVTIKTSSDAPLTDGIVPDSSSNVVIEDSTISV  246



>gb|KEH43186.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=406

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW +F    L+++RPHLVE I+S+ V+ISN TFLN+P W I P YCS
Sbjct  87   TGNNGTIDGQGSIWWSKFRNKTLDHTRPHLVELINSTEVLISNATFLNSPFWTIHPVYCS  146

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV VQN+T+  P  SP T+GI PDSS++VCIE+  IS G
Sbjct  147  NVTVQNVTIIVPFGSPNTDGIDPDSSDNVCIEDCYISTG  185



>ref|XP_010444882.1| PREDICTED: probable polygalacturonase isoform X1 [Camelina sativa]
Length=448

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L Y+RPHL+EFI S +V++SNLTFLNAPA  I   Y S
Sbjct  152  TGDNGTIDGQGLVWWDRFTSHSLKYNRPHLIEFILSENVIVSNLTFLNAPAHTIHSVYSS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I  HS  +SPYT GIVPDSS++VCI+NS I++G
Sbjct  212  HVYIHKILAHSSPESPYTIGIVPDSSDNVCIQNSTINVG  250



>ref|XP_010241441.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=474

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW  F    LNY+RPHLVEFI+S+ VVISNLTFLN+P W I P YCS
Sbjct  152  TGDNGTIDGQGHVWWNWFRNGNLNYTRPHLVEFINSTGVVISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             VLVQ  T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  212  QVLVQKATILAPLHSPNTDGIDPDSSSDVCIEDCYISTG  250



>emb|CDX82390.1| BnaA03g34310D [Brassica napus]
Length=449

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGT DGQGAVWWE F+   LNYSRPH++E +SS +++ISNLTFLNAP+ NI P YCS
Sbjct  144  TGDNGTFDGQGAVWWEWFESGTLNYSRPHIIELVSSKNILISNLTFLNAPSVNIHPVYCS  203

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V ++ + + +   SPY  G+VPDSS++VCIE+S I++G
Sbjct  204  HVHIRKVLIETTVDSPYVLGVVPDSSDNVCIEDSTINVG  242



>ref|XP_007145093.1| hypothetical protein PHAVU_007G209200g [Phaseolus vulgaris]
 gb|ESW17087.1| hypothetical protein PHAVU_007G209200g [Phaseolus vulgaris]
Length=464

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW++F    L Y+RPHLVE ++S+ V+ISN+TFLN+P W I P YCS
Sbjct  154  TGNNGTIDGQGSIWWDKFRNKTLGYTRPHLVELMNSTGVLISNVTFLNSPFWTIHPVYCS  213

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+TV +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  214  HVTIQNVTVIAPHGSPNTDGINPDSSDNVCIEDCYISTG  252



>ref|XP_009135501.1| PREDICTED: probable polygalacturonase isoform X1 [Brassica rapa]
Length=451

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGT DGQGAVWWE F+   LNYSRPH++E +SS +++ISNLTFLNAP+ NI P YCS
Sbjct  146  TGDNGTFDGQGAVWWEWFESGTLNYSRPHIIELVSSKNILISNLTFLNAPSVNIHPVYCS  205

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V ++ + + +   SPY  G+VPDSS++VCIE+S I++G
Sbjct  206  HVHIRKVLIETTVDSPYVLGVVPDSSDNVCIEDSTINVG  244



>emb|CDY54633.1| BnaCnng27510D [Brassica napus]
Length=448

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGT DGQGAVWWE F+   LNYSRPH++E +SS +++ISNLTFLNAP+ NI P YCS
Sbjct  143  TGDNGTFDGQGAVWWEWFESGTLNYSRPHIIELVSSKNILISNLTFLNAPSVNIHPVYCS  202

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V ++ + + +   SPY  G+VPDSS++VCIE+S I++G
Sbjct  203  HVHIRKVLIETTVDSPYVLGVVPDSSDNVCIEDSTINVG  241



>ref|XP_010442382.1| PREDICTED: probable polygalacturonase isoform X3 [Camelina sativa]
Length=412

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F+ ++L YSRPHL+EF+SS +V +SNLTFLNAPA+ I   Y +
Sbjct  115  TGDNGTIDGQGLVWWDRFNTNSLEYSRPHLIEFVSSENVFVSNLTFLNAPAYTIHSVYSN  174

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + N+T ++  +SPYT GIVPDSS ++CI++S I MG
Sbjct  175  NVYIHNVTANTSPESPYTIGIVPDSSVNMCIQDSTIKMG  213



>ref|XP_010241442.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=391

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW  F    LNY+RPHLVEFI+S+ VVISNLTFLN+P W I P YCS
Sbjct  69   TGDNGTIDGQGHVWWNWFRNGNLNYTRPHLVEFINSTGVVISNLTFLNSPFWTIHPVYCS  128

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             VLVQ  T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  129  QVLVQKATILAPLHSPNTDGIDPDSSSDVCIEDCYISTG  167



>ref|XP_007051304.1| Pectin lyase-like superfamily protein isoform 3, partial [Theobroma 
cacao]
 gb|EOX95461.1| Pectin lyase-like superfamily protein isoform 3, partial [Theobroma 
cacao]
Length=422

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGT+DGQG+VWW  F    LNY+RPHLVE ++S+ V+I+NLTFLN+P W I P YCS
Sbjct  156  TGDNGTVDGQGSVWWNWFRSKTLNYTRPHLVELMNSTGVLITNLTFLNSPFWTIHPVYCS  215

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V VQN+T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  216  HVTVQNVTILAPLDSPNTDGIDPDSSDDVCIEDCYISTG  254



>ref|XP_003575492.1| PREDICTED: probable polygalacturonase [Brachypodium distachyon]
Length=451

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG  WW  F  + LNYSRPHLVEF  S  +VISNLTFLN+PAW I P YCS
Sbjct  146  TGNNGVIDGQGLTWWNWFRSNKLNYSRPHLVEFEDSEEIVISNLTFLNSPAWAIHPVYCS  205

