BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17562_g1_i2 len=1986 path=[1:0-385 387:386-484 486:485-521
523:522-1985]

Length=1986
                                                                      Score     E

ref|XP_009627147.1|  PREDICTED: tetrahydrocannabinolic acid synth...    681   0.0      
ref|XP_009796990.1|  PREDICTED: tetrahydrocannabinolic acid synth...    681   0.0      
ref|XP_006353032.1|  PREDICTED: tetrahydrocannabinolic acid synth...    679   0.0      
ref|XP_004233182.1|  PREDICTED: tetrahydrocannabinolic acid synth...    675   0.0      
emb|CDP12617.1|  unnamed protein product                                623   0.0      
ref|XP_011085179.1|  PREDICTED: reticuline oxidase-like protein         620   0.0      
ref|XP_009780565.1|  PREDICTED: reticuline oxidase-like protein         621   0.0      
ref|XP_011096883.1|  PREDICTED: tetrahydrocannabinolic acid synth...    619   0.0      
ref|XP_009613445.1|  PREDICTED: tetrahydrocannabinolic acid synth...    617   0.0      
ref|XP_009624111.1|  PREDICTED: tetrahydrocannabinolic acid synth...    612   0.0      
emb|CDP12618.1|  unnamed protein product                                609   0.0      
emb|CDP12589.1|  unnamed protein product                                608   0.0      
ref|XP_007023066.1|  FAD-binding Berberine family protein isoform 1     603   0.0      
gb|EYU43215.1|  hypothetical protein MIMGU_mgv1a004278mg                602   0.0      
ref|XP_009791203.1|  PREDICTED: tetrahydrocannabinolic acid synth...    601   0.0      
ref|XP_006352999.1|  PREDICTED: tetrahydrocannabinolic acid synth...    601   0.0      
ref|XP_004247512.1|  PREDICTED: reticuline oxidase-like protein         599   0.0      
ref|XP_006367236.1|  PREDICTED: reticuline oxidase-like protein-like    598   0.0      
ref|XP_002523164.1|  Reticuline oxidase precursor, putative             595   0.0      Ricinus communis
gb|KDO52566.1|  hypothetical protein CISIN_1g036220mg                   593   0.0      
ref|XP_002268361.1|  PREDICTED: tetrahydrocannabinolic acid synthase    594   0.0      Vitis vinifera
ref|XP_006468345.1|  PREDICTED: reticuline oxidase-like protein-like    593   0.0      
ref|XP_006448862.1|  hypothetical protein CICLE_v10014829mg             593   0.0      
ref|XP_006490201.1|  PREDICTED: tetrahydrocannabinolic acid synth...    593   0.0      
emb|CAN81654.1|  hypothetical protein VITISV_003756                     592   0.0      Vitis vinifera
gb|KCW77265.1|  hypothetical protein EUGRSUZ_D01622                     592   0.0      
ref|XP_007023064.1|  FAD-binding Berberine family protein               592   0.0      
ref|XP_006421555.1|  hypothetical protein CICLE_v10006451mg             591   0.0      
ref|XP_010053024.1|  PREDICTED: reticuline oxidase-like protein         592   0.0      
ref|XP_006421542.1|  hypothetical protein CICLE_v10004697mg             590   0.0      
gb|KDO52551.1|  hypothetical protein CISIN_1g009485mg                   590   0.0      
ref|XP_002317089.1|  FAD-binding domain-containing family protein       590   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011039283.1|  PREDICTED: tetrahydrocannabinolic acid synth...    590   0.0      
ref|XP_004135540.1|  PREDICTED: reticuline oxidase-like protein-like    589   0.0      
ref|XP_006490192.1|  PREDICTED: tetrahydrocannabinolic acid synth...    589   0.0      
ref|XP_011006006.1|  PREDICTED: tetrahydrocannabinolic acid synth...    587   0.0      
ref|XP_003535119.1|  PREDICTED: cannabidiolic acid synthase-like ...    586   0.0      
ref|XP_002299030.2|  hypothetical protein POPTR_0001s46710g             585   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002523162.1|  Reticuline oxidase precursor, putative             584   0.0      Ricinus communis
ref|XP_010098535.1|  Reticuline oxidase-like protein                    582   0.0      
ref|XP_008439530.1|  PREDICTED: reticuline oxidase-like protein         582   0.0      
ref|XP_010051874.1|  PREDICTED: tetrahydrocannabinolic acid synth...    581   0.0      
ref|XP_009353858.1|  PREDICTED: tetrahydrocannabinolic acid synth...    581   0.0      
ref|XP_008445619.1|  PREDICTED: tetrahydrocannabinolic acid synth...    581   0.0      
ref|XP_010098537.1|  Reticuline oxidase-like protein                    580   0.0      
ref|XP_004134554.1|  PREDICTED: reticuline oxidase-like protein-like    580   0.0      
gb|KEH31333.1|  FAD-binding berberine family protein                    577   0.0      
ref|XP_002299036.1|  hypothetical protein POPTR_0001s46770g             577   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004486486.1|  PREDICTED: cannabidiolic acid synthase-like ...    577   0.0      
ref|XP_004162839.1|  PREDICTED: reticuline oxidase-like protein-like    577   0.0      
ref|XP_008365995.1|  PREDICTED: tetrahydrocannabinolic acid synth...    575   0.0      
ref|XP_010053020.1|  PREDICTED: reticuline oxidase-like protein         575   0.0      
ref|XP_003524780.1|  PREDICTED: tetrahydrocannabinolic acid synth...    574   0.0      
gb|KHN39151.1|  Reticuline oxidase-like protein                         573   0.0      
ref|XP_006377913.1|  hypothetical protein POPTR_0011s16240g             573   0.0      
ref|XP_010053022.1|  PREDICTED: reticuline oxidase-like protein         573   0.0      
ref|XP_003594602.1|  Reticuline oxidase-like protein                    573   0.0      
gb|KDP36338.1|  hypothetical protein JCGZ_09758                         573   0.0      
ref|XP_003546280.1|  PREDICTED: inactive tetrahydrocannabinolic a...    572   0.0      
ref|XP_008225656.1|  PREDICTED: cannabidiolic acid synthase-like 1      572   0.0      
ref|XP_011039279.1|  PREDICTED: tetrahydrocannabinolic acid synth...    570   0.0      
ref|XP_007147451.1|  hypothetical protein PHAVU_006G125800g             571   0.0      
emb|CDP12616.1|  unnamed protein product                                571   0.0      
ref|XP_011016518.1|  PREDICTED: tetrahydrocannabinolic acid synth...    570   0.0      
ref|XP_011013935.1|  PREDICTED: tetrahydrocannabinolic acid synth...    569   0.0      
gb|AFK45445.1|  unknown                                                 569   0.0      
ref|XP_011006002.1|  PREDICTED: reticuline oxidase-like protein         568   0.0      
ref|XP_003531072.2|  PREDICTED: reticuline oxidase-like protein-like    570   0.0      
ref|XP_007213892.1|  hypothetical protein PRUPE_ppa003798mg             569   0.0      
ref|XP_009362193.1|  PREDICTED: tetrahydrocannabinolic acid synth...    567   0.0      
ref|XP_004504721.1|  PREDICTED: reticuline oxidase-like protein-like    568   0.0      
ref|XP_009362192.1|  PREDICTED: cannabidiolic acid synthase-like 1      567   0.0      
ref|XP_002299035.1|  hypothetical protein POPTR_0001s46760g             567   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002317092.2|  hypothetical protein POPTR_0011s16250g             566   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009362191.1|  PREDICTED: tetrahydrocannabinolic acid synth...    566   0.0      
ref|XP_006490236.1|  PREDICTED: cannabidiolic acid synthase-like ...    565   0.0      
ref|XP_010516642.1|  PREDICTED: reticuline oxidase-like protein         564   0.0      
ref|XP_003524781.1|  PREDICTED: reticuline oxidase-like protein-like    564   0.0      
ref|XP_009113917.1|  PREDICTED: tetrahydrocannabinolic acid synthase    565   0.0      
emb|CDY29117.1|  BnaC09g18430D                                          564   0.0      
ref|XP_010098536.1|  Reticuline oxidase-like protein                    563   0.0      
ref|XP_006377931.1|  hypothetical protein POPTR_0011s16420g             563   0.0      
emb|CDY69093.1|  BnaCnng61850D                                          562   0.0      
ref|XP_004295434.1|  PREDICTED: tetrahydrocannabinolic acid synth...    563   0.0      
ref|XP_011006000.1|  PREDICTED: cannabidiolic acid synthase-like 2      562   0.0      
ref|XP_006307230.1|  hypothetical protein CARUB_v10008835mg             562   0.0      
ref|XP_004233152.2|  PREDICTED: tetrahydrocannabinolic acid synth...    562   0.0      
ref|XP_007158990.1|  hypothetical protein PHAVU_002G198800g             561   0.0      
gb|KDO52569.1|  hypothetical protein CISIN_1g043814mg                   560   0.0      
ref|XP_006398053.1|  hypothetical protein EUTSA_v10000843mg             561   0.0      
ref|XP_007158992.1|  hypothetical protein PHAVU_002G199000g             560   0.0      
ref|XP_006490235.1|  PREDICTED: tetrahydrocannabinolic acid synth...    560   0.0      
ref|XP_008225655.1|  PREDICTED: tetrahydrocannabinolic acid synth...    560   0.0      
ref|XP_011013937.1|  PREDICTED: tetrahydrocannabinolic acid synth...    559   0.0      
gb|KFK36380.1|  hypothetical protein AALP_AA4G116000                    559   0.0      
ref|XP_006421539.1|  hypothetical protein CICLE_v10007159mg             559   0.0      
ref|XP_011013936.1|  PREDICTED: tetrahydrocannabinolic acid synth...    559   0.0      
ref|XP_006421540.1|  hypothetical protein CICLE_v10007008mg             559   0.0      
ref|XP_004293697.1|  PREDICTED: tetrahydrocannabinolic acid synth...    558   0.0      
ref|XP_006377926.1|  hypothetical protein POPTR_0011s16380g             558   0.0      
ref|XP_009354035.1|  PREDICTED: inactive tetrahydrocannabinolic a...    557   0.0      
ref|XP_002317736.1|  hypothetical protein POPTR_0012s01070g             557   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006377930.1|  hypothetical protein POPTR_0011s16410g             557   0.0      
ref|XP_010460885.1|  PREDICTED: reticuline oxidase-like protein i...    556   0.0      
ref|NP_174363.1|  FAD-binding and BBE domain-containing protein         557   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863581.1|  FAD-binding domain-containing protein              557   0.0      
ref|XP_010504966.1|  PREDICTED: reticuline oxidase-like protein         555   0.0      
ref|XP_006377916.1|  hypothetical protein POPTR_0011s16280g             555   0.0      
ref|XP_006377917.1|  hypothetical protein POPTR_0011s16290g             555   0.0      
ref|NP_199253.1|  FAD-binding and BBE domain-containing protein         555   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006377921.1|  hypothetical protein POPTR_0011s16330g             555   0.0      
ref|XP_004293692.1|  PREDICTED: cannabidiolic acid synthase-like ...    554   0.0      
ref|XP_010053021.1|  PREDICTED: reticuline oxidase-like protein         554   0.0      
ref|XP_006377923.1|  hypothetical protein POPTR_0011s16350g             553   0.0      
ref|XP_011013934.1|  PREDICTED: tetrahydrocannabinolic acid synth...    553   0.0      
ref|XP_006377914.1|  hypothetical protein POPTR_0011s16260g             552   0.0      
ref|XP_004504722.1|  PREDICTED: tetrahydrocannabinolic acid synth...    552   0.0      
ref|XP_010441892.1|  PREDICTED: cannabidiolic acid synthase-like ...    552   0.0      
ref|XP_006377929.1|  hypothetical protein POPTR_0011s16400g             552   0.0      
ref|XP_010666892.1|  PREDICTED: reticuline oxidase-like protein         553   0.0      
gb|ABK94946.1|  unknown                                                 552   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010478512.1|  PREDICTED: reticuline oxidase-like protein         551   0.0      
emb|CDX77568.1|  BnaA07g07060D                                          551   0.0      
ref|XP_006490234.1|  PREDICTED: reticuline oxidase-like protein-like    551   0.0      
ref|XP_010509704.1|  PREDICTED: reticuline oxidase-like protein         550   0.0      
ref|XP_010499624.1|  PREDICTED: reticuline oxidase-like protein         550   0.0      
ref|XP_006410631.1|  hypothetical protein EUTSA_v10016496mg             550   0.0      
ref|XP_006415426.1|  hypothetical protein EUTSA_v10007327mg             550   0.0      
ref|XP_011001957.1|  PREDICTED: tetrahydrocannabinolic acid synth...    549   0.0      
ref|XP_010519048.1|  PREDICTED: reticuline oxidase-like protein         549   0.0      
gb|KEH31332.1|  FAD-binding berberine family protein                    548   0.0      
ref|XP_008365994.1|  PREDICTED: inactive tetrahydrocannabinolic a...    548   0.0      
gb|KDO52567.1|  hypothetical protein CISIN_1g046361mg                   548   0.0      
ref|XP_009143741.1|  PREDICTED: reticuline oxidase-like protein         547   0.0      
ref|XP_006398052.1|  hypothetical protein EUTSA_v10000846mg             548   0.0      
ref|XP_002881357.1|  EDA28/MEE23                                        547   0.0      
ref|XP_006421541.1|  hypothetical protein CICLE_v10006703mg             547   0.0      
ref|XP_006293979.1|  hypothetical protein CARUB_v10022971mg             547   0.0      
ref|XP_004295436.1|  PREDICTED: tetrahydrocannabinolic acid synth...    547   0.0      
ref|XP_002890896.1|  FAD-binding domain-containing protein              546   0.0      
ref|XP_010494464.1|  PREDICTED: cannabidiolic acid synthase-like 2      546   0.0      
ref|XP_009102687.1|  PREDICTED: reticuline oxidase-like protein         545   0.0      
ref|XP_010481680.1|  PREDICTED: cannabidiolic acid synthase-like 2      545   0.0      
emb|CDY67309.1|  BnaCnng54420D                                          545   0.0      
ref|XP_009115049.1|  PREDICTED: reticuline oxidase-like protein         545   0.0      
ref|NP_181025.1|  protein MATERNAL EFFECT EMBRYO ARREST 23              544   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KFK44880.1|  hypothetical protein AALP_AA1G315000                    544   0.0      
gb|KHN14309.1|  Reticuline oxidase-like protein                         542   0.0      
ref|XP_011005454.1|  PREDICTED: tetrahydrocannabinolic acid synth...    541   0.0      
ref|XP_006280276.1|  hypothetical protein CARUB_v10026198mg             541   0.0      
ref|XP_011001955.1|  PREDICTED: tetrahydrocannabinolic acid synth...    540   0.0      
ref|XP_010690430.1|  PREDICTED: tetrahydrocannabinolic acid synth...    541   0.0      
ref|XP_011001956.1|  PREDICTED: tetrahydrocannabinolic acid synth...    540   0.0      
ref|XP_011001959.1|  PREDICTED: tetrahydrocannabinolic acid synth...    539   0.0      
ref|XP_010540643.1|  PREDICTED: cannabidiolic acid synthase-like 1      540   0.0      
ref|XP_002299033.1|  hypothetical protein POPTR_0001s46740g             539   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006374300.1|  hypothetical protein POPTR_0015s05820g             538   0.0      
ref|XP_007211598.1|  hypothetical protein PRUPE_ppa005451mg             535   0.0      
ref|XP_006381464.1|  hypothetical protein POPTR_0006s13080g             536   0.0      
ref|XP_009115996.1|  PREDICTED: tetrahydrocannabinolic acid synth...    535   2e-180   
ref|XP_011039284.1|  PREDICTED: tetrahydrocannabinolic acid synth...    534   1e-179   
emb|CDX84280.1|  BnaC04g10420D                                          532   2e-179   
ref|XP_002317090.2|  hypothetical protein POPTR_0011s16220g             532   6e-179   Populus trichocarpa [western balsam poplar]
ref|XP_010052547.1|  PREDICTED: cannabidiolic acid synthase-like 2      531   8e-179   
gb|EYU23052.1|  hypothetical protein MIMGU_mgv1a023470mg                531   3e-178   
emb|CDY31642.1|  BnaA05g09050D                                          528   5e-178   
ref|XP_006398051.1|  hypothetical protein EUTSA_v10000851mg             529   9e-178   
ref|XP_006398044.1|  hypothetical protein EUTSA_v10000840mg             528   2e-177   
ref|XP_011006005.1|  PREDICTED: inactive tetrahydrocannabinolic a...    528   3e-177   
gb|KCW77261.1|  hypothetical protein EUGRSUZ_D01617                     526   3e-177   
ref|XP_010051866.1|  PREDICTED: cannabidiolic acid synthase-like 2      526   1e-176   
gb|KCW75697.1|  hypothetical protein EUGRSUZ_D00070                     526   2e-176   
ref|NP_199251.1|  FAD-binding and BBE domain-containing protein         526   2e-176   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003531073.1|  PREDICTED: tetrahydrocannabinolic acid synth...    524   4e-176   
gb|KHN39150.1|  Reticuline oxidase-like protein                         524   6e-176   
gb|KDP36335.1|  hypothetical protein JCGZ_09755                         522   9e-176   
ref|XP_010657063.1|  PREDICTED: tetrahydrocannabinolic acid synth...    523   3e-175   
ref|XP_010261630.1|  PREDICTED: tetrahydrocannabinolic acid synth...    521   6e-175   
ref|XP_011006004.1|  PREDICTED: tetrahydrocannabinolic acid synth...    521   1e-174   
ref|XP_010052550.1|  PREDICTED: cannabidiolic acid synthase-like 2      521   1e-174   
ref|XP_006398049.1|  hypothetical protein EUTSA_v10000841mg             521   1e-174   
ref|XP_010275367.1|  PREDICTED: tetrahydrocannabinolic acid synth...    521   2e-174   
gb|KDP34623.1|  hypothetical protein JCGZ_11146                         520   2e-174   
emb|CDY13105.1|  BnaA09g17120D                                          520   2e-174   
ref|XP_006398048.1|  hypothetical protein EUTSA_v10000844mg             520   3e-174   
ref|XP_008445653.1|  PREDICTED: tetrahydrocannabinolic acid synth...    518   2e-173   
ref|XP_010494451.1|  PREDICTED: tetrahydrocannabinolic acid synth...    516   1e-172   
ref|XP_010261629.1|  PREDICTED: inactive tetrahydrocannabinolic a...    515   2e-172   
ref|XP_009787052.1|  PREDICTED: cannabidiolic acid synthase-like 1      514   3e-172   
ref|XP_002863582.1|  FAD-binding domain-containing protein              513   9e-172   
ref|XP_002277310.1|  PREDICTED: inactive tetrahydrocannabinolic a...    513   1e-171   Vitis vinifera
emb|CAN63058.1|  hypothetical protein VITISV_004191                     513   1e-171   Vitis vinifera
ref|XP_010481746.1|  PREDICTED: tetrahydrocannabinolic acid synthase    513   2e-171   
ref|XP_010250637.1|  PREDICTED: cannabidiolic acid synthase-like 1      512   2e-171   
ref|XP_009615787.1|  PREDICTED: cannabidiolic acid synthase-like        512   3e-171   
ref|XP_002863584.1|  FAD-binding domain-containing protein              511   1e-170   
ref|XP_004135722.1|  PREDICTED: reticuline oxidase-like protein-like    510   2e-170   
ref|XP_010481679.1|  PREDICTED: cannabidiolic acid synthase-like 2      510   3e-170   
ref|XP_010441896.1|  PREDICTED: tetrahydrocannabinolic acid synth...    509   3e-170   
ref|XP_009113919.1|  PREDICTED: cannabidiolic acid synthase-like 2      509   3e-170   
gb|KDP34622.1|  hypothetical protein JCGZ_11145                         509   4e-170   
ref|XP_010441894.1|  PREDICTED: cannabidiolic acid synthase-like 2      507   5e-169   
ref|XP_006279601.1|  hypothetical protein CARUB_v10026133mg             508   6e-169   
ref|XP_010052551.1|  PREDICTED: tetrahydrocannabinolic acid synth...    506   6e-169   
ref|XP_002277294.1|  PREDICTED: inactive tetrahydrocannabinolic a...    506   8e-169   Vitis vinifera
ref|XP_002267904.2|  PREDICTED: reticuline oxidase-like protein         505   2e-168   Vitis vinifera
emb|CAN63059.1|  hypothetical protein VITISV_004192                     504   3e-168   Vitis vinifera
ref|XP_010261633.1|  PREDICTED: tetrahydrocannabinolic acid synth...    503   5e-168   
ref|XP_002523160.1|  Reticuline oxidase precursor, putative             503   1e-167   Ricinus communis
ref|XP_010655774.1|  PREDICTED: reticuline oxidase-like protein         503   2e-167   
ref|XP_004158101.1|  PREDICTED: reticuline oxidase-like protein-like    501   2e-167   
ref|XP_006280269.1|  hypothetical protein CARUB_v10026190mg             503   2e-167   
ref|XP_010054501.1|  PREDICTED: cannabidiolic acid synthase-like 2      502   2e-167   
emb|CAN60572.1|  hypothetical protein VITISV_000229                     502   3e-167   Vitis vinifera
ref|XP_004242239.1|  PREDICTED: cannabidiolic acid synthase-like        502   3e-167   
emb|CAN80091.1|  hypothetical protein VITISV_015121                     501   4e-167   Vitis vinifera
ref|XP_009113914.1|  PREDICTED: cannabidiolic acid synthase-like ...    501   6e-167   
gb|KCW76622.1|  hypothetical protein EUGRSUZ_D01011                     499   9e-167   
gb|KCW76619.1|  hypothetical protein EUGRSUZ_D01008                     500   1e-166   
ref|XP_010054195.1|  PREDICTED: cannabidiolic acid synthase-like 2      500   1e-166   
ref|XP_006370482.1|  FAD-binding domain-containing family protein       499   2e-166   
ref|XP_007023038.1|  FAD-binding Berberine family protein               500   2e-166   
gb|KHN39149.1|  Reticuline oxidase-like protein                         496   2e-166   
gb|KEH31322.1|  reticuline oxidase-like protein                         499   3e-166   
ref|XP_002270585.1|  PREDICTED: reticuline oxidase-like protein         499   4e-166   Vitis vinifera
ref|XP_007023052.1|  FAD-binding Berberine family protein               498   1e-165   
ref|XP_006377943.1|  hypothetical protein POPTR_0011s16540g             498   1e-165   
ref|XP_009101716.1|  PREDICTED: tetrahydrocannabinolic acid synth...    498   3e-165   
ref|XP_007023037.1|  FAD-binding Berberine family protein               496   3e-165   
ref|XP_002299045.1|  hypothetical protein POPTR_0001s46910g             496   5e-165   Populus trichocarpa [western balsam poplar]
ref|XP_006356501.1|  PREDICTED: cannabidiolic acid synthase-like        496   8e-165   
ref|XP_010261632.1|  PREDICTED: tetrahydrocannabinolic acid synth...    495   1e-164   
ref|XP_008445632.1|  PREDICTED: tetrahydrocannabinolic acid synth...    496   1e-164   
ref|XP_006377944.1|  hypothetical protein POPTR_0011s16550g             494   2e-164   
ref|XP_007010661.1|  FAD-binding Berberine family protein               496   2e-164   
ref|XP_004135724.1|  PREDICTED: reticuline oxidase-like protein-like    495   2e-164   
ref|XP_011037721.1|  PREDICTED: cannabidiolic acid synthase-like 1      494   3e-164   
ref|XP_011037734.1|  PREDICTED: cannabidiolic acid synthase-like 1      494   3e-164   
ref|XP_007045724.1|  FAD-binding Berberine family protein               494   4e-164   
ref|XP_010494453.1|  PREDICTED: cannabidiolic acid synthase-like 2      494   6e-164   
ref|XP_010053026.1|  PREDICTED: tetrahydrocannabinolic acid synth...    493   8e-164   
ref|XP_002269462.1|  PREDICTED: reticuline oxidase-like protein         493   1e-163   Vitis vinifera
ref|XP_002317088.2|  hypothetical protein POPTR_0011s16190g             493   1e-163   Populus trichocarpa [western balsam poplar]
ref|XP_003638113.1|  Reticuline oxidase                                 492   2e-163   
gb|AAL24314.1|  berberine bridge enzyme-like protein                    492   3e-163   Arabidopsis thaliana [mouse-ear cress]
gb|KCW77268.1|  hypothetical protein EUGRSUZ_D01625                     491   5e-163   
ref|NP_199252.1|  FAD-binding Berberine family protein                  491   5e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011037730.1|  PREDICTED: cannabidiolic acid synthase-like        491   7e-163   
ref|XP_006398047.1|  hypothetical protein EUTSA_v10001137mg             490   7e-163   
ref|XP_011005994.1|  PREDICTED: tetrahydrocannabinolic acid synth...    490   1e-162   
ref|XP_010053027.1|  PREDICTED: tetrahydrocannabinolic acid synth...    490   1e-162   
ref|XP_010261631.1|  PREDICTED: inactive tetrahydrocannabinolic a...    490   1e-162   
emb|CDX94786.1|  BnaC07g17950D                                          489   2e-162   
emb|CDY49007.1|  BnaAnng10010D                                          489   2e-162   
ref|XP_006377947.1|  hypothetical protein POPTR_0011s16580g             489   2e-162   
ref|XP_011013628.1|  PREDICTED: tetrahydrocannabinolic acid synth...    489   2e-162   
ref|XP_011037728.1|  PREDICTED: cannabidiolic acid synthase-like ...    489   2e-162   
ref|XP_011099776.1|  PREDICTED: tetrahydrocannabinolic acid synth...    489   3e-162   
ref|XP_009113915.1|  PREDICTED: cannabidiolic acid synthase-like ...    485   6e-162   
ref|XP_007023036.1|  FAD-binding Berberine family protein               488   7e-162   
ref|XP_007023073.1|  FAD-binding Berberine family protein, putative     489   7e-162   
ref|XP_007038641.1|  FAD-binding Berberine family protein               488   8e-162   
ref|XP_011096702.1|  PREDICTED: tetrahydrocannabinolic acid synth...    487   2e-161   
emb|CDX94780.1|  BnaC07g17890D                                          487   2e-161   
emb|CDX94785.1|  BnaC07g17940D                                          486   3e-161   
ref|XP_004242238.1|  PREDICTED: inactive tetrahydrocannabinolic a...    486   3e-161   
ref|XP_006448851.1|  hypothetical protein CICLE_v10014802mg             487   4e-161   
gb|KDO75187.1|  hypothetical protein CISIN_1g048392mg                   485   4e-161   
ref|XP_007038638.1|  FAD-binding Berberine family protein               485   7e-161   
gb|AGL44332.1|  FAD-dependent oxidoreductase                            486   7e-161   
ref|XP_008225665.1|  PREDICTED: reticuline oxidase-like protein         486   7e-161   
ref|XP_007038648.1|  FAD-binding Berberine family protein               485   1e-160   
ref|XP_007023058.1|  FAD-binding Berberine family protein               485   1e-160   
ref|XP_006468358.1|  PREDICTED: cannabidiolic acid synthase-like ...    485   1e-160   
ref|XP_006448838.1|  hypothetical protein CICLE_v10014838mg             484   3e-160   
ref|XP_006377933.1|  FAD-binding domain-containing family protein       483   3e-160   
ref|XP_006468466.1|  PREDICTED: reticuline oxidase-like protein-like    484   3e-160   
emb|CDY49011.1|  BnaAnng10050D                                          484   3e-160   
ref|XP_006377918.1|  hypothetical protein POPTR_0011s163102g            479   4e-160   
ref|XP_002299029.2|  hypothetical protein POPTR_0001s46700g             483   4e-160   
ref|XP_003532638.2|  PREDICTED: cannabidiolic acid synthase-like ...    483   1e-159   
gb|AGL44335.1|  FAD-dependent oxidoreductase                            483   1e-159   
ref|XP_010484844.1|  PREDICTED: LOW QUALITY PROTEIN: cannabidioli...    483   1e-159   
ref|XP_007159000.1|  hypothetical protein PHAVU_002G199800g             482   1e-159   
ref|XP_006377928.1|  hypothetical protein POPTR_0011s16390g             482   2e-159   
ref|XP_007211821.1|  hypothetical protein PRUPE_ppa004317mg             481   2e-159   
ref|XP_009101717.1|  PREDICTED: cannabidiolic acid synthase-like ...    481   5e-159   
ref|XP_004499702.1|  PREDICTED: tetrahydrocannabinolic acid synth...    480   6e-159   
ref|XP_006468356.1|  PREDICTED: tetrahydrocannabinolic acid synth...    480   8e-159   
ref|XP_009598364.1|  PREDICTED: cannabidiolic acid synthase-like        480   9e-159   
ref|XP_008225658.1|  PREDICTED: tetrahydrocannabinolic acid synth...    479   1e-158   
gb|KDO75188.1|  hypothetical protein CISIN_1g046660mg                   478   1e-158   
gb|KDP34617.1|  hypothetical protein JCGZ_11140                         479   1e-158   
ref|XP_004135725.1|  PREDICTED: reticuline oxidase-like protein-like    480   2e-158   
ref|XP_006448861.1|  hypothetical protein CICLE_v10017845mg             479   2e-158   
ref|XP_007038647.1|  FAD-binding Berberine family protein               479   2e-158   
ref|XP_011039282.1|  PREDICTED: tetrahydrocannabinolic acid synth...    479   3e-158   
ref|XP_003598276.1|  FAD-linked oxidoreductase                          478   3e-158   
gb|KDP36337.1|  hypothetical protein JCGZ_09757                         485   4e-158   
ref|XP_011040518.1|  PREDICTED: cannabidiolic acid synthase-like 1      478   5e-158   
gb|EYU19096.1|  hypothetical protein MIMGU_mgv1a004131mg                478   5e-158   
ref|XP_006448845.1|  hypothetical protein CICLE_v10018073mg             478   6e-158   
ref|XP_009362292.1|  PREDICTED: tetrahydrocannabinolic acid synth...    478   6e-158   
ref|XP_009353859.1|  PREDICTED: tetrahydrocannabinolic acid synth...    478   6e-158   
ref|XP_010276872.1|  PREDICTED: tetrahydrocannabinolic acid synth...    477   7e-158   
gb|KEH31323.1|  reticuline oxidase-like protein                         478   7e-158   
gb|KHN22946.1|  Reticuline oxidase-like protein                         478   9e-158   
ref|XP_003524099.2|  PREDICTED: cannabidiolic acid synthase-like ...    478   1e-157   
gb|AGL44336.1|  FAD-dependent oxidoreductase                            477   1e-157   
gb|KDO75193.1|  hypothetical protein CISIN_1g037058mg                   476   2e-157   
ref|XP_002317084.1|  hypothetical protein POPTR_0011s16140g             476   2e-157   
gb|AES68535.2|  FAD-linked oxidoreductase                               476   4e-157   
ref|XP_011097021.1|  PREDICTED: cannabidiolic acid synthase-like        476   4e-157   
ref|XP_011006009.1|  PREDICTED: reticuline oxidase-like protein         476   4e-157   
ref|XP_011039847.1|  PREDICTED: reticuline oxidase-like protein         476   5e-157   
ref|XP_002300580.2|  hypothetical protein POPTR_0001s47400g             475   6e-157   
ref|XP_002299022.2|  hypothetical protein POPTR_0001s46620g             475   6e-157   
ref|XP_010054200.1|  PREDICTED: tetrahydrocannabinolic acid synth...    475   6e-157   
gb|KHN20572.1|  Reticuline oxidase-like protein                         474   9e-157   
dbj|BAM74079.1|  hypothetical protein                                   475   1e-156   
ref|XP_002299020.2|  hypothetical protein POPTR_0001s46600g             474   1e-156   
ref|XP_007023054.1|  FAD-binding Berberine family protein               474   1e-156   
ref|XP_008446963.1|  PREDICTED: tetrahydrocannabinolic acid synth...    474   2e-156   
ref|XP_002317086.1|  FAD-binding domain-containing family protein       474   2e-156   
ref|XP_007023061.1|  FAD-binding Berberine family protein               474   3e-156   
ref|XP_003598284.1|  FAD-linked oxidoreductase                          476   3e-156   
ref|XP_006377946.1|  hypothetical protein POPTR_0011s16570g             473   4e-156   
ref|XP_011078509.1|  PREDICTED: cannabidiolic acid synthase-like 1      473   5e-156   
ref|XP_006448852.1|  hypothetical protein CICLE_v10014815mg             473   7e-156   
ref|XP_003598279.1|  FAD-linked oxidoreductase                          472   8e-156   
ref|XP_002523167.1|  Reticuline oxidase precursor, putative             472   9e-156   
gb|KCW75711.1|  hypothetical protein EUGRSUZ_D00089                     471   1e-155   
ref|XP_003526387.2|  PREDICTED: tetrahydrocannabinolic acid synth...    471   2e-155   
ref|XP_008225659.1|  PREDICTED: tetrahydrocannabinolic acid synth...    472   2e-155   
ref|XP_011037731.1|  PREDICTED: tetrahydrocannabinolic acid synth...    471   2e-155   
ref|XP_011039290.1|  PREDICTED: cannabidiolic acid synthase-like 1      471   2e-155   
ref|XP_007211554.1|  hypothetical protein PRUPE_ppa004127mg             471   2e-155   
ref|XP_011005993.1|  PREDICTED: tetrahydrocannabinolic acid synth...    471   3e-155   
ref|XP_009362288.1|  PREDICTED: reticuline oxidase-like protein         471   3e-155   
ref|XP_011006017.1|  PREDICTED: cannabidiolic acid synthase-like 1      471   3e-155   
ref|XP_007211549.1|  hypothetical protein PRUPE_ppa004076mg             471   4e-155   
ref|XP_006377945.1|  hypothetical protein POPTR_0011s16560g             470   5e-155   
ref|XP_008225657.1|  PREDICTED: tetrahydrocannabinolic acid synth...    470   5e-155   
gb|KDO75190.1|  hypothetical protein CISIN_1g038259mg                   469   5e-155   
ref|XP_007038644.1|  FAD-binding Berberine family protein               471   6e-155   
ref|XP_011039288.1|  PREDICTED: tetrahydrocannabinolic acid synth...    471   7e-155   
ref|XP_007038646.1|  FAD-binding Berberine family protein               474   8e-155   
ref|XP_003638116.1|  Reticuline oxidase                                 470   9e-155   
ref|XP_002300557.2|  hypothetical protein POPTR_0001s46580g             469   1e-154   
ref|XP_007214472.1|  hypothetical protein PRUPE_ppa023336mg             469   1e-154   
ref|XP_007211778.1|  hypothetical protein PRUPE_ppa004189mg             469   1e-154   
ref|XP_006468357.1|  PREDICTED: cannabidiolic acid synthase-like ...    469   2e-154   
ref|XP_006448837.1|  hypothetical protein CICLE_v10017768mg             468   2e-154   
ref|XP_002529891.1|  Reticuline oxidase precursor, putative             469   2e-154   
ref|XP_006352996.1|  PREDICTED: cannabidiolic acid synthase-like        469   2e-154   
ref|XP_002523156.1|  Reticuline oxidase precursor, putative             468   2e-154   
ref|XP_011078508.1|  PREDICTED: cannabidiolic acid synthase-like        469   2e-154   
emb|CDP12594.1|  unnamed protein product                                469   2e-154   
ref|XP_002299025.2|  hypothetical protein POPTR_0001s46650g             467   3e-154   
ref|XP_010655840.1|  PREDICTED: tetrahydrocannabinolic acid synth...    476   3e-154   
ref|XP_003638117.1|  Reticuline oxidase-like protein                    469   3e-154   
ref|XP_011037732.1|  PREDICTED: cannabidiolic acid synthase-like        468   3e-154   
ref|XP_004295435.1|  PREDICTED: tetrahydrocannabinolic acid synth...    468   4e-154   
ref|XP_010655770.1|  PREDICTED: reticuline oxidase-like protein         468   5e-154   
ref|XP_007158999.1|  hypothetical protein PHAVU_002G199700g             468   6e-154   
gb|KDO77597.1|  hypothetical protein CISIN_1g009115mg                   468   6e-154   
ref|XP_011097020.1|  PREDICTED: cannabidiolic acid synthase-like        468   7e-154   
dbj|BAJ40864.1|  tetrahydroberberine oxidase                            468   7e-154   
gb|KDO48902.1|  hypothetical protein CISIN_1g009297mg                   468   7e-154   
ref|XP_011096885.1|  PREDICTED: cannabidiolic acid synthase-like        467   8e-154   
ref|XP_004293693.1|  PREDICTED: reticuline oxidase-like protein-like    466   1e-153   
ref|XP_002523151.1|  Reticuline oxidase precursor, putative             467   1e-153   
ref|XP_006370772.1|  hypothetical protein POPTR_0001s46640g             466   1e-153   
ref|XP_006377912.1|  hypothetical protein POPTR_0011s16210g             465   2e-153   
ref|XP_008383451.1|  PREDICTED: tetrahydrocannabinolic acid synth...    466   2e-153   
ref|XP_007214048.1|  hypothetical protein PRUPE_ppa017444mg             466   2e-153   
ref|XP_009362291.1|  PREDICTED: reticuline oxidase-like protein         466   2e-153   
ref|XP_006448854.1|  hypothetical protein CICLE_v10018357mg             467   2e-153   
ref|XP_002299021.2|  hypothetical protein POPTR_0001s46610g             465   2e-153   
ref|XP_008349146.1|  PREDICTED: tetrahydrocannabinolic acid synth...    466   3e-153   
ref|XP_006448846.1|  hypothetical protein CICLE_v10017782mg             466   4e-153   
ref|XP_009776984.1|  PREDICTED: tetrahydrocannabinolic acid synth...    465   4e-153   
gb|ADY15026.1|  (S)-tetrahydroprotoberberine oxidase                    465   5e-153   
gb|KDO75189.1|  hypothetical protein CISIN_1g008779mg                   466   6e-153   
ref|XP_003532641.1|  PREDICTED: reticuline oxidase-like protein-like    465   6e-153   
ref|XP_008225661.1|  PREDICTED: tetrahydrocannabinolic acid synth...    465   7e-153   
ref|XP_011040519.1|  PREDICTED: cannabidiolic acid synthase-like        464   1e-152   
ref|XP_006468349.1|  PREDICTED: tetrahydrocannabinolic acid synth...    465   1e-152   
ref|XP_006448839.1|  hypothetical protein CICLE_v10018353mg             464   2e-152   
gb|KDO38734.1|  hypothetical protein CISIN_1g039163mg                   464   2e-152   
ref|XP_008225664.1|  PREDICTED: reticuline oxidase-like protein         466   2e-152   
ref|XP_003524775.1|  PREDICTED: tetrahydrocannabinolic acid synth...    464   2e-152   
ref|XP_002523155.1|  Reticuline oxidase precursor, putative             463   3e-152   
ref|XP_008225754.1|  PREDICTED: cannabidiolic acid synthase-like 2      463   3e-152   
ref|XP_007023039.1|  FAD-binding Berberine family protein               465   3e-152   
ref|XP_007212419.1|  hypothetical protein PRUPE_ppa016588mg             462   3e-152   
ref|XP_006432918.1|  hypothetical protein CICLE_v10000808mg             463   4e-152   
ref|XP_006448863.1|  hypothetical protein CICLE_v10018216mg             463   4e-152   
ref|XP_011096886.1|  PREDICTED: cannabidiolic acid synthase-like        463   4e-152   
ref|XP_006431541.1|  hypothetical protein CICLE_v10003189mg             464   4e-152   
ref|NP_001237470.1|  FAD-linked oxidoreductase 2 precursor              462   4e-152   
ref|XP_004295439.1|  PREDICTED: reticuline oxidase-like protein-like    462   8e-152   
ref|XP_004293695.1|  PREDICTED: tetrahydrocannabinolic acid synth...    462   8e-152   
gb|KHN39155.1|  Reticuline oxidase-like protein                         462   8e-152   
emb|CDP12596.1|  unnamed protein product                                462   9e-152   
ref|XP_004504926.1|  PREDICTED: cannabidiolic acid synthase-like ...    463   9e-152   
ref|XP_009362289.1|  PREDICTED: reticuline oxidase-like protein         462   9e-152   
ref|XP_006448855.1|  hypothetical protein CICLE_v10014803mg             462   1e-151   
ref|XP_007212922.1|  hypothetical protein PRUPE_ppa022296mg             461   1e-151   
ref|XP_011039364.1|  PREDICTED: tetrahydrocannabinolic acid synth...    465   1e-151   
ref|XP_003594605.1|  Reticuline oxidase                                 461   1e-151   
gb|KDO52568.1|  hypothetical protein CISIN_1g042619mg                   457   1e-151   
ref|XP_006468343.1|  PREDICTED: tetrahydrocannabinolic acid synth...    461   2e-151   
ref|XP_007034169.1|  FAD-binding Berberine family protein               461   2e-151   
ref|XP_008225671.1|  PREDICTED: reticuline oxidase-like protein         461   2e-151   
ref|XP_006448843.1|  hypothetical protein CICLE_v10018146mg             462   2e-151   
ref|XP_006448849.1|  hypothetical protein CICLE_v10014857mg             461   3e-151   
ref|XP_006487638.1|  PREDICTED: cannabidiolic acid synthase-like        461   3e-151   
ref|XP_011039267.1|  PREDICTED: tetrahydrocannabinolic acid synth...    460   3e-151   
gb|KHN22947.1|  Reticuline oxidase-like protein                         461   4e-151   
ref|XP_010529355.1|  PREDICTED: inactive tetrahydrocannabinolic a...    460   4e-151   
ref|XP_006448850.1|  hypothetical protein CICLE_v10014810mg             461   4e-151   
ref|XP_011039280.1|  PREDICTED: reticuline oxidase-like protein         460   7e-151   
ref|XP_002299044.1|  hypothetical protein POPTR_0001s46900g             459   7e-151   
gb|KDP34866.1|  hypothetical protein JCGZ_09154                         460   7e-151   
gb|KCW76618.1|  hypothetical protein EUGRSUZ_D01006                     456   7e-151   
ref|XP_007159396.1|  hypothetical protein PHAVU_002G234800g             459   8e-151   
ref|NP_001237456.1|  FAD-linked oxidoreductase 1 precursor              459   9e-151   
ref|XP_009362185.1|  PREDICTED: reticuline oxidase-like protein i...    460   1e-150   
ref|XP_007213042.1|  hypothetical protein PRUPE_ppa020251mg             459   1e-150   
ref|XP_003522833.1|  PREDICTED: tetrahydrocannabinolic acid synth...    459   1e-150   
ref|XP_008225756.1|  PREDICTED: tetrahydrocannabinolic acid synth...    459   1e-150   
ref|XP_004233882.2|  PREDICTED: cannabidiolic acid synthase-like        459   2e-150   
ref|XP_009362186.1|  PREDICTED: reticuline oxidase-like protein i...    459   2e-150   
ref|XP_009362293.1|  PREDICTED: cannabidiolic acid synthase-like        459   2e-150   
ref|XP_003524777.1|  PREDICTED: cannabidiolic acid synthase-like ...    458   2e-150   
ref|XP_010915476.1|  PREDICTED: LOW QUALITY PROTEIN: tetrahydroca...    459   3e-150   
gb|KCW75699.1|  hypothetical protein EUGRSUZ_D00073                     458   3e-150   
ref|XP_010051867.1|  PREDICTED: reticuline oxidase-like protein         459   4e-150   
ref|XP_009354036.1|  PREDICTED: LOW QUALITY PROTEIN: tetrahydroca...    457   4e-150   
ref|XP_006370773.1|  FAD-binding domain-containing family protein       457   5e-150   
ref|XP_003637115.1|  Reticuline oxidase                                 459   5e-150   
ref|XP_003594608.1|  Reticuline oxidase                                 457   5e-150   
ref|XP_008225669.1|  PREDICTED: reticuline oxidase-like protein         457   6e-150   
ref|XP_002523152.1|  Reticuline oxidase precursor, putative             456   7e-150   
gb|EYU41160.1|  hypothetical protein MIMGU_mgv1a026678mg                456   1e-149   
ref|XP_006448844.1|  hypothetical protein CICLE_v10014726mg             458   1e-149   
ref|XP_007211543.1|  hypothetical protein PRUPE_ppa004021mg             456   1e-149   
gb|EYU41161.1|  hypothetical protein MIMGU_mgv1a020088mg                457   1e-149   
ref|XP_004135736.1|  PREDICTED: LOW QUALITY PROTEIN: reticuline o...    456   1e-149   
gb|AGL44334.1|  FAD-dependent oxidoreductase                            456   2e-149   
ref|XP_002268606.1|  PREDICTED: reticuline oxidase-like protein         456   2e-149   
gb|AGL44331.1|  FAD-dependent oxidoreductase                            456   2e-149   
ref|XP_008807189.1|  PREDICTED: tetrahydrocannabinolic acid synth...    456   2e-149   
emb|CDP08084.1|  unnamed protein product                                456   2e-149   
ref|XP_007158997.1|  hypothetical protein PHAVU_002G199500g             456   2e-149   
ref|XP_008358604.1|  PREDICTED: reticuline oxidase-like protein         456   2e-149   
gb|KHN20571.1|  Reticuline oxidase-like protein                         452   3e-149   
ref|XP_009777853.1|  PREDICTED: cannabidiolic acid synthase-like        456   3e-149   
emb|CAN81650.1|  hypothetical protein VITISV_003752                     456   3e-149   
gb|EYU19102.1|  hypothetical protein MIMGU_mgv1a022353mg                456   4e-149   
ref|XP_010926885.1|  PREDICTED: tetrahydrocannabinolic acid synth...    455   5e-149   
ref|XP_004134553.1|  PREDICTED: reticuline oxidase-like protein-like    455   5e-149   
ref|XP_009354038.1|  PREDICTED: reticuline oxidase-like protein         455   5e-149   
ref|XP_007212681.1|  hypothetical protein PRUPE_ppa018446mg             454   9e-149   
gb|KHN22945.1|  Reticuline oxidase-like protein                         454   9e-149   
ref|XP_010054197.1|  PREDICTED: reticuline oxidase-like protein         454   1e-148   
ref|XP_008225674.1|  PREDICTED: reticuline oxidase-like protein         454   1e-148   
ref|XP_007033584.1|  FAD-binding Berberine family protein isoform 1     454   2e-148   
ref|XP_008439529.1|  PREDICTED: LOW QUALITY PROTEIN: reticuline o...    454   2e-148   
ref|XP_002523154.1|  Reticuline oxidase precursor, putative             453   2e-148   
emb|CDP12592.1|  unnamed protein product                                453   2e-148   
gb|KGN49482.1|  hypothetical protein Csa_6G525670                       455   2e-148   
ref|XP_008790024.1|  PREDICTED: tetrahydrocannabinolic acid synth...    454   2e-148   
gb|ADY15027.1|  (S)-tetrahydroprotoberberine oxidase                    453   3e-148   
ref|XP_010054196.1|  PREDICTED: reticuline oxidase-like protein         453   3e-148   
emb|CBI31067.3|  unnamed protein product                                453   4e-148   
ref|XP_007226571.1|  hypothetical protein PRUPE_ppa024148mg             452   6e-148   
ref|XP_011039289.1|  PREDICTED: cannabidiolic acid synthase-like 1      451   6e-148   
ref|XP_008225662.1|  PREDICTED: tetrahydrocannabinolic acid synth...    452   8e-148   
ref|XP_007148664.1|  hypothetical protein PHAVU_005G004400g             452   8e-148   
ref|XP_003631731.2|  PREDICTED: reticuline oxidase-like protein         452   8e-148   
ref|XP_007148667.1|  hypothetical protein PHAVU_005G004700g             452   1e-147   
ref|XP_011096701.1|  PREDICTED: reticuline oxidase-like protein         451   1e-147   
gb|KDO77595.1|  hypothetical protein CISIN_1g040700mg                   451   1e-147   
ref|XP_006431640.1|  hypothetical protein CICLE_v10000810mg             452   1e-147   
ref|XP_009362189.1|  PREDICTED: tetrahydrocannabinolic acid synth...    451   1e-147   
gb|EYU41171.1|  hypothetical protein MIMGU_mgv1a019888mg                452   1e-147   
emb|CDP12587.1|  unnamed protein product                                452   1e-147   
dbj|BAL46501.1|  carbohydrate                                           451   2e-147   
ref|XP_007213528.1|  hypothetical protein PRUPE_ppa019761mg             450   2e-147   
ref|XP_002268281.2|  PREDICTED: tetrahydrocannabinolic acid synth...    449   2e-147   
ref|XP_008445658.1|  PREDICTED: cannabidiolic acid synthase-like 1      451   2e-147   
emb|CDP12588.1|  unnamed protein product                                450   2e-147   
ref|XP_007034172.1|  FAD-binding Berberine family protein               451   3e-147   
ref|XP_007023065.1|  FAD-binding Berberine family protein, putative     448   3e-147   
gb|KDO77598.1|  hypothetical protein CISIN_1g042207mg                   450   3e-147   
ref|XP_011005333.1|  PREDICTED: reticuline oxidase-like protein         450   3e-147   
ref|XP_002270139.2|  PREDICTED: reticuline oxidase-like protein         451   3e-147   
ref|XP_007159005.1|  hypothetical protein PHAVU_002G200200g             450   3e-147   



>ref|XP_009627147.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Nicotiana 
tomentosiformis]
Length=547

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/523 (73%), Positives = 448/523 (86%), Gaps = 6/523 (1%)
 Frame = -2

Query  1754  LTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVP  1575
             L  + +AVS +IQ QFY+C++LHS  SIPFSTAFF+ T+NA+SFNS+L+ST QNL  L P
Sbjct  15    LFLASYAVSYTIQDQFYQCITLHSDRSIPFSTAFFTPTSNATSFNSILKSTAQNLRCLTP  74

Query  1574  SAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDL  1395
             S PKPLLIFT L+ES+VQAAV+C KE  +QLRVRSGGHD+EG+SYTS+M+   PF+++DL
Sbjct  75    SQPKPLLIFTALSESNVQAAVICAKELKLQLRVRSGGHDYEGISYTSEMKRSMPFILLDL  134

Query  1394  AKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygA  1215
             AKLR IKVD+EDNS WVQAGAT GEVYYR+AEKSK  G+PAG C SLGIGGHITGGAYG 
Sbjct  135   AKLRAIKVDIEDNSAWVQAGATIGEVYYRIAEKSKTHGYPAGLCTSLGIGGHITGGAYGP  194

Query  1214  MLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvp  1035
             M+RKYGL ADN +DARIVDA+GRVLDRA MGEDLFWAIRGGGGGSFGILLAWKI+LVPVP
Sbjct  195   MMRKYGLGADNVVDARIVDASGRVLDRALMGEDLFWAIRGGGGGSFGILLAWKIRLVPVP  254

Query  1034  atvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDA  855
             +TVTVFTVP+TLE  ATK+L KWQ VA+K+DEDL +++LIT  NST   GK+TVQTA+ A
Sbjct  255   STVTVFTVPKTLETGATKVLNKWQHVANKIDEDLFIRILITTANSTK-NGKKTVQTAYQA  313

Query  854   VFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPK  675
             +FLGKTDRL+ +MNHSFPELGLTPKDC+EMSWIESVIY A YP +  PEFLL GK LFP 
Sbjct  314   LFLGKTDRLIHVMNHSFPELGLTPKDCVEMSWIESVIYIAGYPSSIKPEFLLQGKSLFPA  373

Query  674   TFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVI  495
               FKAKS+FLR PVPE GL G+WK FL+ED+P+M+WNPYGGMM KI ES+ PFPHRKGVI
Sbjct  374   VNFKAKSDFLRVPVPEIGLEGMWKKFLEEDSPMMIWNPYGGMMGKISESSIPFPHRKGVI  433

Query  494   CKIVYLTSWKIEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRN  324
             CKI YLTSW  EG+KK   KH++WIR +YDYMGT+ SK PREAYVNYRDLDLGMN+N  N
Sbjct  434   CKIQYLTSW-TEGDKKSADKHINWIRGLYDYMGTFASKFPREAYVNYRDLDLGMNRNA-N  491

Query  323   TSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             ++F EASVWG KYFK N+++LV VKT+VDPDNFFWHEQS+P+L
Sbjct  492   SNFLEASVWGKKYFKNNYDKLVLVKTKVDPDNFFWHEQSLPIL  534



>ref|XP_009796990.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Nicotiana 
sylvestris]
Length=547

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/535 (73%), Positives = 452/535 (84%), Gaps = 6/535 (1%)
 Frame = -2

Query  1790  SSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVL  1611
             SS  I+   F  L  +  AVS +IQ QFY+C++LHS  SIPFSTAFF+ T+NA+SFNSVL
Sbjct  3     SSIFIILSSFIVLFSASCAVSYTIQDQFYRCITLHSDRSIPFSTAFFTPTSNATSFNSVL  62

Query  1610  QSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSD  1431
             +ST QNL  L PS PKPLLIFT L+ES+VQAAV+C KE  +QLRVRSGGHD+EG+SYTS+
Sbjct  63    KSTAQNLRCLAPSQPKPLLIFTALSESNVQAAVICAKELKLQLRVRSGGHDYEGISYTSE  122

Query  1430  MESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLg  1251
             M+   PF+++DLAKLR IKVD+EDNS WVQAGAT GEVYYR+AEKSK  G+PAG C SLG
Sbjct  123   MKRSMPFILLDLAKLRAIKVDIEDNSAWVQAGATIGEVYYRIAEKSKTHGYPAGLCTSLG  182

Query  1250  igghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGI  1071
             IGGHITGGAYG M+RKYGL ADN +DARIVDA+GRVLDR  MGEDLFWAIRGGGGGSFGI
Sbjct  183   IGGHITGGAYGPMMRKYGLGADNVVDARIVDASGRVLDRELMGEDLFWAIRGGGGGSFGI  242

Query  1070  LLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAV  891
             LLAWKI+LVPVP+TVTVFTVP+TLE  ATK+L KWQ VA+K+DEDL ++VLIT  NST  
Sbjct  243   LLAWKIRLVPVPSTVTVFTVPKTLETGATKVLNKWQHVANKIDEDLFIRVLITTANSTK-  301

Query  890   KGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP  711
              GK+TVQTA+ A+FLGKTDRLL +MNHSFPELGLT KDC+EMSWIESVIY A YP +  P
Sbjct  302   NGKKTVQTAYQALFLGKTDRLLHVMNHSFPELGLTRKDCVEMSWIESVIYIAGYPSSIKP  361

Query  710   EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPE  531
             EFLL GK LFP   FKAKS+FLR PVPE+GL G+WK FL+ED+P+M+WNPYGGMM KI E
Sbjct  362   EFLLQGKSLFPPVNFKAKSDFLRVPVPETGLEGMWKKFLEEDSPMMIWNPYGGMMGKISE  421

Query  530   SATPFPHRKGVICKIVYLTSWKIEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVNYR  360
             S+ PFPHRKGVICKI YLTSW  EG+KK   KH++WIR +Y+YMGT+VSK PREAYVNYR
Sbjct  422   SSIPFPHRKGVICKIQYLTSW-TEGDKKSADKHINWIRGLYEYMGTFVSKFPREAYVNYR  480

Query  359   DLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             DLDLGMN+N  N++F EASVWG KYFK N++RLV VKT+VDPDNFFWHEQS+P+L
Sbjct  481   DLDLGMNRNA-NSNFLEASVWGKKYFKNNYDRLVLVKTKVDPDNFFWHEQSLPIL  534



>ref|XP_006353032.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Solanum 
tuberosum]
Length=547

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/537 (72%), Positives = 455/537 (85%), Gaps = 9/537 (2%)
 Frame = -2

Query  1790  SSPIILSILFTF-LTFSP-WAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnS  1617
             +S I ++ILF+F L FS    VS +IQ QFY+C++LHS  SIPFSTAFF+ T+NA+SFNS
Sbjct  2     ASSISMNILFSFILLFSASCVVSYTIQDQFYQCITLHSDRSIPFSTAFFTPTSNATSFNS  61

Query  1616  VLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYT  1437
             VL+ST QNL  L PS  KPLLIFT L ESHVQAAV+C KE  VQLRVRSGGHD+EG+SYT
Sbjct  62    VLKSTAQNLRCLTPSQQKPLLIFTALIESHVQAAVICAKELKVQLRVRSGGHDYEGISYT  121

Query  1436  SDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVS  1257
             S+M+    F+++DLAKLR IKVD+EDNS WVQAGAT GEVYYR+AEKSK  G+PAG C S
Sbjct  122   SEMKRSVSFILLDLAKLRAIKVDIEDNSAWVQAGATIGEVYYRIAEKSKTHGYPAGLCTS  181

Query  1256  LgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSF  1077
             LGIGGHITGGAYG M+RKYGL ADNA+DARIVDA+GRVLDRA MGEDLFWAIRGGGGGSF
Sbjct  182   LGIGGHITGGAYGPMMRKYGLGADNAVDARIVDASGRVLDRALMGEDLFWAIRGGGGGSF  241

Query  1076  GILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNST  897
             GI+LAWK++LVPVP+TVTVFTVP+TLE  ATK+L KWQ VA K+DEDL +++LIT VNST
Sbjct  242   GIILAWKVRLVPVPSTVTVFTVPKTLETGATKVLNKWQHVAHKIDEDLFIRILITTVNST  301

Query  896   AVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTT  717
               KGK+TVQTA+ A+FLGKTDRLL +MNHSFPELGLT KDC+EMSWI+SVIY A YP   
Sbjct  302   --KGKKTVQTAYQALFLGKTDRLLDVMNHSFPELGLTRKDCVEMSWIQSVIYIAGYPSNI  359

Query  716   PPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKI  537
              PEFLL GK LFP   FKAKS+FLR PVP +GL+G+W+ FL++D+P+M+WNPYGGMM KI
Sbjct  360   KPEFLLQGKSLFPTVNFKAKSDFLRVPVPVTGLQGMWEKFLQDDSPMMIWNPYGGMMGKI  419

Query  536   PESATPFPHRKGVICKIVYLTSWKIEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVN  366
              ES+ PFPHRKGVICKI YLTSW  +G+KK   KH++WIR +Y+YMGT+VSK PREAYVN
Sbjct  420   SESSIPFPHRKGVICKIQYLTSW-TDGDKKTADKHINWIRGLYEYMGTFVSKFPREAYVN  478

Query  365   YRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             YRDLDLGMNKN  N++F EASVWG KY+K N++RLV VKT VDPDNFFWHEQS+P+L
Sbjct  479   YRDLDLGMNKNA-NSNFLEASVWGKKYYKNNYDRLVLVKTEVDPDNFFWHEQSLPIL  534



>ref|XP_004233182.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Solanum 
lycopersicum]
Length=547

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/537 (71%), Positives = 454/537 (85%), Gaps = 9/537 (2%)
 Frame = -2

Query  1790  SSPIILSILFTFLTF--SPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnS  1617
             +S I ++ILF+F+    +   VS +IQ QFY+C++L+S  SIPFSTAFF+ T+NA+SFNS
Sbjct  2     ASSISMNILFSFILLFSASCVVSYTIQDQFYQCITLYSDRSIPFSTAFFTPTSNATSFNS  61

Query  1616  VLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYT  1437
             VL+ST QNL  L PS  KPLLIFT L ESHVQAAV+C KE  VQLRVRSGGHD+EG+SYT
Sbjct  62    VLKSTAQNLRCLSPSQQKPLLIFTALIESHVQAAVICAKELKVQLRVRSGGHDYEGISYT  121

Query  1436  SDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVS  1257
             S+M+   PF+++DLAKLR IKVD+EDNS WVQAGAT GEVYYR+AEKSK  G+PAG C S
Sbjct  122   SEMKRSVPFIMLDLAKLRAIKVDIEDNSAWVQAGATIGEVYYRIAEKSKTHGYPAGLCTS  181

Query  1256  LgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSF  1077
             LGIGGHITGGAYG M+RKYGL ADN +DARIVD +GRVLDRA MGEDLFWAIRGGGGGSF
Sbjct  182   LGIGGHITGGAYGPMMRKYGLGADNVVDARIVDVSGRVLDRALMGEDLFWAIRGGGGGSF  241

Query  1076  GILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNST  897
             GI+LAWK++LVPVP+TVTVFTVP+TLE  ATK+L+KWQ VA K+DEDL +++LIT VNST
Sbjct  242   GIILAWKVRLVPVPSTVTVFTVPKTLETGATKVLHKWQHVAHKIDEDLFIRILITTVNST  301

Query  896   AVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTT  717
               KGK+TVQTA+ A+FLGKTDRLL +MNHSFPELGLT KDC+EMSWI+SVIY A YP   
Sbjct  302   --KGKKTVQTAYQALFLGKTDRLLDVMNHSFPELGLTQKDCVEMSWIQSVIYIAGYPSNI  359

Query  716   PPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKI  537
              PEFLL GK LFP   FKAKS+FLR PVP +GL+G+W+ FL++D+P+M+WNPYGGMM KI
Sbjct  360   KPEFLLQGKSLFPAVNFKAKSDFLRVPVPVTGLQGMWEKFLQDDSPMMIWNPYGGMMGKI  419

Query  536   PESATPFPHRKGVICKIVYLTSWKIEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVN  366
              ES+ PFPHRKGVICKI YLT+W  +G+KK   KH++WIR +Y+YMGT+VSK PREAYVN
Sbjct  420   SESSIPFPHRKGVICKIQYLTAWT-DGDKKTADKHINWIRGLYEYMGTFVSKYPREAYVN  478

Query  365   YRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             YRDLDLGMNKN  N++  EASVWG KY+K N++RLV VKT+VDPDNFFWHEQS+P+L
Sbjct  479   YRDLDLGMNKNA-NSNILEASVWGKKYYKNNYDRLVLVKTKVDPDNFFWHEQSLPIL  534



>emb|CDP12617.1| unnamed protein product [Coffea canephora]
Length=550

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/513 (68%), Positives = 417/513 (81%), Gaps = 8/513 (2%)
 Frame = -2

Query  1724  SIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFT  1545
             SI+ +FY+CV+LH+  SIP S AF +    + +   VL+ST  NL  L PS PKP LIFT
Sbjct  30    SIEDEFYQCVNLHTDLSIPSSGAFHTPDNASFAS--VLESTAMNLRCLAPSRPKPELIFT  87

Query  1544  PLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDV  1365
             PLTE HVQAAV+C KE  + LRVRSGGHD+EG+SYTS  +SP  F++IDLAKLR I + +
Sbjct  88    PLTEFHVQAAVICAKELNILLRVRSGGHDYEGVSYTSATKSP--FMMIDLAKLRSINISI  145

Query  1364  EDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAAD  1185
             E+NS WVQ GAT GEVYYR+++KS+  GFPAG C SLGIGGHITGGAYG M+RKYGL AD
Sbjct  146   EENSAWVQVGATIGEVYYRISQKSRTRGFPAGLCTSLGIGGHITGGAYGPMMRKYGLGAD  205

Query  1184  NALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPR  1005
             N +DARIVDATGR+LDRA+MGEDLFWAIRGGGGGSFGILLAWK+KLVPVPATVTVFTVPR
Sbjct  206   NVVDARIVDATGRILDRASMGEDLFWAIRGGGGGSFGILLAWKLKLVPVPATVTVFTVPR  265

Query  1004  TLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLL  825
             TLEQ ATKLLY+WQ+VAD LDEDL ++VLI+A NST  KGK+T+QTA+ A+FLG+ DRLL
Sbjct  266   TLEQGATKLLYRWQQVADTLDEDLFIRVLISAANSTGQKGKKTIQTAYQALFLGRADRLL  325

Query  824   KIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFL  645
             K+M   FPELGLT KDCLEMSWIESV+Y A YP T  PEFLL GKPL  KT+FKAKS+F+
Sbjct  326   KVMKKGFPELGLTQKDCLEMSWIESVLYIAGYPGTIKPEFLLQGKPLSDKTYFKAKSDFV  385

Query  644   RTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWK  465
             + P+PE  + G+WK+FL+ED+P  +WN YGGMM KIPESATPFPHRKG    I +LTSW+
Sbjct  386   KEPIPEYAMEGIWKMFLQEDSPFSIWNAYGGMMGKIPESATPFPHRKGRKFMIQWLTSWQ  445

Query  464   IEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWG  294
               G+KK   KH+ WIR++YD++  YVSK PREAYVNYRDLDLG++K    TS+ +ASVWG
Sbjct  446   -SGDKKTTNKHIGWIRKLYDFVAPYVSKCPREAYVNYRDLDLGVDKLNGKTSYLKASVWG  504

Query  293   YKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              +YFK NF+RLV VKT+ DPDNFF HEQSIP L
Sbjct  505   SQYFKDNFKRLVQVKTKFDPDNFFSHEQSIPTL  537



>ref|XP_011085179.1| PREDICTED: reticuline oxidase-like protein [Sesamum indicum]
Length=542

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/538 (66%), Positives = 430/538 (80%), Gaps = 15/538 (3%)
 Frame = -2

Query  1799  ASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfn  1620
             +S S P+  SI+   L  +  A S  I  +FY+C+ L+S  SIPFSTAF +    + +  
Sbjct  4     SSTSLPLTFSII---LVLASLAASQPIHEKFYQCIMLNSELSIPFSTAFCTPNNASFNS-  59

Query  1619  SVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSY  1440
              +LQS+ QNL  L  S PKP LIFTPL E+HVQAAV+C  E G+QLR+RSGGHD+EGLSY
Sbjct  60    -ILQSSAQNLRCLGSSVPKPQLIFTPLVENHVQAAVICANELGIQLRLRSGGHDYEGLSY  118

Query  1439  TSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCV  1260
              S+ME P  F+++DL+KLR + VD++D+S WVQAGAT GE+YYR+++KSK  GFPAG C 
Sbjct  119   ISEMEEP--FIILDLSKLRSVSVDMQDSSAWVQAGATVGELYYRISQKSKTHGFPAGLCT  176

Query  1259  SLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGS  1080
             SLGIGGHITGGAYG M+RKYGL ADN +DARIVDA+GR+LDR +MGEDLFWAIRGGGG S
Sbjct  177   SLGIGGHITGGAYGTMMRKYGLGADNVIDARIVDASGRILDRESMGEDLFWAIRGGGGAS  236

Query  1079  FGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNS  900
             FGI+LAWK++LVPVPATVTVFTVP+TLE+ ATK+LYKWQ+VADKLDEDL ++V+I  VN 
Sbjct  237   FGIILAWKVRLVPVPATVTVFTVPKTLEEGATKILYKWQQVADKLDEDLFIRVIIQVVNG  296

Query  899   TAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRT  720
              A KG+RTVQT+++A+FLG+ DRLL +M  SFPELGLT KDC+EMSWIESV+Y A YP  
Sbjct  297   -AKKGERTVQTSYNALFLGRIDRLLDVMEVSFPELGLTRKDCIEMSWIESVLYIAGYPSK  355

Query  719   TPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAK  540
             TPPE LL GK LF K +FKAKS+F+R P+PE GL GLWK  ++ED+P++++NPYGGMM+K
Sbjct  356   TPPEVLLQGKSLF-KNYFKAKSDFVRKPIPEDGLEGLWKRLMEEDSPLVIFNPYGGMMSK  414

Query  539   IPESATPFPHRKGVICKIVYLTSW---KIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYV  369
             I ES TPFPHRKGVI KI YLT W   K E E  KH+DWIRR+Y+YM  Y S  PREAYV
Sbjct  415   ISESETPFPHRKGVIFKIQYLTLWNDDKPESE-AKHMDWIRRLYNYMAAYASMLPREAYV  473

Query  368   NYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NYRDLDLGMNKNG  +SF EAS+WG KYFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  474   NYRDLDLGMNKNG--SSFIEASLWGTKYFKDNFIRLVKVKTKVDPDNFFRHEQSIPTL  529



>ref|XP_009780565.1| PREDICTED: reticuline oxidase-like protein [Nicotiana sylvestris]
Length=553

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/515 (66%), Positives = 418/515 (81%), Gaps = 8/515 (2%)
 Frame = -2

Query  1733  VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLL  1554
             +S +   +FY+CV  +S   +PFSTAF +    + +   +LQST QNL  LVPS PKP L
Sbjct  32    LSDTTNEKFYQCVCQNSDYCVPFSTAFVTPANASFTT--ILQSTAQNLRLLVPSVPKPQL  89

Query  1553  IFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIK  1374
             IFTP+ ESHVQAAV+C+K+ G+QLRVRSGGHD+EGLSY S+MESP  F+++DL+KLRGI+
Sbjct  90    IFTPMAESHVQAAVICSKQLGLQLRVRSGGHDYEGLSYISEMESP--FIILDLSKLRGIE  147

Query  1373  VDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGL  1194
             V++EDNSVW QAGAT GEVYYR++EKSK  GFPAG C SLGIGGHITGGAYG M+RKYGL
Sbjct  148   VNIEDNSVWAQAGATVGEVYYRISEKSKTHGFPAGLCTSLGIGGHITGGAYGTMMRKYGL  207

Query  1193  AADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvft  1014
              ADN  DARIVDA GR+LDR +MGEDLFWAIRGGGG SFGI+L+WK++LVPVP+ VTVFT
Sbjct  208   GADNVEDARIVDANGRILDRQSMGEDLFWAIRGGGGASFGIILSWKLRLVPVPSIVTVFT  267

Query  1013  vPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTD  834
             V +TLEQN TK++YKWQ+VADK+DEDL ++V++  V+    KG++T+Q A++++FLG++D
Sbjct  268   VSKTLEQNGTKIIYKWQQVADKIDEDLFIRVIMNVVDKKDKKGEKTIQMAYNSLFLGRSD  327

Query  833   RLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKS  654
             RLL+IMN +FPELGLT KDC EMSWI+S++Y A YP  TPPE LL GK LF K +FKAKS
Sbjct  328   RLLEIMNENFPELGLTQKDCTEMSWIKSILYIAGYPSNTPPEVLLQGKSLF-KNYFKAKS  386

Query  653   EFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLT  474
             +F++ P+PE GL GLWK  L+ED+P+M+WNPYGGMMAKI ES TPFPHRKGVI  + YLT
Sbjct  387   DFVKEPIPEDGLEGLWKRLLEEDSPLMIWNPYGGMMAKISESETPFPHRKGVIYMVQYLT  446

Query  473   SWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASV  300
              W    ++   KH DWIRR+Y+YM  Y S  PR+AYVNYRDLDLGMNKNG ++SF +AS+
Sbjct  447   LWNDPDKELATKHFDWIRRLYNYMTPYASMFPRQAYVNYRDLDLGMNKNG-SSSFIQASI  505

Query  299   WGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             WG KYFK NF RLV VKT+VDP N+F HEQSIP L
Sbjct  506   WGNKYFKDNFNRLVKVKTKVDPKNYFLHEQSIPTL  540



>ref|XP_011096883.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Sesamum 
indicum]
Length=542

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/534 (63%), Positives = 421/534 (79%), Gaps = 10/534 (2%)
 Frame = -2

Query  1790  SSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVL  1611
             SS  IL++    L ++  A S  +Q +FY+C++L+S  SIPFS AF +    + S   +L
Sbjct  4     SSSFILTLHIAILAWASCAASQPVQERFYQCITLNSELSIPFSEAFSAPENASFST--IL  61

Query  1610  QSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSD  1431
             +S+ QNL  LVPS PKP LIFTP  E+HVQAAV+C KE G+QLRVRSGGHD+EGLSY S+
Sbjct  62    ESSAQNLRCLVPSVPKPQLIFTPYIENHVQAAVICAKELGIQLRVRSGGHDYEGLSYRSE  121

Query  1430  MESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLg  1251
             M+ P  F+V+DL+KLR ++VD++DNS W QAGAT GE+YYR+++KSK  GFPAG C SLG
Sbjct  122   MDEP--FIVLDLSKLRSVRVDMQDNSAWAQAGATIGELYYRISQKSKTHGFPAGLCSSLG  179

Query  1250  igghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGI  1071
             IGGHITGGAYG M+RKYGL ADN +DARIVDA+GR+LDR +MGEDLFWAIRGGGG SFGI
Sbjct  180   IGGHITGGAYGPMMRKYGLGADNVIDARIVDASGRILDRESMGEDLFWAIRGGGGASFGI  239

Query  1070  LLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAV  891
             +LAWK++LVPVPATVTVFTVP+TLEQ ATK+LYKWQ       ++ L   +I  V + + 
Sbjct  240   ILAWKVRLVPVPATVTVFTVPKTLEQGATKILYKWQ-QVADKIDEDLFIRVIIQVAAGSQ  298

Query  890   KGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP  711
             KG++TVQT ++A+FLG+ DRLL++M  SFPELGLT KDC+EMSWI+S++Y A YP  TPP
Sbjct  299   KGEKTVQTLYNALFLGRADRLLQVMEESFPELGLTRKDCIEMSWIQSLLYIAGYPSNTPP  358

Query  710   EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPE  531
             E LL GK LF K +FKAKS+F++ P+PE+GL GLWK  ++ED+P+M++NPYGGMM+KI E
Sbjct  359   EVLLQGKSLF-KNYFKAKSDFVKEPIPENGLEGLWKRLMEEDSPLMIFNPYGGMMSKISE  417

Query  530   SATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRD  357
             S  PFPHRKGVI KI YLT W  +  +   KH+DWIRR+Y+YM +Y S  PREAYVNYRD
Sbjct  418   SEIPFPHRKGVIFKIQYLTIWNDDKPESAAKHIDWIRRLYNYMASYASMFPREAYVNYRD  477

Query  356   LDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             LDLG N+N  +TSF +AS WG +YFK NF RLV+VKT+VDPDNFF HEQSIP L
Sbjct  478   LDLGTNRN--STSFIQASSWGSRYFKDNFNRLVSVKTKVDPDNFFRHEQSIPTL  529



>ref|XP_009613445.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Nicotiana 
tomentosiformis]
Length=553

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/515 (66%), Positives = 419/515 (81%), Gaps = 8/515 (2%)
 Frame = -2

Query  1733  VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLL  1554
             +S     +FY+CV  +S   +PFSTAF + T  + +   +LQST QNL  LVPS PKP L
Sbjct  32    LSDKTNEKFYQCVCQNSDYCVPFSTAFVTPTNASFTT--ILQSTAQNLRLLVPSVPKPQL  89

Query  1553  IFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIK  1374
             IFTP+ ESHVQAAV+C+K+ G+QLRVRSGGHD+EGLSY S+MESP  F+++DL+KLRGI+
Sbjct  90    IFTPMVESHVQAAVICSKQLGLQLRVRSGGHDYEGLSYISEMESP--FIILDLSKLRGIE  147

Query  1373  VDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGL  1194
             V++EDN VW QAGAT GEVYYR++EKSK  GFPAG C SLGIGGHITGGAYG M+RKYGL
Sbjct  148   VNIEDNFVWAQAGATVGEVYYRISEKSKTHGFPAGLCTSLGIGGHITGGAYGTMMRKYGL  207

Query  1193  AADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvft  1014
              ADN +DARIVDA GR+LDR +MGEDLFWAIRGGGG SFGI+L+WK++LVPVP+ VTVFT
Sbjct  208   GADNVVDARIVDANGRILDRQSMGEDLFWAIRGGGGASFGIILSWKLRLVPVPSIVTVFT  267

Query  1013  vPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTD  834
             VP+TLEQN T ++YKWQ+V+DK+DEDL ++V++  V+    KG++T+Q A++++FLG++D
Sbjct  268   VPKTLEQNGTTIIYKWQQVSDKIDEDLFIRVIMNVVDKKDKKGEKTIQMAYNSLFLGRSD  327

Query  833   RLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKS  654
             RLL+IMN +FPELGLT KDC EMSWI+S++Y A YP  TPPE LL GK LF K +FKAKS
Sbjct  328   RLLEIMNENFPELGLTQKDCTEMSWIKSILYIAGYPSNTPPEVLLQGKSLF-KNYFKAKS  386

Query  653   EFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLT  474
             +F++ P+PE GL GLWK  L+ED+P+M+WNPYGGMMAKI ES TPFPHRKGVI  + YLT
Sbjct  387   DFVKEPIPEDGLEGLWKRLLEEDSPLMIWNPYGGMMAKISESETPFPHRKGVIYMVQYLT  446

Query  473   SWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASV  300
              W    ++   KH DWIRR+Y+YM  Y S  PR+AYVNYRDLDLGMNKNG ++SF +ASV
Sbjct  447   LWNDPDKELATKHFDWIRRLYNYMTPYASMFPRQAYVNYRDLDLGMNKNG-SSSFIQASV  505

Query  299   WGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             WG KYFK NF RLV VKT+VDP+N+F HEQSIP L
Sbjct  506   WGNKYFKDNFNRLVKVKTKVDPENYFLHEQSIPTL  540



>ref|XP_009624111.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Nicotiana 
tomentosiformis]
Length=547

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/539 (64%), Positives = 425/539 (79%), Gaps = 8/539 (1%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassf  1623
             MAS +S ++  IL    + S  A+S +   +FY+C+  +S  S PF+ AFF+  T+  + 
Sbjct  1     MASLNSILVSFILVLLFSSSCSALSDTTPEKFYQCICKNSDFSDPFTKAFFTPNTDPFNT  60

Query  1622  nSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLS  1443
               VL ST QNL  L+PS PKP LIFTP+ ESHVQAAV+C K+  +QLRVRSGGHD+EGLS
Sbjct  61    --VLNSTAQNLRCLIPSVPKPELIFTPMAESHVQAAVICAKQLNLQLRVRSGGHDYEGLS  118

Query  1442  YTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNC  1263
             Y S MESP  FV++DL+KLR I V++E+NS W QAGAT GEVYYR++EKSK  GFPAG C
Sbjct  119   YISVMESP--FVIVDLSKLREIDVNIEENSAWTQAGATVGEVYYRISEKSKTHGFPAGLC  176

Query  1262  VSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggG  1083
              SLGIGGHITGGAYG+M+RK+GL ADN +DARI++A G +LDR +MGEDLFWAIRGGGG 
Sbjct  177   TSLGIGGHITGGAYGSMMRKFGLGADNVIDARIINANGTILDRQSMGEDLFWAIRGGGGA  236

Query  1082  SFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVN  903
             SFG++L+WK+KLV VP+ VTVFTVP+TLE +ATK+LYKW++VADK+D+DL ++V+I  V 
Sbjct  237   SFGVILSWKLKLVTVPSVVTVFTVPKTLEDDATKILYKWEQVADKIDDDLFMRVVINVVE  296

Query  902   STAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR  723
                 KG+RTVQTA++++FLG  DRLL+IMN SFPELGLT KDC EMSWIES++Y A +P 
Sbjct  297   RKDKKGERTVQTAYNSLFLGTADRLLQIMNESFPELGLTEKDCTEMSWIESILYIAGFPT  356

Query  722   TTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMA  543
              TPPE LL GK  F K +FKAKS+F+R P+PE+GL G+WK  L+E++P+M+WNPYGGMMA
Sbjct  357   KTPPEVLLQGKSTF-KNYFKAKSDFVREPIPETGLEGIWKRLLEENSPLMIWNPYGGMMA  415

Query  542   KIPESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYV  369
              I ES TPFPHRKGVI KI YLT W    ++   KH+DWIRR+Y+YM +Y S  PREAYV
Sbjct  416   NISESETPFPHRKGVIFKIQYLTLWNEPDQELATKHVDWIRRLYNYMTSYASMFPREAYV  475

Query  368   NYRDLDLGMNKNGR-NTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NYRDLDLGMNKNG  N+SF +ASVWG KYFK NF RLV +KTRVDP+NFF  EQSIP L
Sbjct  476   NYRDLDLGMNKNGNSNSSFVQASVWGNKYFKNNFNRLVQIKTRVDPENFFKFEQSIPTL  534



>emb|CDP12618.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/513 (68%), Positives = 414/513 (81%), Gaps = 8/513 (2%)
 Frame = -2

Query  1724  SIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFT  1545
             SI+ +FY+CV+LH+  SIPF +AFF+    + +   VLQST  NL  L PS PKP LIFT
Sbjct  29    SIEDKFYQCVNLHTDLSIPFHSAFFTPENASFTS--VLQSTAMNLRCLGPSRPKPELIFT  86

Query  1544  PLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDV  1365
             PLTES VQAAV+C KE  +QLRVRSGGHD+EG+SYTS   +P PF++IDLAKLR I V +
Sbjct  87    PLTESQVQAAVICAKELNIQLRVRSGGHDYEGMSYTS--ATPFPFIMIDLAKLRFINVSI  144

Query  1364  EDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAAD  1185
             E+NS W Q GAT GEVYYR+++KS+  GFPAG C SLGIGGHITGGAYG M+RKYGL AD
Sbjct  145   EENSAWAQVGATIGEVYYRISQKSRIHGFPAGLCTSLGIGGHITGGAYGPMMRKYGLGAD  204

Query  1184  NALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPR  1005
             N +DARIVDATGR+LDRA+MGEDLFWAIRGGGGGSFGILLAWK+KLVPVP TVTVFTVPR
Sbjct  205   NVVDARIVDATGRILDRASMGEDLFWAIRGGGGGSFGILLAWKLKLVPVPLTVTVFTVPR  264