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV V NIT+ +   +P ++GIVPDS ++VCIE+S IS+
Sbjct  206  NVTVNNITIQTSLDAPLSDGIVPDSCSNVCIEDSRISV  243



>gb|AES61557.2| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=510

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW +F    L+++RPHLVE I+S+ V+ISN TFLN+P W I P YCS
Sbjct  191  TGNNGTIDGQGSIWWSKFRNKTLDHTRPHLVELINSTEVLISNATFLNSPFWTIHPVYCS  250

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV VQN+T+  P  SP T+GI PDSS++VCIE+  IS G
Sbjct  251  NVTVQNVTIIVPFGSPNTDGIDPDSSDNVCIEDCYISTG  289



>ref|XP_010486208.1| PREDICTED: probable polygalacturonase isoform X2 [Camelina sativa]
Length=379

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L Y+RPHL+EFI S +V++SNLTFLNAPA  I   Y S
Sbjct  83   TGDNGTIDGQGLVWWDRFTSHSLKYNRPHLIEFILSENVIVSNLTFLNAPAHTIHSIYSS  142

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I  HS  +SPYT GIVPDSS++VCI+NS I++G
Sbjct  143  HVYIHKILAHSSPESPYTIGIVPDSSDNVCIQNSTINVG  181



>ref|XP_010486207.1| PREDICTED: probable polygalacturonase isoform X1 [Camelina sativa]
Length=448

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F  H+L Y+RPHL+EFI S +V++SNLTFLNAPA  I   Y S
Sbjct  152  TGDNGTIDGQGLVWWDRFTSHSLKYNRPHLIEFILSENVIVSNLTFLNAPAHTIHSIYSS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +  I  HS  +SPYT GIVPDSS++VCI+NS I++G
Sbjct  212  HVYIHKILAHSSPESPYTIGIVPDSSDNVCIQNSTINVG  250



>ref|XP_008788175.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=468

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW+ F    LN++RPHLVE + S+ VVISNLTF+N+P W I P YCS
Sbjct  152  TGDNGTIDGQGSVWWDWFHNMTLNFTRPHLVELMYSTKVVISNLTFINSPFWAIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +VLV+ +T+ +P  SP T+GI PDSSN+VCIE   IS G
Sbjct  212  DVLVEKVTILAPPDSPNTDGIDPDSSNNVCIEECYISTG  250



>ref|XP_006444619.1| hypothetical protein CICLE_v10020035mg [Citrus clementina]
 ref|XP_006492425.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
 gb|ESR57859.1| hypothetical protein CICLE_v10020035mg [Citrus clementina]
 gb|KDO86775.1| hypothetical protein CISIN_1g012308mg [Citrus sinensis]
Length=466

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG++WWE F    L+Y+RPHLVE ++S+ V+ISNLTFLN P W I P YCS
Sbjct  152  TGDNGTIDGQGSIWWEWFRNGTLDYTRPHLVELMNSTGVIISNLTFLNPPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V VQN+T+ +P  SP T+GI PDSS+ VCI++  IS G
Sbjct  212  HVKVQNVTIRAPLDSPNTDGIDPDSSDDVCIKDCYISTG  250



>ref|XP_010442381.1| PREDICTED: probable polygalacturonase isoform X2 [Camelina sativa]
Length=440

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F+ ++L YSRPHL+EF+SS +V +SNLTFLNAPA+ I   Y +
Sbjct  143  TGDNGTIDGQGLVWWDRFNTNSLEYSRPHLIEFVSSENVFVSNLTFLNAPAYTIHSVYSN  202

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + N+T ++  +SPYT GIVPDSS ++CI++S I MG
Sbjct  203  NVYIHNVTANTSPESPYTIGIVPDSSVNMCIQDSTIKMG  241



>gb|EMS65348.1| putative polygalacturonase [Triticum urartu]
Length=816

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG VWW+    H LN+SRPHLVEF+ S  +VISNLTFLN+PAW+I P YCS
Sbjct  511  TGNNGLIDGQGLVWWDWLRSHELNHSRPHLVEFLYSEEIVISNLTFLNSPAWSIHPVYCS  570

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV V N+T+ +   +P T+GIVPDS  +VCIE+S IS+
Sbjct  571  NVKVHNVTIKTLLDAPLTDGIVPDSCLNVCIEDSTISV  608



>ref|XP_007051302.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007051303.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX95459.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX95460.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=468

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGT+DGQG+VWW  F    LNY+RPHLVE ++S+ V+I+NLTFLN+P W I P YCS
Sbjct  152  TGDNGTVDGQGSVWWNWFRSKTLNYTRPHLVELMNSTGVLITNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V VQN+T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  212  HVTVQNVTILAPLDSPNTDGIDPDSSDDVCIEDCYISTG  250



>ref|XP_010442380.1| PREDICTED: probable polygalacturonase isoform X1 [Camelina sativa]
Length=444

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F+ ++L YSRPHL+EF+SS +V +SNLTFLNAPA+ I   Y +
Sbjct  147  TGDNGTIDGQGLVWWDRFNTNSLEYSRPHLIEFVSSENVFVSNLTFLNAPAYTIHSVYSN  206

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + N+T ++  +SPYT GIVPDSS ++CI++S I MG
Sbjct  207  NVYIHNVTANTSPESPYTIGIVPDSSVNMCIQDSTIKMG  245



>ref|XP_006604763.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=468

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW +F    L+Y+RPHLVE ++S+ V+ISNLTFLN+P W I P YCS
Sbjct  152  TGNNGTIDGQGSIWWNRFMNRTLDYTRPHLVELMNSTGVLISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V VQN+ + +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  212  QVTVQNVRILAPHDSPNTDGIDPDSSDNVCIEDCYISTG  250



>ref|XP_003554577.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=467

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW +F    L+Y+RPHLVE ++S+ V+ISNLTFLN+P W I P YCS
Sbjct  152  TGNNGTIDGQGSIWWNRFMNRTLDYTRPHLVELMNSTGVLISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V VQN+ + +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  212  QVTVQNVRILAPHDSPNTDGIDPDSSDNVCIEDCYISTG  250



>ref|XP_008676433.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|ACF82423.1| unknown [Zea mays]
Length=335

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG VWW+    H LN+SRP+L+EF+ S  +VISNLTFLN+PAW+I P YCS
Sbjct  153  TGNNGVIDGQGLVWWQWLRSHELNHSRPNLLEFLYSEDIVISNLTFLNSPAWSIHPVYCS  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV V N+T+ +   +P T+GIVPDS +++CIE+S IS+
Sbjct  213  NVKVHNVTIKTSLDAPLTDGIVPDSCSNLCIEDSTISV  250



>ref|XP_010676306.1| PREDICTED: probable polygalacturonase [Beta vulgaris subsp. vulgaris]
Length=441

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGT+DGQG VWW  + Q  L Y+RPHL+EF+ SSH++ISN+ F N+P WN+ P YCS
Sbjct  149  TGENGTVDGQGDVWWNMWRQRTLQYTRPHLIEFMHSSHIIISNVIFKNSPFWNVHPVYCS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV+V+ +T+ +P  SP T+GI PDSS++VCIE+S +S G
Sbjct  209  NVVVRYVTILAPVDSPNTDGIDPDSSSNVCIEDSYVSTG  247



>gb|EMS62381.1| putative polygalacturonase [Triticum urartu]
Length=269

 Score =   129 bits (323),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG+VWW+ + +  L ++RPHL+E + SS+ ++SNL F ++P WNI P YCS
Sbjct  55   TGENGTIDGQGSVWWDMWKKGTLPFTRPHLLELMDSSNAIVSNLVFQDSPFWNIHPVYCS  114

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NVL++N+T+ +P  SP T+GI PDSS++VCIE+ NIS G
Sbjct  115  NVLIRNLTILAPHDSPNTDGIDPDSSSNVCIEDCNISTG  153



>ref|XP_010068401.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
Length=341

 Score =   130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            T +NGTIDGQGA WW+ F  H+LNYS PH +EF+ + HVV+SN+TFLNA A+NI P YCS
Sbjct  182  TSDNGTIDGQGAFWWDLFTTHSLNYSHPHFMEFVEAKHVVVSNITFLNA-AYNIHPVYCS  240

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +  +QN+++ +  +SP+T GIVPDSS+++CIE+ +ISMG
Sbjct  241  DAHIQNVSITASPESPHTVGIVPDSSDNICIEDCSISMG  279



>ref|XP_003591306.1| Polygalacturonase-like protein [Medicago truncatula]
Length=601

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW +F    L+++RPHLVE I+S+ V+ISN TFLN+P W I P YCS
Sbjct  282  TGNNGTIDGQGSIWWSKFRNKTLDHTRPHLVELINSTEVLISNATFLNSPFWTIHPVYCS  341

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV VQN+T+  P  SP T+GI PDSS++VCIE+  IS G
Sbjct  342  NVTVQNVTIIVPFGSPNTDGIDPDSSDNVCIEDCYISTG  380



>ref|XP_007163248.1| hypothetical protein PHAVU_001G218400g [Phaseolus vulgaris]
 gb|ESW35242.1| hypothetical protein PHAVU_001G218400g [Phaseolus vulgaris]
Length=465

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW  F    L+Y+RPHL+E ++S+ V+ISNLTFLN+P W + P YCS
Sbjct  151  TGNNGTIDGQGSIWWSMFRNKTLDYTRPHLIELMNSTGVLISNLTFLNSPFWTLHPVYCS  210

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V VQ +T+ +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  211  HVTVQKVTIFAPLDSPNTDGIDPDSSDNVCIEDCYISTG  249



>ref|XP_002459610.1| hypothetical protein SORBIDRAFT_02g007470 [Sorghum bicolor]
 gb|EER96131.1| hypothetical protein SORBIDRAFT_02g007470 [Sorghum bicolor]
Length=499

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQGAVWW+ F  H LNY+RP LVE + S+ VVISNLTF+N+P WNI P YCS
Sbjct  169  TGSNGTIDGQGAVWWDWFHNHTLNYTRPPLVELMYSTRVVISNLTFINSPFWNIHPVYCS  228

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             VL Q++T+ +P  SP T+GI PDSS +VCIE+  I  G
Sbjct  229  QVLAQHLTILAPISSPNTDGIDPDSSTNVCIEDCYIRNG  267



>ref|XP_006576262.1| PREDICTED: uncharacterized protein LOC100817309 isoform X1 [Glycine 
max]
Length=468

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW +F   +L+Y+RPHLVE ++S+ V+ISNLTFLN+P W I P YCS
Sbjct  152  TGNNGTIDGQGSIWWNRFWNRSLDYTRPHLVELMNSTGVLISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V VQN+ + +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  212  QVTVQNVRILAPHDSPNTDGIDPDSSDNVCIEDCYISTG  250



>ref|XP_006576263.1| PREDICTED: uncharacterized protein LOC100817309 isoform X2 [Glycine 
max]
Length=463

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW +F   +L+Y+RPHLVE ++S+ V+ISNLTFLN+P W I P YCS
Sbjct  152  TGNNGTIDGQGSIWWNRFWNRSLDYTRPHLVELMNSTGVLISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V VQN+ + +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  212  QVTVQNVRILAPHDSPNTDGIDPDSSDNVCIEDCYISTG  250



>ref|NP_001241086.1| uncharacterized protein LOC100817309 precursor [Glycine max]
 gb|ACU18828.1| unknown [Glycine max]
Length=467

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW +F   +L+Y+RPHLVE ++S+ V+ISNLTFLN+P W I P YCS
Sbjct  152  TGNNGTIDGQGSIWWNRFWNRSLDYTRPHLVELMNSTGVLISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V VQN+ + +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  212  QVTVQNVRILAPHDSPNTDGIDPDSSDNVCIEDCYISTG  250



>gb|ABA99544.2| glycoside hydrolase family 28 protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EEE53403.1| hypothetical protein OsJ_36464 [Oryza sativa Japonica Group]
Length=457