Query  1004  TLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLL  825
             TLEQ ATKLLY+WQ+VAD LDEDL ++VLI+AVNST  +GKRT+QTA+ A+FLG+ +RLL
Sbjct  265   TLEQGATKLLYRWQQVADTLDEDLFIRVLISAVNSTDQQGKRTIQTAYQALFLGRANRLL  324

Query  824   KIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFL  645
             K+M   FPELGLT KDC+EMSWIESV+Y A YP T  PEFLL  K  F KT+FKAKS+F+
Sbjct  325   KVMKKGFPELGLTQKDCVEMSWIESVLYIAGYPPTLKPEFLLQRKSFFNKTYFKAKSDFV  384

Query  644   RTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWK  465
             + P+P+  L G+WK FL+ED+P  +WN YGGMM KIPES  PFPHRKG    I +LT+W+
Sbjct  385   KEPIPKFALEGIWKRFLQEDSPFTIWNAYGGMMGKIPESEIPFPHRKGRKFMIQWLTAWQ  444

Query  464   IEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWG  294
               G+KK   KH+DWIR++YD +G YVSK PREAYVNYRDLDLG++K   N ++ +AS WG
Sbjct  445   -SGDKKTADKHIDWIRKLYDSVGPYVSKFPREAYVNYRDLDLGVDKLSGNVNYLKASFWG  503

Query  293   YKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
               YFK NF+RLV VKT+VDPDNFF HEQSIP L
Sbjct  504   SSYFKDNFKRLVQVKTKVDPDNFFRHEQSIPTL  536



>emb|CDP12589.1| unnamed protein product [Coffea canephora]
Length=550

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/517 (67%), Positives = 416/517 (80%), Gaps = 11/517 (2%)
 Frame = -2

Query  1733  VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLL  1554
             VS ++Q  F++C++ +S   +PFS+AF S   ++ S   VLQST QNL  L PS  KP L
Sbjct  30    VSQTVQENFFQCINQNSELYVPFSSAFVSPNNDSFSS--VLQSTAQNLRCLEPSVAKPQL  87

Query  1553  IFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIK  1374
             IFTPL ESHVQAAV+C KE G+Q+R+RSGGHD+EGLSY SD++SP  F+++DL KLR I 
Sbjct  88    IFTPLIESHVQAAVICAKEVGIQIRMRSGGHDYEGLSYISDLDSP--FIIVDLGKLRAIS  145

Query  1373  VDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGL  1194
             VD++DNS WVQAGAT GEVYYR+ +KSK  GFPAG C SLGIGGHITGGAYG M+RK+GL
Sbjct  146   VDIDDNSAWVQAGATIGEVYYRIFQKSKTHGFPAGLCTSLGIGGHITGGAYGTMMRKFGL  205

Query  1193  AADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvft  1014
              ADN LDARIVDA GR+LDR +MGEDLFWAIRGGGG SFGI+L+WKIKLVPVP+ VTVFT
Sbjct  206   GADNVLDARIVDAQGRILDRQSMGEDLFWAIRGGGGASFGIILSWKIKLVPVPSIVTVFT  265

Query  1013  vPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTD  834
             VP+TLEQ ATK+LYKWQ+VADKLDEDL ++V+I   ++ A KG++TVQTA++A FLG   
Sbjct  266   VPKTLEQGATKILYKWQQVADKLDEDLFIRVIIQNADA-AQKGEKTVQTAYNAQFLGTAS  324

Query  833   RLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKS  654
             RLL++MN SFPELGLT KDC EMSWI+SV+Y A YP  TPPE LL GK LF K +FKAKS
Sbjct  325   RLLEVMNQSFPELGLTQKDCTEMSWIQSVMYIAGYPSKTPPEVLLEGKSLF-KNYFKAKS  383

Query  653   EFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLT  474
             +F+R P+PE GL GLWK  ++ D+P+M+WNPYGGMM+KI ES  PFPHRKGVI KI Y+T
Sbjct  384   DFVREPIPEDGLEGLWKRLMEGDSPLMIWNPYGGMMSKISESEIPFPHRKGVIFKIQYVT  443

Query  473   SWKIEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEAS  303
              W+ + +K    KH+DWIR++Y+YM TY S  PREAYVNYRDLDLG+NK+G NTSF +AS
Sbjct  444   LWQ-DADKDTAAKHIDWIRKLYNYMATYASTFPREAYVNYRDLDLGVNKDG-NTSFIQAS  501

Query  302   VWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             VWG KYFK NF RLV +K +VDP N F HEQSIP L+
Sbjct  502   VWGSKYFKNNFNRLVRIKNKVDPGNMFRHEQSIPPLA  538



>ref|XP_007023066.1| FAD-binding Berberine family protein isoform 1 [Theobroma cacao]
 ref|XP_007023067.1| FAD-binding Berberine family protein isoform 1 [Theobroma cacao]
 gb|EOY25688.1| FAD-binding Berberine family protein isoform 1 [Theobroma cacao]
 gb|EOY25689.1| FAD-binding Berberine family protein isoform 1 [Theobroma cacao]
Length=530

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/518 (64%), Positives = 397/518 (77%), Gaps = 12/518 (2%)
 Frame = -2

Query  1745  SPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAP  1566
             + WA S SIQ  F +C+  +S   IP S       ++ +S   VL ST QNL +L PS P
Sbjct  18    ASWATSASIQDNFIQCLDDNSEQVIPISAVCAQNNSSFTS---VLNSTAQNLRYLEPSVP  74

Query  1565  KPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKL  1386
             KP  IFTPL ESHVQAAV+C K+ G+ LR RSGGHD+EGLSY S++E+P  F+++DLA+L
Sbjct  75    KPQFIFTPLNESHVQAAVICAKKLGIHLRFRSGGHDYEGLSYASEIETP--FIMLDLARL  132

Query  1385  RGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLR  1206
             R + VD++DN+ WVQAGAT GEVYYR++E SK  GFPAG C SLGIGGHITGGAYG+M+R
Sbjct  133   RSVNVDIDDNTAWVQAGATIGEVYYRISETSKTHGFPAGLCSSLGIGGHITGGAYGSMMR  192

Query  1205  KYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatv  1026
             KYGL ADN LDARIVDA G+VLDRAAMGED FWAIRGGGG SFGI+LAWKIKLVPVP TV
Sbjct  193   KYGLGADNVLDARIVDANGKVLDRAAMGEDHFWAIRGGGGASFGIILAWKIKLVPVPETV  252

Query  1025  tvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFL  846
             TVFTVP+TLEQ ATK+LY+WQ       ++ L   +I  V     KG+RTV TA++A+FL
Sbjct  253   TVFTVPKTLEQGATKILYRWQ-QVADKLDEDLFIRVIIQVTKAGQKGERTVTTAYNALFL  311

Query  845   GKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFF  666
             G  DRLL++MN SFPELGLT K+C+E SWI+SV+Y A YP  TPPE L  GK LF K +F
Sbjct  312   GDADRLLQVMNQSFPELGLTRKECIETSWIKSVLYIAGYPSDTPPEVLQQGKSLF-KNYF  370

Query  665   KAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKI  486
             KAKS+F++ P+PE+GL GLWK  L+ED+P+M+WNPYGGMMA I ESA  FPHRKG + KI
Sbjct  371   KAKSDFVQRPIPETGLEGLWKRLLQEDSPLMIWNPYGGMMANISESAIAFPHRKGNLFKI  430

Query  485   VYLTSWKIEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSF  315
              Y+TSW  EG +    KH DWIR +YDYM  YV  SPR AYVNYRDLDLG+N +  NTS 
Sbjct  431   QYVTSW-YEGSQDATTKHTDWIRGLYDYMAAYVPTSPRAAYVNYRDLDLGIN-DKTNTSL  488

Query  314   SEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             S+A VWG KYFKGNF+RLV VK++VDPDNFF HEQSIP
Sbjct  489   SQARVWGTKYFKGNFDRLVKVKSKVDPDNFFRHEQSIP  526



>gb|EYU43215.1| hypothetical protein MIMGU_mgv1a004278mg [Erythranthe guttata]
Length=535

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/531 (64%), Positives = 424/531 (80%), Gaps = 12/531 (2%)
 Frame = -2

Query  1781  IILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQST  1602
             +IL+I+ +  + S +A S +IQ +FY+C+ ++S  +IPFSTAF +    + +   +LQST
Sbjct  9     VILAIVLS--SSSSYATSQTIQEKFYQCIIVNSELAIPFSTAFSTPENASFTT--ILQST  64

Query  1601  VQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMES  1422
              QNL  L PS PKP LIFTPL E+HVQAAV C+KE  + LR+RSGGHD+EGLSY S+ E 
Sbjct  65    AQNLRCLTPSIPKPQLIFTPLIENHVQAAVTCSKELDIHLRIRSGGHDYEGLSYMSEDEQ  124

Query  1421  PAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigg  1242
             P  FVV+DL+KLR + VD+ DN+ W QAGA+ GE+YYR+A+KSK  GFPAG C SLGIGG
Sbjct  125   P--FVVLDLSKLRQVSVDIPDNTAWAQAGASVGELYYRIAQKSKTHGFPAGLCPSLGIGG  182

Query  1241  hitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLA  1062
             H+TGGAYG M+RKYGL ADN +DARIVD++GR+LDR +MGEDLFWAIRGGGGGSFGI+LA
Sbjct  183   HLTGGAYGPMMRKYGLGADNVIDARIVDSSGRILDRESMGEDLFWAIRGGGGGSFGIILA  242

Query  1061  WKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             WK++LVPVP  VTVFTV +TLE+N T+++ KWQ+VADKLDEDL ++V++  V  +  KG 
Sbjct  243   WKVRLVPVPTIVTVFTVSKTLEENGTEIIKKWQEVADKLDEDLFIRVIMQVVEGSE-KGS  301

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             +TVQT+++A+FLG TDRLL +M   FPELGLT KDC+EMSWIESV+Y A +P  TPPE L
Sbjct  302   KTVQTSYNALFLGGTDRLLGVMETGFPELGLTKKDCVEMSWIESVLYIAGFPSKTPPEVL  361

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK LF K +FKAKS+F+R PVPE GL GL++  ++ED+P+M+WNPYGGMM+ I ES T
Sbjct  362   LQGKSLF-KNYFKAKSDFVRKPVPEEGLNGLFERLMEEDSPLMIWNPYGGMMSNISESET  420

Query  521   PFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
             PFPHRKGVI KI YLT W  + ++   KH+DWIRR+Y YM  YVSK PREAYVNYRDLDL
Sbjct  421   PFPHRKGVIYKIQYLTLWNDDKQESEAKHVDWIRRLYSYMRAYVSKFPREAYVNYRDLDL  480

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             GMN+NG  ++F EAS+WG KYFK NF RLV VKT+VDPDNFF HEQSIP+L
Sbjct  481   GMNRNG--STFIEASLWGSKYFKDNFSRLVRVKTKVDPDNFFRHEQSIPIL  529



>ref|XP_009791203.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Nicotiana 
sylvestris]
Length=547

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/539 (63%), Positives = 424/539 (79%), Gaps = 8/539 (1%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassf  1623
             MAS +S  +   +    + S  A S +   +FY+C+  +S  S PFS AFF+  T++ + 
Sbjct  1     MASLNSITVSFFIVLLFSSSCSAHSDTTPEKFYQCICKNSDFSDPFSKAFFTPNTDSFNT  60

Query  1622  nSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLS  1443
               VL ST QNL  L+PS PKP LIFTP+ ES+VQAAV+C K+  +QLRVRSGGHD+EGLS
Sbjct  61    --VLNSTAQNLRCLIPSVPKPELIFTPMAESYVQAAVICAKQLNLQLRVRSGGHDYEGLS  118

Query  1442  YTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNC  1263
             Y S M+SP  FV++DL+KLR I V++E+NS W QAGAT GEVYYR++EKSK  GFPAG C
Sbjct  119   YISVMDSP--FVIVDLSKLREIDVNIEENSAWAQAGATVGEVYYRISEKSKTHGFPAGLC  176

Query  1262  VSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggG  1083
              SLGIGGHITGGAYG+M+RK+GL ADN +DARIV+A G +LDR +MGEDLFWAIRGGGG 
Sbjct  177   TSLGIGGHITGGAYGSMMRKFGLGADNVIDARIVNANGTILDRQSMGEDLFWAIRGGGGA  236

Query  1082  SFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVN  903
             SFGI+L+WK+KLV VP+ VTVFTVP+TLE  ATK+LYKWQ+VADK+D+DL ++V+I  V+
Sbjct  237   SFGIILSWKLKLVTVPSIVTVFTVPKTLEDGATKILYKWQQVADKIDDDLFMRVVINVVD  296

Query  902   STAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR  723
                 KG+RTVQTA++++FLGK DRLL+IMN SFPELGLT KDC+EM+WIES++Y A +P 
Sbjct  297   KKDKKGERTVQTAYNSLFLGKADRLLQIMNESFPELGLTQKDCIEMNWIESILYIAGFPT  356

Query  722   TTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMA  543
              TPPE LL GKP F K +FKAKS+F++ P+PE+GL G+WK  L+E +P+M+WNPYGGMMA
Sbjct  357   KTPPEILLQGKPTF-KNYFKAKSDFIKEPIPETGLEGIWKRLLEEYSPLMIWNPYGGMMA  415

Query  542   KIPESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYV  369
              I ES TPFPHRKGVI KI YLT W    ++   KH++WIR++Y+YM +Y S  PREAYV
Sbjct  416   NISESETPFPHRKGVIFKIQYLTLWNEPDQELATKHINWIRKLYNYMTSYASMFPREAYV  475

Query  368   NYRDLDLGMNKN-GRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NYRDLDLGMNKN   N+SF +ASVWG KYFK NF RLV +KT+VDP+NFF  EQSIP L
Sbjct  476   NYRDLDLGMNKNVNSNSSFVQASVWGNKYFKNNFNRLVEIKTKVDPENFFKFEQSIPTL  534



>ref|XP_006352999.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Solanum 
tuberosum]
Length=534

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/538 (64%), Positives = 425/538 (79%), Gaps = 9/538 (2%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassf  1623
             MAS S+ I+++++   L  S   +S +I  +FY+C+  +S  S   S +    T N +SF
Sbjct  1     MAS-SNCIMVTLIIILLWSSSSVLSDTIPEKFYQCICKNSDFS--DSFSTAFYTPNDASF  57

Query  1622  nSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLS  1443
             N++L ST QNL  L+PS PKP LIFTPLTE HVQA+V+C K+  +QLRVRSGGHD+EG+S
Sbjct  58    NTILNSTAQNLRCLMPSVPKPELIFTPLTEPHVQASVICAKQLNLQLRVRSGGHDYEGIS  117

Query  1442  YTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNC  1263
             Y S+M SP  FV++DL KLRGI+V++E+NS W QAGAT GEVYYR++EKSK LGFPAG C
Sbjct  118   YISEMGSP--FVIVDLLKLRGIEVNIEENSAWAQAGATVGEVYYRISEKSKTLGFPAGLC  175

Query  1262  VSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggG  1083
              SLGIGGHITGGAYG+M+RK+GL  DN +DA IV+A G +LDR +MGEDLFWAIRGGGG 
Sbjct  176   TSLGIGGHITGGAYGSMMRKFGLGVDNVIDAHIVNANGTILDRQSMGEDLFWAIRGGGGA  235

Query  1082  SFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVN  903
             SFGI+L+WK+KLV VP+ VTVFTVP+TLE  ATK+LYKWQ+VADK+D+ L ++V+I  V+
Sbjct  236   SFGIILSWKMKLVTVPSIVTVFTVPKTLEDGATKILYKWQQVADKIDDGLFMRVVINVVD  295

Query  902   STAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR  723
                VKG+RTVQTA++++FLG  + LL+IMN SFPELGLT KD  EMSWIES++Y A Y  
Sbjct  296   KKDVKGERTVQTAYNSLFLGNAETLLRIMNESFPELGLTQKDVTEMSWIESILYIAGYAN  355

Query  722   TTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMA  543
              TPPE LL GK LF K +FKAKS+F++ P+PE+GL GLWK  L+ED+P+M+WNPYGGMMA
Sbjct  356   NTPPEVLLQGKSLF-KNYFKAKSDFIKEPIPETGLEGLWKRLLEEDSPLMIWNPYGGMMA  414

Query  542   KIPESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYV  369
              I ES TPFPHRKGVI KI YLT W    ++   KH+DWIR++Y+YM +Y S  PREAYV
Sbjct  415   NISESDTPFPHRKGVIFKIQYLTLWNQPDQELATKHVDWIRKLYNYMTSYASMYPREAYV  474

Query  368   NYRDLDLGMNKN-GRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             NYRDLDLGMNKN  RN+SF++ASVWG KYFK NF RLV +KT VDP+NFF HEQSIPV
Sbjct  475   NYRDLDLGMNKNVNRNSSFAQASVWGNKYFKNNFNRLVQIKTIVDPENFFKHEQSIPV  532



>ref|XP_004247512.1| PREDICTED: reticuline oxidase-like protein [Solanum lycopersicum]
Length=549

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/542 (62%), Positives = 417/542 (77%), Gaps = 13/542 (2%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFSPWAVS----LSIQHQFYKCVSLHSHTSIPfstaffstttn  1635
             M S +  ++LSI       S +A+S     S   + Y+C+  +S   +PFSTAF + T +
Sbjct  1     MKSLNFSVMLSIFLIVSCSSSYALSDVSTSSSNGKLYECICQNSDYCVPFSTAFVTPTND  60

Query  1634  assfnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDF  1455
             + +   +LQST QNL  L+PS  KP LIFTP+TESHVQAAV+C+K+ G+QLRVRSGGHD+
Sbjct  61    SFNT--ILQSTAQNLRCLLPSVTKPQLIFTPMTESHVQAAVICSKQLGLQLRVRSGGHDY  118

Query  1454  EGLSYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFP  1275
             EGLSY SDMESP  F+++DL+KLR I V+  DN  W QAGAT GEVYYR++EKSK  GFP
Sbjct  119   EGLSYMSDMESP--FIILDLSKLRDIVVNTVDNYAWAQAGATVGEVYYRISEKSKTHGFP  176

Query  1274  AGNCVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRg  1095
             AG C SLGIGGHITGGAYG M+RKYGL  DN +DARIVDA GR+LDR +MGEDLFWAIRG
Sbjct  177   AGLCTSLGIGGHITGGAYGTMMRKYGLGVDNVVDARIVDANGRILDRQSMGEDLFWAIRG  236

Query  1094  gggGSFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLI  915
             GGG SFGI+L+WK+KLVPVP+ VTVFTVP+TL+QNAT +LYKWQ+VA    ++ L   +I
Sbjct  237   GGGASFGIILSWKLKLVPVPSIVTVFTVPKTLDQNATNILYKWQQVAADKLDEDLFIRVI  296

Query  914   TAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNA  735
               V +   KG++T+QTA++++FLG+ DRLL+IMN  FPELGLT KDC EMSWI+S++Y A
Sbjct  297   INVAADK-KGEKTIQTAYNSMFLGRADRLLQIMNDVFPELGLTHKDCTEMSWIKSIMYIA  355

Query  734   LYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYG  555
              YP  TPPE LL GK LF K +FKAKS+F++ P+P  GL GLWK  ++ED+P+++WNPYG
Sbjct  356   GYPSNTPPEVLLQGKSLF-KNYFKAKSDFVKEPIPIDGLEGLWKRLMEEDSPLVIWNPYG  414

Query  554   GMMAKIPESATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPR  381
             GMMAKI ES TPFPHRKG+I  I YLT W    ++   KH DWIRR+Y+YM  YVS  PR
Sbjct  415   GMMAKISESETPFPHRKGIIYMIQYLTLWNDPSKESATKHYDWIRRLYNYMTPYVSMFPR  474

Query  380   EAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             EAYVNYRDLD+GMNKN  ++SF EASVWG KY+K NF RLV VKT+VDP+NFF HEQSIP
Sbjct  475   EAYVNYRDLDIGMNKN-ESSSFIEASVWGNKYYKDNFNRLVKVKTKVDPENFFLHEQSIP  533

Query  200   VL  195
              L
Sbjct  534   TL  535



>ref|XP_006367236.1| PREDICTED: reticuline oxidase-like protein-like [Solanum tuberosum]
Length=554

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/545 (62%), Positives = 419/545 (77%), Gaps = 16/545 (3%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFS---PWAVS----LSIQHQFYKCVSLHSHTSIPfstaffst  1644
             M S +  ++LSI    L +S    +A+S     S+  + Y+C+  +S   +PFSTAF + 
Sbjct  1     MKSLNFSVMLSIFLIVLLYSCSSSYALSDDSTSSLNGKLYECICQNSDYCVPFSTAFVTP  60

Query  1643  ttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGG  1464
             T ++ +   +LQST QNL  L+PS  KP +IFTP+ ESHVQAAV+C+K+ G+QLRVRSGG
Sbjct  61    TNDSFNT--ILQSTAQNLRCLLPSVTKPQIIFTPMAESHVQAAVICSKQLGLQLRVRSGG  118

Query  1463  HDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNL  1284
             HD+EGLSY SDMESP  F+++DL+KLR I V+ EDN  W QAGAT GEVYYR++EKSK  
Sbjct  119   HDYEGLSYMSDMESP--FIILDLSKLREIVVNTEDNYAWTQAGATVGEVYYRISEKSKTH  176

Query  1283  GFPAGNCVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWA  1104
             GFPAG C SLGIGGHITGGAYG M+RKYGL  DN +DARIVDA GR+LDR +MGEDLFWA
Sbjct  177   GFPAGLCTSLGIGGHITGGAYGTMMRKYGLGVDNVVDARIVDANGRILDRQSMGEDLFWA  236

Query  1103  IRggggGSFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllk  924
             IRGGGG SFGI+L+WK+KLVPVP+ VTVFTVP+TL+QNAT +LYKWQ+VA    ++ L  
Sbjct  237   IRGGGGASFGIILSWKLKLVPVPSIVTVFTVPKTLDQNATNILYKWQQVAADKLDEDLFI  296

Query  923   vLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVI  744
              +I  V +   KG++T+QTA++++FLG+ DRLL+IMN  FPELGLT KDC EMSWI+S++
Sbjct  297   RVIINVVADK-KGEKTIQTAYNSMFLGRADRLLQIMNDVFPELGLTQKDCTEMSWIKSIM  355

Query  743   YNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWN  564
             Y A YP  TPPE LL GK LF K +FKAKS+F++ P+P  GL GLWK  ++ED+P+++WN
Sbjct  356   YIAGYPSNTPPEVLLQGKSLF-KNYFKAKSDFVKEPIPIDGLEGLWKRLMEEDSPLVIWN  414

Query  563   PYGGMMAKIPESATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSK  390
             PYGGMMAKI ES TPFPHRKG+I  I YLT W    ++   KH DWIRR+Y+YM  Y S 
Sbjct  415   PYGGMMAKISESETPFPHRKGIIYMIQYLTLWNDPSKESATKHYDWIRRLYNYMTPYASM  474

Query  389   SPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQ  210
              PREAYVNYRDLD+GMNKN  ++SF EASVWG KY+K NF RLV VKT+VDP+NFF HEQ
Sbjct  475   FPREAYVNYRDLDIGMNKN-ESSSFIEASVWGNKYYKDNFNRLVKVKTKVDPENFFLHEQ  533

Query  209   SIPVL  195
             SIP L
Sbjct  534   SIPTL  538



>ref|XP_002523164.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39195.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=548

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/520 (66%), Positives = 414/520 (80%), Gaps = 16/520 (3%)
 Frame = -2

Query  1739  WAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKP  1560
             +A SL I   F +C+ ++S   IPFST+F++   ++ S      +  QNL +L+PS PKP
Sbjct  23    FAYSLPIFDSFIQCLKVNSEILIPFSTSFYTHDNSSFSSVLQSSA--QNLRYLLPSVPKP  80

Query  1559  LLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRG  1380
               IFTPL E+HVQAAV+C+K+ G+ LRVRSGGHD+EGLSY S++ESP  F+V+DL+KLR 
Sbjct  81    EFIFTPLHETHVQAAVICSKQLGIHLRVRSGGHDYEGLSYASEIESP--FIVVDLSKLRY  138

Query  1379  IKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKY  1200
             + VD++DNS WVQAGAT GE YYR++EKS+  GFPAG C SLGIGGHITGGAYG+M+RKY
Sbjct  139   VSVDIDDNSAWVQAGATVGEAYYRISEKSRTHGFPAGLCTSLGIGGHITGGAYGSMMRKY  198

Query  1199  GLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtv  1020
             GL ADN +DARI+DA GRVLDR AMGEDLFWAIRGGGG SFGI+LAWK+KLVPVPA VTV
Sbjct  199   GLGADNVIDARIIDANGRVLDRQAMGEDLFWAIRGGGGASFGIILAWKLKLVPVPAIVTV  258

Query  1019  ftvPRTLEQNATKLLYKWQkvadkldedlllkvLI---TAVNSTAVKGKRTVQTAFDAVF  849
             FTV +TLEQ+ATK+LY+WQ+VADKLDEDL ++V+I   T  NSTA    RTV  ++   F
Sbjct  259   FTVTKTLEQDATKILYRWQQVADKLDEDLFIRVIISTATIANSTA----RTVSNSYQGQF  314

Query  848   LGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTF  669
             LG  +RLL +M  SFPELGLT KDC+E SWI+SV+Y A YP TTPPE LL GK LF K +
Sbjct  315   LGDANRLLHVMETSFPELGLTRKDCIETSWIKSVLYIAGYPSTTPPEVLLQGKSLF-KNY  373

Query  668   FKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICK  489
             FKAKS+F++ P+PE+ L+GLWK  L+E++P+M+WNPYGGMM KI ESA PFPHRKGV+CK
Sbjct  374   FKAKSDFVKEPIPETALQGLWKRLLQEESPLMIWNPYGGMMGKISESAIPFPHRKGVLCK  433

Query  488   IVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSF  315
             I YLT W+ +GEK   KH+DWIR++Y+YM  YVS  PR AYVNYRDLDLGMNKN  +TSF
Sbjct  434   IQYLTGWQ-DGEKNAAKHMDWIRKLYNYMAPYVSMFPRTAYVNYRDLDLGMNKNS-STSF  491

Query  314   SEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              +AS WG KYFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  492   IQASAWGSKYFKDNFNRLVQVKTKVDPDNFFRHEQSIPPL  531



>gb|KDO52566.1| hypothetical protein CISIN_1g036220mg, partial [Citrus sinensis]
Length=522

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/518 (66%), Positives = 418/518 (81%), Gaps = 13/518 (3%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S S+   F KC+S++S   +P ST F    ++ SS   +L+S+ QNL +LVPS PKP  I
Sbjct  10    SASLLDNFSKCLSVNSELYVPSSTFFSQNNSSFSS---ILESSAQNLRYLVPSMPKPEFI  66

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPL E+HVQAAV+C KE GV LRVRSGGHD+EGLSY S+ E+P  F+++DLAKLR +KV
Sbjct  67    FTPLYEAHVQAAVICCKELGVHLRVRSGGHDYEGLSYVSETETP--FIIVDLAKLRSVKV  124

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D++DNS WVQAGAT GEVYYR++EKSK  GFPAG C SLG+GGHITGGAYG+M+RKYGL 
Sbjct  125   DIDDNSAWVQAGATIGEVYYRISEKSKTHGFPAGLCTSLGVGGHITGGAYGSMMRKYGLG  184

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DARIVDA+GR+LDR AMGED FWAIRGGGG SFG++LAWKIKLVPVPATVTVFTV
Sbjct  185   ADNVVDARIVDASGRILDREAMGEDFFWAIRGGGGASFGVILAWKIKLVPVPATVTVFTV  244

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ ATKLL++WQ+VADKLDEDL ++V+I   N+   KG++TV T+++++FLG  +R
Sbjct  245   TKTLEQCATKLLHRWQEVADKLDEDLFIRVIIQVANA-GPKGEKTVTTSYNSLFLGGAER  303

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LLK++  SFPELGLT KDC E SWI+SV+Y A YP  TPPE LL GK LF K +FKAKS+
Sbjct  304   LLKVVEESFPELGLTKKDCTETSWIKSVLYIAGYPSNTPPEVLLQGKSLF-KNYFKAKSD  362

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F++ P+PE+ L GLWK  L ED+P+M+W PYGGMM+KI ES  PFPHRKG + KI Y+++
Sbjct  363   FVKDPIPETALEGLWKRLLGEDSPLMIWTPYGGMMSKISESEIPFPHRKGTLFKIQYVST  422

Query  470   WKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             W+ +GEK   KH+DWIRR+Y+YMG YVS  PR AYVNYRDLDLGMNKNG  +SF ++SVW
Sbjct  423   WQ-DGEKNATKHIDWIRRLYNYMGPYVSMLPRAAYVNYRDLDLGMNKNG--SSFIKSSVW  479

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS*LC  183
             GYKYFK NF RLV VKT+VDPDNFF HEQSIP L  LC
Sbjct  480   GYKYFKDNFNRLVKVKTKVDPDNFFRHEQSIPPLP-LC  516



>ref|XP_002268361.1| PREDICTED: tetrahydrocannabinolic acid synthase [Vitis vinifera]
Length=539

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/533 (65%), Positives = 418/533 (78%), Gaps = 12/533 (2%)
 Frame = -2

Query  1793  WSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSV  1614
             +S+  +  +LF  L+ S  A S  I  +F +CVSL+S   IP STAF++  T + S    
Sbjct  3     YSNFAMFPLLFILLSASVTA-SDPILEKFSQCVSLNSEILIPVSTAFYTPNTTSFSA--F  59

Query  1613  LQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTS  1434
             LQS+ QNL +LVPSAPKP  IFTP+ ++HVQAAV+C+K+  + +RVRSGGHD+EGLSY S
Sbjct  60    LQSSAQNLRYLVPSAPKPEFIFTPMHDTHVQAAVICSKQLSIHMRVRSGGHDYEGLSYVS  119

Query  1433  DMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSL  1254
             +ME P  F+++DLA+LRGIKVD++DNS WVQAGAT GEVYYR+ EKSK  GFPAG C SL
Sbjct  120   EMEKP--FIMVDLARLRGIKVDIDDNSAWVQAGATVGEVYYRIYEKSKTHGFPAGLCTSL  177

Query  1253  gigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFG  1074
             GIGGHITGGAYG+M+RKYGL ADN +DARIVD  GR+LDR +MGEDLFWAIRGGGG SFG
Sbjct  178   GIGGHITGGAYGSMMRKYGLGADNVMDARIVDVHGRILDRESMGEDLFWAIRGGGGASFG  237

Query  1073  ILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTA  894
             I+L WKI+LVPVP+TVTVFTV R LEQ ATKLLY+WQ+VADKL EDL ++V+I+   +  
Sbjct  238   IILWWKIRLVPVPSTVTVFTVGRALEQGATKLLYRWQQVADKLHEDLFIRVIISVKANE-  296

Query  893   VKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTP  714
              KG +TV  AF+++FLG  DRLL+IM  SFPELGLT KDC EMSWI SV+Y   YP  TP
Sbjct  297   -KGNKTVSAAFNSLFLGGVDRLLQIMGESFPELGLTMKDCTEMSWIRSVLYIGGYPSGTP  355

Query  713   PEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIP  534
             PE LL GK  F K +FKAKS+F++ P+PE+ L GLW   L+E++P+M+WNPYGGMM+KI 
Sbjct  356   PEVLLQGKSTF-KNYFKAKSDFVKEPIPENALEGLWTRLLEEESPLMIWNPYGGMMSKIS  414

Query  533   ESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYR  360
             ES  PFPHRKG I KI  LT+W+ +GEK  K H++WIRR+Y YM  YVS  PR AYVNYR
Sbjct  415   ESEIPFPHRKGNIFKIQLLTTWQ-DGEKNTKNHMEWIRRLYCYMTPYVSMFPRAAYVNYR  473

Query  359   DLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             DLDLG+NKN  NTSF +ASVWG KYFKGNF RLV VKT+VDPDNFF HEQSIP
Sbjct  474   DLDLGINKNS-NTSFIQASVWGAKYFKGNFNRLVHVKTKVDPDNFFRHEQSIP  525



>ref|XP_006468345.1| PREDICTED: reticuline oxidase-like protein-like [Citrus sinensis]
 gb|KDO75194.1| hypothetical protein CISIN_1g009399mg [Citrus sinensis]
Length=535

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/514 (65%), Positives = 409/514 (80%), Gaps = 10/514 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S S++  F  C++ +S  S+PFST    T ++  S   +LQS+ QNL +L PS PKP  I
Sbjct  25    SDSVEDSFIHCLNSNSDLSVPFSTFCDQTNSSFGS---ILQSSAQNLRYLTPSMPKPEFI  81

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPL ESHVQAAV+C+K+ G+ LRVRSGGHD+EGLSY S++E+P  F+++DLA+LR I V
Sbjct  82    FTPLYESHVQAAVICSKQLGIHLRVRSGGHDYEGLSYVSEIETP--FIIVDLARLRAISV  139

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+E NS WVQ GAT GEVYYR+AEKSK  GFPAG C SLG+GGHITGGAYG+M+RKYGL 
Sbjct  140   DIESNSAWVQTGATIGEVYYRIAEKSKIHGFPAGLCTSLGVGGHITGGAYGSMMRKYGLG  199

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN LDARIVDA G++LDR AMGEDLFWAIRGGGG SFGI+L+WKIKLVPVP TVTVFTV
Sbjct  200   ADNVLDARIVDANGKILDREAMGEDLFWAIRGGGGASFGIILSWKIKLVPVPETVTVFTV  259

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ ATK+LY+WQ+VADKLDEDL ++V+I A      KG+RT+ T+++A+FLG  DR
Sbjct  260   TKTLEQGATKILYRWQQVADKLDEDLFIRVIIQAAEIPERKGQRTISTSYNALFLGGVDR  319

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL++M  SFPELGLT KDC+E SWI+SV+Y A YP  TPPE LL GK  F K +FKAKS+
Sbjct  320   LLQVMQESFPELGLTQKDCIETSWIKSVLYIAGYPSNTPPEVLLQGKSTF-KNYFKAKSD  378

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F+R P+PE+ L GLWK FL+E+ P+ +WNPYGGMM+KI ESA PFPHR G + KI Y+T+
Sbjct  379   FVREPIPETALEGLWKRFLEEEGPLSIWNPYGGMMSKIAESAIPFPHRNGTLFKIQYVTN  438

Query  470   WKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             W+ +G+K   KH++WIRR+Y+YM  YVS  PR AYVNYRDLDLGMN N  NTSF +A+ W
Sbjct  439   WQ-DGDKNMAKHMEWIRRLYNYMAPYVSMLPRAAYVNYRDLDLGMN-NKSNTSFIQATAW  496

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             G +YFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  497   GSRYFKDNFMRLVRVKTKVDPDNFFRHEQSIPPL  530



>ref|XP_006448862.1| hypothetical protein CICLE_v10014829mg [Citrus clementina]
 gb|ESR62102.1| hypothetical protein CICLE_v10014829mg [Citrus clementina]
Length=542

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/514 (65%), Positives = 407/514 (79%), Gaps = 10/514 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S S++  F  C++ +S  S+PFST      ++  S   +LQS+ QNL +L PS PKP  I
Sbjct  32    SDSVEDSFIHCLNSNSDLSVPFSTFCDQKNSSFGS---ILQSSAQNLRYLTPSMPKPEFI  88

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPL ESHVQAAV+C+K+ G+ LRVRSGGHD+EGLSY S++E+P  F+++DLA+LR I V
Sbjct  89    FTPLYESHVQAAVICSKQLGIHLRVRSGGHDYEGLSYVSEIETP--FIIVDLARLRAISV  146

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+E NS WVQ GAT GEVYYR+AE SK  GFPAG C SLG+GGHITGGAYG+M+RKYGL 
Sbjct  147   DIESNSAWVQTGATIGEVYYRIAENSKIHGFPAGLCTSLGVGGHITGGAYGSMMRKYGLG  206

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN LDARIVDA G++LDR AMGEDLFWAIRGGGG SFGI+L+WKIKLVPVP TVTVFTV
Sbjct  207   ADNVLDARIVDANGKILDREAMGEDLFWAIRGGGGASFGIILSWKIKLVPVPETVTVFTV  266

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ ATK+LY+WQ+VADKLDEDL ++V+I A      KG+RT+ T+++A+FLG  DR
Sbjct  267   TKTLEQGATKILYRWQQVADKLDEDLFIRVIIQAAEIPGRKGQRTISTSYNALFLGGVDR  326

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL++M  SFPELGLT KDC+E SWI+SV+Y A YP  TPPE LL GK  F K +FKAKS+
Sbjct  327   LLQVMQESFPELGLTQKDCIETSWIKSVLYIAGYPSNTPPEVLLQGKSTF-KNYFKAKSD  385

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F+R P+PE+ L GLWK FL+E+ P+ +WNPYGGMM+KI ESA PFPHR G + KI Y+T+
Sbjct  386   FVREPIPETALEGLWKRFLEEEGPLSIWNPYGGMMSKIAESAIPFPHRNGTLFKIQYVTN  445

Query  470   WKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             W+ +GEK   KH++WIRR+Y+YM  YVS  PR AYVNYRDLDLGMN N  NTSF +A+ W
Sbjct  446   WQ-DGEKNMAKHMEWIRRLYNYMAPYVSMLPRAAYVNYRDLDLGMN-NKSNTSFIQATAW  503

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             G +YFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  504   GSRYFKDNFMRLVRVKTKVDPDNFFRHEQSIPPL  537



>ref|XP_006490201.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Citrus 
sinensis]
Length=536

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/518 (66%), Positives = 417/518 (81%), Gaps = 13/518 (3%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S S+   F KC+S++S   +P ST F    ++ SS   +L+S+ QNL +LVPS PKP  I
Sbjct  24    SASLLDNFSKCLSVNSELYVPSSTFFSQNNSSFSS---ILESSAQNLRYLVPSMPKPEFI  80

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPL E HVQAAV+C KE GV LRVRSGGHD+EGLSY S+ E+P  F+++DLAKLR +KV
Sbjct  81    FTPLHEVHVQAAVICCKELGVHLRVRSGGHDYEGLSYVSETETP--FIIVDLAKLRSVKV  138

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D++DNS WVQAGAT GEVYYR++EKSK  GFPAG C SLG+GGHITGGAYG+M+RKYGL 
Sbjct  139   DIDDNSAWVQAGATIGEVYYRISEKSKTHGFPAGLCTSLGVGGHITGGAYGSMMRKYGLG  198

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DARIVDA+GR+LDR AMGED FWAIRGGGG SFG++LAWKIKLVPVPATVTVFTV
Sbjct  199   ADNVVDARIVDASGRILDREAMGEDFFWAIRGGGGASFGVILAWKIKLVPVPATVTVFTV  258

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ ATKLL++WQ+VADKLDEDL ++V+I   N+   KG++TV T+++++FLG  +R
Sbjct  259   TKTLEQGATKLLHRWQEVADKLDEDLFIRVIIQVANA-GPKGEKTVTTSYNSLFLGGAER  317

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LLK++  SFPELGLT KDC E SWI+SV+Y A YP  TPPE LL GK LF K +FKAKS+
Sbjct  318   LLKVVEESFPELGLTKKDCTETSWIKSVLYIAGYPSNTPPEVLLQGKSLF-KNYFKAKSD  376

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F++ P+PE+ L GLWK  L ED+P+M+W PYGGMM+KI ES  PFPHRKG + KI Y+++
Sbjct  377   FVKDPIPETALEGLWKRLLGEDSPLMIWTPYGGMMSKISESEIPFPHRKGTLFKIQYVST  436

Query  470   WKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             W+ +GEK   KH+DWIRR+Y+YMG YVS  PR AYVNYRDLDLGMNKNG  +SF ++SVW
Sbjct  437   WQ-DGEKNATKHIDWIRRLYNYMGPYVSMLPRAAYVNYRDLDLGMNKNG--SSFIKSSVW  493

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS*LC  183
             GYKYFK NF RLV VKT+VDPDNFF HEQSIP L  LC
Sbjct  494   GYKYFKDNFNRLVKVKTKVDPDNFFRHEQSIPPLP-LC  530



>emb|CAN81654.1| hypothetical protein VITISV_003756 [Vitis vinifera]
Length=539

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/533 (64%), Positives = 409/533 (77%), Gaps = 12/533 (2%)
 Frame = -2

Query  1793  WSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSV  1614
             +S+  +  +LF  L+ S  A S  I  +F +CVSL+S   IP STAF++  T + S    
Sbjct  3     YSNFAMXPLLFILLSASVTA-SDPILEKFSQCVSLNSEILIPVSTAFYTPNTTSFSA--F  59

Query  1613  LQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTS  1434
             LQS+ QNL +LVPSAPKP  IFTP+ ++HVQAAV+C+K+  + +RVRSGGHD+EGLSY S
Sbjct  60    LQSSAQNLRYLVPSAPKPEFIFTPMHDTHVQAAVICSKQLSIHMRVRSGGHDYEGLSYVS  119