 Score =   131 bits (329),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG  WW  F  + LNYSRPHLVEF+ S  +VISNLT LN+PAW I P +CS
Sbjct  152  TGNNGIIDGQGLTWWNWFRSNKLNYSRPHLVEFVDSEDIVISNLTLLNSPAWGIHPVFCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV+V ++T+ +   +P T+GIVPDS +++CIE+S+IS+
Sbjct  212  NVMVHDVTIRTSLDAPLTDGIVPDSCSNMCIEDSSISV  249



>ref|XP_008676432.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28601.1| unknown [Zea mays]
Length=376

 Score =   130 bits (327),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG VWW+    H LN+SRP+L+EF+ S  +VISNLTFLN+PAW+I P YCS
Sbjct  153  TGNNGVIDGQGLVWWQWLRSHELNHSRPNLLEFLYSEDIVISNLTFLNSPAWSIHPVYCS  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV V N+T+ +   +P T+GIVPDS +++CIE+S IS+
Sbjct  213  NVKVHNVTIKTSLDAPLTDGIVPDSCSNLCIEDSTISV  250



>ref|NP_001066993.1| Os12g0554800 [Oryza sativa Japonica Group]
 dbj|BAF30012.1| Os12g0554800, partial [Oryza sativa Japonica Group]
Length=424

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG  WW  F  + LNYSRPHLVEF+ S  +VISNLT LN+PAW I P +CS
Sbjct  119  TGNNGIIDGQGLTWWNWFRSNKLNYSRPHLVEFVDSEDIVISNLTLLNSPAWGIHPVFCS  178

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV+V ++T+ +   +P T+GIVPDS +++CIE+S+IS+
Sbjct  179  NVMVHDVTIRTSLDAPLTDGIVPDSCSNMCIEDSSISV  216



>ref|NP_001183080.1| hypothetical protein precursor [Zea mays]
 gb|ACR35653.1| unknown [Zea mays]
 tpg|DAA60155.1| TPA: hypothetical protein ZEAMMB73_186239 [Zea mays]
Length=490

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGT+DGQGAVWW+ F  H LNY+RP LVE + S+ VVISNLTF+N+P WNI P YCS
Sbjct  162  TGANGTVDGQGAVWWDWFHNHTLNYTRPPLVELMYSTRVVISNLTFINSPFWNIHPVYCS  221

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             VLVQ++T+ +P  SP T+GI PDSS +VCIE+  +  G
Sbjct  222  QVLVQHLTILAPISSPNTDGIDPDSSTNVCIEDCYVRNG  260



>gb|KHN14175.1| Putative polygalacturonase [Glycine soja]
Length=489

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW +F   +L+Y+RPHLVE ++S+ V+ISNLTFLN+P W I P YCS
Sbjct  174  TGNNGTIDGQGSIWWNRFWNRSLDYTRPHLVELMNSTGVLISNLTFLNSPFWTIHPVYCS  233

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V VQN+ + +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  234  QVTVQNVRILAPHDSPNTDGIDPDSSDNVCIEDCYISTG  272



>gb|KHN43408.1| Putative polygalacturonase [Glycine soja]
Length=563

 Score =   131 bits (330),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW +F    L+Y+RPHLVE ++S+ V+ISNLTFLN+P W I P YCS
Sbjct  250  TGNNGTIDGQGSIWWNRFMNRTLDYTRPHLVELMNSTGVLISNLTFLNSPFWTIHPVYCS  309

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V VQN+ + +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  310  QVTVQNVRILAPHDSPNTDGIDPDSSDNVCIEDCYISTG  348



>ref|XP_003626072.1| Polygalacturonase [Medicago truncatula]
 gb|AES82290.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=466

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGN G IDGQG++WW  F    L+Y+RPHLVE ++S+ V+ISNLTFLN+P W I P YCS
Sbjct  152  TGNEGIIDGQGSIWWSMFRNKTLDYTRPHLVELMNSTRVLISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V VQN+T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  212  QVTVQNVTILAPLDSPNTDGIDPDSSDDVCIEDCYISTG  250



>ref|XP_008807372.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=455

 Score =   131 bits (329),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 79/98 (81%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG+VWW  F  H LN+SRPHLVE +SS+ VVISNL FL+ PAW+I P YC 
Sbjct  149  TGDNGTIDGQGSVWWGWFRSHTLNFSRPHLVELVSSNDVVISNLIFLDPPAWSIHPVYCG  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            N+ V+NIT+H+ S S +T+GIVPDS ++V IE+ +IS+
Sbjct  209  NLEVRNITIHASSNSSFTSGIVPDSCSNVSIEDCSISV  246



>gb|KEH24447.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=466

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGN G IDGQG++WW  F    L+Y+RPHLVE ++S+ V+ISNLTFLN+P W I P YCS
Sbjct  152  TGNEGIIDGQGSIWWSMFRNKTLDYTRPHLVELMNSTRVLISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V VQN+T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  212  QVTVQNVTILAPLDSPNTDGIDPDSSDDVCIEDCYISTG  250



>ref|XP_002883030.1| hypothetical protein ARALYDRAFT_318449 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59289.1| hypothetical protein ARALYDRAFT_318449 [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGT DGQGA WWE  +  +LNYSRPH++EF+SS H++ISNLTFLNAP+ NI P YCS
Sbjct  147  TGENGTFDGQGAAWWEWLETGSLNYSRPHIIEFVSSKHILISNLTFLNAPSINIHPVYCS  206

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             + ++ + + +   SPY  G+ PDSS++VCIE+S I++G
Sbjct  207  QIHIRKVLIETSVDSPYVLGVAPDSSDNVCIEDSTINVG  245



>ref|XP_009146055.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=455

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGT DGQGA WWE  +   LNYSRPH++EF+SS +++ISNLTFLNAP+ NI P YCS
Sbjct  150  TGDNGTFDGQGAAWWEWLESGTLNYSRPHIIEFVSSKNILISNLTFLNAPSVNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V ++ + + +   SPY  G+VPDSS++VCIE+S I++G
Sbjct  210  HVHIKKVLIETSVDSPYVLGVVPDSSDNVCIEDSTINVG  248



>emb|CDX92101.1| BnaA05g23060D [Brassica napus]
Length=455

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGT DGQGA WWE  +   LNYSRPH++EF+SS +++ISNLTFLNAP+ NI P YCS
Sbjct  150  TGDNGTFDGQGAAWWEWLESGTLNYSRPHIIEFVSSKNILISNLTFLNAPSVNIHPVYCS  209

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V ++ + + +   SPY  G+VPDSS++VCIE+S I++G
Sbjct  210  HVHIKKVLIETSVDSPYVLGVVPDSSDNVCIEDSTINVG  248



>ref|XP_004494475.1| PREDICTED: probable polygalacturonase-like isoform X2 [Cicer 
arietinum]
Length=466

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGN G IDGQG++WW +F    L+Y+RPHLVE ++S+ ++ISNLTFLN+P W I P YCS
Sbjct  152  TGNEGIIDGQGSIWWSKFRNKTLDYTRPHLVELMNSTGILISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V VQN+T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  212  QVTVQNVTILAPLDSPNTDGIDPDSSDDVCIEDCYISTG  250



>ref|XP_010271039.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=474

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW  F    LNY+RPHLVE ++S+ V++SNLTFLN+P W I P YCS
Sbjct  152  TGDNGTIDGQGNVWWNWFRNGTLNYTRPHLVELMNSTGVIVSNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V+VQ++T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  212  EVVVQDVTILAPLDSPNTDGINPDSSDDVCIEDCYISTG  250



>ref|NP_001130359.1| hypothetical protein precursor [Zea mays]
 gb|ACF78550.1| unknown [Zea mays]
 gb|AFW60189.1| hypothetical protein ZEAMMB73_155387 [Zea mays]
Length=458

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNG IDGQG VWW+    H LN+SRP+L+EF+ S  +VISNLTFLN+PAW+I P YCS
Sbjct  153  TGNNGVIDGQGLVWWQWLRSHELNHSRPNLLEFLYSEDIVISNLTFLNSPAWSIHPVYCS  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISM  295
            NV V N+T+ +   +P T+GIVPDS +++CIE+S IS+
Sbjct  213  NVKVHNVTIKTSLDAPLTDGIVPDSCSNLCIEDSTISV  250



>ref|XP_010271038.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=478

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW  F    LNY+RPHLVE ++S+ V++SNLTFLN+P W I P YCS
Sbjct  156  TGDNGTIDGQGNVWWNWFRNGTLNYTRPHLVELMNSTGVIVSNLTFLNSPFWTIHPVYCS  215

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V+VQ++T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  216  EVVVQDVTILAPLDSPNTDGINPDSSDDVCIEDCYISTG  254



>ref|XP_006280304.1| hypothetical protein CARUB_v10026227mg, partial [Capsella rubella]
 gb|EOA13202.1| hypothetical protein CARUB_v10026227mg, partial [Capsella rubella]
Length=524

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++++ ++L +SRPHL+EF+SS +V +SNLTFLNAPA+ I   Y  
Sbjct  227  TGDNGTIDGQGLVWWDRYNSNSLEHSRPHLIEFVSSENVFVSNLTFLNAPAYTIHSVYSR  286

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + N+T ++  +SPYT GIVPDSS +VCI++S I+MG
Sbjct  287  NVYIHNVTANTSPESPYTVGIVPDSSENVCIQDSTINMG  325



>ref|XP_004494474.1| PREDICTED: probable polygalacturonase-like isoform X1 [Cicer 
arietinum]
Length=467

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGN G IDGQG++WW +F    L+Y+RPHLVE ++S+ ++ISNLTFLN+P W I P YCS
Sbjct  152  TGNEGIIDGQGSIWWSKFRNKTLDYTRPHLVELMNSTGILISNLTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             V VQN+T+ +P  SP T+GI PDSS+ VCIE+  IS G
Sbjct  212  QVTVQNVTILAPLDSPNTDGIDPDSSDDVCIEDCYISTG  250



>ref|XP_002876663.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52922.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=471

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG+VWW+ F    LNY+RPHLVE ++S+ ++ISNLTFLN+P WNI P YC 
Sbjct  152  TGENGTIDGQGSVWWDWFRNGELNYTRPHLVELMNSTGLIISNLTFLNSPFWNIHPVYCR  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+N+T+ +P +SP T+G+ PDSS +VCIE+  I  G
Sbjct  212  DVVVKNLTILAPLESPNTDGVDPDSSTNVCIEDCYIVTG  250



>ref|XP_004955888.1| PREDICTED: probable polygalacturonase-like isoform X1 [Setaria 
italica]
 ref|XP_004955889.1| PREDICTED: probable polygalacturonase-like isoform X2 [Setaria 
italica]
Length=480

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQGA+WW+ F  H LNY+RP LVE + S+ VVISNLTF N+P WNI P YCS
Sbjct  153  TGANGTIDGQGAIWWDWFHNHTLNYTRPPLVELMYSTRVVISNLTFTNSPFWNIHPVYCS  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             VLVQ++T+ +P  SP T+GI PDSS +VCIE+  I  G
Sbjct  213  QVLVQHLTILAPISSPNTDGIDPDSSTNVCIEDCYIRNG  251



>ref|NP_188308.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 gb|AAK59579.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAM44924.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE75873.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=455

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGT DGQGA WWE  +  +LNYSRPH++EF+SS H++ISNLTFLNAPA NI P YCS
Sbjct  149  TGENGTFDGQGAAWWEWLESGSLNYSRPHIIEFVSSKHILISNLTFLNAPAINIHPVYCS  208

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             + ++ + + +   SP+  G+ PDSS++VCIE+S I++G
Sbjct  209  QIHIRKVLIETSVDSPHVLGVAPDSSDNVCIEDSTINVG  247