Query  1433  DMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSL  1254
             +ME P  F+++DLA+LRGIKVD++DNS WVQAGAT GEVYYR+ EKSK  GFPAG C SL
Sbjct  120   EMEKP--FIMVDLARLRGIKVDIDDNSAWVQAGATIGEVYYRIYEKSKTHGFPAGLCPSL  177

Query  1253  gigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFG  1074
             GIGGHITGGAYG+M+RKYGL ADN +DARIVD  GR+LDR +MGEDLFWAIRGGGG SFG
Sbjct  178   GIGGHITGGAYGSMMRKYGLGADNVMDARIVDVHGRILDRESMGEDLFWAIRGGGGASFG  237

Query  1073  ILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTA  894
             I+L WKI+LVPVP+TVTVFTV R LEQ ATKLLY+WQ        + L   +I +V +  
Sbjct  238   IILWWKIRLVPVPSTVTVFTVGRALEQGATKLLYRWQ-QVADKLHEDLFIRVIMSVKANE  296

Query  893   VKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTP  714
              KG +TV  AF+++FLG  DRLL+IM  SFPELGLT KDC EMSWI SV+Y   YP  TP
Sbjct  297   -KGNKTVSAAFNSLFLGGVDRLLQIMGESFPELGLTMKDCTEMSWIRSVLYIGGYPSGTP  355

Query  713   PEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIP  534
             PE LL GK  F K +FKAKS+F++ P+PE+ L GLW   L+E +P+M+WNPYGGMM+KI 
Sbjct  356   PEVLLQGKSTF-KNYFKAKSDFVKEPIPENALEGLWTRLLEEXSPLMIWNPYGGMMSKIS  414

Query  533   ESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYR  360
             ES  PFPHRKG I KI YLT+W+ +GEK  K H++WIRR+Y YM  YVS  PR AYVNYR
Sbjct  415   ESEIPFPHRKGNIFKIQYLTTWQ-DGEKNTKNHMEWIRRLYCYMTPYVSMFPRAAYVNYR  473

Query  359   DLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             DLDLG+NKN  NTSF +ASVWG KYFKGNF RLV VKT+VDPDNFF HEQSIP
Sbjct  474   DLDLGINKNS-NTSFIQASVWGAKYFKGNFNRLVHVKTKVDPDNFFRHEQSIP  525



>gb|KCW77265.1| hypothetical protein EUGRSUZ_D01622 [Eucalyptus grandis]
Length=541

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/515 (64%), Positives = 398/515 (77%), Gaps = 9/515 (2%)
 Frame = -2

Query  1736  AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPL  1557
             +VS +IQ  F +C++L+S   +P ST +   ++N S+   VLQS+ QNL +LVPS PKP 
Sbjct  24    SVSSTIQDDFVQCLNLNSELVVPLSTFYNQKSSNFSA---VLQSSAQNLRYLVPSMPKPE  80

Query  1556  LIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGI  1377
              IFTPL E HVQAAV+C+K+ G+ LRVRSGGHD+EGLSY S  E+  PF+++DL++LR +
Sbjct  81    FIFTPLIEGHVQAAVICSKQLGIHLRVRSGGHDYEGLSYVS--ETLTPFIIVDLSRLRSV  138

Query  1376  KVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYG  1197
              VD+ DN+ W QAGAT GEVYYR+AEKS+  GFPAG C SLG+GGHITGGAYG+M+RKYG
Sbjct  139   TVDLADNTAWAQAGATIGEVYYRIAEKSRIHGFPAGLCTSLGVGGHITGGAYGSMMRKYG  198

Query  1196  LAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvf  1017
             L  DN LDARIVD  GR+LDRAAMGEDLFWAIRGGGG SFGI+L WKIKLVPVP+ VTVF
Sbjct  199   LGVDNVLDARIVDVNGRILDRAAMGEDLFWAIRGGGGASFGIILEWKIKLVPVPSMVTVF  258

Query  1016  tvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKT  837
             TV +TLEQ ATKLL++WQ+V D LDEDL ++V+I A ++   K  RTV T+++A+FLG  
Sbjct  259   TVTKTLEQGATKLLHRWQQVVDTLDEDLFIRVIIQAASAGGGKANRTVSTSYNALFLGTA  318

Query  836   DRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAK  657
             DRLLK+M  SFPELGL   DC EMSWI SV+Y A YP  TPPE LL GK  F K FFKAK
Sbjct  319   DRLLKVMEDSFPELGLMRSDCFEMSWIRSVLYIAGYPSGTPPEVLLKGKSTF-KNFFKAK  377

Query  656   SEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYL  477
             S+F+R  + E+GL GLW   ++ED+P+M+W PYGGMM+KI ES+ PFPHRKG I  I YL
Sbjct  378   SDFVRDTISETGLEGLWMRLVQEDSPLMIWTPYGGMMSKISESSAPFPHRKGTIFMIQYL  437

Query  476   TSWKIEGEKK-KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASV  300
             + W  E E   KH++WIRR+Y YM  YVS  PRE YVNYRDLDLGMNKNG  TSF +  V
Sbjct  438   SLWNDESEDATKHMNWIRRLYSYMAPYVSMFPRETYVNYRDLDLGMNKNG--TSFIQTVV  495

Query  299   WGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             WG KYFK NF+RLV VKT+VDPDNFF HEQSIP L
Sbjct  496   WGAKYFKDNFDRLVQVKTKVDPDNFFRHEQSIPPL  530



>ref|XP_007023064.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY25686.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=546

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/514 (66%), Positives = 406/514 (79%), Gaps = 10/514 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S  IQ QF +C   +S   IP STAFF+    + +   VLQST QNL +LVPS PKP  I
Sbjct  35    STQIQEQFLQCFDANSEFDIPLSTAFFTPKNASFTS--VLQSTAQNLRYLVPSMPKPEFI  92

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
              TPL ESHVQAAV+C+KE G+ LRVRSGGHD+EGLSY S++ESP  F+++DL++LR IKV
Sbjct  93    ITPLYESHVQAAVICSKELGIHLRVRSGGHDYEGLSYVSEIESP--FIIVDLSRLRSIKV  150

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+EDNS WV+AGAT GEVYYR++EKSK  GFPAG C SLGIGGHITGGAYG ++RKYGL 
Sbjct  151   DIEDNSAWVEAGATTGEVYYRISEKSKTHGFPAGLCTSLGIGGHITGGAYGTIMRKYGLG  210

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DARIVDA+GRVLDRAAM EDL+WAIRGGGG SFGI+LAWKIKLVPVP TVTVFTV
Sbjct  211   ADNVVDARIVDASGRVLDRAAMSEDLYWAIRGGGGASFGIILAWKIKLVPVPETVTVFTV  270

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              ++LEQ ATK+LYKWQ+VAD+LDEDL ++V+I   N     GK TV T+++A+FLG  +R
Sbjct  271   TKSLEQGATKILYKWQQVADELDEDLFIRVIIQGANPGNSGGK-TVTTSYNALFLGDAER  329

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL++M  SFPELGLT KDC+E SWI+SV+Y A +P  TPPE LL GK LF K +FKAKS+
Sbjct  330   LLQVMRQSFPELGLTRKDCIETSWIKSVLYIAGFPSNTPPEVLLQGKSLF-KNYFKAKSD  388

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F++  +PE+ L GLWK  L+ED P+ +WNPYGGMM KI ES   FPHRKG    I YLT 
Sbjct  389   FVKEAIPETALEGLWKRLLEEDNPLTIWNPYGGMMGKISESEIAFPHRKGNKFMIQYLTL  448

Query  470   WKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             W+ +G+K   KH+DWIRR+++YM  YVS+ PR AYVNYRDLDLGMNKN  NTSF +ASVW
Sbjct  449   WQ-DGDKNASKHMDWIRRLHNYMAPYVSRFPRGAYVNYRDLDLGMNKN-INTSFIQASVW  506

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             G +YFK NF +LV VKT+VDPDNFF HEQSIP L
Sbjct  507   GVRYFKDNFNKLVKVKTKVDPDNFFRHEQSIPPL  540



>ref|XP_006421555.1| hypothetical protein CICLE_v10006451mg [Citrus clementina]
 gb|ESR34795.1| hypothetical protein CICLE_v10006451mg [Citrus clementina]
Length=533

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/528 (64%), Positives = 416/528 (79%), Gaps = 9/528 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             ILSI+  FL  +    S S+Q  F  C+S +++ ++   ++ +  T N  SF+S+LQS+ 
Sbjct  9     ILSIVSVFLLSASCIASYSVQRTFLYCLSFNAN-NLSTPSSTYFYTPNTRSFSSILQSSA  67

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL +L PS PKP  IFTPL ESHVQAAV+C+K  G+ LRVRSGGHD+EGLSY S++E+P
Sbjct  68    QNLRYLQPSVPKPEFIFTPLYESHVQAAVICSKRLGIHLRVRSGGHDYEGLSYASEIETP  127

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DLA+LR + VD+  N+ WVQAGAT GE+YYR+ EKS   GFPAG C SLGIGGH
Sbjct  128   --FIVVDLARLRSVNVDINQNTAWVQAGATVGELYYRIYEKSNIHGFPAGLCTSLGIGGH  185

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+M+RKYG+ ADN LDARIVDA GRVLDRAAMGEDLFWAIRGGGG SFGI+LAW
Sbjct  186   ITGGAYGSMMRKYGIGADNVLDARIVDARGRVLDRAAMGEDLFWAIRGGGGASFGIILAW  245

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLVPVPATVTVFTV +TLEQ AT +LYKWQ+VADKLDEDL ++VLI   ++ A K  R
Sbjct  246   KVKLVPVPATVTVFTVSKTLEQGATNILYKWQQVADKLDEDLFIRVLIQG-SAAAQKVNR  304

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV T+++A+FLG  DRLL++M  SFPELGL+ +DC+E SWI+SVIY A +P  + PEFLL
Sbjct  305   TVTTSYNALFLGGADRLLQVMQKSFPELGLSRQDCIETSWIKSVIYIAGFPSNSTPEFLL  364

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
              GK + PK +FKAKS+F+RTP+P   L GLW+ FL ED P+M+WNPYGGMM+KIPE+A P
Sbjct  365   QGKAM-PKAYFKAKSDFVRTPIPTKALGGLWRRFLAEDGPLMIWNPYGGMMSKIPENAIP  423

Query  518   FPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLG  345
             FPHRKG + KI Y+T W ++GEK   KH++WIR +Y+YM  YVS+ PR AYVNYRDLDLG
Sbjct  424   FPHRKGTLFKIQYVTLW-LDGEKSQNKHMNWIRNLYNYMAPYVSRFPRAAYVNYRDLDLG  482

Query  344   MNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             MN N  N SF++A +WG KYFK NF RLV VKT+VDP NFF HEQSIP
Sbjct  483   MN-NKCNASFNQARIWGVKYFKNNFYRLVRVKTKVDPGNFFRHEQSIP  529



>ref|XP_010053024.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
Length=559

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/515 (64%), Positives = 398/515 (77%), Gaps = 9/515 (2%)
 Frame = -2

Query  1736  AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPL  1557
             +VS +IQ  F +C++L+S   +P ST +   ++N S+   VLQS+ QNL +LVPS PKP 
Sbjct  42    SVSSTIQDDFVQCLNLNSELVVPLSTFYNQKSSNFSA---VLQSSAQNLRYLVPSMPKPE  98

Query  1556  LIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGI  1377
              IFTPL E HVQAAV+C+K+ G+ LRVRSGGHD+EGLSY S  E+  PF+++DL++LR +
Sbjct  99    FIFTPLIEGHVQAAVICSKQLGIHLRVRSGGHDYEGLSYVS--ETLTPFIIVDLSRLRSV  156

Query  1376  KVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYG  1197
              VD+ DN+ W QAGAT GEVYYR+AEKS+  GFPAG C SLG+GGHITGGAYG+M+RKYG
Sbjct  157   TVDLADNTAWAQAGATIGEVYYRIAEKSRIHGFPAGLCTSLGVGGHITGGAYGSMMRKYG  216

Query  1196  LAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvf  1017
             L  DN LDARIVD  GR+LDRAAMGEDLFWAIRGGGG SFGI+L WKIKLVPVP+ VTVF
Sbjct  217   LGVDNVLDARIVDVNGRILDRAAMGEDLFWAIRGGGGASFGIILEWKIKLVPVPSMVTVF  276

Query  1016  tvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKT  837
             TV +TLEQ ATKLL++WQ+V D LDEDL ++V+I A ++   K  RTV T+++A+FLG  
Sbjct  277   TVTKTLEQGATKLLHRWQQVVDTLDEDLFIRVIIQAASAGGGKANRTVSTSYNALFLGTA  336

Query  836   DRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAK  657
             DRLLK+M  SFPELGL   DC EMSWI SV+Y A YP  TPPE LL GK  F K FFKAK
Sbjct  337   DRLLKVMEDSFPELGLMRSDCFEMSWIRSVLYIAGYPSGTPPEVLLKGKSTF-KNFFKAK  395

Query  656   SEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYL  477
             S+F+R  + E+GL GLW   ++ED+P+M+W PYGGMM+KI ES+ PFPHRKG I  I YL
Sbjct  396   SDFVRDTISETGLEGLWMRLVQEDSPLMIWTPYGGMMSKISESSAPFPHRKGTIFMIQYL  455

Query  476   TSWKIEGEKK-KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASV  300
             + W  E E   KH++WIRR+Y YM  YVS  PRE YVNYRDLDLGMNKNG  TSF +  V
Sbjct  456   SLWNDESEDATKHMNWIRRLYSYMAPYVSMFPRETYVNYRDLDLGMNKNG--TSFIQTVV  513

Query  299   WGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             WG KYFK NF+RLV VKT+VDPDNFF HEQSIP L
Sbjct  514   WGAKYFKDNFDRLVQVKTKVDPDNFFRHEQSIPPL  548



>ref|XP_006421542.1| hypothetical protein CICLE_v10004697mg [Citrus clementina]
 gb|ESR34782.1| hypothetical protein CICLE_v10004697mg [Citrus clementina]
Length=536

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/518 (66%), Positives = 418/518 (81%), Gaps = 13/518 (3%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S S+   F KC+S++S   +P ST F    ++ SS   +L+S+ QNL +LVPS PKP  I
Sbjct  24    SASLLDNFSKCLSVNSELYVPSSTFFSQNNSSFSS---ILESSAQNLRYLVPSMPKPEFI  80

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPL E+HVQAAV+C KE GV LRVRSGGHD+EGLSY S+ E+P  F+++DLAKLR +KV
Sbjct  81    FTPLYEAHVQAAVICCKELGVHLRVRSGGHDYEGLSYVSETETP--FIIVDLAKLRSVKV  138

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D++DNS WVQAGAT GEVYYR++EKSK  GFPAG C SLG+GGHITGGAYG+M+RKYGL 
Sbjct  139   DIDDNSAWVQAGATIGEVYYRISEKSKTHGFPAGLCTSLGVGGHITGGAYGSMMRKYGLG  198

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DARIVDA+GR+LDR AMGED FWAIRGGGG SFG++LAWKIKLVPVPATVTVFTV
Sbjct  199   ADNVVDARIVDASGRILDREAMGEDFFWAIRGGGGASFGVILAWKIKLVPVPATVTVFTV  258

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ ATKLL++WQ+VADKLDEDL ++V+I   N+   KG++TV T+++++FLG  +R
Sbjct  259   TKTLEQCATKLLHRWQEVADKLDEDLFIRVIIQVANA-GPKGEKTVTTSYNSLFLGGAER  317

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LLK++  SFPELGLT KDC E SWI+SV+Y A YP  TPPE LL GK LF K +FKAKS+
Sbjct  318   LLKVVEESFPELGLTKKDCTETSWIKSVLYIAGYPSNTPPEVLLQGKSLF-KNYFKAKSD  376

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F++ P+PE+ L+GLWK  L ED+P+M+W PYGGMM+KI ES  PFPHRKG + KI Y+++
Sbjct  377   FVKDPIPETALKGLWKRLLGEDSPLMIWTPYGGMMSKISESEIPFPHRKGTLFKIQYVST  436

Query  470   WKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             W+ +GEK   KH+DWIRR+Y+YM  YVS  PR AYVNYRDLDLGMNKN  ++SF ++SVW
Sbjct  437   WQ-DGEKNATKHIDWIRRLYNYMAPYVSMLPRAAYVNYRDLDLGMNKN--DSSFIQSSVW  493

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS*LC  183
             GYKYFK NF RLV VKT+VDPDNFF HEQSIP L  LC
Sbjct  494   GYKYFKDNFNRLVKVKTKVDPDNFFRHEQSIPPLP-LC  530



>gb|KDO52551.1| hypothetical protein CISIN_1g009485mg [Citrus sinensis]
Length=533

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/528 (64%), Positives = 415/528 (79%), Gaps = 9/528 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             +LSI   FL  +    S S+Q  F  C+S +++ ++   ++ +  T N  SF+S+LQS+ 
Sbjct  9     VLSIASVFLLSASCTASYSVQRTFLYCLSFNAN-NLSTPSSTYFYTPNTRSFSSILQSSA  67

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL +L PS PKP  IFTPL ESHVQAAV+C+K  G+ LRVRSGGHD+EGLSY S++E+P
Sbjct  68    QNLRYLQPSVPKPEFIFTPLYESHVQAAVICSKRLGIHLRVRSGGHDYEGLSYASEIETP  127

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DLA+LR + VD+  N+ WVQAGAT GE+YYR+ EKS   GFPAG C SLGIGGH
Sbjct  128   --FIVVDLARLRSVNVDINQNTAWVQAGATVGELYYRIYEKSNIHGFPAGLCTSLGIGGH  185

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+M+RKYG+ ADN LDARIVDA GRVLDRAAMGEDLFWAIRGGGG SFGI+LAW
Sbjct  186   ITGGAYGSMMRKYGIGADNVLDARIVDARGRVLDRAAMGEDLFWAIRGGGGASFGIILAW  245

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLVPVPATVTVFTV +TLEQ AT +LYKWQ+VADKLDEDL ++VLI   ++ A K  R
Sbjct  246   KVKLVPVPATVTVFTVSKTLEQGATNILYKWQQVADKLDEDLFIRVLIQG-SAAAQKVNR  304

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV T+++A+FLG  DRLL++M  SFPELGL+ +DC+E SWI+SVIY A +P  + PEFLL
Sbjct  305   TVTTSYNALFLGVADRLLQVMQKSFPELGLSRQDCIETSWIKSVIYIAGFPSNSTPEFLL  364

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
              GK + PK +FKAKS+F+RTP+P   L GLW+ FL ED P+M+WNPYGGMM+KIPE+A P
Sbjct  365   QGKAM-PKAYFKAKSDFVRTPIPTKALGGLWRRFLAEDGPLMIWNPYGGMMSKIPENAIP  423

Query  518   FPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLG  345
             FPHRKG + KI Y+T W ++GEK   KH++WIR +Y+YM  YVS+ PR AYVNYRDLDLG
Sbjct  424   FPHRKGTLFKIQYVTLW-LDGEKSQNKHMNWIRNLYNYMAPYVSRFPRAAYVNYRDLDLG  482

Query  344   MNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             MN N  N SF++A +WG KYFK NF RLV VKT+VDP NFF HEQSIP
Sbjct  483   MN-NKCNASFNQARIWGVKYFKNNFYRLVRVKTKVDPGNFFRHEQSIP  529



>ref|XP_002317089.1| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|EEE97701.1| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=545

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/510 (65%), Positives = 406/510 (80%), Gaps = 8/510 (2%)
 Frame = -2

Query  1721  IQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTP  1542
             I+  F +C   +S  S+P S+ +    +++ S   VLQST QNL +L+PS PKP+ IFTP
Sbjct  27    IKDDFVQCFLQNSEISVPTSSFYTPDNSSSFSA--VLQSTAQNLRYLLPSVPKPVFIFTP  84

Query  1541  LTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVE  1362
             L E+HVQA+V+C ++ G+ LRVRSGGHD+EGLSY S++ESP  F+V+DLAKLR I+V++E
Sbjct  85    LYEAHVQASVICCRQLGLHLRVRSGGHDYEGLSYASEIESP--FIVVDLAKLRAIQVNIE  142

Query  1361  DNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADN  1182
             DNS WVQAGAT GE+YYR+AEKSK  GFPAG C SLGIGGHITGGAYG+M+RKYGL ADN
Sbjct  143   DNSAWVQAGATIGELYYRIAEKSKTHGFPAGLCSSLGIGGHITGGAYGSMMRKYGLGADN  202

Query  1181  ALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRT  1002
              +DAR++DA+GRVL+R +MGED FWAIRGGGG SFGI+ AWK+KLVPVP+TVTVFTV +T
Sbjct  203   VIDARVIDASGRVLERQSMGEDFFWAIRGGGGASFGIITAWKVKLVPVPSTVTVFTVTKT  262

Query  1001  LEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLK  822
             LEQ  TKLLY+WQ+VADKLDEDL ++V+I   N  A KG+RTV T+++A+FLG   RLL 
Sbjct  263   LEQGGTKLLYRWQQVADKLDEDLFIRVIIQTANG-AKKGQRTVTTSYNALFLGDASRLLN  321

Query  821   IMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLR  642
             +M   FPELGLT KDC+E +W++SV+Y A YP  TPPE LL GK  F K +FKAKS+F++
Sbjct  322   VMKTGFPELGLTRKDCVETTWLKSVLYIAGYPANTPPEVLLQGKSTF-KNYFKAKSDFVQ  380

Query  641   TPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKI  462
              P+PE+ L G+WK + +E TP M+WNPYGGMM+KI ES+ PFPHRKGV+ KI YLTSW+ 
Sbjct  381   HPIPEAALEGIWKRYFQEVTPFMIWNPYGGMMSKISESSIPFPHRKGVLFKIQYLTSWQT  440

Query  461   EGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKY  285
               E   KH++WIR++Y YM  YVS  PR+AYVNYRDLDLGMNK  RNTSF EASVWG KY
Sbjct  441   PAEDASKHINWIRKLYKYMAPYVSMFPRQAYVNYRDLDLGMNKK-RNTSFKEASVWGTKY  499

Query  284   FKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             FK NF RLV VKT VDPDNFF HEQSIP L
Sbjct  500   FKNNFNRLVQVKTTVDPDNFFRHEQSIPPL  529



>ref|XP_011039283.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Populus 
euphratica]
Length=545

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/529 (63%), Positives = 409/529 (77%), Gaps = 8/529 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             ILSI    L       SL I+  F +C+S +S   IP S  +    +++ +   VL+ST 
Sbjct  8     ILSIFVVLLLSPGLTFSLPIKDSFVQCLSQNSEIFIPASDFYTPDNSSSFNA--VLESTA  65

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL +L+PS PKP  IFTPL E+HVQAAV+C K+ G+ LRVRSGGHD+EGLSY S++E+ 
Sbjct  66    QNLRYLLPSVPKPEFIFTPLYEAHVQAAVICCKQLGIHLRVRSGGHDYEGLSYASEIETQ  125

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DLAKLR ++VD+EDNS WVQAGAT GE+YYR+AEKS+  GFP G C SLGIGGH
Sbjct  126   --FIVVDLAKLRAVQVDIEDNSAWVQAGATIGELYYRIAEKSEAHGFPGGLCSSLGIGGH  183

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+M+RKYGL ADN +DARI+DA+GRVL+R  MGEDLFWAIRGGGG SFGI+ AW
Sbjct  184   ITGGAYGSMMRKYGLGADNVIDARIIDASGRVLERQTMGEDLFWAIRGGGGASFGIITAW  243

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLVPVP+TVTVFTV +TLEQ  TKLLY+WQ+VADKLDEDL ++V+I A +  A KGKR
Sbjct  244   KVKLVPVPSTVTVFTVTKTLEQGGTKLLYRWQQVADKLDEDLFIRVIIQAADG-ATKGKR  302

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV T+++A+FLG   RLL +M   FPELGLT KDC E +W++SV+Y A YP  TPPE LL
Sbjct  303   TVTTSYNALFLGDAKRLLNVMEQGFPELGLTLKDCTETTWLKSVLYIAGYPANTPPEVLL  362

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
              GK  F K +FKAKS+F+  P+PE+ L G+W+ + +E TP M+WNPYGGMM+KI ES+ P
Sbjct  363   QGKSTF-KNYFKAKSDFVTEPIPETALEGIWERYFEEATPFMIWNPYGGMMSKISESSIP  421

Query  518   FPHRKGVICKIVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGM  342
             FPHRKG++ KI YLT W+   E   KH+DWIRR+Y+YM  YVS  PR+AYVNYRDLDLG+
Sbjct  422   FPHRKGILFKIQYLTMWQDAAEDASKHIDWIRRLYNYMAPYVSMFPRQAYVNYRDLDLGI  481

Query  341   NKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NK   NTSF EASVWG KYFK NF RL+ VKT+VDPDNFF HEQSIP L
Sbjct  482   NKKS-NTSFIEASVWGAKYFKDNFNRLIQVKTKVDPDNFFRHEQSIPPL  529



>ref|XP_004135540.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
 ref|XP_004158078.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
Length=546

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/517 (63%), Positives = 410/517 (79%), Gaps = 12/517 (2%)
 Frame = -2

Query  1736  AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPL  1557
             +VS S++  F +CVSL+S  S+P  +       +      +LQST QNL FL PS PKP 
Sbjct  23    SVSASLEQSFLQCVSLNSQQSVPPLSVCSQNNPSFFP---LLQSTAQNLRFLDPSVPKPQ  79

Query  1556  LIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGI  1377
              IFTPL ++HVQAAV+C+K+  + LRVRSGGHD+EGLSY S+ E+P  F+VIDLAKLR +
Sbjct  80    FIFTPLHDTHVQAAVICSKKLNIHLRVRSGGHDYEGLSYASETETP--FIVIDLAKLRSV  137

Query  1376  KVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYG  1197
             +V+++DN+ W QAGAT GEVYYR+++KS   GFPAG C SLGIGGHITGGAYG+M+RKYG
Sbjct  138   EVNIQDNTAWAQAGATVGEVYYRISQKSNVHGFPAGLCTSLGIGGHITGGAYGSMMRKYG  197

Query  1196  LAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvf  1017
             L ADN +DARIVD  GR+LDR+ MGED FWAIRGG GGSFGI+L WK++LVPVP TVTVF
Sbjct  198   LGADNVIDARIVDVNGRILDRSTMGEDYFWAIRGGAGGSFGIILWWKLQLVPVPETVTVF  257

Query  1016  tvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKT  837
             TVP+TLEQ AT++LYKWQ+VADKLDEDL ++V+I   N  A K +RT+ TA++A+FLG +
Sbjct  258   TVPKTLEQGATQILYKWQQVADKLDEDLFIRVIIQVTNDKATK-ERTITTAYNALFLGDS  316

Query  836   DRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAK  657
             DRLL+IM  SFPELGLTPKDC+E +WI+SV+Y A  P  TPPE LL GKP F K +FKAK
Sbjct  317   DRLLQIMRKSFPELGLTPKDCIETNWIKSVLYIAGEPPKTPPEVLLQGKPQF-KNYFKAK  375

Query  656   SEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYL  477
             S+F++ P+PE+GL GLWKIFL+E++P+M+WNPYGGMM+KI E+  PFPHRKG + KI Y+
Sbjct  376   SDFVQVPIPETGLEGLWKIFLQEESPLMIWNPYGGMMSKISENEIPFPHRKGNLFKIQYV  435

Query  476   TSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEAS  303
               W+ +G+K   +H++WIR +Y+YM  YVSKSPR AYVNYRDLDLGMNK+  NTS + A+
Sbjct  436   NPWQ-DGDKHETEHIEWIRELYNYMAPYVSKSPRAAYVNYRDLDLGMNKD--NTSLAHAT  492

Query  302   VWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
              WG KYFK NF RLV VKT+VDP NFF HEQSIP L+
Sbjct  493   EWGNKYFKNNFNRLVKVKTKVDPGNFFRHEQSIPPLA  529



>ref|XP_006490192.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Citrus 
sinensis]
Length=533

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/528 (64%), Positives = 414/528 (78%), Gaps = 9/528 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             +LSI   FL  +    S S+Q  F  C+S +++ ++   ++ +  T N  SF+S+LQS+ 
Sbjct  9     VLSIASVFLLSASCTASYSVQRTFLYCLSFNAN-NLSTPSSTYFYTPNTRSFSSILQSSA  67

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL +L PS PKP  IFTPL ESHVQAAV+C+K  G+ LRVRSGGHD+EGLSY S++E+P
Sbjct  68    QNLRYLQPSVPKPEFIFTPLYESHVQAAVICSKRLGIHLRVRSGGHDYEGLSYASEIETP  127

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DLA+LR + VD+  N+ WVQAGAT GE+YYR+ EKS   GFPAG C SLGIGGH
Sbjct  128   --FIVVDLARLRSVNVDINQNTAWVQAGATVGELYYRIYEKSNIHGFPAGLCTSLGIGGH  185

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+M+RKYG+ ADN LDARIVDA GRVLDRAAMGEDLFWAIRGGGG SFGI+LAW
Sbjct  186   ITGGAYGSMMRKYGIGADNVLDARIVDARGRVLDRAAMGEDLFWAIRGGGGASFGIILAW  245

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLVPVPATVTVFTV +TLEQ AT +LYKWQ+VADKLDEDL ++VLI   ++ A K  R
Sbjct  246   KVKLVPVPATVTVFTVSKTLEQGATNILYKWQQVADKLDEDLFIRVLIQG-SAAAQKVNR  304

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV T+++A+FLG  DRLL++M  SFPELGL+ +DC+E SWI+SVIY A +P  + PEFLL
Sbjct  305   TVTTSYNALFLGVADRLLQVMQKSFPELGLSRQDCIETSWIKSVIYIAGFPSNSTPEFLL  364

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
              GK + PK +FKAKS+F RTP+P   L GLW+ FL ED P+M+WNPYGGMM+KIPE+A P
Sbjct  365   QGKAM-PKAYFKAKSDFARTPIPTKALGGLWRRFLAEDGPLMIWNPYGGMMSKIPENAIP  423

Query  518   FPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLG  345
             FPHRKG + KI Y+T W ++GEK   KH++WIR +Y+YM  YVS+ PR AYVNYRDLDLG
Sbjct  424   FPHRKGTLFKIQYVTLW-LDGEKSQNKHMNWIRNLYNYMAPYVSRFPRAAYVNYRDLDLG  482

Query  344   MNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             MN N  N SF++A +WG KYFK NF RLV VKT+VDP NFF HEQSIP
Sbjct  483   MN-NKCNASFNQARIWGVKYFKNNFYRLVRVKTKVDPGNFFRHEQSIP  529



>ref|XP_011006006.1| PREDICTED: tetrahydrocannabinolic acid synthase-like isoform 
X1 [Populus euphratica]
 ref|XP_011006007.1| PREDICTED: tetrahydrocannabinolic acid synthase-like isoform 
X2 [Populus euphratica]
Length=545

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/510 (64%), Positives = 409/510 (80%), Gaps = 8/510 (2%)
 Frame = -2

Query  1721  IQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTP  1542
             I+  F +C   +S  ++P S+ +    +++ S   VLQST QNL +L+PS PKP+ IFTP
Sbjct  27    IKDNFVQCFLQNSELAVPTSSFYTPDNSSSFSA--VLQSTAQNLRYLLPSVPKPVFIFTP  84

Query  1541  LTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVE  1362
             L E+HVQA+V+C ++ G+ LRVRSGGHD+EGLSY S++ESP  F+V+DLA+LR I+V++E
Sbjct  85    LYEAHVQASVICCRQLGLHLRVRSGGHDYEGLSYASEIESP--FIVVDLARLRAIQVNIE  142

Query  1361  DNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADN  1182
             DNS WVQAGAT GE+YYR+AEKSK  GFPAG C SLGIGGHITGGAYG+M+RKYGL ADN
Sbjct  143   DNSAWVQAGATIGELYYRIAEKSKTHGFPAGLCSSLGIGGHITGGAYGSMMRKYGLGADN  202

Query  1181  ALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRT  1002
              +DARI+DA+GRVL+R AMGED+FWAIRGGGG SFGI+ AWK+KLVPVP+TVTVFTV +T
Sbjct  203   VIDARIIDASGRVLERQAMGEDVFWAIRGGGGASFGIITAWKVKLVPVPSTVTVFTVTKT  262

Query  1001  LEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLK  822
             LEQ  TKLLY+WQ+VADKLDEDL ++V+I A +  A KG+RTV T+++A+FLG  +RLL 
Sbjct  263   LEQGGTKLLYRWQQVADKLDEDLFIRVIIQAADG-AKKGQRTVTTSYNALFLGDANRLLN  321

Query  821   IMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLR  642
             +M   FPELGLT KDC+E +W++SV+Y A YP  T PE LL GK  F K +FKAKS+F++
Sbjct  322   VMKTGFPELGLTRKDCVETTWLKSVLYIAGYPANTTPEVLLQGKSTF-KNYFKAKSDFVQ  380

Query  641   TPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKI  462
              P+PE+ L G+WK + +E TP M+WNPYGGMM+KI ES+ PFPHRKG++ KI Y+TSW+ 
Sbjct  381   HPIPETALEGIWKRYFQEVTPFMIWNPYGGMMSKISESSIPFPHRKGILFKIQYVTSWQS  440

Query  461   EGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKY  285
               E   KH+DWIR++Y+YM  YVS  PR+AYVNYRDLDLGMNK  RNTSF EASVWG KY
Sbjct  441   PSEDASKHIDWIRKLYNYMAPYVSMFPRQAYVNYRDLDLGMNKK-RNTSFKEASVWGTKY  499

Query  284   FKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             FK NF RLV  KT++DPDNFF HEQSIP L
Sbjct  500   FKNNFNRLVQAKTKIDPDNFFRHEQSIPPL  529



>ref|XP_003535119.1| PREDICTED: cannabidiolic acid synthase-like 1-like isoform 1 
[Glycine max]
Length=543

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/533 (62%), Positives = 410/533 (77%), Gaps = 10/533 (2%)
 Frame = -2

Query  1787  SPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQ  1608
             SPI   +    L     A S S++  F +C+S +S  + PF  + ++    + +   +L+
Sbjct  3     SPISHLVTLILLLSVSLAASASLEENFVQCLSFYSDKAAPFYASIYTPQNASFNK--ILE  60

Query  1607  STVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDM  1428
             S+ QNL +LVPSAPKP LIFTPLT+SHVQ AV C+K+ G+ LR+RSGGHD+EGLSY S++
Sbjct  61    SSAQNLRYLVPSAPKPELIFTPLTDSHVQVAVTCSKKLGIHLRIRSGGHDYEGLSYVSEV  120

Query  1427  ESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgi  1248
             ESP  F+++DL+KLR I VD+EDN+ W+QAGAT GEVYYR+ EKS   GFPAG C SLG+
Sbjct  121   ESP--FIIVDLSKLRAIDVDIEDNTAWIQAGATIGEVYYRIYEKSSVHGFPAGLCTSLGV  178

Query  1247  gghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGIL  1068
             GGHITGGAYG+M+RKYGL ADN +DARIVDA G++LDR AMGEDLFWAIRGGGG SFGIL
Sbjct  179   GGHITGGAYGSMMRKYGLGADNVVDARIVDANGQILDREAMGEDLFWAIRGGGGASFGIL  238

Query  1067  LAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVK  888
             L WKIKLVPVP TVTVFTV R+LEQ+ATK+L++WQ+VA  +DEDL ++V+I    +   K
Sbjct  239   LWWKIKLVPVPETVTVFTVTRSLEQDATKILHRWQEVAPYIDEDLFIRVIIQPA-TVGNK  297

Query  887   GKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPE  708
              +RT+ T+++A FLG  DRLL++M  SFPELGLT KDCLE SWI+SV+Y A YP  TPPE
Sbjct  298   TERTITTSYNAQFLGGADRLLQVMKESFPELGLTKKDCLETSWIKSVLYIAGYPNDTPPE  357

Query  707   FLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPES  528
              LL GK  F K +FKAKS+F+R P+PE+GL GLW+  L+ED+P+M+WNPYGGMM+K  ES
Sbjct  358   VLLQGKSTF-KNYFKAKSDFVRDPIPETGLEGLWQRLLEEDSPLMIWNPYGGMMSKFSES  416

Query  527   ATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDL  354
               PFPHR G + KI YLT W+ +G+K   KH DWIR++Y+YM  YVSK PREAYVNYRDL
Sbjct  417   DIPFPHRNGTLYKIQYLTLWQ-DGDKNASKHEDWIRKLYNYMTPYVSKFPREAYVNYRDL  475

Query  353   DLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             DLGMNK   +TS+ +A+ WG  YFK NF RLV +KT+VDPDN F HEQSIP L
Sbjct  476   DLGMNKK-NSTSYIQATAWGNMYFKDNFNRLVKIKTKVDPDNVFRHEQSIPPL  527



>ref|XP_002299030.2| hypothetical protein POPTR_0001s46710g [Populus trichocarpa]
 gb|EEE83835.2| hypothetical protein POPTR_0001s46710g [Populus trichocarpa]
Length=545

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/529 (63%), Positives = 409/529 (77%), Gaps = 8/529 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             ILSI    L       SL I+  F +C+S +S   IP S  +    +++ +   VL+ST 
Sbjct  8     ILSIFVVLLLSPGLTFSLPIKDSFVQCLSQNSEFVIPASDFYTPDNSSSFNA--VLESTA  65

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL +L+PS PKP  IFTPL E+HVQA+V+C K+ G+ LRVRSGGHD+EGLSY +++E+ 
Sbjct  66    QNLRYLLPSVPKPEFIFTPLYEAHVQASVICCKQLGIHLRVRSGGHDYEGLSYATEIETQ  125

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DLAKLR ++VD+EDNS WVQAGAT GE+YYR+AEKS+  GFP G C SLGIGGH
Sbjct  126   --FIVVDLAKLRAVQVDIEDNSAWVQAGATIGELYYRIAEKSEAHGFPGGLCSSLGIGGH  183

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+M+RKYGL ADN +DARI+DA+GRVL+R AMGEDLFWAIRGGGG SFGI+ AW
Sbjct  184   ITGGAYGSMMRKYGLGADNVIDARIIDASGRVLERRAMGEDLFWAIRGGGGASFGIITAW  243

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLVPVP+TVTVFTV +TLEQ  TKLLY+WQ+VADKLDEDL ++V+I A +  A KGKR
Sbjct  244   KVKLVPVPSTVTVFTVTKTLEQGGTKLLYRWQQVADKLDEDLFIRVIIQAADG-ATKGKR  302

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV T+++A+FLG   RLL +M   FPELGLT KDC E +W++SV+Y A YP  TPPE LL
Sbjct  303   TVTTSYNALFLGDAKRLLNVMEQGFPELGLTLKDCTETTWLKSVLYIAGYPANTPPEVLL  362

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
              GK  F K +FKAKS+F+  P+PE+ L G+W+ + +E TP M+WNPYGGMM++I ES+ P
Sbjct  363   QGKSTF-KNYFKAKSDFVTEPIPETALEGIWERYFEEATPFMIWNPYGGMMSEISESSIP  421

Query  518   FPHRKGVICKIVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGM  342
             FPHRKG++ KI YLT W+   E   KH+DWIRR+Y+YM  YVS  PR+AYVNYRDLDLG+
Sbjct  422   FPHRKGILFKIQYLTMWQNPAEDASKHIDWIRRLYNYMAPYVSMFPRQAYVNYRDLDLGI  481

Query  341   NKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NK   NTSF EAS WG KYFK NF RL+ VKT+VDPDNFF HEQSIP L
Sbjct  482   NKES-NTSFIEASAWGAKYFKDNFNRLIQVKTKVDPDNFFKHEQSIPPL  529



>ref|XP_002523162.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39193.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=548

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/514 (65%), Positives = 409/514 (80%), Gaps = 10/514 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S  I   F +C+ ++S   IPFST+ ++   ++ S      +  QNL +L PS PKP  I
Sbjct  26    SFRIFDSFIQCLKVNSEILIPFSTSLYTPDNSSFSSVLQSSA--QNLRYLSPSVPKPEFI  83

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPL E+HVQAAV+C+K+ G+ LRVRSGGHD+EGLSY S++ESP  F+V+DL+KLR + V
Sbjct  84    FTPLHETHVQAAVICSKQLGIHLRVRSGGHDYEGLSYASEIESP--FIVVDLSKLRYVSV  141

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D++DNS WVQAGAT GE YYR++EKS+  GFPAG C SLGIGGHITGGAYG+M+RKYGL 
Sbjct  142   DIDDNSAWVQAGATVGEAYYRISEKSRTHGFPAGLCTSLGIGGHITGGAYGSMMRKYGLG  201

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DARI+DA G+VLDR AMGEDLFWAIRGGGG SFGI+LAWK+KLVPVPATVTVFTV
Sbjct  202   ADNVIDARIIDANGKVLDRQAMGEDLFWAIRGGGGASFGIILAWKLKLVPVPATVTVFTV  261

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ+ATK+LY+WQ+VADKLDEDL ++V+I+   + A    RTV  +F   FLG  +R
Sbjct  262   TKTLEQDATKILYRWQQVADKLDEDLFIRVIISTA-TIAKSASRTVSNSFQGQFLGDANR  320

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL +M  SFPELGLT KDC+E SWI+SV+Y A YP TTPPE LL GK LF K +FKAKS+
Sbjct  321   LLHVMETSFPELGLTRKDCIETSWIKSVLYIAGYPSTTPPEVLLQGKSLF-KNYFKAKSD  379

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F++ P+PE+GL+GLW+  L+E++P+M+WNPYGGMM KI ESA PFPHRKGV+ KI YLTS
Sbjct  380   FVKEPIPETGLQGLWERLLQEESPLMIWNPYGGMMGKISESAIPFPHRKGVLFKIQYLTS  439

Query  470   WKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             W+ +GEK   KH+DWIR++Y+YM  YVS  PR AYVNYRDLDLGMNKN  +TSF +AS W
Sbjct  440   WQ-DGEKNAAKHMDWIRKLYNYMAPYVSMFPRTAYVNYRDLDLGMNKNS-STSFIQASAW  497

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             G KYFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  498   GSKYFKDNFNRLVQVKTKVDPDNFFRHEQSIPPL  531



>ref|XP_010098535.1| Reticuline oxidase-like protein [Morus notabilis]
 gb|EXB75195.1| Reticuline oxidase-like protein [Morus notabilis]
Length=545

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/538 (61%), Positives = 414/538 (77%), Gaps = 9/538 (2%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassf  1623
             MA W  P +  I+F  L  S ++++ S    F +CVSL+S  S+    +      N + F
Sbjct  1     MAVWIKPSVAIIMFLLLQCSEYSLAASTLETFAQCVSLNSDLSV-LPLSTIFFAANDTFF  59

Query  1622  nSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLS  1443
              ++LQS+ QNL +LVPSAPKP  IFTPL +SHVQA+V+C+K+ G+ LRVRSGGHD+EGLS
Sbjct  60    TTILQSSAQNLRYLVPSAPKPEFIFTPLHDSHVQASVICSKQLGLHLRVRSGGHDYEGLS  119

Query  1442  YTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNC  1263
             Y S++E P  F+++DL+ LR + VDVE+N+ W+QAGAT GEVYYR+A+KS+  GFPAG C
Sbjct  120   YVSEIERP--FIIVDLSNLRVVSVDVEENTAWIQAGATIGEVYYRIAKKSRVHGFPAGLC  177

Query  1262  VSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggG  1083
              SLGIGGHITGGAYG+M+RKYGL ADN +DA+IVDA G++LDRAAMGEDLFWAIRGGGG 
Sbjct  178   TSLGIGGHITGGAYGSMMRKYGLGADNVVDAKIVDANGKILDRAAMGEDLFWAIRGGGGA  237

Query  1082  SFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVN  903
             SFGI+L WKIKLVPVP TVTVFTV +TLEQ  TK+L+KWQ+V DKLDEDL ++ +I   N
Sbjct  238   SFGIILWWKIKLVPVPETVTVFTVAKTLEQGGTKVLHKWQQVVDKLDEDLFIRAIIQVAN  297

Query  902   STAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR  723
             +   KG++T+ TA+  +FLG  D+LL+I+  SFPELGLT KDC+EMSWIESV+Y A +P 
Sbjct  298   A-GEKGQKTIVTAYQGLFLGGVDKLLQIIRQSFPELGLTGKDCVEMSWIESVLYIASFPT  356

Query  722   TTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMA  543
              TPPE LL GK  F K FFKAKS+F+  P+ E+ L GLWK  ++ED+P+ +W PYGGMM+
Sbjct  357   GTPPEVLLQGKSTF-KNFFKAKSDFVTEPISETALEGLWKKLMEEDSPLTIWTPYGGMMS  415

Query  542   KIPESATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYV  369
             KI ESA PFPHR G +  I +L+ W+ +GE+   KH++WIR++YDYM  YVS+ PR+AYV
Sbjct  416   KISESAIPFPHRNGTVFMIQWLSLWQ-DGERDAGKHMNWIRKLYDYMAPYVSRFPRQAYV  474

Query  368   NYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NYRDLDLGMNK    T+F EAS WG KYFK NF++LV +KT +DPDNFF HEQSIP L
Sbjct  475   NYRDLDLGMNKK-NETNFIEASGWGNKYFKDNFDKLVLIKTMIDPDNFFRHEQSIPPL  531



>ref|XP_008439530.1| PREDICTED: reticuline oxidase-like protein [Cucumis melo]
Length=549

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/543 (62%), Positives = 424/543 (78%), Gaps = 14/543 (3%)
 Frame = -2

Query  1826  MQSSLHIAMASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffs  1647
             M  S +    S+ +P+ L  L   L+ S W  S S++  F +C++ +S  S+P+S+    
Sbjct  1     MMVSTNPKYKSFVAPLFLVFL---LSSSSWVDSFSLEESFLQCLNENSQFSVPYSSFCAP  57

Query  1646  tttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSG  1467
               +  ++   +LQST QNL +L PS PKPL IFTPL +SHVQ+AV+C+K+  + LRVRSG
Sbjct  58    NNSTFNA---LLQSTAQNLRYLEPSVPKPLFIFTPLFDSHVQSAVICSKQLRIHLRVRSG  114

Query  1466  GHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKN  1287
             GHD+EGLSY S+ME+P  F+++DLAKLR +KVD++ NS WVQAGAT GEVYYR+AEKSK 
Sbjct  115   GHDYEGLSYASEMETP--FIILDLAKLRSVKVDIDSNSAWVQAGATIGEVYYRIAEKSKV  172

Query  1286  LGFPAGNCVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFW  1107
              GFPAG C SLG+GGHITGGAYG+M+RKYGL ADN +DARIVDA GR+L+R AMGEDLFW
Sbjct  173   HGFPAGLCTSLGVGGHITGGAYGSMMRKYGLGADNVVDARIVDANGRILNREAMGEDLFW  232

Query  1106  AIRggggGSFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlll  927
             AIRGGGGGSFGI+L WK+ LVPVP+TVTVFTV +TLEQ ATK+LYKWQ+VADKLDEDL +
Sbjct  233   AIRGGGGGSFGIILWWKLNLVPVPSTVTVFTVAKTLEQGATKILYKWQQVADKLDEDLFI  292

Query  926   kvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESV  747
             +V+I   N  A  G++TV TA++A+FLG   RLLK+M  +FPELGLT KDC+E SWI+SV
Sbjct  293   RVII---NVAANGGQKTVSTAYNALFLGDASRLLKVMGENFPELGLTRKDCIETSWIKSV  349

Query  746   IYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVW  567
             +Y A YP  TPPE LL GK  F K +FKAKS+F++TP+PE+GL GLWK   ++++P+M+W
Sbjct  350   LYIAGYPSGTPPEVLLQGKSTF-KNYFKAKSDFVKTPIPETGLEGLWKRLFEDESPLMIW  408

Query  566   NPYGGMMAKIPESATPFPHRKGVICKIVYLTSW-KIEGEKKKHLDWIRRMYDYMGTYVSK  390
             NPYGGMM KI E+  PFPHR+GV+ KI YLT+W K E  + KHL WI+++Y+YM  YVS+
Sbjct  409   NPYGGMMGKISETEIPFPHRRGVLFKIQYLTTWQKGEENQDKHLQWIKKLYNYMTPYVSQ  468

Query  389   SPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQ  210
              PREAYVNYRDLDLG+NKN  NTS+ E+  WG +YFK NF RL+ VKT+VDPDNFF HEQ
Sbjct  469   LPREAYVNYRDLDLGINKNS-NTSYIESIGWGTRYFKENFGRLLRVKTKVDPDNFFRHEQ  527

Query  209   SIP  201
             SIP
Sbjct  528   SIP  530



>ref|XP_010051874.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Eucalyptus 
grandis]
 gb|KCW75710.1| hypothetical protein EUGRSUZ_D00088 [Eucalyptus grandis]
Length=542

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/534 (61%), Positives = 414/534 (78%), Gaps = 14/534 (3%)
 Frame = -2

Query  1781  IILSILFTFLTFSPWAVSLSIQHQFYKCVS-LHSHTSIPfstaffstttnassfnSVLQS  1605
             I L +LF+  + +  + S+ IQ  F +C+S L++  SIP S  +    +++ +   +LQS
Sbjct  11    IFLLVLFSIDSHAS-SPSIPIQQSFLQCMSSLNNTLSIPTSLFYTPDNSSSFNS--ILQS  67

Query  1604  TVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDME  1425
             + QNL +LVPS PKP  IFTPLTE H Q AV C+   G+ LRVRSGGHD+EG SY S++E
Sbjct  68    SAQNLRYLVPSMPKPEFIFTPLTEPHAQVAVACSNRLGIHLRVRSGGHDYEGASYVSEIE  127

Query  1424  SPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgig  1245
             SP  F+VID+A+LR + V+ ++++ WVQAGAT GE+YY +AEKS   GFPAG C SLGIG
Sbjct  128   SP--FIVIDMAQLRAVDVNTQESTAWVQAGATTGELYYWIAEKSSIHGFPAGVCSSLGIG  185

Query  1244  ghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILL  1065
             GHITGGAYG+M+RKYGLAADN LDARIVDA GR LDR AMGEDLFWAIRG GGGSFG++L
Sbjct  186   GHITGGAYGSMMRKYGLAADNVLDARIVDAQGRTLDRTAMGEDLFWAIRGAGGGSFGVIL  245

Query  1064  AWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKG  885
             AWK+KLVPVP  VTVFTV +TLEQ AT++LYKWQ+V DKLDEDL ++V+I + +    KG
Sbjct  246   AWKLKLVPVPEKVTVFTVTKTLEQGATRILYKWQQVVDKLDEDLFIRVIIKSASGDP-KG  304

Query  884   KRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR--TTPP  711
             KRTV T+++A+FLG  DRL+++M  SFPELGLT  DC + SWI +V+Y A +P   +TPP
Sbjct  305   KRTVTTSYNALFLGDVDRLIQVMGKSFPELGLTRNDCTQTSWIGAVLYIAGFPNGTSTPP  364

Query  710   EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPE  531
             E LL GK LF K +FKAKS+F+R P+PE+ L GLW  +L ++ P M+W PYGGMM+++PE
Sbjct  365   EVLLQGKSLF-KNYFKAKSDFVRAPIPEAALLGLWNRYLLDENPYMIWTPYGGMMSRVPE  423

Query  530   SATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRD  357
             S TPFPHR G I KI Y+ SW+ +G+K   KH+DW+R++Y+YM  YVSKSPREAYVNYRD
Sbjct  424   SQTPFPHRSGTIFKIQYVASWQ-DGDKDPSKHMDWVRKLYNYMTPYVSKSPREAYVNYRD  482

Query  356   LDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             LDLGMN+  RNT+F+EAS WG KY+KGNF RL  +K+R DPDNFFWHEQSIPV+
Sbjct  483   LDLGMNRR-RNTTFAEASSWGSKYYKGNFYRLAKIKSRFDPDNFFWHEQSIPVI  535



>ref|XP_009353858.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Pyrus x 
bretschneideri]
Length=549

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/526 (62%), Positives = 404/526 (77%), Gaps = 9/526 (2%)
 Frame = -2

Query  1766  LFTFLTFSPWAVSL-SIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNL  1590
             LF  L  +PWA  L S+Q  F +C+S+ S  SIPFSTA  +   +       LQS+ QNL
Sbjct  13    LFLLLISTPWAHPLASLQEDFSQCLSVKSEISIPFSTALITPNNSTFLP--FLQSSAQNL  70

Query  1589  VFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPF  1410
              +LVP+APKP  IFTPL +SHVQAAV+C+K+ G+ LRVRSGGHD+E  SY S +E+P  F
Sbjct  71    RYLVPTAPKPQFIFTPLHDSHVQAAVICSKQLGIHLRVRSGGHDYEAASYVSQIETP--F  128

Query  1409  VVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitg  1230
             VV+DLAKLR + VD++DNS W QAGA+ GEVYYR+AEKSK  GFPAG C SLG+GGHITG
Sbjct  129   VVVDLAKLRSVIVDIQDNSTWAQAGASIGEVYYRIAEKSKTHGFPAGLCTSLGVGGHITG  188

Query  1229  gaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIK  1050
             GAYG+M+RKYGL ADN +DA+IVD +GRVLDRAAMGEDLFWAIRGGGGGSFGI+L WKIK
Sbjct  189   GAYGSMMRKYGLGADNVIDAKIVDVSGRVLDRAAMGEDLFWAIRGGGGGSFGIILWWKIK  248

Query  1049  LvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQ  870
             LVPVP TVTVFTVP+TLE  ATK+L+KWQ+VA    ++ L   ++  V+  +  G +TV 
Sbjct  249   LVPVPETVTVFTVPKTLETGATKVLHKWQQVAATELDEDLFMRVVIQVSEGSKTGNKTVT  308

Query  869   TAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGK  690
             T + A FLG  DRLL ++  SFPELGLT KDC E SW++SV+Y A YP +TPPE LL GK
Sbjct  309   TLYQAQFLGGADRLLDVVQTSFPELGLTKKDCTETSWLKSVMYIAGYPSSTPPEVLLQGK  368

Query  689   PLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPH  510
               F K +FKAKS+F++ P+PESGL G WK  ++E++P+++ NPYGGMM +I ESA PFPH
Sbjct  369   STF-KNYFKAKSDFVKDPIPESGLEGFWKRLMEEESPLVILNPYGGMMGRISESAIPFPH  427

Query  509   RKGVICKIVYLTSWKIEGEKK-KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKN  333
             RK V+ KI YLT+W+ E E + KH+DWIR++Y+YM  YV+  PR+AYVNYRDLDLG+NK 
Sbjct  428   RK-VLFKIQYLTTWQDEKEDEGKHMDWIRKLYNYMAPYVTMFPRQAYVNYRDLDLGVNKK  486

Query  332   GRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
               N SF EAS WG +YFK NF RL+ +K++VDPDNFF HEQSIP L
Sbjct  487   S-NISFIEASAWGNRYFKDNFNRLIKIKSKVDPDNFFRHEQSIPPL  531



>ref|XP_008445619.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Cucumis 
melo]
Length=563

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/510 (63%), Positives = 403/510 (79%), Gaps = 9/510 (2%)
 Frame = -2

Query  1718  QHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPL  1539
             +  F +CVSL+S  S+P  +       +      +LQST QNL +L PS PKP  IFTPL
Sbjct  46    EQSFLQCVSLNSQQSVPPLSVCSQNNPSFFP---LLQSTAQNLRYLDPSVPKPQFIFTPL  102

Query  1538  TESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVED  1359
              ++HVQAAV+C+K+  + LRVRSGGHD+EGLSY S++E+P  F+VIDLAKLR ++V+++D
Sbjct  103   HDTHVQAAVICSKKLQIHLRVRSGGHDYEGLSYASEIETP--FIVIDLAKLRSVEVNIQD  160

Query  1358  NSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNA  1179
             N+ WVQAGAT GEVYYR++EKS   GFPAG C SLGIGGHITGGAYG+M+RKYGL ADN 
Sbjct  161   NTAWVQAGATVGEVYYRISEKSNVHGFPAGLCTSLGIGGHITGGAYGSMMRKYGLGADNV  220

Query  1178  LDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTL  999
             +DARIVD  GR+L+R+ MGED FWAIRGG GGSFGI+L WK++LV VP  VTVFTVP+TL
Sbjct  221   IDARIVDVNGRILNRSTMGEDYFWAIRGGAGGSFGIILWWKLQLVSVPEIVTVFTVPKTL  280

Query  998   EQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKI  819
             +Q AT++LYKWQ+VADKLDEDL ++V+I   N  A K +RT+ TA++A+FLG ++RLL+I
Sbjct  281   QQGATQVLYKWQQVADKLDEDLFIRVIIQVTNDKATK-ERTITTAYNALFLGDSNRLLQI  339

Query  818   MNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRT  639
             M  SFPELGLTPKDC+E SWI+SV+Y A  P  TPPE LL GKP F K +FKAKS+F++ 
Sbjct  340   MRKSFPELGLTPKDCIETSWIKSVLYIAGEPPKTPPEVLLQGKPQF-KNYFKAKSDFVQV  398

Query  638   PVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKI-  462
             P+PE+GL GLWKIFL+E++P+M+WNPYGGMM+KI E+  PFPHRKG + KI Y+  W+  
Sbjct  399   PIPETGLEGLWKIFLQEESPLMIWNPYGGMMSKISENEIPFPHRKGNLFKIQYVNPWQAG  458

Query  461   EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYF  282
             +  + +H++WIR +Y+YM  YVSKSPR AYVNYRDLDLGMNK   NT+ ++A+ WG KYF
Sbjct  459   DKHETRHIEWIRELYNYMAPYVSKSPRAAYVNYRDLDLGMNKKD-NTTLAQANEWGNKYF  517

Query  281   KGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             K NF RLV VKT+VDP NFF HEQSIP L+
Sbjct  518   KNNFNRLVKVKTKVDPGNFFRHEQSIPPLA  547



>ref|XP_010098537.1| Reticuline oxidase-like protein [Morus notabilis]
 gb|EXB75197.1| Reticuline oxidase-like protein [Morus notabilis]
Length=538

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/513 (62%), Positives = 402/513 (78%), Gaps = 16/513 (3%)
 Frame = -2

Query  1715  HQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPLT  1536
               F +CVS +S  S+P STAF +  T++ +   +LQS+ QNL +LVPSAPKP  IFTPL 
Sbjct  31    EDFIECVSQNSDVSVPISTAFVTPNTSSFTP--LLQSSAQNLRYLVPSAPKPEFIFTPLH  88

Query  1535  ESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVEDN  1356
             +SHVQA+V+C+K+ G+ LRVRSGGHD+EGLSY S +E+P  F+V+DL +LR I  ++E+N
Sbjct  89    DSHVQASVICSKKLGIHLRVRSGGHDYEGLSYVSQIETP--FIVVDLGRLRTIDANIENN  146

Query  1355  SVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNAL  1176
             + WVQAGAT GEVYYR++EKS+  GFPAG C SLG+GGHITGGAYG+++RKYGL  DN +
Sbjct  147   TAWVQAGATIGEVYYRISEKSRVHGFPAGLCTSLGVGGHITGGAYGSLMRKYGLGVDNVV  206

Query  1175  DARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTLE  996
             DA+IVD  GR+LDR AMGEDLFWAIRGGGG SFG++L WKIKLVPVP TVTVFTV +TLE
Sbjct  207   DAKIVDVNGRILDREAMGEDLFWAIRGGGGASFGVILWWKIKLVPVPETVTVFTVAKTLE  266

Query  995   QNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK----RTVQTAFDAVFLGKTDRL  828
             Q ATK+LYKWQ    ++ + L   + I A+   A KGK    RT+ TAF A+FLG + RL
Sbjct  267   QGATKVLYKWQ----QVVDKLDEDLFIRAIIQPASKGKNSTERTIVTAFQALFLGDSTRL  322

Query  827   LKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEF  648
             +++M +SFPELGLT KDCLEMSWI+SV+Y A +P  TPPE LL GK  F K +FKAKS+F
Sbjct  323   VQVMENSFPELGLTKKDCLEMSWIQSVLYIASFPSGTPPEVLLKGKSTF-KNYFKAKSDF  381

Query  647   LRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSW  468
             ++ P+PE+ L GLWK FL+ED+P+ +W PYGGMM+KI ES TPFPHR G +  I +L+ W
Sbjct  382   VKEPIPETALEGLWKRFLEEDSPLTLWTPYGGMMSKILESETPFPHRNGTVFMIQWLSLW  441

Query  467   KIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWG  294
              ++GE    KH+DW+R +Y+YM  YVSK PRE+YVNYRDLDLG NKN ++TSF EAS WG
Sbjct  442   -LDGENDTAKHMDWVRTLYNYMAPYVSKFPRESYVNYRDLDLGKNKNNKSTSFIEASAWG  500

Query  293   YKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              KYFK NF+RLV+VK++VDPDNFF HEQSIP+L
Sbjct  501   NKYFKDNFDRLVSVKSKVDPDNFFRHEQSIPLL  533



>ref|XP_004134554.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
Length=549

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/507 (64%), Positives = 403/507 (79%), Gaps = 11/507 (2%)
 Frame = -2

Query  1718  QHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPL  1539
             +  F +C++ +S  S+P+S+         ++   +LQST QNL +L PS PKPL IFTPL
Sbjct  34    EESFLQCLNENSQFSVPYSSFCAPNNATFNA---LLQSTAQNLRYLEPSVPKPLFIFTPL  90

Query  1538  TESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVED  1359
              +SHVQ+AV+C+K+  + LRVRSGGHD+EGLSY S+ME+P  F+++DLAKLR IKVD+E 
Sbjct  91    VDSHVQSAVICSKQLRIHLRVRSGGHDYEGLSYASEMETP--FIILDLAKLRSIKVDIES  148

Query  1358  NSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNA  1179
             NS W QAGAT GEVYYR+AEKSK  GFPAG C SLG+GGHITGGAYG+M+RKYGL ADN 
Sbjct  149   NSAWAQAGATIGEVYYRIAEKSKVHGFPAGLCPSLGVGGHITGGAYGSMMRKYGLGADNV  208

Query  1178  LDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTL  999
             +DARIVDA GR+L+R AMGEDLFWAIRGGGGGSFGI+L WK+ LVPVP+TVTVFTV +TL
Sbjct  209   VDARIVDANGRILNREAMGEDLFWAIRGGGGGSFGIILWWKLNLVPVPSTVTVFTVAKTL  268

Query  998   EQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKI  819
             EQ ATK+LYKWQ+VADKLD+DL ++V+I   N  A  G++TV TA++A+FLG   RLLK+
Sbjct  269   EQGATKILYKWQQVADKLDDDLFIRVII---NVAANGGQKTVSTAYNALFLGDASRLLKV  325

Query  818   MNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRT  639
             M  SFPEL LT KDC+E SWI+SV+Y A YP  TPPE LL GK  F K +FKAKS+F++ 
Sbjct  326   MGESFPELSLTRKDCIETSWIKSVLYIAGYPSGTPPEVLLQGKSTF-KNYFKAKSDFVKN  384

Query  638   PVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSW-KI  462
             P+PE+GL GLWK   +++ P+M+WNPYGGMM KI E+  PFPHR+GV+ KI YLT+W K+
Sbjct  385   PIPETGLEGLWKRLFEDEGPLMIWNPYGGMMGKISETEIPFPHRRGVLFKIQYLTTWQKV  444

Query  461   EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYF  282
             E  + KHL WI+++Y+YM  YVS+ PREAYVNYRDLDLG+NKN  NTS+ E+  WG +YF
Sbjct  445   EENQDKHLQWIKKLYNYMTPYVSQLPREAYVNYRDLDLGINKNS-NTSYIESIGWGTRYF  503

Query  281   KGNFERLVAVKTRVDPDNFFWHEQSIP  201
             K NF RL+ VKT+VDPDNFF HEQSIP
Sbjct  504   KENFGRLLRVKTKVDPDNFFRHEQSIP  530



>gb|KEH31333.1| FAD-binding berberine family protein [Medicago truncatula]
Length=536

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/532 (61%), Positives = 405/532 (76%), Gaps = 12/532 (2%)
 Frame = -2

Query  1778  ILSILFTFLTF--SPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQS  1605
             ++S+L TF+     P + S+SI+  F  C+SLH+   IP        T+   S+ S+L+S
Sbjct  9     MMSLLATFVVLLSVPLSTSVSIEETFNNCLSLHAQ--IPNQFPSSIYTSTNKSYTSILES  66

Query  1604  TVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDME  1425
             T QNL +L+PS PKP  IFTP  +S VQAAV+C K+ G+ +R+RSGGHD+EGLSY S +E
Sbjct  67    TAQNLRYLLPSVPKPDFIFTPFHDSQVQAAVICAKQHGIHMRIRSGGHDYEGLSYVSLIE  126

Query  1424  SPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgig  1245
              P  F+++DLAKLR + VD+  N+ W+QAGAT GEVYY+++ KS   GFPAG C SLGIG
Sbjct  127   KP--FMILDLAKLRAVNVDIPHNTAWIQAGATIGEVYYKISAKSSVHGFPAGLCTSLGIG  184

Query  1244  ghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILL  1065
             G ITGGAYG+M+RKYGL  DN +DARIVDA G++LDR AMGEDLFWAIRGGGGGSFG++L
Sbjct  185   GLITGGAYGSMMRKYGLGVDNVVDARIVDANGKILDRKAMGEDLFWAIRGGGGGSFGVIL  244

Query  1064  AWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKG  885
              WKIKLVPVP TVTVFTV ++LEQ   KLLY+WQ+VA  +DE+L ++VLI   N + V G
Sbjct  245   WWKIKLVPVPKTVTVFTVTKSLEQGGNKLLYRWQQVAPNIDENLFIRVLIQPGNGS-VPG  303

Query  884   KRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEF  705
             +RTV T++ A+FLG  +RLL++M  SFPELGLT KDCLE SWI+SV+Y A YP TTPPE 
Sbjct  304   QRTVTTSYQALFLGGANRLLQVMKQSFPELGLTRKDCLETSWIKSVLYIAGYPNTTPPEV  363

Query  704   LLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESA  525
             LL GKP   K +FKAKS+F+R  +PE+ L  LWKIFL+++ P+M+WNPYGGMM++I ESA
Sbjct  364   LLQGKPT-SKAYFKAKSDFVRQVIPETSLNSLWKIFLQDEGPLMIWNPYGGMMSRIAESA  422

Query  524   TPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLD  351
             TPFPHRKG + KI YL+ W I+GEK   KH+ W+R+ Y YM  Y SK+PRE YVNYRDLD
Sbjct  423   TPFPHRKGTLYKIQYLSGW-IDGEKNMAKHMSWMRKFYSYMTPYASKNPRENYVNYRDLD  481

Query  350   LGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             +GMNK    TS S A+ WGY+YFKGNF RLV VKT+VDP NFF HEQSIP L
Sbjct  482   IGMNKK-NCTSLSLANSWGYRYFKGNFNRLVKVKTKVDPSNFFRHEQSIPSL  532



>ref|XP_002299036.1| hypothetical protein POPTR_0001s46770g [Populus trichocarpa]
 gb|EEE83841.1| hypothetical protein POPTR_0001s46770g [Populus trichocarpa]
Length=532

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/517 (63%), Positives = 404/517 (78%), Gaps = 9/517 (2%)
 Frame = -2

Query  1742  PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPK  1563
             P+ VS +IQ +F +C+S  SH+S PFSTA ++   N+S    VL ST QNL + +PS PK
Sbjct  19    PFVVSFTIQDRFLQCLSTTSHSSYPFSTAMYTPIDNSSFAT-VLLSTAQNLRYTLPSVPK  77

Query  1562  PLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLR  1383
             P  IFTP  ES +QAAVVC K+ G+  RVRSGGHD+E +SY S++ESP  F++IDLAKLR
Sbjct  78    PDFIFTPFNESDIQAAVVCCKQLGIHFRVRSGGHDYEAVSYVSEIESP--FIIIDLAKLR  135

Query  1382  GIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRK  1203
              I VD+ED+S WVQAGATNGE+YYR+AEKSK  GF AG C SLGIGGHITGGAYG M+RK
Sbjct  136   SIDVDIEDSSAWVQAGATNGELYYRIAEKSKTHGFAAGLCTSLGIGGHITGGAYGPMMRK  195

Query  1202  YGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvt  1023
             YGL ADN +DARI+DA GR+LDR AMGE+LFWAIRGGGGGSFGI+ AWK+KLVPVP  VT
Sbjct  196   YGLGADNVIDARIIDAQGRILDRQAMGEELFWAIRGGGGGSFGIITAWKVKLVPVPENVT  255

Query  1022  vftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLG  843
             VFTV +TLEQ ATKLLY+WQ+VADKLDEDL ++V+I    +   KG RT+ T+++A+FLG
Sbjct  256   VFTVRKTLEQGATKLLYRWQQVADKLDEDLFIRVIIQTAGN---KGNRTISTSYNALFLG  312

Query  842   KTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFK  663
               +RLLK+M   FPELGLTPKDC+E +W+ SV+Y   YP TTPPE LL  K +  K++FK
Sbjct  313   DANRLLKVMEEGFPELGLTPKDCIETTWLGSVLYIGGYPSTTPPEVLLQAKNIL-KSYFK  371

Query  662   AKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             AKS+F++ P+PE+GL G+W  FLKED+P+M+WNP+GGMM+KI ES TPFPHRKG +  I 
Sbjct  372   AKSDFVQEPIPETGLEGIWMRFLKEDSPLMIWNPFGGMMSKISESETPFPHRKGDLFMIH  431

Query  482   YLTSWK-IEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
             Y+T+W+   G   +H+ W+R +Y YM  YVSK+PREAYVNYRDLDLGMN+N R  +F +A
Sbjct  432   YVTNWQNASGNVGRHIKWMRGLYKYMKPYVSKNPREAYVNYRDLDLGMNRNTR-ANFKKA  490

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              VWG KY+K NF RL  VK+ VDP+N F HEQSIP L
Sbjct  491   RVWGAKYYKDNFYRLALVKSMVDPENIFRHEQSIPPL  527



>ref|XP_004486486.1| PREDICTED: cannabidiolic acid synthase-like 1-like [Cicer arietinum]
Length=545

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/529 (60%), Positives = 407/529 (77%), Gaps = 10/529 (2%)
 Frame = -2

Query  1775  LSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQ  1596
             L+IL   +T S    S SI+  F +C+S +S  + PF    ++    + +   +L S+ Q
Sbjct  9     LAILIFLITIS-LTKSASIEENFVQCLSFYSDKAAPFYATIYTPNNASFNN--ILNSSAQ  65

Query  1595  NLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPA  1416
             NL +LVPSAPKP  IFTPLT+SHVQ AV C+K+ G+ LRVRSGGHD+EGLSY S++E+P 
Sbjct  66    NLRYLVPSAPKPEFIFTPLTDSHVQVAVTCSKKLGIHLRVRSGGHDYEGLSYVSEIETP-  124

Query  1415  PFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghi  1236
              F++IDLAKLR I +D+E+N+ W+QAGAT GEVYYR+ EKS   G+PAG C SLG+GGHI
Sbjct  125   -FIIIDLAKLRDINIDIENNAAWIQAGATIGEVYYRIHEKSDVHGYPAGLCTSLGVGGHI  183

Query  1235  tggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWK  1056
             TGGAYG+M+RKYGL ADN LDARIVDA G +LDR +MGEDLFWAIRGGGGGSFGILL WK
Sbjct  184   TGGAYGSMMRKYGLGADNVLDARIVDANGNILDRKSMGEDLFWAIRGGGGGSFGILLWWK  243

Query  1055  IKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRT  876
             IKLVPVP  VTVFTV ++LEQ+ATK+ ++WQ+VA  ++E+L ++V+I    + A K +RT
Sbjct  244   IKLVPVPKIVTVFTVTKSLEQDATKIAHRWQEVAPNINENLFMRVIIQPATTVANKTQRT  303

Query  875   VQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLH  696
             + T+++A FLG  D+LL++M  SFPELGLT +DC+E SWI+SV+Y A +P  TPPE LL 
Sbjct  304   ITTSYNAQFLGDADKLLQVMKESFPELGLTKQDCMETSWIKSVLYIAGFPNDTPPEILLQ  363

Query  695   GKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPF  516
             GK  F K +FKAKS+F+R  +PE+GL+GLW+  L+ED+P+M+WNPYGGMM    ES +PF
Sbjct  364   GKSTF-KNYFKAKSDFVRESIPETGLQGLWQRLLEEDSPLMIWNPYGGMMNNFSESDSPF  422

Query  515   PHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGM  342
             PHR G + KI YL+ W+ EG+K   KH+DWIR++Y+YM  YVSK PREAYVNYRDLDLGM
Sbjct  423   PHRNGTLYKIQYLSLWQ-EGDKNASKHVDWIRKLYNYMTPYVSKFPREAYVNYRDLDLGM  481

Query  341   NKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NK   +TS+ EA+ WG  YFK NF RLV +KT+VDP+N F HEQSIP L
Sbjct  482   NKKN-STSYLEATSWGNMYFKDNFNRLVKIKTKVDPENVFRHEQSIPPL  529



>ref|XP_004162839.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
Length=549

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/507 (64%), Positives = 402/507 (79%), Gaps = 11/507 (2%)
 Frame = -2

Query  1718  QHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPL  1539
             +  F +C++ +S  S+P+S+         ++   +LQST QNL +L PS PKPL IFTPL
Sbjct  34    EESFLQCLNENSQFSVPYSSFCAPNNATFNA---LLQSTAQNLRYLEPSVPKPLFIFTPL  90

Query  1538  TESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVED  1359
              +SHVQ+AV+C+K+  + LRVRSGGHD+EGLSY S+ME+P  F+++DLAKLR IKVD+E 
Sbjct  91    VDSHVQSAVICSKQLRIHLRVRSGGHDYEGLSYASEMETP--FIILDLAKLRSIKVDIES  148

Query  1358  NSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNA  1179
             NS W QAGAT GEVYYR+AEKSK  GFPAG C SLG+GGHITGGAYG+M+RKYGL ADN 
Sbjct  149   NSAWAQAGATIGEVYYRIAEKSKVHGFPAGLCPSLGVGGHITGGAYGSMMRKYGLGADNV  208

Query  1178  LDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTL  999
             +DARIVDA GR+L+  AMGEDLFWAIRGGGGGSFGI+L WK+ LVPVP+TVTVFTV +TL
Sbjct  209   VDARIVDANGRILNGEAMGEDLFWAIRGGGGGSFGIILWWKLNLVPVPSTVTVFTVAKTL  268

Query  998   EQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKI  819
             EQ ATK+LYKWQ+VADKLD+DL ++V+I   N  A  G++TV TA++A+FLG   RLLK+
Sbjct  269   EQGATKILYKWQQVADKLDDDLFIRVII---NVAANGGQKTVSTAYNALFLGDASRLLKV  325

Query  818   MNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRT  639
             M  SFPEL LT KDC+E SWI+SV+Y A YP  TPPE LL GK  F K +FKAKS+F++ 
Sbjct  326   MGESFPELSLTRKDCIETSWIKSVLYIAGYPSGTPPEVLLQGKSTF-KNYFKAKSDFVKN  384

Query  638   PVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSW-KI  462
             P+PE+GL GLWK   +++ P+M+WNPYGGMM KI E+  PFPHR+GV+ KI YLT+W K+
Sbjct  385   PIPETGLEGLWKRLFEDEGPLMIWNPYGGMMGKISETEIPFPHRRGVLFKIQYLTTWQKV  444

Query  461   EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYF  282
             E  + KHL WI+++Y+YM  YVS+ PREAYVNYRDLDLG+NKN  NTS+ E+  WG +YF
Sbjct  445   EENQDKHLQWIKKLYNYMTPYVSQLPREAYVNYRDLDLGINKNS-NTSYIESIGWGTRYF  503

Query  281   KGNFERLVAVKTRVDPDNFFWHEQSIP  201
             K NF RL+ VKT+VDPDNFF HEQSIP
Sbjct  504   KENFGRLLRVKTKVDPDNFFRHEQSIP  530



>ref|XP_008365995.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Malus domestica]
Length=549

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/526 (62%), Positives = 400/526 (76%), Gaps = 9/526 (2%)
 Frame = -2

Query  1766  LFTFLTFSPWAVSL-SIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNL  1590
             LF  L  +PWA  L S+Q  F +C+S +S  SIPFSTA  +   +       LQS+ QNL
Sbjct  13    LFLLLISTPWAHPLASLQEDFSQCLSENSEISIPFSTALITPNNSTFLP--FLQSSAQNL  70

Query  1589  VFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPF  1410
              +LVP+APKP  IFTPL +SHVQAAV+C+K+ GV LRVRSGGHD+E  SY S +E+P  F
Sbjct  71    RYLVPTAPKPEFIFTPLHDSHVQAAVICSKQLGVHLRVRSGGHDYEAASYVSQIETP--F  128

Query  1409  VVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitg  1230
             VV+DLAKLR + VD++DNS W QAGA+ GEVYYR+AEKSK  GFPAG C SLG+GGHITG
Sbjct  129   VVVDLAKLRSVIVDIQDNSTWAQAGASIGEVYYRIAEKSKTHGFPAGLCTSLGVGGHITG  188

Query  1229  gaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIK  1050
             GAYG M+RKYGL ADN +DA+IVD +GRVLDRAAMGEDLFWAIRGGGGGSFGI+L WKIK
Sbjct  189   GAYGTMMRKYGLGADNVIDAKIVDVSGRVLDRAAMGEDLFWAIRGGGGGSFGIILWWKIK  248

Query  1049  LvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQ  870
             LVPVP TVTVFTVP+TLE  ATK+L+KWQ+VA    ++ L   ++  V+       +TV 
Sbjct  249   LVPVPETVTVFTVPKTLETGATKILHKWQQVAATELDEDLFMRVVIQVSEDGKTANKTVT  308

Query  869   TAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGK  690
             T + A FLG  DRLL ++  SFPELGL   DC E SW+++V+Y A YP +TPPE LL GK
Sbjct  309   TLYQAQFLGGADRLLDVVQTSFPELGLXKXDCTETSWLKAVMYIAGYPSSTPPEVLLEGK  368

Query  689   PLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPH  510
               F K +FKAKS+F++ P+PESGL G WK  ++E++P+++ NPYGGMM +I ESA PFPH
Sbjct  369   STF-KNYFKAKSDFVKDPIPESGLEGFWKRLMEEESPLVILNPYGGMMGRISESAIPFPH  427

Query  509   RKGVICKIVYLTSWKIEGEKK-KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKN  333
             RK V+ KI YLT+W+ E E + KH+DWIR++Y+YM  YV+  PR+AYVNYRDLDLG+NK 
Sbjct  428   RK-VLFKIQYLTTWQDEKEDEGKHMDWIRKLYNYMAPYVTTFPRQAYVNYRDLDLGVNKK  486

Query  332   GRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
               N SF EAS WG +YFK NF+RL+ +KT+VDPDNFF HEQSIP L
Sbjct  487   S-NISFIEASAWGKRYFKDNFKRLIKIKTKVDPDNFFRHEQSIPPL  531



>ref|XP_010053020.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
 gb|KCW77259.1| hypothetical protein EUGRSUZ_D01614 [Eucalyptus grandis]
Length=538

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/520 (61%), Positives = 400/520 (77%), Gaps = 11/520 (2%)
 Frame = -2

Query  1745  SPW-AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSA  1569
             SPW + +  IQ  F++C+S +S  S+P S+ +     ++ +   VL ST  NL +L+P+ 
Sbjct  21    SPWTSATYPIQQTFFRCLSTNSKNSVPLSSYYTPNNVSSFTS--VLNSTANNLRYLLPTV  78

Query  1568  PKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAK  1389
             PKP++IFTPL+E HVQ AV+C+++ G+ LRVRSGGHD+E +SY S +E    FVV+DL +
Sbjct  79    PKPVIIFTPLSELHVQTAVLCSRQLGLTLRVRSGGHDYEAVSYVSQIE--PTFVVLDLCQ  136

Query  1388  LRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAML  1209
             LR I+VD+   + W QAGATNGEVYYR+AEKSK  GFP G C SLG+GGHITGGAYG+M+
Sbjct  137   LRAIEVDIPRGTAWAQAGATNGEVYYRIAEKSKVHGFPMGLCTSLGVGGHITGGAYGSMM  196

Query  1208  RKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpat  1029
             RK+GL  DN +D R+VDA G++LDR AMGEDLFWA+RGGGGGSFGI+LAWK+KLV VP T
Sbjct  197   RKFGLGVDNVIDVRMVDAKGKILDRKAMGEDLFWALRGGGGGSFGIILAWKLKLVNVPET  256

Query  1028  vtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVF  849
             VTVFTV + LEQ ATK+LYKWQ VA KLD+ L ++V+I A +S  +   RTV TA++A+F
Sbjct  257   VTVFTVAKALEQGATKVLYKWQNVAPKLDDRLFIRVIIQA-SSANLTANRTVLTAYNALF  315

Query  848   LGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTF  669
             LG  + LL IM   FPELGLT  DC+E SWI SV+Y A YP TT PE LL GKPLF + +
Sbjct  316   LGDANTLLGIMGKRFPELGLTRADCVETSWIGSVLYIAGYPNTTAPEVLLQGKPLF-RNY  374