>ref|XP_006402409.1| hypothetical protein EUTSA_v10005945mg [Eutrema salsugineum]
 ref|XP_006402411.1| hypothetical protein EUTSA_v10005945mg [Eutrema salsugineum]
 ref|XP_006402412.1| hypothetical protein EUTSA_v10005945mg [Eutrema salsugineum]
 gb|ESQ43862.1| hypothetical protein EUTSA_v10005945mg [Eutrema salsugineum]
 gb|ESQ43864.1| hypothetical protein EUTSA_v10005945mg [Eutrema salsugineum]
 gb|ESQ43865.1| hypothetical protein EUTSA_v10005945mg [Eutrema salsugineum]
Length=471

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG++WW+ F    LNY+RPHLVE ++S+ +VISNLTFLN+P WNI P YC 
Sbjct  152  TGENGTIDGQGSIWWDWFRNGELNYTRPHLVELMNSTGLVISNLTFLNSPFWNIHPVYCR  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+N+T+ +P +SP T+G+ PDSS +VCIE+  I  G
Sbjct  212  DVVVKNLTILAPLESPNTDGVDPDSSTNVCIEDCYIVTG  250



>ref|XP_010053124.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 ref|XP_010053125.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW77376.1| hypothetical protein EUGRSUZ_D01730 [Eucalyptus grandis]
Length=449

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG VWW  + Q  L Y+RPHLVEF++S  ++ISN+ F N+P WNI P YCS
Sbjct  152  TGENGTIDGQGEVWWNMWRQRTLQYTRPHLVEFMNSRSIMISNVVFKNSPFWNIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV+++ +T+ +P  SP T+GI PDSS++VCIE+S+IS+G
Sbjct  212  NVVIRYVTILAPYDSPNTDGIDPDSSSNVCIEDSHISVG  250



>dbj|BAA95779.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=453

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGT DGQGA WWE  +  +LNYSRPH++EF+SS H++ISNLTFLNAPA NI P YCS
Sbjct  147  TGENGTFDGQGAAWWEWLESGSLNYSRPHIIEFVSSKHILISNLTFLNAPAINIHPVYCS  206

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             + ++ + + +   SP+  G+ PDSS++VCIE+S I++G
Sbjct  207  QIHIRKVLIETSVDSPHVLGVAPDSSDNVCIEDSTINVG  245



>ref|XP_010512598.1| PREDICTED: probable polygalacturonase isoform X2 [Camelina sativa]
Length=474

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG+VWW+ F    LNY+RPHLVE ++S+ ++ISNLTFLN+P WNI P YC 
Sbjct  153  TGENGTIDGQGSVWWDWFRNGELNYTRPHLVELMNSTGLIISNLTFLNSPFWNIHPVYCR  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+N+T+ +P +SP T+G+ PDSS +VCIE+  I  G
Sbjct  213  DVVVKNLTILAPLESPNTDGVDPDSSTNVCIEDCYIVTG  251



>emb|CAB71871.1| putative protein [Arabidopsis thaliana]
Length=470

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG VWW+ F    LNY+RPHLVE ++S+ ++ISNLTFLN+P WNI P YC 
Sbjct  151  TGENGTIDGQGTVWWDWFRNGELNYTRPHLVELMNSTGLIISNLTFLNSPFWNIHPVYCR  210

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+N+T+ +P +SP T+G+ PDSS +VCIE+  I  G
Sbjct  211  DVVVKNLTILAPLESPNTDGVDPDSSTNVCIEDCYIVTG  249



>ref|XP_010512597.1| PREDICTED: probable polygalacturonase isoform X1 [Camelina sativa]
Length=565

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG+VWW+ F    LNY+RPHLVE ++S+ ++ISNLTFLN+P WNI P YC 
Sbjct  244  TGENGTIDGQGSVWWDWFRNGELNYTRPHLVELMNSTGLIISNLTFLNSPFWNIHPVYCR  303

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+N+T+ +P +SP T+G+ PDSS +VCIE+  I  G
Sbjct  304  DVVVKNLTILAPLESPNTDGVDPDSSTNVCIEDCYIVTG  342



>gb|AAM62920.1| polygalacturonase, putative [Arabidopsis thaliana]
Length=453

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGT DGQGA WWE  +  +LNYSRPH++EF+SS H++ISNLTFLNAPA NI P YCS
Sbjct  147  TGENGTFDGQGAAWWEWLESGSLNYSRPHIIEFVSSKHILISNLTFLNAPAINIHPVYCS  206

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             + ++ + + +   SP+  G+ PDSS++VCIE+S I++G
Sbjct  207  QIHIRKVLIETSVDSPHVLGVAPDSSDNVCIEDSTINVG  245



>ref|NP_567126.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 gb|AAG40344.1|AF324992_1 AT3g62110 [Arabidopsis thaliana]
 gb|AAN31866.1| unknown protein [Arabidopsis thaliana]
 gb|AEE80311.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=471

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG VWW+ F    LNY+RPHLVE ++S+ ++ISNLTFLN+P WNI P YC 
Sbjct  152  TGENGTIDGQGTVWWDWFRNGELNYTRPHLVELMNSTGLIISNLTFLNSPFWNIHPVYCR  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+N+T+ +P +SP T+G+ PDSS +VCIE+  I  G
Sbjct  212  DVVVKNLTILAPLESPNTDGVDPDSSTNVCIEDCYIVTG  250



>ref|XP_006654851.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=306

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG VWW+ + +  L ++RPHL+E ISS+ V+ISN+ F ++P WNI P YCS
Sbjct  15   TGENGTIDGQGNVWWDMWKKRTLPFTRPHLLELISSTDVIISNVVFQDSPFWNIHPVYCS  74

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV++ N+TV +P  SP T+GI PDSS++VCIE+S IS G
Sbjct  75   NVVITNVTVLAPQDSPNTDGIDPDSSSNVCIEDSYISTG  113



>ref|XP_003519731.2| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=464

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW  F    LNY+RPHLVE ++S+ V+ISN+TFLN+P W I P YCS
Sbjct  152  TGNNGTIDGQGSIWWNNFWNKTLNYTRPHLVELMNSTGVLISNVTFLNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+T+ +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  212  HVTIQNVTIIAPLSSPNTDGINPDSSDNVCIEDCYISTG  250



>ref|XP_010523877.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
Length=471

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG VWW+ F    LNY+RPHLVE ++S+ V++S+LT LN+P WNI P YCS
Sbjct  153  TGENGTIDGQGNVWWDWFRSGVLNYTRPHLVELMNSTGVIVSHLTLLNSPFWNIHPVYCS  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+++T+ SP +SP T+G+ PDSSN VCIE+  I  G
Sbjct  213  DVVVKDLTILSPLESPNTDGVAPDSSNDVCIEDCYIVTG  251



>emb|CDX67875.1| BnaA07g19150D [Brassica napus]
Length=458

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG+VWW+ F    LNY+RPH+VE I+++ ++ISNLTFLN+P WNI P YC 
Sbjct  139  TGENGTIDGQGSVWWDWFRHGELNYTRPHIVELINTTGLIISNLTFLNSPFWNIHPVYCR  198

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +VLV+N+T+ +P  SP T+G+ PDSS +VCIE+  I  G
Sbjct  199  DVLVKNLTILAPLDSPNTDGVDPDSSTNVCIEDCYIVTG  237



>gb|KHN00242.1| Putative polygalacturonase [Glycine soja]
Length=472

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW  F    LNY+RPHLVE ++S+ V+ISN+TFLN+P W I P YCS
Sbjct  160  TGNNGTIDGQGSIWWNNFWNKTLNYTRPHLVELMNSTGVLISNVTFLNSPFWTIHPVYCS  219

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+T+ +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  220  HVTIQNVTIIAPLSSPNTDGINPDSSDNVCIEDCYISTG  258



>ref|XP_009104364.1| PREDICTED: probable polygalacturonase [Brassica rapa]
 ref|XP_009104365.1| PREDICTED: probable polygalacturonase [Brassica rapa]
 ref|XP_009104366.1| PREDICTED: probable polygalacturonase [Brassica rapa]
 ref|XP_009104367.1| PREDICTED: probable polygalacturonase [Brassica rapa]
 ref|XP_009104368.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=472

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG+VWW+ F    LNY+RPH+VE I+++ ++ISNLTFLN+P WNI P YC 
Sbjct  153  TGENGTIDGQGSVWWDWFRHGELNYTRPHIVELINTTGLIISNLTFLNSPFWNIHPVYCR  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +VLV+N+T+ +P  SP T+G+ PDSS +VCIE+  I  G
Sbjct  213  DVLVKNLTILAPLDSPNTDGVDPDSSTNVCIEDCYIVTG  251



>ref|XP_010440353.1| PREDICTED: probable polygalacturonase isoform X2 [Camelina sativa]
Length=412

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F+ ++L YSRPHL+E +SS +V +SNLTFLNAPA+ I   Y +
Sbjct  115  TGDNGTIDGQGLVWWDRFNTNSLEYSRPHLIELVSSENVFVSNLTFLNAPAYTIHSVYSN  174

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + N+T ++  +SPYT GIVPDS+ +VCI++S I+MG
Sbjct  175  NVYIHNVTANTSPESPYTIGIVPDSTVNVCIQDSTINMG  213



>ref|XP_010468984.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010468985.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010468986.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=473

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG+VWW+ F    LNY+RPHLVE ++S+ ++ISNLTFLN+P WNI P YC 
Sbjct  153  TGENGTIDGQGSVWWDWFRNGELNYTRPHLVELMNSTGLIISNLTFLNSPFWNIHPVYCR  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+N+T+ +P +SP T+G+ PDSS +VCIE+  I  G
Sbjct  213  DVVVKNLTILAPLESPNTDGVDPDSSTNVCIEDCYIVTG  251



>ref|XP_010523874.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
 ref|XP_010523875.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
Length=493

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG VWW+ F    LNY+RPHLVE ++S+ V++S+LT LN+P WNI P YCS
Sbjct  175  TGENGTIDGQGNVWWDWFRSGVLNYTRPHLVELMNSTGVIVSHLTLLNSPFWNIHPVYCS  234

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+++T+ SP +SP T+G+ PDSSN VCIE+  I  G
Sbjct  235  DVVVKDLTILSPLESPNTDGVAPDSSNDVCIEDCYIVTG  273



>ref|XP_006291055.1| hypothetical protein CARUB_v10017170mg [Capsella rubella]
 gb|EOA23953.1| hypothetical protein CARUB_v10017170mg [Capsella rubella]
Length=471

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG++WW+ F    LNY+RPHLVE ++S+ ++ISNLTFLN+P WNI P YC 
Sbjct  152  TGENGTIDGQGSIWWDWFRNGELNYTRPHLVELMNSTGLIISNLTFLNSPFWNIHPVYCR  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+N+T+ +P +SP T+G+ PDSS +VCIE+  I  G
Sbjct  212  DVVVKNLTILAPLESPNTDGVDPDSSTNVCIEDCYIVTG  250



>emb|CDY25090.1| BnaC06g18320D [Brassica napus]
Length=458

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG+VWW+ F    LNY+RPH+VE I+++ ++ISNLTFLN+P WNI P YC 
Sbjct  139  TGENGTIDGQGSVWWDWFRNGELNYTRPHIVELINTTGLIISNLTFLNSPFWNIHPVYCR  198

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +VLV+N+T+ +P  SP T+G+ PDSS +VCIE+  I  G
Sbjct  199  DVLVKNLTILAPLDSPNTDGVDPDSSTNVCIEDCYIVTG  237



>ref|XP_010440347.1| PREDICTED: probable polygalacturonase isoform X1 [Camelina sativa]
Length=440

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGTIDGQG VWW++F+ ++L YSRPHL+E +SS +V +SNLTFLNAPA+ I   Y +
Sbjct  143  TGDNGTIDGQGLVWWDRFNTNSLEYSRPHLIELVSSENVFVSNLTFLNAPAYTIHSVYSN  202