Query  668   FKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICK  489
             FKAKS+F+RTP+PE GL GLWKI+L+E+ P M+WNPYGG MA++PESATPFPHR+G + K
Sbjct  375   FKAKSDFVRTPIPEEGLLGLWKIYLEEEVPFMIWNPYGGAMARVPESATPFPHRRGTLFK  434

Query  488   IVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSF  315
             I Y+ +W+ +G +   +H+ WI ++YDYMG YVSK+PREAYVNYRDLDLGMNK G N S 
Sbjct  435   IQYVATWQ-DGTQSMARHMSWIGKLYDYMGNYVSKNPREAYVNYRDLDLGMNKKGVN-SM  492

Query  314   SEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              EAS WG +YFK NF RL+ VKTRVDPDN F HEQSIP L
Sbjct  493   MEASSWGLRYFKSNFYRLIKVKTRVDPDNVFRHEQSIPPL  532



>ref|XP_003524780.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Glycine 
max]
 gb|KHN25857.1| Reticuline oxidase-like protein [Glycine soja]
Length=531

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/532 (61%), Positives = 410/532 (77%), Gaps = 13/532 (2%)
 Frame = -2

Query  1784  PIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQS  1605
             P+I+ +L +F      A S S+Q  F +C++L+S  + PF ++ ++ +  + +   +L S
Sbjct  9     PLIIVLLLSF----SLANSASLQESFVQCLNLNSDRTFPFYSSIYTPSNPSFTS--ILDS  62

Query  1604  TVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDME  1425
             + QNL  LVPSAPKP  IFTP  +SHVQAAV+C+K+ G+ +RVRSGGHD+EG+SY S++E
Sbjct  63    SAQNLRLLVPSAPKPEFIFTPSRDSHVQAAVICSKKLGIHIRVRSGGHDYEGISYVSEIE  122

Query  1424  SPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgig  1245
             +P  F+V+DL KLRGI VDV+ N+ WVQAGAT GEVYYR+ EKS   GFPAG C SLGIG
Sbjct  123   TP--FIVVDLVKLRGINVDVKSNTAWVQAGATTGEVYYRIYEKSSVHGFPAGLCTSLGIG  180

Query  1244  ghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILL  1065
             GHITGGAYG M+RKYGL  DN LDA+IVDA GRVLDR AMGEDLFWAIRGGGGGSFGILL
Sbjct  181   GHITGGAYGTMMRKYGLGVDNVLDAQIVDANGRVLDREAMGEDLFWAIRGGGGGSFGILL  240

Query  1064  AWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKG  885
              WKIKLVPVP TVTVFTV ++LEQ ATK+L++WQ+VA  +DE+L ++V+I   +    K 
Sbjct  241   WWKIKLVPVPPTVTVFTVTKSLEQGATKILHRWQEVAPYIDENLFIRVIIQPSSDGRNKT  300

Query  884   KRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEF  705
             +RT+ T+++A+FLG    LL++M  SFPELGLT KDCLE SWI+SV+Y A +P  TPPE 
Sbjct  301   QRTITTSYNALFLGGARTLLQVMKTSFPELGLTRKDCLETSWIKSVLYIAGFPSDTPPEV  360

Query  704   LLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESA  525
             LL GK  F K FFKAKS+F+R P+PE+GL GLW+  L ED+P+M+WNPYGG M++  ES 
Sbjct  361   LLKGKSTF-KNFFKAKSDFVREPIPETGLEGLWQRLLVEDSPLMIWNPYGGRMSQFSESE  419

Query  524   TPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLD  351
             TPFPHR G + KI YL+ W+ EG+K   KH+DWIR++Y+YMG YVS  PREAYVNYRDLD
Sbjct  420   TPFPHRNGTLYKIQYLSLWQ-EGDKNAAKHIDWIRKLYNYMGPYVSSLPREAYVNYRDLD  478

Query  350   LGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             LG+N    +TS+ +AS WGY+Y+K NF+RLV +KT+VDP N F HEQSIP L
Sbjct  479   LGINTK-NSTSYIQASAWGYRYYKNNFDRLVKIKTKVDPQNVFRHEQSIPPL  529



>gb|KHN39151.1| Reticuline oxidase-like protein [Glycine soja]
Length=527

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/514 (62%), Positives = 401/514 (78%), Gaps = 9/514 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S S+Q  F +C++L+S  + PF ++ ++ +  + +   +L S+ QNL  LVPS PKP  I
Sbjct  19    SASVQESFVQCLNLNSDKTFPFYSSIYTASNPSFTS--ILDSSAQNLRLLVPSVPKPEFI  76

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTP  +SHVQAAV+C+K+ G+ +RVRSGGHD+EG+SY S++ESP  F+V+DL KLRGI V
Sbjct  77    FTPSRDSHVQAAVICSKKLGIHIRVRSGGHDYEGISYVSEIESP--FIVVDLVKLRGIDV  134

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             DV+ N+ WVQAGAT GEVYYR+ EKS   GFPAG C SLGIGGHITGGAYGAM+RKYGL 
Sbjct  135   DVKSNTAWVQAGATTGEVYYRIYEKSSVHGFPAGLCTSLGIGGHITGGAYGAMMRKYGLG  194

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
              DN LDA+IVDA GR+LDR AMGEDLFWAIRGGGGGSFGILL WKIKLV VP TVTVFTV
Sbjct  195   VDNVLDAKIVDANGRILDREAMGEDLFWAIRGGGGGSFGILLWWKIKLVSVPPTVTVFTV  254

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ ATK+L+KWQ+VA  +DE+L ++V+I   +    K +RT+ T+++A+FLG    
Sbjct  255   TKTLEQGATKILHKWQEVAPYIDENLFIRVIIQPSSDARNKTQRTIATSYNALFLGGART  314

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL++M  SFPELGLT KDCLE SWI+SV+Y A +P  TPPE LL GK  F K FFKAKS+
Sbjct  315   LLQVMKTSFPELGLTIKDCLETSWIKSVLYIAGFPSDTPPEVLLKGKSTF-KNFFKAKSD  373

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F+R P+PE+GL GLW+  L ED+P+M+WNPYGG M++  ES TPFPHR G + KI YL+ 
Sbjct  374   FVREPIPETGLEGLWQRLLVEDSPLMIWNPYGGRMSQFSESETPFPHRNGTLYKIQYLSL  433

Query  470   WKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             W+ EG+K   KH+DWIR++Y+YMG YVS  PREAYVNYRDLDLG+N    +TS+ +AS W
Sbjct  434   WQ-EGDKNAAKHIDWIRKLYNYMGPYVSSLPREAYVNYRDLDLGINTK-NSTSYIQASAW  491

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             GY+Y+K NF+RLV +KT+VDP+N F HEQSIP L
Sbjct  492   GYRYYKNNFDRLVKIKTKVDPENVFRHEQSIPPL  525



>ref|XP_006377913.1| hypothetical protein POPTR_0011s16240g [Populus trichocarpa]
 gb|ERP55710.1| hypothetical protein POPTR_0011s16240g [Populus trichocarpa]
Length=532

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/517 (63%), Positives = 398/517 (77%), Gaps = 9/517 (2%)
 Frame = -2

Query  1742  PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPK  1563
             P+  S  IQ  F +C+S  S +S PFSTA ++   N+S    VL ST QNL +++PS PK
Sbjct  19    PFVFSYPIQDTFLQCLSSTSESSFPFSTALYTPINNSSFTT-VLLSTAQNLRYILPSVPK  77

Query  1562  PLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLR  1383
             P  IFTP  ES +QAAVVC K+ G+  RVRSGGHD+E +SY S +ESP  F++IDLAKLR
Sbjct  78    PEFIFTPFNESDIQAAVVCCKQLGIHFRVRSGGHDYEAVSYVSAIESP--FIIIDLAKLR  135

Query  1382  GIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRK  1203
              + VD+EDNS WVQAGATNGE+YYR+AEKSK  GFPAG C SLG+GG ITGGAYGAM+RK
Sbjct  136   SVDVDIEDNSAWVQAGATNGELYYRIAEKSKTHGFPAGLCTSLGMGGLITGGAYGAMMRK  195

Query  1202  YGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvt  1023
             YGL ADN +DARIVDA GR+LDR AMGE+LFWAIRGGGGGSFGI+ AWK+KLVPVP TVT
Sbjct  196   YGLGADNVIDARIVDAQGRILDRKAMGEELFWAIRGGGGGSFGIITAWKVKLVPVPETVT  255

Query  1022  vftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLG  843
             VFTV +TLEQ ATKLLY+WQ+VADKLDEDL ++V I    +T   G RT+ T+++AVFLG
Sbjct  256   VFTVTKTLEQGATKLLYRWQQVADKLDEDLFIRVSIQTAGTT---GNRTITTSYNAVFLG  312

Query  842   KTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFK  663
                RLL++M  SFPELGLT KDC+E +W+ESV+Y   YP  TPPE LL    +  K++FK
Sbjct  313   DAKRLLRVMESSFPELGLTQKDCIETTWLESVLYTGSYPSNTPPEALLQANNVL-KSYFK  371

Query  662   AKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             AKS+F++ P+PES L+G+WK   KE+   M+WNP+GGMM+KI E  TPFPHRKG +  I 
Sbjct  372   AKSDFVQEPIPESALKGIWKRLFKEEGGFMIWNPFGGMMSKISEFETPFPHRKGDLFMIQ  431

Query  482   YLTSWK-IEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
             Y+T W+   G+  KH+ WIR +Y YM  YVSK+PREAYVNYRDLDLG+N+N  NTSF +A
Sbjct  432   YVTGWQDASGDVGKHVKWIRELYKYMAPYVSKNPREAYVNYRDLDLGINRN-TNTSFIKA  490

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             SVWG KYFKGNF RL  VK++VDPDN F HEQSIP L
Sbjct  491   SVWGAKYFKGNFYRLALVKSKVDPDNIFRHEQSIPPL  527



>ref|XP_010053022.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
 gb|KCW77263.1| hypothetical protein EUGRSUZ_D01619 [Eucalyptus grandis]
Length=538

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/540 (60%), Positives = 414/540 (77%), Gaps = 12/540 (2%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTF-SPWAVSLS-IQHQFYKCVSLHSHTSIPfstaffstttnas  1629
             MA  SS ++  ILF F+   S W  + S IQ  F++C+S +S  SIP ST +      + 
Sbjct  1     MAFRSSLLLSQILFLFVALPSSWTSATSTIQQTFFRCLSTNSMNSIPLSTYYTPNNVTSF  60

Query  1628  sfnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEG  1449
             +   VL ST  NL +L+P+APKP++IFTPL E+HVQAAV+C++  G+ LRVRSGGHD+E 
Sbjct  61    TS--VLNSTANNLRYLLPNAPKPVIIFTPLCEAHVQAAVLCSRRFGLALRVRSGGHDYEA  118

Query  1448  LSYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAG  1269
             +SY S +ESP  F+V+DLA+LR I+VD+   + W QAGAT GEVYYR+A++S+  GFP G
Sbjct  119   VSYVSQIESP--FLVLDLARLRSIQVDIRRGTAWAQAGATTGEVYYRIAQQSRVHGFPMG  176

Query  1268  NCVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggg  1089
              C SLG+GGHITGGAYG+M+R +GL  DN +D R+VD+ GR+LDR AMGEDLFWA+RGGG
Sbjct  177   LCASLGVGGHITGGAYGSMMRMFGLGVDNVIDVRMVDSKGRILDRKAMGEDLFWALRGGG  236

Query  1088  gGSFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITA  909
             GGSFG++LAW +KLV VP TVTVFTV +TLEQ ATKLLYKWQKVA K+D+ L ++V+I A
Sbjct  237   GGSFGVILAWNLKLVNVPETVTVFTVTKTLEQGATKLLYKWQKVAPKIDDRLYIRVIIQA  296

Query  908   VNSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALY  729
              +S  +   RTV T+++A+FLG  D LL+IM   FPELGLT  DC++ SWI SV+Y A Y
Sbjct  297   -SSADLTANRTVVTSYNALFLGDPDTLLRIMGKRFPELGLTRADCVKTSWIGSVLYIAGY  355

Query  728   PRTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGM  549
             P TT PE LL GKPLF + +FKAKS+F+RTP+   GL GLWKI+L+E+ P M+WNPYGG 
Sbjct  356   PNTTAPEVLLQGKPLF-RNYFKAKSDFVRTPISVKGLLGLWKIYLQEENPFMIWNPYGGA  414

Query  548   MAKIPESATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREA  375
             MA++PESATPFPHR G + KI Y+ +W+ +G +   +H++W+ ++Y+YMG+YVSK+PREA
Sbjct  415   MARVPESATPFPHRYGTLFKIQYVATWQ-DGTQSMARHMNWLTKLYNYMGSYVSKNPREA  473

Query  374   YVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             YVNYRDLDLGMNK G N S +EAS WG +YFK NF RLV VKTRVDPDNFF HEQSIP L
Sbjct  474   YVNYRDLDLGMNKKGVN-SLAEASSWGLRYFKSNFYRLVQVKTRVDPDNFFRHEQSIPPL  532



>ref|XP_003594602.1| Reticuline oxidase-like protein [Medicago truncatula]
 gb|AES64853.1| FAD-binding berberine family protein [Medicago truncatula]
Length=545

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/514 (61%), Positives = 402/514 (78%), Gaps = 9/514 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S SI+  F +C+S +S  + PF  + ++    + +   +L S+ QNL +LVPSAPKP  I
Sbjct  23    SASIEENFVQCLSFYSDKAAPFYASIYTPNNASFNN--ILNSSAQNLRYLVPSAPKPEFI  80

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPLT+SHVQ AV C+K+ G+ LRVRSGGHD+EGLSY S++E+P  F+++DLAKLR + V
Sbjct  81    FTPLTDSHVQVAVTCSKKLGIHLRVRSGGHDYEGLSYVSEIETP--FIIVDLAKLRDVNV  138

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+ DNS W+QAGAT GEVYYR+ EKS   GFPAG C SLG+GGHITGGAYG+M+RKYGL 
Sbjct  139   DIGDNSAWIQAGATIGEVYYRIHEKSDVHGFPAGLCTSLGVGGHITGGAYGSMMRKYGLG  198

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN LDA+IVDA G +LDR +MGE+ FWAIRGGGGGSFGILL WKIKLVPVP TVTVFTV
Sbjct  199   ADNVLDAKIVDANGNILDRKSMGEEFFWAIRGGGGGSFGILLWWKIKLVPVPKTVTVFTV  258

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              ++LEQ+A+K+++KWQ+VA  +DE+L ++V+I    STA K +RT+ T+++A FLG +++
Sbjct  259   TKSLEQDASKIVHKWQEVAPTIDENLFMRVIIQPAASTANKTQRTITTSYNAQFLGDSEK  318

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL++M  SFPELGLT +DC E SWI+SV+Y A YP  TPPE LL GK  F K +FKAKS+
Sbjct  319   LLQVMKESFPELGLTKQDCTETSWIKSVMYIAGYPNDTPPEVLLEGKSTF-KNYFKAKSD  377

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F+R P+PE+GL+GLW+  L+ED+P+M+WNPYGGMM    ES  PFPHR G + KI YLT 
Sbjct  378   FVREPIPETGLQGLWQRLLEEDSPLMIWNPYGGMMNNFSESDIPFPHRNGTLYKIQYLTL  437

Query  470   WKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             W+ +G+K   KH+DWIR++Y+YM  YVSK PREAYVNYRDLDLGMNK   +TSF +A+ W
Sbjct  438   WQ-DGDKNASKHVDWIRKLYNYMTPYVSKFPREAYVNYRDLDLGMNKK-NSTSFIQATSW  495

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             G  YFK NF RLV +KT+VDP+N F HEQSIP L
Sbjct  496   GNMYFKDNFNRLVKIKTKVDPENVFRHEQSIPPL  529



>gb|KDP36338.1| hypothetical protein JCGZ_09758 [Jatropha curcas]
Length=544

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/536 (63%), Positives = 412/536 (77%), Gaps = 15/536 (3%)
 Frame = -2

Query  1787  SPIILSILFTFLTFSPWAV-SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVL  1611
             SPI  SIL  FL  SP  + S  I   F +C+ L+S   IPFS +FF+   ++ S   VL
Sbjct  3     SPISCSILVLFLLLSPSCILSFPIVDSFLQCLKLNSEVIIPFSNSFFTPNNSSFSS--VL  60

Query  1610  QSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSD  1431
             QST QNL +L+PS PKP  IFTPL E+H+QAAV+C+K+ G+ LRVRSGGHD+EGLSY S 
Sbjct  61    QSTAQNLRYLLPSVPKPQFIFTPLHETHIQAAVICSKQLGIHLRVRSGGHDYEGLSYASQ  120

Query  1430  MESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLg  1251
             +E+P  F++IDL+KLR + VD++DNS WVQAGAT GE YYR+AEKSK  GFPAG C SLG
Sbjct  121   IENP--FIIIDLSKLRSVYVDIDDNSAWVQAGATIGEAYYRIAEKSKTHGFPAGLCTSLG  178

Query  1250  igghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGI  1071
             IGGHITGGAYG M+RKYGL ADN +DA IVD  GR+LDR AMGE+LFWAIRGG GGSFGI
Sbjct  179   IGGHITGGAYGPMMRKYGLGADNVIDAHIVDVNGRLLDRQAMGENLFWAIRGGAGGSFGI  238

Query  1070  LLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVN--ST  897
             +++WK+KLVPVP+TVTVFTV +TLEQ+ TK+L++W +VADKLDEDL ++VLI+  N  +T
Sbjct  239   IVSWKLKLVPVPSTVTVFTVTKTLEQHGTKILHRWTEVADKLDEDLFIRVLISPANVGNT  298

Query  896   AVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTT  717
              V   RTV T++ A+FLG  +RLL +M   FPELGLT  DC E SWI+SV+Y A YP TT
Sbjct  299   TV---RTVSTSYQALFLGDVNRLLHVMQSGFPELGLTRNDCTETSWIKSVLYIAGYPSTT  355

Query  716   PPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKI  537
              PE LL GK LF K +FKAKS+F++ P+PE+GL GLWK FL+E+ P M+WN +GGMM+KI
Sbjct  356   APEVLLQGKSLF-KNYFKAKSDFIKEPIPETGLEGLWKRFLEEENPFMIWNAFGGMMSKI  414

Query  536   PESATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNY  363
              ES  PFPHRKG +  + YLTSW+ +GEK   KH+DWIR++Y+YM  Y S  PR AYVNY
Sbjct  415   SESEIPFPHRKGNLFMVQYLTSWQ-DGEKSEAKHMDWIRKLYNYMAPYASMFPRTAYVNY  473

Query  362   RDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             RDLDLG+NK   N SF EA+ WG KYFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  474   RDLDLGVNKKS-NFSFLEATSWGSKYFKDNFNRLVQVKTKVDPDNFFRHEQSIPPL  528



>ref|XP_003546280.1| PREDICTED: inactive tetrahydrocannabinolic acid synthase-like 
[Glycine max]
Length=543

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/529 (61%), Positives = 409/529 (77%), Gaps = 11/529 (2%)
 Frame = -2

Query  1775  LSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQ  1596
             L+ L   L+ S  A S S++  F +C+S +S  + PF  + ++    + +   +L+S+ Q
Sbjct  8     LATLILLLSVS-MAASASLEENFVQCLSFYSDKAAPFYASIYTPQNASFNK--ILESSAQ  64

Query  1595  NLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPA  1416
             NL +LVPSA KP LIFTP T+SHVQ AV C+K+ G+ LR+RSGGHD+EGLSY S++E+P 
Sbjct  65    NLRYLVPSAHKPELIFTPSTDSHVQVAVTCSKKLGIHLRIRSGGHDYEGLSYVSEVETP-  123

Query  1415  PFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghi  1236
              F+++DL+KLR + VD+EDN+ W+QAGAT GEVYY++ EKS   GFPAG C SLG+GGHI
Sbjct  124   -FIIVDLSKLRAVNVDIEDNTAWIQAGATIGEVYYKIYEKSSVHGFPAGLCTSLGVGGHI  182

Query  1235  tggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWK  1056
             TGGAYG+M+RKYGL ADN LDARIVDA G++LDR AMGEDLFWAIRGGGG SFGILL WK
Sbjct  183   TGGAYGSMMRKYGLGADNVLDARIVDANGQILDREAMGEDLFWAIRGGGGASFGILLWWK  242

Query  1055  IKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRT  876
             IKLVPVP TVTVFTV R+LEQ+AT++L++WQ+VA  +DEDL ++V+I    +   K +RT
Sbjct  243   IKLVPVPETVTVFTVTRSLEQDATRILHRWQEVAPYIDEDLFIRVIIQPA-TVGNKTERT  301

Query  875   VQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLH  696
             + T+++A FLG  DRLL++M  SFPEL LT KDCLE SWI+SV+Y A YP  TPPE LL 
Sbjct  302   ITTSYNAQFLGGADRLLQVMKESFPELVLTKKDCLETSWIKSVLYIAGYPNDTPPEVLLQ  361

Query  695   GKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPF  516
             GK  F K +FKAKS+F+R  +PE+GL+GLW+  L+ED+P+M+WNPYGGMM+K  ES  PF
Sbjct  362   GKSTF-KNYFKAKSDFVRDTIPETGLKGLWQRLLEEDSPLMIWNPYGGMMSKFSESDIPF  420

Query  515   PHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGM  342
             PHR G + KI YLT W+ +G+K   KH+DWIR++Y+YM  YVSK PREAYVNYRDLDLGM
Sbjct  421   PHRNGTLYKIQYLTLWQ-DGDKNASKHIDWIRKLYNYMTPYVSKFPREAYVNYRDLDLGM  479

Query  341   NKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NK   +TS+ +A+ WG  YFK NF RLV +KT+VDPDN F HEQSIP L
Sbjct  480   NKK-NSTSYIQATAWGNMYFKDNFNRLVKIKTKVDPDNVFRHEQSIPPL  527



>ref|XP_008225656.1| PREDICTED: cannabidiolic acid synthase-like 1 [Prunus mume]
Length=548

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/531 (60%), Positives = 397/531 (75%), Gaps = 7/531 (1%)
 Frame = -2

Query  1784  PIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQS  1605
             PI    LF  ++ S      S+Q  F KC+S +S   IPFSTA  +   +       LQS
Sbjct  9     PIFPLFLFLLISTSFTQPLPSVQDNFIKCLSENSEILIPFSTALITPKNSTFIP--TLQS  66

Query  1604  TVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDME  1425
             T QNL +LVPS PKP  IFTPL +SHVQAAV+C+K+ G+ LRVRSGGHD+E LSY S  E
Sbjct  67    TAQNLRYLVPSVPKPEFIFTPLHDSHVQAAVICSKQLGIHLRVRSGGHDYEALSYVSQTE  126

Query  1424  SPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgig  1245
             +P  F+V+DLAKLR + VD+EDNS WVQAGA+ GEVYYR+AEKSK  GFPAG C SLG+G
Sbjct  127   TP--FIVVDLAKLRSVIVDIEDNSSWVQAGASIGEVYYRIAEKSKTHGFPAGLCTSLGVG  184

Query  1244  ghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILL  1065
             GHITGGAYG+M+RKYGL ADN +DARI+D TGR+LDRAAMGEDLFWAIRGGGG SFGI+L
Sbjct  185   GHITGGAYGSMMRKYGLGADNVIDARIIDVTGRILDRAAMGEDLFWAIRGGGGASFGIIL  244

Query  1064  AWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKG  885
              WKIKLVPVP+TVTVFTV +TLE  ATK+L+KWQ+VA    +D L   ++   +  +  G
Sbjct  245   WWKIKLVPVPSTVTVFTVAKTLETGATKVLHKWQQVAATELDDDLFIRVVIQSSKDSKTG  304

Query  884   KRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEF  705
              +T+ T + A FLG  DRLL ++   FPELGLT KDC E SW+++V+Y A YP  TPPE 
Sbjct  305   TKTITTLYQAQFLGDADRLLDVVKAKFPELGLTKKDCTETSWLKAVMYIAGYPSGTPPEV  364

Query  704   LLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESA  525
             LL GK  F K +FKAKS+F++ P+PE+GL GLWK  ++E++P++++NPYGG M++I ES 
Sbjct  365   LLQGKSTF-KNYFKAKSDFVKDPIPETGLEGLWKRLMEEESPLLIFNPYGGQMSRISESE  423

Query  524   TPFPHRKGVICKIVYLTSWKIEGEKK-KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
              PFPHR G++ KI YLT+W+   E + KH+DWIR++Y+YM  Y +  PR+AYVNYRDLDL
Sbjct  424   IPFPHRNGILFKIQYLTTWQDPHEDEAKHMDWIRKLYNYMAPYATMFPRQAYVNYRDLDL  483

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             G+NK   N SF EAS WG +YFK NF RL+ +KT+VDPDNFF HEQSIP L
Sbjct  484   GVNKKS-NISFIEASAWGNRYFKDNFNRLIKIKTKVDPDNFFRHEQSIPPL  533



>ref|XP_011039279.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Populus 
euphratica]
Length=532

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/517 (62%), Positives = 400/517 (77%), Gaps = 9/517 (2%)
 Frame = -2

Query  1742  PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPK  1563
             P+ VS +IQ +F +C+   SH+S PFSTA ++   N+S    VL ST QNL + +PS PK
Sbjct  19    PFVVSFTIQDRFLQCLPTTSHSSFPFSTALYTPIDNSSFTT-VLLSTAQNLRYTLPSVPK  77

Query  1562  PLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLR  1383
             P  IFTP  ES +QAAVVC K+ G+  RVRSGGHD+E +SY S +ESP  F++IDLAKLR
Sbjct  78    PEFIFTPFNESDIQAAVVCCKQLGIHFRVRSGGHDYEAVSYVSKIESP--FIIIDLAKLR  135

Query  1382  GIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRK  1203
              I VD+ED+S WVQAGATNGE+YYR+AEKSK  GF AG C SLGIGGHITGGAYG M+RK
Sbjct  136   SIDVDIEDSSAWVQAGATNGELYYRIAEKSKTHGFAAGLCTSLGIGGHITGGAYGPMMRK  195

Query  1202  YGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvt  1023
             YGL ADN +DARI+DA GR+LDR AMGE+LFWAIRGGGGGSFGI+ AWK+KLVPVP  VT
Sbjct  196   YGLGADNVIDARIIDAQGRILDRQAMGEELFWAIRGGGGGSFGIITAWKVKLVPVPENVT  255

Query  1022  vftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLG  843
             VFTV +TLEQ ATKLLY+WQ+VADKLDEDL ++V+I    +   KG RT+ T+++A+FLG
Sbjct  256   VFTVRKTLEQGATKLLYRWQQVADKLDEDLFIRVIIQTAGN---KGNRTISTSYNALFLG  312

Query  842   KTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFK  663
               +RLLK+M   FPELGLTPKDC+E +W+ SV+Y   YP TTPPE LL  K +  K++FK
Sbjct  313   DANRLLKVMEEGFPELGLTPKDCIETTWLGSVLYIGGYPSTTPPEVLLQAKNIL-KSYFK  371

Query  662   AKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             AKS+F++ P+PE+GL G+W   LKED+P+M+WNP+GGMM++I ES TPFPHRK  +  I 
Sbjct  372   AKSDFVQEPIPETGLEGIWIRLLKEDSPLMIWNPFGGMMSQISESETPFPHRKCDLFMIQ  431

Query  482   YLTSWK-IEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
             Y+T W+   G   +H+ W+RR+Y YM  YVSK+PREAYVNYRDLDLGMN+N R  +F +A
Sbjct  432   YVTGWQNASGNVGRHIKWMRRLYKYMTPYVSKNPREAYVNYRDLDLGMNRNTR-ANFKKA  490

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              VWG KY+K NF RL  VK+ VDP+N F HEQSIP L
Sbjct  491   RVWGAKYYKDNFYRLALVKSMVDPENIFRHEQSIPPL  527



>ref|XP_007147451.1| hypothetical protein PHAVU_006G125800g [Phaseolus vulgaris]
 gb|ESW19445.1| hypothetical protein PHAVU_006G125800g [Phaseolus vulgaris]
Length=543

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/510 (62%), Positives = 400/510 (78%), Gaps = 10/510 (2%)
 Frame = -2

Query  1718  QHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPL  1539
                F +C+S +S  + PF  + ++    + +   +L+S+ QNL +LVPSAPKP LIFTPL
Sbjct  26    DENFAQCLSFYSDKAAPFYASIYTPKNASFTN--ILESSAQNLRYLVPSAPKPELIFTPL  83

Query  1538  TESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVED  1359
             T+SHVQ AV C+K+ G+ LR+RSGGHD+EGLSY S++E  APF+++DL+KLR I VD++D
Sbjct  84    TDSHVQVAVTCSKKLGIHLRIRSGGHDYEGLSYVSEVE--APFIIVDLSKLRAINVDIKD  141

Query  1358  NSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNA  1179
             NS W+QAGAT GEVYYR+ EKS   GFPAG C SLG+GGHITGGAYG+M+RKYGL ADN 
Sbjct  142   NSAWIQAGATIGEVYYRIYEKSSVHGFPAGLCTSLGVGGHITGGAYGSMMRKYGLGADNV  201

Query  1178  LDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTL  999
             LDA++VDA G++LDR AMGEDLFWAIRGGGG SFGILL WKIKLVPVP  VTVFTV R+L
Sbjct  202   LDAKLVDANGQILDREAMGEDLFWAIRGGGGASFGILLWWKIKLVPVPENVTVFTVTRSL  261

Query  998   EQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKI  819
             EQ+ATK++++WQ+VA  +DEDL ++V+I    +   K +RT+ T+++A FLG  DRLL++
Sbjct  262   EQDATKIVHRWQEVAPYIDEDLFIRVIIQPA-TVGNKTERTITTSYNAQFLGGADRLLQV  320

Query  818   MNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRT  639
             M  +FPELGLT KDCLE SWI+SV+Y A YP  TPPE LL GK  F K +FKAKS+F+R 
Sbjct  321   MKENFPELGLTRKDCLETSWIKSVLYIAGYPNDTPPEVLLQGKSTF-KNYFKAKSDFVRE  379

Query  638   PVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKIE  459
             P+PE+GL+GLW+  L+ED+P+M+WNPYGGMM+K  ES  PFPHR G + KI YL+ W+ +
Sbjct  380   PIPETGLQGLWQRLLEEDSPLMIWNPYGGMMSKFSESDIPFPHRNGTLYKIQYLSLWQ-D  438

Query  458   GEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKY  285
             G+K   KH+DWIR++Y+YM  YVSK PREAYVNYRDLDLGMNK    TS+ +A+ WG  Y
Sbjct  439   GDKNATKHIDWIRKLYNYMTPYVSKFPREAYVNYRDLDLGMNKKNY-TSYIQATSWGNMY  497

Query  284   FKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             FK NF RLV +KT+VDPD+ F HEQSIP L
Sbjct  498   FKDNFNRLVKIKTKVDPDDVFRHEQSIPPL  527



>emb|CDP12616.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/539 (61%), Positives = 408/539 (76%), Gaps = 8/539 (1%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassf  1623
             M S SS I+       L  + WA S SI+ +FY CV  ++  SIP S AFF    +A + 
Sbjct  1     MPSASSVILPLFCALLLLSASWAASDSIEEEFYYCVCSNTEISIPISEAFFIQNNSAFTS  60

Query  1622  nSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLS  1443
               +L+ST QNL  LV S  KP LIF PL E  VQ AV+C ++ G+QLRVRSGGHD+EGLS
Sbjct  61    --ILESTAQNLRCLVQSRHKPELIFKPLDEFQVQVAVICARKLGIQLRVRSGGHDYEGLS  118

Query  1442  YTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNC  1263
             YTS  E+ + F +IDLA LR + V + +NS WVQAGAT GEVYY +A+KS+  GFPAG C
Sbjct  119   YTS--ETKSSFFLIDLANLRTVNVSIAENSAWVQAGATIGEVYYWIAQKSRTHGFPAGLC  176

Query  1262  VSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggG  1083
              S+GIGGHITGGAYG ++RKYGLAADN +DARIVD++GR+LDR +MGEDLFWAIRGGGGG
Sbjct  177   TSVGIGGHITGGAYGTLMRKYGLAADNVVDARIVDSSGRILDRESMGEDLFWAIRGGGGG  236

Query  1082  SFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVN  903
             SFGILLAWK++LVPVPA V VFTV RTLEQ ATKLLY+WQ+VAD LDEDL ++VL    N
Sbjct  237   SFGILLAWKLRLVPVPAIVAVFTVRRTLEQGATKLLYRWQQVADHLDEDLFIRVLSRPTN  296

Query  902   STA-VKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYP  726
             ST   KGKRT++TA+ A+FLG+ DRLLK+M    PELGLT KDC+EMSWIESV+Y A YP
Sbjct  297   STDDQKGKRTIETAYQALFLGRADRLLKVMKKGLPELGLTQKDCIEMSWIESVLYIAEYP  356

Query  725   RTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMM  546
             RT  PEFLL GKPL  K +FKAKS+F++ P+ E  L G+WK+FL++D+P+ +WNP+GGMM
Sbjct  357   RTIRPEFLLQGKPLLNKVYFKAKSDFVKEPIKEHALEGIWKMFLEQDSPLTIWNPHGGMM  416

Query  545   AKIPESATPFPHRKGVICKIVYLTSWKIEGEK---KKHLDWIRRMYDYMGTYVSKSPREA  375
             ++I ES TP+PHR G    I +LT W+   ++   K+H+DWIR++Y +M  YV +SPR A
Sbjct  417   SRISESETPYPHRNGTKFMIQWLTRWESGDDEETIKEHIDWIRKLYKFMTPYVPRSPRAA  476

Query  374   YVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             YVNYRDLDLG+N     TS +EAS WG KYFK N++RLV VK +VDP+NFF HEQSIP+
Sbjct  477   YVNYRDLDLGVNSIDGGTSLAEASSWGTKYFKNNWKRLVLVKAKVDPENFFRHEQSIPI  535



>ref|XP_011016518.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Populus 
euphratica]
Length=532

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/517 (63%), Positives = 396/517 (77%), Gaps = 9/517 (2%)
 Frame = -2

Query  1742  PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPK  1563
             P+  S  IQ +F +C+S  S +S PFSTA ++   N+S    VL ST QNL + +PS PK
Sbjct  19    PFVFSYPIQDRFRQCLSTTSESSFPFSTALYTPINNSSFTT-VLLSTAQNLRYTLPSVPK  77

Query  1562  PLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLR  1383
             P  IFTP  ES +QAAVVC K+ G+  RVRSGGHD+E +SY S +ESP  F++IDLAKLR
Sbjct  78    PEFIFTPFNESDIQAAVVCCKQLGIHFRVRSGGHDYEAVSYVSAIESP--FIIIDLAKLR  135

Query  1382  GIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRK  1203
              + VD+EDNS WVQAGATNGE+YYR+AEKSK  GFPAG C SLG+GGHI GGAYG M+RK
Sbjct  136   SVDVDIEDNSAWVQAGATNGELYYRIAEKSKTHGFPAGLCTSLGMGGHIIGGAYGPMMRK  195

Query  1202  YGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvt  1023
             YGL ADN +DARIVDA GR+LDR AMGE+LFWAIRGGGGGSFGI+ AWK+KLVPVP TVT
Sbjct  196   YGLGADNVIDARIVDAQGRILDRKAMGEELFWAIRGGGGGSFGIITAWKVKLVPVPETVT  255

Query  1022  vftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLG  843
             VFTV +TLEQ ATKLLY+WQ+VADKLDEDL ++    ++ +   +G RT+ T+++A+FLG
Sbjct  256   VFTVTKTLEQGATKLLYRWQQVADKLDEDLFIR---VSIQTAGTRGNRTITTSYNALFLG  312

Query  842   KTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFK  663
                RLLK+M  SFPELGLT KDC+E +W+ESV+Y   YP  TPPE LL    +  K++FK
Sbjct  313   DAKRLLKVMESSFPELGLTQKDCIETTWLESVMYTGSYPSNTPPEALLQANNVL-KSYFK  371

Query  662   AKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             AKS+F++ P+PES L+G+WK   KE+   M+WNP+GGMM+KI E  TPFPHRKG +  I 
Sbjct  372   AKSDFVQEPIPESALKGIWKRLFKEEGAFMIWNPFGGMMSKISEFETPFPHRKGDLFMIQ  431

Query  482   YLTSWK-IEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
             Y+T W+   G   KH+ WIR +Y YM  YVSK+PREAYVNYRDLDLG+N+N  NTSF +A
Sbjct  432   YVTGWQDASGNVGKHVKWIRELYMYMAPYVSKNPREAYVNYRDLDLGINRN-TNTSFIKA  490

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             SVWG KYFKGNF RL  VK++VDPDN F HEQSIP L
Sbjct  491   SVWGAKYFKGNFYRLALVKSKVDPDNIFRHEQSIPPL  527



>ref|XP_011013935.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Populus 
euphratica]
Length=532

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/517 (62%), Positives = 397/517 (77%), Gaps = 9/517 (2%)
 Frame = -2

Query  1742  PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPK  1563
             P+  S  IQ +F +C+S  S +S PFSTA ++   N+S    VL ST QNL + +PS PK
Sbjct  19    PFVFSYPIQDRFRQCLSTTSESSFPFSTALYTPINNSSFTT-VLLSTAQNLRYTLPSVPK  77

Query  1562  PLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLR  1383
             P  IFTP+ ES +QAAVVC K+ G+  RVRSGGHD++ +SY S +ESP  F++IDLAKLR
Sbjct  78    PEFIFTPVNESDIQAAVVCCKQLGIHFRVRSGGHDYDAVSYVSAIESP--FIIIDLAKLR  135

Query  1382  GIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRK  1203
              + VD+EDNS WVQAGATNGE+YYR+AEKSK  GFPAG C SLG+GGHI GGAYG M+RK
Sbjct  136   SVDVDIEDNSAWVQAGATNGELYYRIAEKSKKHGFPAGLCTSLGMGGHIIGGAYGPMMRK  195

Query  1202  YGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvt  1023
             YGL ADN +DARIVDA GR+LDR AMGE+LFWAIRGGGGGSFGI+ AWK+KLVPVP TVT
Sbjct  196   YGLGADNVIDARIVDAQGRILDRKAMGEELFWAIRGGGGGSFGIITAWKVKLVPVPETVT  255

Query  1022  vftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLG  843
             VFTV +TLEQ ATKLLY+WQ+VADKLDEDL ++    ++ +   +G RT+ T+++A+FLG
Sbjct  256   VFTVTKTLEQGATKLLYRWQQVADKLDEDLFIR---VSIQTAGTRGNRTITTSYNALFLG  312

Query  842   KTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFK  663
                RLLK+M  SFPELGLT KDC+E +W+ESV+Y   YP  TPPE LL    +  K++FK
Sbjct  313   DAKRLLKVMESSFPELGLTQKDCIETTWLESVMYTGSYPSNTPPEALLQANNVL-KSYFK  371

Query  662   AKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             AKS+F++ P+PES L+G+WK   KE+   M+WNP+GGMM+KI E  TPFPHRKG +  I 
Sbjct  372   AKSDFVQEPIPESALKGIWKRLFKEEGAFMIWNPFGGMMSKISEFETPFPHRKGDLFMIQ  431

Query  482   YLTSWK-IEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
             Y+T W+   G   KH+ WIR +Y YM  YVSK+PREAYVNYRDLDLG+N+N  NTSF +A
Sbjct  432   YVTGWQDASGNVGKHVKWIRELYMYMAPYVSKNPREAYVNYRDLDLGINRN-TNTSFIKA  490

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             SVWG KYFKGNF RL  VK++VDPDN F HEQSIP L
Sbjct  491   SVWGAKYFKGNFYRLALVKSKVDPDNIFRHEQSIPPL  527



>gb|AFK45445.1| unknown [Medicago truncatula]
Length=545

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/514 (61%), Positives = 400/514 (78%), Gaps = 9/514 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S SI+    +C+S +S  + PF  + ++    + +   +L S+ QNL +LVPSAPKP  I
Sbjct  23    SASIEENLVQCLSFYSDKAAPFYASIYTPNNASFNN--ILNSSAQNLRYLVPSAPKPEFI  80

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPLT+SHVQ AV C+K+ G+ LRVRSGGHD+EGLSY S++E+P  F+++DLAKLR + V
Sbjct  81    FTPLTDSHVQVAVTCSKKLGIHLRVRSGGHDYEGLSYVSEIETP--FIIVDLAKLRDVNV  138