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            NV + N+T ++  +SPYT GIVPDS+ +VCI++S I+MG
Sbjct  203  NVYIHNVTANTSPESPYTIGIVPDSTVNVCIQDSTINMG  241



>emb|CDY11403.1| BnaA09g39690D [Brassica napus]
Length=460

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG++WW+ F    LNY+RPHLVE ++S+ ++ISNLTFLN+P WNI P YC 
Sbjct  141  TGENGTIDGQGSIWWDWFRNGELNYTRPHLVELMNSTGLIISNLTFLNSPFWNIHPVYCR  200

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+N+T+ +P  SP T+G+ PDSS +VCIE+  I  G
Sbjct  201  DVVVKNLTILAPLDSPNTDGVDPDSSTNVCIEDCYIVTG  239



>emb|CDX95899.1| BnaC05g36500D [Brassica napus]
Length=453

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGT DGQGA WW+  +   LNYSRPH++EF+SS +++ISNLTFLNAP+ NI P YCS
Sbjct  148  TGDNGTFDGQGAAWWKWLESGTLNYSRPHIIEFVSSKNILISNLTFLNAPSVNIHPVYCS  207

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V ++ + + +   SPY  G+VPDSS++VCIE+S I++G
Sbjct  208  HVHIKKVLIETSVDSPYVLGVVPDSSDNVCIEDSTINVG  246



>ref|XP_009116889.1| PREDICTED: probable polygalacturonase [Brassica rapa]
 ref|XP_009116890.1| PREDICTED: probable polygalacturonase [Brassica rapa]
 ref|XP_009116891.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=471

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG++WW+ F    LNY+RPHLVE ++S+ ++ISNLTFLN+P WNI P YC 
Sbjct  152  TGENGTIDGQGSIWWDWFRNGELNYTRPHLVELMNSTGLIISNLTFLNSPFWNIHPVYCR  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+N+T+ +P  SP T+G+ PDSS +VCIE+  I  G
Sbjct  212  DVVVKNLTILAPLDSPNTDGVDPDSSTNVCIEDCYIVTG  250



>gb|KFK35396.1| hypothetical protein AALP_AA5G279500 [Arabis alpina]
Length=469

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG++WW+ F    LNY+RPHLVE ++S+ ++ISNLTFLN+P WNI P YC 
Sbjct  153  TGENGTIDGQGSIWWDWFRNGELNYTRPHLVELMNSTGLIISNLTFLNSPFWNIHPVYCR  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+N+T+ +P  SP T+G+ PDSS++VCIE+  I  G
Sbjct  213  DVVVKNLTILAPLDSPNTDGVDPDSSSNVCIEDCYIVTG  251



>ref|XP_004288344.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=466

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG+NGT+DGQG++WW  +    LNY+RPHLVE ++S+ VVISNLTFLN+P W I P YCS
Sbjct  162  TGHNGTVDGQGSIWWNWYHNKTLNYTRPHLVELMNSTAVVISNLTFLNSPFWTIHPVYCS  221

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V VQN+T+ +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  222  HVSVQNLTILAPLNSPNTDGIDPDSSDNVCIEDCYISTG  260



>ref|XP_003557344.1| PREDICTED: probable polygalacturonase [Brachypodium distachyon]
 ref|XP_010228201.1| PREDICTED: probable polygalacturonase [Brachypodium distachyon]
Length=479

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG +WW  F  H LNY+RP LVEF+ S+ VV+SNLTF N+P WNI P YCS
Sbjct  153  TGANGTIDGQGEIWWNWFHNHTLNYTRPPLVEFMYSTRVVVSNLTFTNSPFWNIHPVYCS  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
             VLVQ++T+ +P  SP T+GI PDSS +VCIE+  I  G
Sbjct  213  QVLVQHLTILAPISSPNTDGIDPDSSTNVCIEDCYIRNG  251



>ref|XP_003535296.2| PREDICTED: probable polygalacturonase-like [Glycine max]
 gb|KHN14231.1| Putative polygalacturonase [Glycine soja]
Length=464

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TGNNGTIDGQG++WW  F    LNY+RPHLVE ++S+ V+ISN+TF+N+P W I P YCS
Sbjct  152  TGNNGTIDGQGSIWWNNFWNKTLNYTRPHLVELMNSTGVLISNVTFMNSPFWTIHPVYCS  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V +QN+T+ +P  SP T+GI PDSS++VCIE+  IS G
Sbjct  212  HVTIQNVTIIAPLSSPNTDGINPDSSDNVCIEDCYISTG  250



>gb|KFK35395.1| hypothetical protein AALP_AA5G279500 [Arabis alpina]
Length=481

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG++WW+ F    LNY+RPHLVE ++S+ ++ISNLTFLN+P WNI P YC 
Sbjct  153  TGENGTIDGQGSIWWDWFRNGELNYTRPHLVELMNSTGLIISNLTFLNSPFWNIHPVYCR  212

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNISMG  298
            +V+V+N+T+ +P  SP T+G+ PDSS++VCIE+  I  G
Sbjct  213  DVVVKNLTILAPLDSPNTDGVDPDSSSNVCIEDCYIVTG  251



>ref|XP_002875985.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52244.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=471

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +2

Query  2    TGNNGTIDGQGAVWWEQFDQHALNYSRPHLVEFISSSHVVISNLTFLNAPAWNIRPAYCS  181
            TG NGTIDGQG+VWW+ F    LNY+RPHLVE ++S+ ++ISNLTFLN+P WNI P YC 
Sbjct  152  TGENGTIDGQGSVWWDWFRNGELNYTRPHLVELMNSTGLIISNLTFLNSPFWNIHPVYCR  211

Query  182  NVLVQNITVHSPSKSPYTNGIVPDSSNHVCIENSNI  289
            +V+V+N+T+ +P +SP T+G+ PDSS +VCIE+  I
Sbjct  212  DVVVKNLTILAPLESPNTDGVDPDSSTNVCIEDCYI  247



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520990218604