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+ DNS W+QAGAT GEVYYR+ EKS   GFPAG C S G+GGHITGGAYG+M+RKYGL 
Sbjct  139   DIGDNSAWIQAGATIGEVYYRIHEKSDVHGFPAGLCTSSGVGGHITGGAYGSMMRKYGLG  198

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN LDA+IVDA G +LDR +MGE+ FWAIRGGGGGSFGILL WKIKLVPVP TVTVFTV
Sbjct  199   ADNVLDAKIVDANGNILDRKSMGEEFFWAIRGGGGGSFGILLWWKIKLVPVPKTVTVFTV  258

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              ++LEQ+A+K+++KWQ+VA  +DE+L ++V+I    STA K +RT+ T+++A FLG +++
Sbjct  259   TKSLEQDASKIVHKWQEVAPTIDENLFMRVIIQPAASTANKTQRTITTSYNAQFLGDSEK  318

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL++M  SFPELGLT +DC E SWI+SV+Y A YP  TPPE LL GK  F K +FKAKS+
Sbjct  319   LLQVMKESFPELGLTKQDCTETSWIKSVMYIAGYPNDTPPEVLLEGKSTF-KNYFKAKSD  377

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F+R P+PE+GL+GLW+  L+ED+P+M+WNPYGGMM    ES  PFPHR G + KI YLT 
Sbjct  378   FVREPIPETGLQGLWQRLLEEDSPLMIWNPYGGMMNNFSESDIPFPHRNGTLYKIQYLTL  437

Query  470   WKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             W+ +G+K   KH+DWIR++Y+YM  YVSK PREAYVNYRDLDLGMNK   +TSF +A+ W
Sbjct  438   WQ-DGDKNASKHVDWIRKLYNYMTPYVSKFPREAYVNYRDLDLGMNKK-NSTSFIQATSW  495

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             G  YFK NF RLV +KT+VDP+N F HEQSIP L
Sbjct  496   GNMYFKDNFNRLVKIKTKVDPENVFRHEQSIPPL  529



>ref|XP_011006002.1| PREDICTED: reticuline oxidase-like protein [Populus euphratica]
Length=532

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/517 (62%), Positives = 397/517 (77%), Gaps = 9/517 (2%)
 Frame = -2

Query  1742  PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPK  1563
             P+  S  IQ +F +C+S  S +S PFSTA +S   N+S    VL ST QNL + +PS PK
Sbjct  19    PFVFSYPIQDRFRQCLSTTSESSFPFSTALYSPINNSSFTT-VLLSTAQNLRYTLPSVPK  77

Query  1562  PLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLR  1383
             P  IFTP  ES +QAAVVC K+ G+  RVRSGGHD++ +SY S +ESP  F++IDLAKLR
Sbjct  78    PEFIFTPFNESDIQAAVVCCKQLGIHFRVRSGGHDYDAVSYVSAIESP--FIIIDLAKLR  135

Query  1382  GIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRK  1203
              + VD+EDNS WVQAGATNGE+YYR+AEKSK  GFPAG C SLG+GGHI GGAYG M+RK
Sbjct  136   SVDVDIEDNSAWVQAGATNGELYYRIAEKSKKHGFPAGLCTSLGMGGHIIGGAYGPMMRK  195

Query  1202  YGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvt  1023
             YGL ADN +DARIVDA GR+LDR AMGE+LFWAIRGGGGGSFGI+ AWK+KLVPVP TVT
Sbjct  196   YGLGADNVIDARIVDAQGRILDRKAMGEELFWAIRGGGGGSFGIITAWKVKLVPVPETVT  255

Query  1022  vftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLG  843
             VFTV +TLEQ ATK+LY+WQ+VADKLDEDL ++    ++ +   +G RT+ T+++A+FLG
Sbjct  256   VFTVTKTLEQGATKILYRWQQVADKLDEDLFIR---VSIQTAGTRGNRTITTSYNALFLG  312

Query  842   KTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFK  663
                RLLK+M  SFPELGLT KDC+E +W+ESV+Y   YP  TPPE LL    +  K++FK
Sbjct  313   DAKRLLKVMESSFPELGLTQKDCIETTWLESVLYTGSYPSNTPPEALLQANNVL-KSYFK  371

Query  662   AKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             AKS+F++ P+PES L+G+WK   KE+   M+WNP+GGMM+KI E  TPFPHRKG +  I 
Sbjct  372   AKSDFVQEPIPESALKGIWKRLFKEEGAFMIWNPFGGMMSKISEFETPFPHRKGDLFMIQ  431

Query  482   YLTSWK-IEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
             Y+T W+   G+  KH+ WIR +Y YM  YVSK+PREAYVNYRDLDLG+N+N  NTSF +A
Sbjct  432   YVTGWQDASGDVGKHVKWIRELYMYMAPYVSKNPREAYVNYRDLDLGINRN-TNTSFIKA  490

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             SVWG KYFKGNF RL  VK++VDPDN F HEQSIP L
Sbjct  491   SVWGAKYFKGNFYRLALVKSKVDPDNIFRHEQSIPPL  527



>ref|XP_003531072.2| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=593

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/530 (62%), Positives = 404/530 (76%), Gaps = 12/530 (2%)
 Frame = -2

Query  1772  SILFTFLTFSPWA--VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             SIL TF+     +  +SL I+  F  C++ HS T  P        T    SF S+L+ST 
Sbjct  66    SILATFVVLLSISLTISLPIEEAFNHCLTQHSQT--PNQFPSSIYTYTNGSFTSILESTA  123

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL +L+PS PKP  IFTPL +S VQAAVVC K+ G+ +RVRSGGHD+EGLSY S +E P
Sbjct  124   QNLRYLLPSVPKPDFIFTPLDDSQVQAAVVCAKKLGIHMRVRSGGHDYEGLSYVSLIEKP  183

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+++DLAKLR + VD+  N+ W+QAGAT GEVYYR++EKS   GFPAG C +LGIGGH
Sbjct  184   --FMILDLAKLRAVNVDIARNTAWIQAGATIGEVYYRISEKSAVHGFPAGLCTTLGIGGH  241

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+M+RKYGL ADN LDARIVDA G+VLDR AMGEDLFWAIRGGGGGSFG++L W
Sbjct  242   ITGGAYGSMMRKYGLGADNVLDARIVDANGKVLDRKAMGEDLFWAIRGGGGGSFGVILWW  301

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             KIKLVPVP TVTVFTV +TLEQ  +KLL++WQ+VA  +DE+L ++V+I   N T V GKR
Sbjct  302   KIKLVPVPQTVTVFTVTKTLEQGGSKLLHRWQQVAPHIDENLFIRVIIQPGNGT-VPGKR  360

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV T+++A+FLG  +RLL++M H FPELGLT KDC+E SWIESV+Y A YP  T PE LL
Sbjct  361   TVTTSYNALFLGGANRLLQVMKHGFPELGLTRKDCVETSWIESVLYIAGYPDGTAPEVLL  420

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
              GK    K +FKAKS+F+R  + E  L  LWKIFL++D P+M+WNPYGG M++I ESATP
Sbjct  421   QGKST-TKAYFKAKSDFVREVITEKSLNALWKIFLQDDGPLMIWNPYGGKMSRIAESATP  479

Query  518   FPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLG  345
             FPHRKGV+ KI ++T W ++GEK   KH++W+R+ Y YM  YVSK PRE YVNYRDLD+G
Sbjct  480   FPHRKGVLYKIQHVTGW-LDGEKSMAKHMNWMRKFYFYMAPYVSKYPRETYVNYRDLDIG  538

Query  344   MNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             MN+   NTS  +AS WGY+YFKGNF RLV VKT+VDP NFF HEQSIP+L
Sbjct  539   MNQK-NNTSLLKASSWGYRYFKGNFNRLVKVKTKVDPSNFFRHEQSIPLL  587



>ref|XP_007213892.1| hypothetical protein PRUPE_ppa003798mg [Prunus persica]
 gb|EMJ15091.1| hypothetical protein PRUPE_ppa003798mg [Prunus persica]
Length=548

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/511 (61%), Positives = 389/511 (76%), Gaps = 7/511 (1%)
 Frame = -2

Query  1724  SIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFT  1545
             S+Q  F KC+S +S   IPFSTA  +   +       LQST QNL +LVPS PKP  IFT
Sbjct  29    SVQDNFIKCLSENSEILIPFSTALITPNNSTFIP--TLQSTAQNLRYLVPSVPKPEFIFT  86

Query  1544  PLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDV  1365
             PL +SHVQAAV+C+K+ G+ LRVRSGGHD+E LSY S  E  APF+V+DLAKLR + VD+
Sbjct  87    PLHDSHVQAAVICSKQLGIHLRVRSGGHDYEALSYVSQTE--APFIVVDLAKLRSVIVDI  144

Query  1364  EDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAAD  1185
             EDNS WVQAGA+ GEVYYR+A+KSK  GFPAG C SLG+GGHITGGAYG+M+RKYGL AD
Sbjct  145   EDNSSWVQAGASIGEVYYRIAQKSKTHGFPAGLCTSLGVGGHITGGAYGSMMRKYGLGAD  204

Query  1184  NALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPR  1005
             N +DARI+D +GRVLDRAAMGEDLFWAIRGGGG SFGI+L WKI LVPVP+TVTVFTV +
Sbjct  205   NVIDARIIDVSGRVLDRAAMGEDLFWAIRGGGGASFGIILWWKINLVPVPSTVTVFTVAK  264

Query  1004  TLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLL  825
             TLE  ATK+L+KWQ+VA    ++ L   ++   +  +  G +T+ T + A FLG  DRLL
Sbjct  265   TLETGATKVLHKWQQVAATELDEDLFIRVVIQSSKDSKTGTKTITTLYQAQFLGDADRLL  324

Query  824   KIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFL  645
              ++   FPELGLT KDC E SW++SV+Y A YP  TPPE LL GK  F K +FKAKS+F+
Sbjct  325   DVVKTKFPELGLTKKDCTETSWLKSVMYIAGYPSGTPPEVLLQGKSTF-KNYFKAKSDFV  383

Query  644   RTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWK  465
             + P+PE+GL GLWK  ++E++P++++NPYGG M++I ES  PFPHR G++ KI YLT+W+
Sbjct  384   KDPIPETGLEGLWKRLMEEESPLVIFNPYGGQMSRISESEIPFPHRNGILFKIQYLTTWQ  443

Query  464   IEGEKK-KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYK  288
                E + KH+DWIR++Y+YM  Y +  PR+AYVNYRDLDLG+NK   N SF EAS WG +
Sbjct  444   DPHEDEAKHMDWIRKLYNYMAPYATMFPRQAYVNYRDLDLGINKKS-NISFIEASAWGNR  502

Query  287   YFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             YFK NF RL+ +KT+VDPDNFF HEQSIP L
Sbjct  503   YFKDNFNRLIKIKTKVDPDNFFRHEQSIPPL  533



>ref|XP_009362193.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Pyrus x 
bretschneideri]
Length=529

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/532 (62%), Positives = 400/532 (75%), Gaps = 11/532 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAV----SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVL  1611
             I SI   FL   P A+     LS Q  F +C+S  S T IPFST FF+   ++ +   VL
Sbjct  4     IFSISSIFLFLLPSALWAHPPLSTQANFIQCLSHKSKTYIPFSTTFFTPKNSSFTS--VL  61

Query  1610  QSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSD  1431
             +S+ QNL +LV S PKP  IFTPL +S VQAAV+C+K+  + LRVRSGGHD+EGLSY S 
Sbjct  62    ESSAQNLRYLVHSVPKPEFIFTPLHDSQVQAAVICSKKLRIHLRVRSGGHDYEGLSYVSQ  121

Query  1430  MESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLg  1251
             +E+P  F+V+DLAKLR + VD++ N+ W+QAGA+ GEVYYR AEKS+  G+PAG C SLG
Sbjct  122   IETP--FIVVDLAKLRSVNVDIKSNTAWIQAGASIGEVYYRTAEKSQTHGYPAGLCTSLG  179

Query  1250  igghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGI  1071
             IGGHITGGAYG+M+RKYGL ADNA+DARI+D  G++LDR AMGE+LFWAIRGGGG SFGI
Sbjct  180   IGGHITGGAYGSMMRKYGLGADNAIDARIIDVNGQILDRKAMGEELFWAIRGGGGASFGI  239

Query  1070  LLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAV  891
             +L WKIKLV VPA VTVF+V +TLEQ ATKLL+ WQ+VA  LDEDL ++VLI   N T +
Sbjct  240   ILWWKIKLVSVPAKVTVFSVAKTLEQGATKLLHIWQQVAPFLDEDLFIRVLIQVSNDT-I  298

Query  890   KGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP  711
              G +TV T + A FLG + RLL +M  SFPELGLT KDC E SWIESV+Y A YP  TP 
Sbjct  299   TGSKTVTTVYQAHFLGDSKRLLNVMQKSFPELGLTRKDCTETSWIESVLYIAGYPSGTPT  358

Query  710   EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPE  531
             E LL GK   PK +FKAKS+F++ P+PE  L+GLWK  L+E +P+M+ NPYGGMM+KI E
Sbjct  359   EILLEGKATLPKVYFKAKSDFVKNPIPEIALKGLWKRLLEEPSPLMILNPYGGMMSKISE  418

Query  530   SATPFPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLD  351
             SA PFPHRK V+ KI Y T W+    + KH+DWIR++Y YMG YV+  PR+AYVNYRDLD
Sbjct  419   SAIPFPHRK-VLFKIQYATVWQAGDNESKHMDWIRKLYIYMGPYVTMFPRQAYVNYRDLD  477

Query  350   LGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             LG NK   NTSF EAS WGY+YFK NF RLV +KT+VDPDNFF HEQSIP L
Sbjct  478   LGTNKKS-NTSFIEASSWGYRYFKSNFNRLVKIKTKVDPDNFFRHEQSIPPL  528



>ref|XP_004504721.1| PREDICTED: reticuline oxidase-like protein-like [Cicer arietinum]
Length=546

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/533 (60%), Positives = 404/533 (76%), Gaps = 13/533 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSI--QHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQS  1605
             ++S+L  F+     ++S SI  +  F  C+SLHS   I         T++ +S+ S+L+S
Sbjct  20    LMSLLACFVVLLSVSLSTSIPIEETFKNCLSLHSQ--ISNQFPSTIYTSSNNSYTSILES  77

Query  1604  TVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDME  1425
             T QNL +L+PS PKP  IFTP  ES VQAAV+C K+ G+ +RVRSGGHD+EGLSY S +E
Sbjct  78    TAQNLRYLLPSVPKPDFIFTPFHESQVQAAVICAKQHGIHMRVRSGGHDYEGLSYVSLIE  137

Query  1424  SPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgig  1245
              P  F+++DL K R + VD+  N+ W+Q GAT GEVYYR++EKS   GFPAG C S+G+G
Sbjct  138   KP--FMILDLVKFRAVNVDIPHNTAWIQTGATIGEVYYRISEKSAVHGFPAGLCTSIGVG  195

Query  1244  ghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILL  1065
             G ITGGAYG+M+RKYGL  DN +DA+IVDA GR+LDR AMGEDLFWAIRGGGGGSFG++L
Sbjct  196   GLITGGAYGSMMRKYGLGVDNVVDAKIVDANGRILDRKAMGEDLFWAIRGGGGGSFGVIL  255

Query  1064  AWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKG  885
              WKIKLVPVP TVTVFTV ++LEQ A KLLY+WQ+VA  +DE+L ++VLI   NS +V G
Sbjct  256   WWKIKLVPVPKTVTVFTVTKSLEQGANKLLYRWQQVAPNIDENLFIRVLIQPGNS-SVPG  314

Query  884   KRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEF  705
             +RTV T+++A+FLG  ++LL++M HSFPELGLT KDCLE SWI+SV+Y A YP  TPPE 
Sbjct  315   QRTVTTSYNALFLGGANKLLQVMKHSFPELGLTRKDCLETSWIKSVLYIAGYPNGTPPEV  374

Query  704   LLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESA  525
             LL GKP   K +FKAKS+F+R  +PE+ L  LWK+FL++D P+M+WNPYGGMM++I ESA
Sbjct  375   LLQGKPT-SKAYFKAKSDFVRQVIPETSLNTLWKVFLQDDGPLMIWNPYGGMMSRIEESA  433

Query  524   TPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLD  351
             TPFPHRKG + KI YLT W I+GEK   KH+ W+R+ Y YM  Y SK PRE YVNYRDLD
Sbjct  434   TPFPHRKGTLYKIQYLTGW-IDGEKNMAKHMSWMRKFYSYMTPYASKYPRENYVNYRDLD  492

Query  350   LGMN-KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             +GMN KN  + S +  S WGY+YFKGNF RLV VKT+VDP NFF HEQSIP L
Sbjct  493   IGMNQKNCTSLSVANNS-WGYRYFKGNFNRLVKVKTKVDPSNFFRHEQSIPPL  544



>ref|XP_009362192.1| PREDICTED: cannabidiolic acid synthase-like 1 [Pyrus x bretschneideri]
Length=528

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/526 (62%), Positives = 411/526 (78%), Gaps = 14/526 (3%)
 Frame = -2

Query  1766  LFTFLTFSP-WA-VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQN  1593
             L+ FL  S  WA    S Q  F +C+S +S T+IPFS+ F +   ++ +   VL+ST QN
Sbjct  10    LYLFLVLSASWAHPPPSTQENFIQCLSRYSKTTIPFSSDFLTPKNSSFTT--VLESTAQN  67

Query  1592  LVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAP  1413
             L +LV S PKP  IFTP+ +S VQAAV+C K+  + LRVRSGGHD+EGLSY S +E+P  
Sbjct  68    LRYLVSSVPKPEFIFTPVHDSQVQAAVICAKKLRIHLRVRSGGHDYEGLSYVSQIETP--  125

Query  1412  FVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghit  1233
             F+V+DLAKLR I VD++ N+ WVQAGAT GE+YYR+AEKSK LGFPAG C SLG+GGHIT
Sbjct  126   FLVVDLAKLRTISVDIKSNTAWVQAGATIGELYYRIAEKSKTLGFPAGLCTSLGVGGHIT  185

Query  1232  ggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKI  1053
             GGAYG+MLRKYGL ADNA+DARI+D  G++LDR AMGEDLFWAIRGGGG SFGI+L WK+
Sbjct  186   GGAYGSMLRKYGLGADNAVDARIIDFNGKILDRKAMGEDLFWAIRGGGGASFGIILWWKV  245

Query  1052  KLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTV  873
             KLVPVPATVT FTVP+TLEQ ATKLLY+WQ+VA  +D+DL ++V+I+   +T      +V
Sbjct  246   KLVPVPATVTGFTVPKTLEQGATKLLYRWQQVAPLIDDDLFIRVIISKTGNT------SV  299

Query  872   QTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHG  693
              T ++A FLG  DRLL +M  SFPELGLT KDC EMSWI+SV++ A YP TTPPE LL G
Sbjct  300   TTLYEAQFLGGVDRLLNVMQKSFPELGLTRKDCTEMSWIKSVMFIAGYPSTTPPEVLLQG  359

Query  692   KPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFP  513
             K   PK +FKAKS+F++TP+PE GL GLWK+ L+E +P+M++NPYGGMM++I ESA PFP
Sbjct  360   KSSTPKGYFKAKSDFVKTPIPEKGLEGLWKMILQESSPLMIFNPYGGMMSRISESAIPFP  419

Query  512   HRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKN  333
             HR  V+ KI Y+T W+  G++ +H+DWIR++Y+YMG+YV+K PR+AYVNYRDLDLG NK 
Sbjct  420   HRN-VLFKIQYVTLWQAGGDEAQHMDWIRKLYNYMGSYVTKFPRQAYVNYRDLDLGTNKK  478

Query  332   GRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
               ++SF +AS WGY+YFK NF RLV +KT+ DP NFF HEQSIP L
Sbjct  479   -SSSSFIQASSWGYRYFKDNFNRLVKIKTKADPQNFFRHEQSIPPL  523



>ref|XP_002299035.1| hypothetical protein POPTR_0001s46760g [Populus trichocarpa]
 gb|EEE83840.1| hypothetical protein POPTR_0001s46760g [Populus trichocarpa]
Length=537

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/528 (60%), Positives = 399/528 (76%), Gaps = 8/528 (2%)
 Frame = -2

Query  1775  LSILFTFLTFSPWAV-SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             LS+    L  SP ++ SLSI+  F +C+S +S +S PFST  ++   ++ +   VL+S+V
Sbjct  9     LSVFVFLLVLSPSSIDSLSIKDSFLQCLSKNSESSYPFSTILYTPNNSSFTS--VLESSV  66

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL F  P+ PKP  IFTPL ESH+QA VVC+K+ G+ LRVRSGGHD+EGLSY S++E P
Sbjct  67    QNLRFSQPTVPKPEFIFTPLYESHIQAVVVCSKQLGIHLRVRSGGHDYEGLSYVSEIEHP  126

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DLAKLR I VD+EDNS WV+AGAT GE+YYR++EKS   G+PAG C SLGIGGH
Sbjct  127   --FIVVDLAKLRSISVDIEDNSAWVEAGATTGELYYRISEKSNTHGYPAGVCTSLGIGGH  184

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG M RKYGLAADN +DARI+DA GRVLDR AMGEDLFWAIRGGGGGSFGI+ +W
Sbjct  185   ITGGAYGTMFRKYGLAADNVIDARIIDAYGRVLDRKAMGEDLFWAIRGGGGGSFGIITSW  244

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLVPVP  VT+F   RTLEQ ATK+LY++ + +DKLDE+L  +V     N++  +GK+
Sbjct  245   KVKLVPVPPIVTIFGAARTLEQGATKILYRFLQASDKLDENLFFRVSTQLANASE-EGKK  303

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             T+ T+++ +FLG   +LL++M  SFPELGLT +DC+E +WI SV+Y   +P  + PE LL
Sbjct  304   TISTSYNGLFLGDAKKLLQVMQESFPELGLTKQDCIETNWINSVLYMGFFPNNSTPEILL  363

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
               + LF  T FK KS+F + P+ ES L GLW++  +EDTP + + PYGGMM+KI ES  P
Sbjct  364   QRQNLFKGT-FKGKSDFAKKPIHESALEGLWEMMYEEDTPSVAFIPYGGMMSKISESEIP  422

Query  518   FPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             FPHRKG +  I Y+T+W+   E  KH+DWIR++Y YM  YVS  PREAY+NYRDLDLGMN
Sbjct  423   FPHRKGNMFFISYMTTWEDPSENAKHIDWIRKVYKYMTPYVSMYPREAYLNYRDLDLGMN  482

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             KN  NTSF EASVWG KYFKGNF+RLV VKT+VD  NFF HEQSIP L
Sbjct  483   KN-TNTSFKEASVWGSKYFKGNFKRLVKVKTKVDAGNFFRHEQSIPPL  529



>ref|XP_002317092.2| hypothetical protein POPTR_0011s16250g [Populus trichocarpa]
 gb|EEE97704.2| hypothetical protein POPTR_0011s16250g [Populus trichocarpa]
Length=529

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/507 (64%), Positives = 394/507 (78%), Gaps = 9/507 (2%)
 Frame = -2

Query  1712  QFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPLTE  1533
             +F +C+S  S +S PFSTA ++   N+S    VL ST QNL +++PS PKP  IFTP  E
Sbjct  26    RFLQCLSTTSESSFPFSTALYTPINNSSFTT-VLLSTAQNLRYILPSVPKPEFIFTPFNE  84

Query  1532  SHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVEDNS  1353
             S +QAAVVC K+ G+  RVRSGGHD+E +SY S +ESP  F++IDLAKLR + VD+EDNS
Sbjct  85    SDIQAAVVCCKQLGIHFRVRSGGHDYEAVSYVSAIESP--FIIIDLAKLRSVDVDIEDNS  142

Query  1352  VWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNALD  1173
              WVQAGATNGE+YYR+AEKSK  GFPAG C SLG+GG ITGGAYGAM+RKYGL ADN +D
Sbjct  143   AWVQAGATNGELYYRIAEKSKTHGFPAGLCTSLGMGGLITGGAYGAMMRKYGLGADNVID  202

Query  1172  ARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTLEQ  993
             ARIVDA GR+LDR AMGE+LFWAIRGGGGGSFGI+ AWK+KLVPVP TVTVFTV +TLEQ
Sbjct  203   ARIVDAQGRILDRKAMGEELFWAIRGGGGGSFGIITAWKVKLVPVPETVTVFTVTKTLEQ  262

Query  992   NATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKIMN  813
              ATKLLY+WQ+VADKLDEDL ++V I    +T   G RT+ T+++AVFLG   RLL++M 
Sbjct  263   GATKLLYRWQQVADKLDEDLFIRVSIQTAGTT---GNRTITTSYNAVFLGDAKRLLRVME  319

Query  812   HSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRTPV  633
              SFPELGLT KDC+E +W+ESV+Y   YP  TPPE LL    +  K++FKAKS+F++ P+
Sbjct  320   SSFPELGLTQKDCIETTWLESVLYTGSYPSNTPPEALLQANNVL-KSYFKAKSDFVQEPI  378

Query  632   PESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWK-IEG  456
             PES L+G+WK   KE+   M+WNP+GGMM+KI E  TPFPHRKG +  I Y+T W+   G
Sbjct  379   PESALKGIWKRLFKEEGGFMIWNPFGGMMSKISEFETPFPHRKGDLFMIQYVTGWQDASG  438

Query  455   EKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKG  276
             +  KH+ WIR +Y YM  YVSK+PREAYVNYRDLDLG+N+N  NTSF +ASVWG KYFKG
Sbjct  439   DVGKHVKWIRELYKYMAPYVSKNPREAYVNYRDLDLGINRN-TNTSFIKASVWGAKYFKG  497

Query  275   NFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NF RL  VK++VDPDN F HEQSIP L
Sbjct  498   NFYRLALVKSKVDPDNIFRHEQSIPPL  524



>ref|XP_009362191.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Pyrus x 
bretschneideri]
Length=553

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/525 (61%), Positives = 398/525 (76%), Gaps = 8/525 (2%)
 Frame = -2

Query  1766  LFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLV  1587
             LF  L  + W  SL    +F +C+S +S  SIPF+TA  +   +       LQS+ QNL 
Sbjct  17    LFLLLISTSWVHSLPSLQEFSQCLSENSDISIPFTTALITPKNSTFLP--FLQSSAQNLR  74

Query  1586  FLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFV  1407
             +LVPSAPKP  IFTPL ++HVQAAV+C+K+ G+ LRVRSGGHD+E LSY S +E+P  F+
Sbjct  75    YLVPSAPKPEFIFTPLHDTHVQAAVICSKQLGIHLRVRSGGHDYEALSYVSQIETP--FI  132

Query  1406  VIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitgg  1227
             ++DLAKLR + VD+EDNS W QAGAT GEVYYR+A+KSK  GFPAG C SLG+GGHITGG
Sbjct  133   IVDLAKLRSVIVDIEDNSAWAQAGATIGEVYYRIAQKSKTHGFPAGLCTSLGVGGHITGG  192

Query  1226  aygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKL  1047
             AYG+M+RKYGL ADN +DARIVD +GRVLDRAAMGEDLFWAIRGGGGGSFGI+L WKIKL
Sbjct  193   AYGSMMRKYGLGADNVIDARIVDVSGRVLDRAAMGEDLFWAIRGGGGGSFGIILWWKIKL  252

Query  1046  vpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQT  867
             VPVPATVTVFTVP+TLE  ATK+L+KWQ+VA    ++ L   +I  V+  +  G +TV T
Sbjct  253   VPVPATVTVFTVPKTLETGATKVLHKWQQVAATKLDEDLFIRVIIQVSKDSKTGNKTVIT  312

Query  866   AFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKP  687
              + A FLG  DRLL ++   FPELGLT KDC E SW++SV+Y A YP +TPPE LL GK 
Sbjct  313   LYQAQFLGGADRLLDVVQTRFPELGLTKKDCTETSWLKSVMYIAGYPSSTPPEVLLQGKS  372

Query  686   LFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHR  507
              F K +FKAKS+F++ P+PESGL G WK  ++E++P++   PYGGM+++I ESA PFPHR
Sbjct  373   TF-KNYFKAKSDFVKYPIPESGLEGFWKRLMQEESPLVFLTPYGGMVSRISESAIPFPHR  431

Query  506   KGVICKIVYLTSWKIEGE-KKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNG  330
             K VI K+ YLT+W+   E +  H+DWIR++Y+YM  YV+  PR+AYVNYRDLDLG+NK  
Sbjct  432   K-VIFKVQYLTTWQDGKEDQNNHMDWIRKLYNYMTPYVTMFPRQAYVNYRDLDLGVNKKS  490

Query  329   RNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              N SF EAS WG +YF  NF+RL+ +KT VDPDNFF HEQSIP L
Sbjct  491   -NVSFIEASDWGKRYFMDNFKRLIEIKTEVDPDNFFRHEQSIPPL  534



>ref|XP_006490236.1| PREDICTED: cannabidiolic acid synthase-like 2-like [Citrus sinensis]
Length=538

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/532 (61%), Positives = 405/532 (76%), Gaps = 10/532 (2%)
 Frame = -2

Query  1790  SSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVL  1611
             SS  IL ++   L  +    S+S+   F KC++++S   IPFS  +    ++  S   VL
Sbjct  4     SSKCILPLISVLLLSASGTTSISVLDNFIKCLTINSEVYIPFSNFYTPNNSSFLS---VL  60

Query  1610  QSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSD  1431
             +S+ QNL +LVPS PKP  IFTPL ESHV+AAV+C+++  + LR+RSGGHD+EGLSY S 
Sbjct  61    ESSAQNLRYLVPSMPKPEFIFTPLNESHVRAAVICSRDLRIHLRIRSGGHDYEGLSYVSQ  120

Query  1430  MESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLg  1251
             +E+P  F ++DLAKLR I+VD+ DN+ WVQAGAT GE+YYR+AEKS   GF AG C S+G
Sbjct  121   IETP--FFLLDLAKLRSIEVDINDNTAWVQAGATIGELYYRIAEKSNTQGFTAGLCPSVG  178

Query  1250  igghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGI  1071
              GGHITGG YG M+RKYGL ADN +DARIVDA+GR+LDR AMGEDLFWAIRGGGGGSFGI
Sbjct  179   SGGHITGGGYGTMMRKYGLGADNVVDARIVDASGRILDREAMGEDLFWAIRGGGGGSFGI  238

Query  1070  LLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAV  891
             +LAWK+KLVPVPATVTVFTV +TLEQ ATK+LYKWQ+VADKLDEDL ++V+I   N+   
Sbjct  239   ILAWKVKLVPVPATVTVFTVSKTLEQGATKILYKWQQVADKLDEDLFIRVIIQLANA-GP  297

Query  890   KGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP  711
             KGK+TV T+++A+FLG ++RLL++++  FPELGLT  DC+E SWI SV+Y A YP  T P
Sbjct  298   KGKKTVTTSYNALFLGDSERLLQVIHKRFPELGLTRNDCIETSWIRSVLYFAGYPNNTEP  357

Query  710   EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPE  531
             E LL  + L  K +FKAK +F++ PVPE+ L GLWK+ L+ED P+++WNPYGG+M+KI E
Sbjct  358   EILLDVQSL-GKNYFKAKLDFVQDPVPETVLEGLWKMVLEEDIPIILWNPYGGIMSKISE  416

Query  530   SATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRD  357
             S   FPHRKG I  I Y+ +WK   EK   KH+ WIRR+YDYM  YVS  PR AYVNYRD
Sbjct  417   SEIAFPHRKGNIFTIQYMNAWKDGDEKNGTKHIGWIRRLYDYMAPYVSMFPRAAYVNYRD  476

Query  356   LDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             LDLG+NK   NTS++EAS WG KYFK NF RLV VK +VDPDN F HEQSIP
Sbjct  477   LDLGINKK-FNTSYTEASAWGIKYFKDNFNRLVRVKIKVDPDNIFRHEQSIP  527



>ref|XP_010516642.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=529

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/530 (61%), Positives = 403/530 (76%), Gaps = 10/530 (2%)
 Frame = -2

Query  1781  IILSILFTFLTFS-PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQS  1605
             I ++ L T L  S P ++S ++Q  F +C+  +S  S P + +FFS   NA+ F   L+S
Sbjct  5     IPIAFLVTLLLVSVPSSLSTTLQQDFMQCLVDNSDVSFPITASFFSPDQNATLFKEELES  64

Query  1604  TVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDME  1425
             T QNL +L PS PKP+ IF PL E+HVQAAVVC K+  VQLRVRSGGHD+EGLS+ ++ E
Sbjct  65    TAQNLRYLTPSKPKPVFIFEPLYETHVQAAVVCAKKLKVQLRVRSGGHDYEGLSFVAEDE  124

Query  1424  SPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgig  1245
             +P  FVV+DL+KLR + VD++ +S W  AGATNGEVYYR+ EKS+  GFPAG C SLG+G
Sbjct  125   TP--FVVVDLSKLRQVDVDLDSSSAWAHAGATNGEVYYRIQEKSQTHGFPAGLCSSLGMG  182

Query  1244  ghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILL  1065
             GH+ GGAYG+M+RK+GL ADN LDARIVDA G++LDRAAMGED+FWAIRG GGGSFG++L
Sbjct  183   GHLVGGAYGSMMRKFGLGADNVLDARIVDANGKILDRAAMGEDVFWAIRGAGGGSFGVIL  242

Query  1064  AWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKG  885
             AWKIKLVPVPATVTVFTV +TLEQ+ T +LYKWQ+VADKLD+DL ++V+I+    T    
Sbjct  243   AWKIKLVPVPATVTVFTVTKTLEQDGTNVLYKWQQVADKLDDDLFIRVIISPARKTTGSA  302

Query  884   KRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEF  705
              RT+  +F A FLG ++RLL+IM   FPELGLT KDC EMSWI+SV+Y A +P +  PE 
Sbjct  303   DRTISMSFQAQFLGDSNRLLEIMQKDFPELGLTEKDCTEMSWIKSVMYIAGFPNSAAPEA  362

Query  704   LLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESA  525
             LL GK LF K  FKAKS+F++ P+P  GL GLWK FL+ED+P+ +WNPYGGMM++I ES 
Sbjct  363   LLAGKSLF-KNHFKAKSDFVKEPIPVEGLEGLWKRFLEEDSPLTIWNPYGGMMSRISESE  421

Query  524   TPFPHRKGVICKIVYLTSW-KIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
             TPFPHR+G + KI +L++W   E  + KH+ WIR MYDYM  YVS++PR+AYVNYRDLDL
Sbjct  422   TPFPHREGTLFKIQWLSTWPDGEASEAKHMKWIREMYDYMEQYVSQNPRQAYVNYRDLDL  481

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             G NK G     S+A  WG KY+KGNFERLV +K   DPDNFF HEQS+P 
Sbjct  482   GTNKEG-----SDAREWGAKYYKGNFERLVKIKGEFDPDNFFRHEQSVPT  526



>ref|XP_003524781.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max]
Length=534

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/531 (62%), Positives = 404/531 (76%), Gaps = 11/531 (2%)
 Frame = -2

Query  1781  IILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQST  1602
             I+ S +   L+ S +  SL I+  F  C++ HS T  P   +    T+   SF S+L+ST
Sbjct  7     ILASFVVLLLSIS-FTASLPIEEAFNHCLTQHSQT--PNQFSSSIYTSTNGSFTSILEST  63

Query  1601  VQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMES  1422
              QNL +L+PS PKP  IFTPL +S VQAAV+C K+ G+ +RVRSGGHD+EGLSY S +E 
Sbjct  64    AQNLRYLLPSVPKPDFIFTPLDDSQVQAAVICAKKLGIHMRVRSGGHDYEGLSYVSLIEK  123

Query  1421  PAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigg  1242
             P  F+++DLAKLR + VD+  N+ W+QAGAT GEVYYR++EKS   GFPAG C +LGIGG
Sbjct  124   P--FMILDLAKLRAVNVDIARNTAWIQAGATIGEVYYRISEKSAVHGFPAGLCTTLGIGG  181

Query  1241  hitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLA  1062
             HITGGAYG+M+RKYGL ADN  DARIVDA GRVLDR AMGEDLFWAIRGGGGGSFG++L 
Sbjct  182   HITGGAYGSMMRKYGLGADNVRDARIVDAKGRVLDRKAMGEDLFWAIRGGGGGSFGVILW  241

Query  1061  WKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             WKIKLVPVP TVTVFTV +TLEQ   KLL +WQ+VA K+DE+L ++V+I   N T V GK
Sbjct  242   WKIKLVPVPQTVTVFTVTKTLEQGGNKLLQRWQQVAPKIDENLFIRVIIQPGNGT-VPGK  300

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             RT+ T+++A+FLG  DRLL++M H FPELGLT KDC+E SWI+SV+Y A YP  T PE L
Sbjct  301   RTLTTSYNALFLGGADRLLQVMKHGFPELGLTIKDCVETSWIKSVLYIAGYPDGTAPEVL  360

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK    K +FKAKS+F+R  +PE  L  LWKIF+++D P+M+WNPYGG M++I ESAT
Sbjct  361   LQGKST-TKAYFKAKSDFVREVIPEKSLDALWKIFVQDDGPLMIWNPYGGKMSRIAESAT  419

Query  521   PFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
             PFPHRKGV+ KI Y+T W ++GEK   KH++W+R+ Y YM  YVSK PRE YVNYRDLD+
Sbjct  420   PFPHRKGVLYKIQYVTGW-LDGEKSMAKHMNWMRKFYFYMAPYVSKYPRETYVNYRDLDI  478

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             GMN+   NTS  +A  WGY+YFKGNF RLV VKT+VDP NFF HEQSIP+L
Sbjct  479   GMNQK-NNTSLLKAWSWGYRYFKGNFNRLVKVKTKVDPSNFFRHEQSIPLL  528



>ref|XP_009113917.1| PREDICTED: tetrahydrocannabinolic acid synthase [Brassica rapa]
Length=543

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/529 (59%), Positives = 398/529 (75%), Gaps = 7/529 (1%)
 Frame = -2

Query  1781  IILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQST  1602
             +I ++ F+F T +P   S S+Q QF  C+  ++H S P  + FF+   N S F+ VLQST
Sbjct  14    LIFALYFSFYTITPTTSSASLQDQFINCLHKNTHVSFPLESTFFAPAKNVSMFSEVLQST  73

Query  1601  VQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMES  1422
              QNL +L  S PKP  IF PL ESHVQA+++C+K+ G  +RV SGGHD+EGLSY S++E 
Sbjct  74    AQNLRYLTKSMPKPGFIFKPLHESHVQASIICSKKLGTHVRVISGGHDYEGLSYVSEIEK  133

Query  1421  PAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigg  1242
             P  F+V+DL+KLR + ++++DNS WVQAGAT GE+YYR+AEKS+  GFPAG C SLGIGG
Sbjct  134   P--FIVMDLSKLRNVNINIKDNSAWVQAGATVGELYYRIAEKSRVHGFPAGLCSSLGIGG  191

Query  1241  hitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLA  1062
             HITGGAYG+M+RKYGL ADN LDA+I DA G++LDR AMGED FWAIRGG GGSFGI+L 
Sbjct  192   HITGGAYGSMMRKYGLGADNVLDAKIGDANGKILDRKAMGEDTFWAIRGGAGGSFGIILE  251

Query  1061  WKIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAVNSTAVKG  885
             WKIKLVPVP TVTVFTV +TL+Q+   K+L KWQ VADKL ++L ++      N  A  G
Sbjct  252   WKIKLVPVPKTVTVFTVTKTLQQDPGNKILSKWQMVADKLVDELFIR---VIFNVAANNG  308

Query  884   KRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEF  705
              +T  T+++AVFLG    L+K+MN SFPELGLTPKDC EMSW+ES++Y + +   TP + 
Sbjct  309   SKTATTSYNAVFLGNKGVLMKVMNKSFPELGLTPKDCTEMSWLESIVYISGFASRTPTKV  368

Query  704   LLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESA  525
             LL GK  FPK  FKAKS+F++ P+ ESGL+G++K  LKED P+M+WNPYGGMMAKIPES 
Sbjct  369   LLQGKSAFPKNNFKAKSDFVKKPISESGLKGIFKKLLKEDNPMMIWNPYGGMMAKIPESQ  428

Query  524   TPFPHRKGVICKIVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
              PFPHRKGVI KI Y+T+W     +  +H+ WIR +Y +M  YVS +PR+AYVNYRDLDL
Sbjct  429   IPFPHRKGVIFKIQYVTNWPDSDRRANRHIKWIRDLYSFMTPYVSANPRQAYVNYRDLDL  488

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             G NK G  ++ ++A VWG  YFK NF+RLV VKT+VDP+N F HEQSIP
Sbjct  489   GQNKKGCKSTINQAQVWGASYFKDNFKRLVKVKTKVDPNNVFRHEQSIP  537



>emb|CDY29117.1| BnaC09g18430D [Brassica napus]
Length=535

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/529 (60%), Positives = 399/529 (75%), Gaps = 15/529 (3%)
 Frame = -2

Query  1781  IILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQST  1602
             +I ++ F+F T +P   S S+Q QF  C+  ++H S P  + FF+   N S F+ VLQST
Sbjct  14    LIFALYFSFYTITPTTSSASLQDQFINCLHKNTHVSFPLESTFFAPAKNVSMFSEVLQST  73

Query  1601  VQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMES  1422
              QNL +L  S PKP  IF PL ESHVQA+++C+K+ G  +RVRSGGHD+EGLSY S++E 
Sbjct  74    AQNLRYLTKSVPKPGFIFKPLHESHVQASIICSKKLGTHVRVRSGGHDYEGLSYVSEIEK  133

Query  1421  PAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigg  1242
             P  F+V+DL+KLR + ++++DNS WVQAGAT GE+YYR+AEKS   GFPAG C SLGIGG
Sbjct  134   P--FIVMDLSKLRKVNINIKDNSGWVQAGATVGELYYRIAEKSGVHGFPAGLCSSLGIGG  191

Query  1241  hitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLA  1062
             HITGGAYG+M+RKYGL ADN LDA+IVDA G++LDR AMGED FWAIRGG GGSFGI+L 
Sbjct  192   HITGGAYGSMMRKYGLGADNVLDAKIVDANGKILDRKAMGEDTFWAIRGGAGGSFGIILE  251

Query  1061  WKIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAVNSTAVKG  885
             WKIKLVPVP TVTVFTV +TL+Q+   K+L KWQ VADKL ++L     I  + +TA   
Sbjct  252   WKIKLVPVPKTVTVFTVTKTLQQDPGNKILSKWQMVADKLVDELF----IRVIFNTAT--  305

Query  884   KRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEF  705
                  T+++AVFLG    L+K+MN SFPELGLTPKDC EMSW+ES++Y + +   TP + 
Sbjct  306   -----TSYNAVFLGNKGVLMKVMNKSFPELGLTPKDCTEMSWLESIVYISGFASRTPTKV  360

Query  704   LLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESA  525
             LL GK  FPK  FKAKS+F++ P+PESGL+G++K  LKED P+M+WNPYGGMMAKIPES 
Sbjct  361   LLQGKSPFPKNNFKAKSDFVKKPIPESGLKGIFKKLLKEDNPMMIWNPYGGMMAKIPESQ  420

Query  524   TPFPHRKGVICKIVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
              PFPHRKGVI KI Y+T+W     +  +H+ WIR +Y +M  YVS +PR+AYVNYRDLDL
Sbjct  421   IPFPHRKGVIFKIQYVTNWPDSDRRASRHIKWIRDLYSFMTPYVSTNPRQAYVNYRDLDL  480

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             G NK G  ++ ++A VWG  YFK NF+RLV VKT+VDP+NFF HEQSIP
Sbjct  481   GQNKKGCKSTINQAQVWGASYFKDNFKRLVKVKTKVDPNNFFRHEQSIP  529



>ref|XP_010098536.1| Reticuline oxidase-like protein [Morus notabilis]
 gb|EXB75196.1| Reticuline oxidase-like protein [Morus notabilis]
Length=554

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/518 (63%), Positives = 399/518 (77%), Gaps = 8/518 (2%)
 Frame = -2

Query  1736  AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPL  1557
             A S S    F +CVSL+S  S+   ++    + N+S F SVL+S+ QNL +LVPSAPKP 
Sbjct  23    ADSASTLESFIQCVSLNSDLSVLPISSTIFFSRNSSLFTSVLESSAQNLRYLVPSAPKPE  82

Query  1556  LIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGI  1377
              IFTPL++SHVQA+V+C+K+  + LRVRSGGHD+EGLSY S +E+   F ++DLA LR +
Sbjct  83    FIFTPLSDSHVQASVICSKQLKIHLRVRSGGHDYEGLSYVSKIETS--FFILDLANLRSV  140

Query  1376  KVD-VEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKY  1200
              VD + +N+ W+QAGAT GEVYYR+A+KSK  G+PAG C +LGIGGHITGGAYG+M+RKY
Sbjct  141   DVDQINNNTAWIQAGATIGEVYYRIAQKSKVHGYPAGLCTTLGIGGHITGGAYGSMMRKY  200

Query  1199  GLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtv  1020
             GL ADN LDA IVD  G +LDR AMGEDLFWAIRGGGG SFGI+L WKIKLVPVP TVTV
Sbjct  201   GLGADNVLDALIVDVNGEILDRKAMGEDLFWAIRGGGGASFGIILWWKIKLVPVPETVTV  260

Query  1019  ftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGK  840
             FTV +TLEQ ATKLL++WQ+V DKLDEDL ++VLI   +    K KRT+ TA+ A+FLG 
Sbjct  261   FTVSKTLEQGATKLLHRWQQVVDKLDEDLFIRVLIQPESVGKNKTKRTISTAYQALFLGD  320

Query  839   TDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKA  660
             T+RLL++M  SFPELGLT +DC +MSWI+SVIY A YP  TP E LL GK    K  FKA
Sbjct  321   TERLLQVMRKSFPELGLTRRDCAQMSWIQSVIYIAGYPSGTPNEVLLQGKT-SSKVSFKA  379

Query  659   KSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVY  480
             KS+F+R P+PE+ L G+WK FL+E+ P+ +W PYGGMM+KI ES  PFPHRKG I  I Y
Sbjct  380   KSDFVRNPIPETALEGIWKRFLEEENPITIWTPYGGMMSKIAESEIPFPHRKGTIFMIQY  439

Query  479   LTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
             LT+W ++G+K   KH++WI+++YDY   YVS+SPREAYVNYRDLDLG N+   +T F EA
Sbjct  440   LTAW-VDGDKSTTKHVNWIQKLYDYTAPYVSRSPREAYVNYRDLDLGTNRR-NSTGFIEA  497

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
               WGYKYFKGNF RLV VKT+VDP NFF HEQSIP LS
Sbjct  498   LAWGYKYFKGNFNRLVKVKTKVDPSNFFRHEQSIPPLS  535



>ref|XP_006377931.1| hypothetical protein POPTR_0011s16420g [Populus trichocarpa]
 gb|ERP55728.1| hypothetical protein POPTR_0011s16420g [Populus trichocarpa]
Length=534

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/519 (61%), Positives = 400/519 (77%), Gaps = 9/519 (2%)
 Frame = -2

Query  1745  SPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAP  1566
             +P+ VSL +Q +F KC+S +S +S PFST  ++   ++ +   +L ST QNL F +PS P
Sbjct  18    TPFVVSLHLQDRFLKCLSRNSESSFPFSTVLYAPNNSSFNS--ILLSTAQNLRFTLPSVP  75

Query  1565  KPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKL  1386
             KP LIFTPL ESH+QAAV+C+K+  + LRVRSGGHD+EGLSY S++E P  ++++DLAKL
Sbjct  76    KPELIFTPLKESHIQAAVICSKKLEIHLRVRSGGHDYEGLSYVSEIERP--YIIVDLAKL  133

Query  1385  RGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLR  1206
             R I VD+EDNS WVQ GATNGE+YYR++EKSK  GFPAG C SLG+GGHI+GGAYGAMLR
Sbjct  134   RSISVDIEDNSAWVQVGATNGELYYRISEKSKTHGFPAGTCSSLGMGGHISGGAYGAMLR  193

Query  1205  KYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatv  1026
             KYGL ADN +DA I+D  GR+LDR +MGEDLFWAIRGG GGSFGI+ AWK+KLV VP+TV
Sbjct  194   KYGLGADNVVDAHIIDVHGRLLDRKSMGEDLFWAIRGGAGGSFGIVTAWKVKLVSVPSTV  253

Query  1025  tvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFL  846
             TVFTV +TLEQ ATK+LY+WQ++ADKLDEDL ++VLI   N+T+ +GKRT+ T+++A+FL
Sbjct  254   TVFTVTKTLEQGATKILYRWQEIADKLDEDLFIRVLIQTANATS-QGKRTIATSYNALFL  312

Query  845   GKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFF  666
             G   RLL+IM+HSFPELGL  +DC+E  WI S +Y A +P  TPPE LL  + +  K FF
Sbjct  313   GDATRLLQIMHHSFPELGLARQDCIETDWINSTVYLAFFPNNTPPEVLLQRRNIV-KLFF  371

Query  665   KAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKI  486
             KAKS++ + P+PE+ L GLW I L+E+ P + + PYGG M++I ES  PFPHRKG+   I
Sbjct  372   KAKSDYAKEPLPETALEGLWDIILEEELPTVAFTPYGGKMSEISESQIPFPHRKGIRFMI  431

Query  485   VYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSE  309
             +Y  +W+   E   KH+DW R++Y YM  YVSK PRE YVNYRDLDLG+NK   NTSF+E
Sbjct  432   LYSANWQDAKENVAKHVDWTRKVYKYMQPYVSKHPRETYVNYRDLDLGINKR-TNTSFTE  490

Query  308   ASV-WGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             A   WG KYFK NF RL  VK +VDPD+FFWHEQSIP L
Sbjct  491   AGTSWGLKYFKNNFHRLAFVKAKVDPDDFFWHEQSIPPL  529



>emb|CDY69093.1| BnaCnng61850D [Brassica napus]
Length=535

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/529 (60%), Positives = 398/529 (75%), Gaps = 15/529 (3%)
 Frame = -2

Query  1781  IILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQST  1602
             +I ++ F+  T +P   S S+Q QF  C+  ++H S P  + FF+   N S F+ VLQST
Sbjct  14    LIFALYFSLYTITPTTSSASLQDQFINCLHKNTHVSFPLESTFFAPAKNVSMFSEVLQST  73

Query  1601  VQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMES  1422
              QNL +L  S PKP  IF PL ESHVQA+++C+K+ G  +RVRSGGHD+EGLSY S++E 
Sbjct  74    AQNLRYLTQSMPKPGFIFKPLHESHVQASIICSKKLGTHVRVRSGGHDYEGLSYVSEIEK  133

Query  1421  PAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigg  1242
             P  F+V+DL+KLR + ++++DNS WVQAGAT GE+YYR+AEKS+  GFPAG C SLGIGG
Sbjct  134   P--FIVMDLSKLRKVNINIKDNSAWVQAGATVGELYYRIAEKSRVHGFPAGLCSSLGIGG  191

Query  1241  hitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLA  1062
             HITGGAYG+M+RKYGL ADN LDA+IVDA G++LDR AMGED FWAIRGG GGSFGI+L 
Sbjct  192   HITGGAYGSMMRKYGLGADNVLDAKIVDANGKILDRKAMGEDTFWAIRGGAGGSFGIILE  251

Query  1061  WKIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAVNSTAVKG  885
             WKIKLVPVP TVTVFTV +TL+Q+   K+L KWQ VADKL ++L     I  + +TA   
Sbjct  252   WKIKLVPVPKTVTVFTVTKTLQQDPGNKILSKWQMVADKLVDELF----IRVIFNTAT--  305

Query  884   KRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEF  705
                  T+++AVFLG    L+K+MN SFPELGLTPKDC EMSW+ES++Y + +   TP + 
Sbjct  306   -----TSYNAVFLGNKGVLMKVMNKSFPELGLTPKDCTEMSWLESIVYISGFASRTPTKV  360

Query  704   LLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESA  525
             LL GK  FPK  FKAKS+F++ P+PESGL+G++K  LKED P+M+WNPYGGMMAKIPES 
Sbjct  361   LLQGKSAFPKNNFKAKSDFVKKPIPESGLKGIFKKLLKEDNPMMIWNPYGGMMAKIPESQ  420

Query  524   TPFPHRKGVICKIVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
              PFPHRKGVI KI Y+T+W     +  +H+ WIR +Y +M  YVS +PR+AYVNYRDLDL
Sbjct  421   IPFPHRKGVIFKIQYVTNWPDSDRRASRHIKWIRDLYSFMTPYVSANPRQAYVNYRDLDL  480

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             G NK G  ++ ++A VWG  YFK NF+RLV VKT+VDP+N F HEQSIP
Sbjct  481   GQNKKGCKSTINQAQVWGASYFKDNFKRLVKVKTKVDPNNVFRHEQSIP  529



>ref|XP_004295434.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Fragaria 
vesca subsp. vesca]
Length=543

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/506 (61%), Positives = 387/506 (76%), Gaps = 7/506 (1%)
 Frame = -2

Query  1709  FYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPLTES  1530
             F +C+S HS  SI  S +    T N S+F ++LQST +NL ++VPSAPKP  IFTP  +S
Sbjct  35    FSQCLSYHSKVSI--SFSSTIFTPNNSAFTTILQSTAENLRYVVPSAPKPEFIFTPTHDS  92

Query  1529  HVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVEDNSV  1350
             HVQ AV+C+K+ G+ LRVRSGGHD+EGLSY S++E+P  F+V+DLAKLR + VD++ NS 
Sbjct  93    HVQTAVICSKQLGIHLRVRSGGHDYEGLSYVSEIETP--FIVLDLAKLRSVNVDIQQNSA  150

Query  1349  WVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNALDA  1170
             W+QAGAT GEVYYR+AE+S   GFPAG C SLG+GGHITGGAYG+M+RKYGL  DNA+DA
Sbjct  151   WIQAGATIGEVYYRIAEQSATHGFPAGLCTSLGVGGHITGGAYGSMMRKYGLGVDNAVDA  210

Query  1169  RIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTLEQN  990
             +IVD  GR+LDR  MGEDLFWAIRGGGG SFGI+L WKIKLVPVP+TVTVFTV RTLEQ+
Sbjct  211   QIVDVDGRILDRETMGEDLFWAIRGGGGASFGIILWWKIKLVPVPSTVTVFTVARTLEQD  270

Query  989   ATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNH  810
              TKLL++WQ+VA    ++ L   +I  + S +  GKRTV T + A FLG  +RLL +M  
Sbjct  271   GTKLLHRWQQVAATELDEDLFIRVIIQLTSDSKSGKRTVTTLYQAQFLGGVERLLYVMQT  330

Query  809   SFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVP  630
              FPELGLT KDC E SWI+SV+Y A YP  T PE LL GK    +++FKAKS+F++ P+P
Sbjct  331   GFPELGLTRKDCTETSWIKSVMYIANYPNGTQPEILLQGKST-TRSYFKAKSDFVKDPIP  389

Query  629   ESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKIEGEK  450
             E+GL GL K  ++E  PV++W PYGGMM+KI ES TPFPHRKGV+ KI YLT W+   + 
Sbjct  390   ETGLEGLRKRLMEETNPVLIWTPYGGMMSKISESDTPFPHRKGVLFKIQYLTIWQAANQD  449

Query  449   K-KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGN  273
             + KH+DWIR++Y+YM  YV+  PR+AYVNYRDLDLG+NK   N SF EAS WGY+YFK N
Sbjct  450   EAKHMDWIRKLYNYMAPYVTMFPRQAYVNYRDLDLGINKKS-NLSFIEASSWGYRYFKDN  508

Query  272   FERLVAVKTRVDPDNFFWHEQSIPVL  195
             F RL+ +KT+VDP NFF HEQSI  L
Sbjct  509   FNRLIKIKTKVDPYNFFRHEQSITPL  534



>ref|XP_011006000.1| PREDICTED: cannabidiolic acid synthase-like 2 [Populus euphratica]
Length=533

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/529 (62%), Positives = 400/529 (76%), Gaps = 9/529 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             ILSI F  L  SP  VSL IQ +F KC+S +S TS PFST  ++   ++ +   VLQS  
Sbjct  8     ILSI-FVALLLSPLIVSLPIQDRFLKCLSKYSDTSFPFSTVLYTPQNSSFTS--VLQSYA  64

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL F +PS PKP  IFTPL ESH+QA V+C+K+  + LRVRSGGHDFEGLSY S+++ P
Sbjct  65    QNLRFTLPSVPKPEFIFTPLQESHIQAVVICSKQLEIHLRVRSGGHDFEGLSYVSEIDKP  124

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DLAKLR I VD+EDNS WVQ GATNGE+YYR++EKSK  GFPAG C SLG+GGH
Sbjct  125   --FIVVDLAKLRSISVDIEDNSAWVQVGATNGELYYRISEKSKTHGFPAGTCSSLGMGGH  182

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             I+GGAYGAMLRKYGL ADN +DA I+D  GR+LDR +MGEDLFWAIRGG GGSFGI+ AW
Sbjct  183   ISGGAYGAMLRKYGLGADNVVDAHIIDVHGRLLDRKSMGEDLFWAIRGGAGGSFGIVTAW  242

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLV VP+TVTVFTV +TLEQ ATK+LY+WQ++ADKLDEDL ++VLI   N T+  GKR
Sbjct  243   KLKLVSVPSTVTVFTVTKTLEQGATKILYRWQEIADKLDEDLFIRVLIQTANVTS-PGKR  301

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             T+ T+++++FLG   +LL+IM  SFPELGLT KDC+E +WI S ++ AL    TPPE  L
Sbjct  302   TIATSYNSLFLGDASKLLQIMQRSFPELGLTRKDCIETNWINSTVFMALLQNNTPPEVFL  361

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
                 L  + +FKAKS++ + PV E  L GLW+   +E+ P++V+ PYGGMM++I ES TP
Sbjct  362   QRTDL-NRWYFKAKSDYAKKPVSEKALEGLWEKLFEEENPLIVFTPYGGMMSQISESQTP  420

Query  518   FPHRKGVICKIVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGM  342
             FPHRKG    I+Y T W+   E   KH+DW R +Y+YM  YVSK+PREAYVNYRDLDLGM
Sbjct  421   FPHRKGTKFMILYYTGWQDAKENVAKHIDWTRMVYNYMTPYVSKNPREAYVNYRDLDLGM  480

Query  341   NKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             N N  NTSF EASV+G KYFK NF RLV  KT VDPDNFF HEQSIP L
Sbjct  481   N-NDSNTSFVEASVFGTKYFKDNFYRLVHAKTEVDPDNFFRHEQSIPPL  528



>ref|XP_006307230.1| hypothetical protein CARUB_v10008835mg [Capsella rubella]
 gb|EOA40128.1| hypothetical protein CARUB_v10008835mg [Capsella rubella]
Length=527

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/516 (62%), Positives = 396/516 (77%), Gaps = 10/516 (2%)
 Frame = -2

Query  1742  PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPK  1563
             P++ S ++Q  F  C+  +S  S P  ++FF+   NASSF + L+++ QNL +L+PS PK
Sbjct  18    PFSFS-NVQQDFVMCLVDNSDASFPMDSSFFTHDLNASSFKAALETSAQNLRYLMPSQPK  76

Query  1562  PLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLR  1383
             P  IF PL E+HVQAAVVC K+  + LR+RSGGHD+EGLSY S+ME+   FV++DL+KLR
Sbjct  77    PEFIFEPLYETHVQAAVVCAKKLKLHLRLRSGGHDYEGLSYVSEMETA--FVIVDLSKLR  134

Query  1382  GIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRK  1203
              I VD+E NS WV AGA+ GEVYYR+ EKSK  GFPAG C SLGIGGHI GGAYG+M+RK
Sbjct  135   QISVDLESNSAWVHAGASIGEVYYRIQEKSKIHGFPAGLCTSLGIGGHIIGGAYGSMMRK  194

Query  1202  YGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvt  1023
             YGL ADN LDARIVDA G++L+RAAMGED+FWAIRGGGGGSFG++LAWKIKLVPVP  VT
Sbjct  195   YGLGADNVLDARIVDAEGKILNRAAMGEDVFWAIRGGGGGSFGVILAWKIKLVPVPEIVT  254

Query  1022  vftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLG  843
             VFTV R LEQ+ TKLLYKWQ+VADKLDEDL ++V+I   + T    +RT+ T++   FLG
Sbjct  255   VFTVTRMLEQDGTKLLYKWQQVADKLDEDLFIRVIIQPASKTPKSKERTISTSYQGQFLG  314

Query  842   KTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFK  663
              +DRLL++M  SFP+LGLT KDCLE SWI+SV+Y A +P T P E LL GK LF K +FK
Sbjct  315   DSDRLLQVMQRSFPQLGLTKKDCLETSWIKSVMYIAGFPSTAPSEALLDGKSLF-KNYFK  373

Query  662   AKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             AKS+++  P+P  GL GLW+ FL+ED+P+ +WNPYGGMMAKIPE+ TPFPHR G + KI 
Sbjct  374   AKSDYVEEPIPVEGLEGLWEKFLEEDSPLTIWNPYGGMMAKIPETETPFPHRSGTLFKIQ  433

Query  482   YLTSWKI-EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
             +LT W+  +  + KH+ W+R MY YM  YVSKSPR AYVNYRDLDLGMN  G     S+A
Sbjct  434   WLTLWQDGKASEAKHMGWMREMYSYMEQYVSKSPRAAYVNYRDLDLGMNGKG-----SDA  488

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
               WG KYFKGNFERLV +K + DP+NFF HEQSIP 
Sbjct  489   REWGSKYFKGNFERLVKIKAKFDPENFFRHEQSIPT  524



>ref|XP_004233152.2| PREDICTED: tetrahydrocannabinolic acid synthase-like [Solanum 
lycopersicum]
Length=531

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/511 (63%), Positives = 402/511 (79%), Gaps = 10/511 (2%)
 Frame = -2

Query  1724  SIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFT  1545
             +I  +FY+C+  +S  S PFS+AF++    + +   +L ST QNL  L+PS PKP LIFT
Sbjct  27    TIPEKFYQCICKNSDFSDPFSSAFYTPNDASFNT--ILNSTAQNLRCLMPSVPKPDLIFT  84

Query  1544  PLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDV  1365
             P+TE HVQA+V+C K+  +QLRVRSGGHD+EG+SY S+M    PFV++DL KLRGI V+ 
Sbjct  85    PITEPHVQASVICAKKLNLQLRVRSGGHDYEGISYISEMG--FPFVIVDLLKLRGIDVNT  142

Query  1364  EDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAAD  1185
             E+NS W QAGAT GEVYYR++EKSK LGFPAG C SLGIGGHITGGAYG+M+RK+GL  D
Sbjct  143   EENSAWAQAGATVGEVYYRISEKSKTLGFPAGLCTSLGIGGHITGGAYGSMMRKFGLGVD  202

Query  1184  NALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPR  1005
             N +DARIV+A G +LDR +MGEDLFWAIRGGGG SFGI+L+WK+KLV VP+ VTVFTV +
Sbjct  203   NVIDARIVNANGTILDRQSMGEDLFWAIRGGGGASFGIILSWKMKLVTVPSVVTVFTVSK  262

Query  1004  TLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLL  825
             TLE  ATK+LYKWQ+VADK+D+ L ++V+I  V+    KG+RTVQTA++++FLG  + LL
Sbjct  263   TLEDGATKVLYKWQQVADKIDDRLFMRVVINVVDKKQAKGERTVQTAYNSLFLGNGETLL  322

Query  824   KIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFL  645
             +I N SFPELGLT KD  EMSWIES++Y   Y   TPPE LL GKP F K +FKAKS+F+
Sbjct  323   RITNESFPELGLTQKDVTEMSWIESILYIVGYANNTPPEVLLQGKPQF-KNYFKAKSDFV  381

Query  644   RTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWK  465
             + P+PE+GL GLW++ L+ED+P+M+WNPYGGMMA I ES TPFPHRKGVI KI YLT W 
Sbjct  382   KVPIPETGLEGLWELLLEEDSPLMIWNPYGGMMANISESDTPFPHRKGVIFKIQYLTLWN  441

Query  464   IEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGY  291
                E+   KH+ W+R++Y+YM +Y S  PREAYVNYRDLDLGMN    N+SF++ASVWG 
Sbjct  442   QPNEELATKHVHWMRKLYNYMTSYASMYPREAYVNYRDLDLGMNG---NSSFAQASVWGN  498

Query  290   KYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             KYFK NF RLV +KT VDP+NFF HEQSIPV
Sbjct  499   KYFKNNFHRLVQIKTVVDPENFFKHEQSIPV  529



>ref|XP_007158990.1| hypothetical protein PHAVU_002G198800g [Phaseolus vulgaris]
 gb|ESW30984.1| hypothetical protein PHAVU_002G198800g [Phaseolus vulgaris]
Length=533

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/531 (62%), Positives = 404/531 (76%), Gaps = 18/531 (3%)
 Frame = -2

Query  1781  IILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQST  1602
             ++LSI  T         S+ I+  F  C++LHS T      +    T+  +SF S+L+ST
Sbjct  13    VLLSISLT--------TSVPIEEAFNHCLTLHSQTH--NQFSSSIYTSTNASFTSILEST  62

Query  1601  VQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMES  1422
              QNL +L+PS PKP  IFT L +S VQAAV+C K+  + +RVRSGGHD+EGLSY S +E 
Sbjct  63    AQNLRYLLPSVPKPDFIFTALDDSQVQAAVLCAKQLRIHMRVRSGGHDYEGLSYASLIEK  122

Query  1421  PAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigg  1242
             P  F+V+DLAK+R + VD+E N+ W+QAGAT GEVYYR++EKS   GFPAG C +LGIGG
Sbjct  123   P--FMVLDLAKIRAVNVDIEHNTAWIQAGATIGEVYYRISEKSSVHGFPAGLCTTLGIGG  180

Query  1241  hitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLA  1062
             HITGGAYG+M+RKYGL  D+ LDA+IVDA GRVLDRAAMGEDLFWAIRGGGGGSFG++L 
Sbjct  181   HITGGAYGSMMRKYGLGVDHVLDAKIVDANGRVLDRAAMGEDLFWAIRGGGGGSFGVILW  240

Query  1061  WKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             WKIKLVPVP TVTVFTV +TLEQ   KLL++WQ+VA K+DEDL ++V+I   NS+ V GK
Sbjct  241   WKIKLVPVPQTVTVFTVTKTLEQGGNKLLHRWQRVAPKIDEDLFIRVIIQPGNSS-VPGK  299

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             RTV T+++A+FLG  DRLL++M H FPELGLT KDC+E SWI+SV+Y A YP  + PE L
Sbjct  300   RTVTTSYNALFLGGADRLLRVMKHGFPELGLTRKDCVETSWIKSVLYIAGYPDGSAPEVL  359

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK    K  FKAKS+F+R  +PE  L  LW+IFL+ED P+M+WNPYGGMM++I ESAT
Sbjct  360   LQGKST-TKAHFKAKSDFVREVIPEKSLNSLWEIFLQEDGPLMIWNPYGGMMSRIAESAT  418

Query  521   PFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
             PFPHRKGV+ KI Y+T W I+GEK   KH++W+R+ Y Y   YVSK PRE YVNYRDLD+
Sbjct  419   PFPHRKGVLYKIQYVTGW-IDGEKSMAKHMNWMRKFYFYTAPYVSKYPRETYVNYRDLDI  477

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             GMN+   NTSF +A  WGY+YFKGNF RLV VKT+VDP NFF HEQSIP L
Sbjct  478   GMNQK-NNTSFFQAFSWGYRYFKGNFNRLVKVKTKVDPSNFFRHEQSIPPL  527



>gb|KDO52569.1| hypothetical protein CISIN_1g043814mg, partial [Citrus sinensis]
Length=524

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/512 (63%), Positives = 397/512 (78%), Gaps = 10/512 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S+S+   F KC++++S   IPFS  +    ++  S   VL+S+ QNL +LVPS PKP  I
Sbjct  10    SISVLDNFIKCLTINSEVYIPFSNFYTPNNSSFLS---VLESSAQNLRYLVPSMPKPEFI  66

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPL ESHV+AAV+C+++  + LR+RSGGHD+EGLSY S +E+P  F ++DLAKLR I+V
Sbjct  67    FTPLNESHVRAAVICSRDLRIHLRIRSGGHDYEGLSYVSQIETP--FFLLDLAKLRSIEV  124

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+ DN+ WVQAGAT GE+YYR+AEKS   GF AG C S+G GGHITGG YG M+RKYGL 
Sbjct  125   DINDNTAWVQAGATIGELYYRIAEKSNTQGFTAGLCPSVGSGGHITGGGYGTMMRKYGLG  184

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DARIVDA+GR+LDR AMGEDLFWAIRGGGGGSFGI+LAWK+KLVPVPATVTVFTV
Sbjct  185   ADNVVDARIVDASGRILDREAMGEDLFWAIRGGGGGSFGIILAWKVKLVPVPATVTVFTV  244

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ ATK+LYKWQ+VADKLDEDL ++V+I   N+   KGK+TV T+++A+FLG ++R
Sbjct  245   SKTLEQGATKILYKWQQVADKLDEDLFIRVIIQLANA-GPKGKKTVTTSYNALFLGDSER  303

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL++++  FPELGLT  DC+E SWI SV+Y A YP  T PE LL  + L  K +FKAK +
Sbjct  304   LLQVIHKRFPELGLTRNDCIETSWIRSVLYFAGYPNNTEPEILLDVQSL-GKNYFKAKLD  362

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F++ PVPE+ L GLWK+ L+ED P+++WNPYGG+M+KI ES   FPHRKG I  I Y+ +
Sbjct  363   FVQEPVPETVLEGLWKMVLEEDIPIILWNPYGGIMSKISESEIAFPHRKGNIFTIQYMNA  422

Query  470   WKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             WK   EK   KH+ WIRR+YDYM  YVS  PR AYVNYRDLDLG+NK   NTS++EAS W
Sbjct  423   WKDGDEKNGTKHIGWIRRLYDYMAPYVSMFPRAAYVNYRDLDLGINKK-FNTSYTEASAW  481

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             G KYFK NF RLV VK +VDPDN F HEQSIP
Sbjct  482   GTKYFKDNFNRLVRVKIKVDPDNIFRHEQSIP  513



>ref|XP_006398053.1| hypothetical protein EUTSA_v10000843mg [Eutrema salsugineum]
 ref|XP_006398054.1| hypothetical protein EUTSA_v10000843mg [Eutrema salsugineum]
 gb|ESQ39506.1| hypothetical protein EUTSA_v10000843mg [Eutrema salsugineum]
 gb|ESQ39507.1| hypothetical protein EUTSA_v10000843mg [Eutrema salsugineum]
Length=542

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/530 (59%), Positives = 400/530 (75%), Gaps = 8/530 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             IL++ F+  T +P + S S+Q QF  C+  ++H   P    FF+   N S F+ VL+ST 
Sbjct  15    ILALFFSLYTITPTS-SASLQDQFINCLHRNTHVYFPLENTFFAPAKNVSMFSQVLESTA  73

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL FL  S PKP  IF PL ES VQA+++C+K+ G+  RVRSGGHD+EGLSY S+ME P
Sbjct  74    QNLRFLTKSMPKPGFIFKPLDESQVQASIICSKKLGIHFRVRSGGHDYEGLSYVSEMERP  133

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DL+KLR I ++++DNS WVQAGAT GE+YY++AEKS+  GFPAG C SLGIGGH
Sbjct  134   --FIVMDLSKLRQININIKDNSAWVQAGATVGELYYKIAEKSRVHGFPAGLCSSLGIGGH  191

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             +TGGAYG+M+RKYGL ADN LDA+IVDA G+VL+R AMG+D FWAIRGG GGSFGI+LAW
Sbjct  192   LTGGAYGSMMRKYGLGADNVLDAKIVDANGKVLNRKAMGDDTFWAIRGGAGGSFGIILAW  251

Query  1058  KIKLvpvpatvtvftvPRTLEQNA-TKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             KIKLVPVP TVTVFTV +TL+Q+A  K+L KWQ VADKL ++L ++      N     G 
Sbjct  252   KIKLVPVPKTVTVFTVTKTLQQDAGNKILSKWQMVADKLVDELFIR---VIFNVAGNNGN  308

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             +T  T+++AVFLG    L+ +M  SFPELGLTPKDC+EMSW+ES++Y + +   TP   L
Sbjct  309   KTATTSYNAVFLGNKGALMNVMKKSFPELGLTPKDCIEMSWLESIVYISGFSSRTPTHVL  368

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK  FPK  FKAKS+F++ P+PESGL+G+++  LKED P+M+WNPYGGMMA+IPES  
Sbjct  369   LQGKSPFPKINFKAKSDFVKKPIPESGLKGIFQKLLKEDIPMMIWNPYGGMMARIPESQI  428

Query  521   PFPHRKGVICKIVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLG  345
             PFPHRKGVI KI Y+TSW    ++  +H++WIR +Y +M  YVS +PR++YVNYRDLDLG
Sbjct  429   PFPHRKGVIFKIQYVTSWPDSDKRPSRHINWIRDLYSFMTPYVSSNPRQSYVNYRDLDLG  488

Query  344   MNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              NK    +S  +A VWG KYFKGNF RL+ +K++VDP+NFF HEQSIP L
Sbjct  489   KNKKTAMSSIKQAQVWGAKYFKGNFNRLMKIKSKVDPENFFRHEQSIPPL  538



>ref|XP_007158992.1| hypothetical protein PHAVU_002G199000g [Phaseolus vulgaris]
 gb|ESW30986.1| hypothetical protein PHAVU_002G199000g [Phaseolus vulgaris]
Length=526

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/536 (61%), Positives = 405/536 (76%), Gaps = 19/536 (4%)
 Frame = -2

Query  1787  SPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQ  1608
             SPII   L   L     A S S Q  F +C+ L          A    T +  SF S+L 
Sbjct  3     SPIIPLSLLVLLLSVSMANSASFQESFVQCLHLTQ-----SEFASSIYTPSNPSFTSLLN  57

Query  1607  STVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDM  1428
             S+ QNL  LVPSAPKP LIFTP  +SHVQAAV+C+K+ G+   VRSGGHD+EG+SY S++
Sbjct  58    SSAQNLRLLVPSAPKPELIFTPSDDSHVQAAVICSKKLGIHFIVRSGGHDYEGVSYVSEI  117

Query  1427  ESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgi  1248
             ESP  F+++DL KLRGI VD++ N+ WVQAGATNGE+YYR+ EKS   GFPAG C SLGI
Sbjct  118   ESP--FIIVDLVKLRGINVDIKSNTAWVQAGATNGELYYRIYEKSSVHGFPAGLCTSLGI  175

Query  1247  gghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGIL  1068
             GGHITGGAYGAM+RK+GL  DN LDA+IVDA GR+LDR AMGEDLFWAIRGGGGGSFGIL
Sbjct  176   GGHITGGAYGAMMRKFGLGVDNVLDAKIVDANGRILDREAMGEDLFWAIRGGGGGSFGIL  235

Query  1067  LAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLIT---AVNST  897
             L WK+KLVPVP TVTVFTV ++LEQ ATK+L +WQ+VA  +DE+L ++V+I    A N+T
Sbjct  236   LWWKVKLVPVPPTVTVFTVTKSLEQGATKILQRWQEVAPYIDENLFIRVIIQPFRAGNNT  295

Query  896   AVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTT  717
                 +RT+ T+++A+FLG    LL++M  SFPELGLT KDCLE SWI+SV+Y A +P  T
Sbjct  296   ----QRTIITSYNALFLGGASTLLQVMKTSFPELGLTRKDCLETSWIKSVLYIAGFPSNT  351

Query  716   PPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKI  537
             PP+ LL GKP F K FFKAKS+F+R P+PE GL+GLW+  L ED P+M+WNPYGG M+++
Sbjct  352   PPQVLLKGKPTF-KNFFKAKSDFVREPIPEIGLQGLWQRLLIEDAPLMIWNPYGGRMSQV  410

Query  536   PESATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNY  363
              ES TPFPHR G + KI YL++W+ EG+K   KH+DWIR++Y YMG YVS SPREAYVNY
Sbjct  411   SESDTPFPHRNGTLYKIQYLSAWQ-EGDKNVAKHIDWIRKLYSYMGPYVSTSPREAYVNY  469

Query  362   RDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             RDLDLG+N    +T++ +AS WGY+YFK NFERLV VKT+VDP+N F HEQSIP L
Sbjct  470   RDLDLGVNTK-NSTNYIQASSWGYRYFKNNFERLVKVKTKVDPENVFRHEQSIPPL  524



>ref|XP_006490235.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Citrus 
sinensis]
Length=541

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/513 (63%), Positives = 398/513 (78%), Gaps = 12/513 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S+SI   F KC+++++   IPFS  +    ++  S   +L+S+ QNL +LVPS PKP  I
Sbjct  24    SISILDNFIKCLTINAEIYIPFSNFYTPNNSSFLS---ILESSAQNLRYLVPSMPKPEFI  80

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPL ESHV+AAV+C ++  + LR+RS GHD+EGLSY S +E+P  F ++DLAKLR I+V
Sbjct  81    FTPLNESHVRAAVICARDLRIHLRIRSRGHDYEGLSYVSQIETP--FFLLDLAKLRSIEV  138

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+ D + WVQAGAT GE+YYR++EKS   GF AG C S+GIGGHITGG YG M+RKYGLA
Sbjct  139   DINDKTAWVQAGATIGELYYRISEKSNIHGFAAGLCPSVGIGGHITGGGYGTMMRKYGLA  198

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DARIVDA GR+LDR AMGEDLFWAIRGGGGGSFGI+LAWK+KLVPVPATVTVFTV
Sbjct  199   ADNVVDARIVDARGRILDREAMGEDLFWAIRGGGGGSFGIILAWKVKLVPVPATVTVFTV  258

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ ATK+LYKWQ+VADKLDEDL ++V+I   N+   KGKRTV T+++A+FLG ++R
Sbjct  259   SKTLEQGATKILYKWQQVADKLDEDLFIRVIIKLANA-GPKGKRTVTTSYNALFLGDSER  317

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL++M+  FPELGLT  DC+E SWI SV+Y A +   T PE LL  + LF K +FKAKS+
Sbjct  318   LLQVMHMWFPELGLTRNDCIETSWIRSVLYIADFQNNTEPEILLEAESLF-KNYFKAKSD  376

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F++ P+PES L GLWK+ L+ED PVM+WNPYGGMM+KI E   PFPHRKG I KI YLT 
Sbjct  377   FVKEPIPESVLEGLWKMLLEEDNPVMIWNPYGGMMSKISEYEIPFPHRKGNIFKIQYLTL  436

Query  470   WKIEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASV  300
             WK +G++K   KH  WIRR+YDYM  Y S  PR AYVNYRDLDLG+NK   NTS++EAS 
Sbjct  437   WK-DGDQKNATKHNGWIRRLYDYMAPYASIFPRAAYVNYRDLDLGLNKKF-NTSYTEASA  494

Query  299   WGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             WG KYFK NF RLV VK +VDPDN F HEQSIP
Sbjct  495   WGTKYFKDNFNRLVRVKIKVDPDNIFRHEQSIP  527



>ref|XP_008225655.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Prunus 
mume]
Length=537

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/533 (62%), Positives = 413/533 (77%), Gaps = 14/533 (3%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSL---SIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQ  1608
             + S++F  L  + WA +    SIQ    KC+S +S TS+PFS AFF+  T+  +   VL+
Sbjct  8     VSSLVFFLLISASWAHARTPPSIQDNLIKCLSKYSQTSVPFSQAFFTPNTSTFTT--VLE  65

Query  1607  STVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDM  1428
             ST QNL +LVPS PKP  IFTP+ +SHVQAAV+C+K+  + LRVRSGGHD+EGLSY S +
Sbjct  66    STAQNLRYLVPSMPKPEFIFTPVHDSHVQAAVICSKKLQIHLRVRSGGHDYEGLSYVSQI  125

Query  1427  ESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgi  1248
             E+P  F+++DLAKLR + VD+++N+ W+QAGAT GEVYYR+AEKSK  GFPAG C SLG+
Sbjct  126   ETP--FIIVDLAKLRSVNVDIKNNAAWIQAGATIGEVYYRIAEKSKTHGFPAGLCTSLGV  183

Query  1247  gghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGIL  1068
             GGHITGGAYG+M+RKYGLAADNA+DARIVD  G++LDR AMGEDLFWAIRGGGG SFGI+
Sbjct  184   GGHITGGAYGSMMRKYGLAADNAIDARIVDVKGKILDRKAMGEDLFWAIRGGGGASFGII  243

Query  1067  LAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVK  888
             L WKIKLVPVPATVTVF V +TLE  ATKLL++WQ+VA  +DEDL ++V I   N T   
Sbjct  244   LWWKIKLVPVPATVTVFAVAKTLETGATKLLHRWQQVAPVIDEDLFIRVFIQLANGTKTG  303

Query  887   GKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPE  708
               +TV T + A+FLG  DRL++++  SFPELG+T KDC E SWI+SV++ A YP  TP E
Sbjct  304   -TKTVTTVYQALFLGGADRLVRVIQKSFPELGVTRKDCTETSWIKSVLFIAGYPSGTPTE  362

Query  707   FLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPES  528
              LL GK    K +FKAKS+F++ P+PE+GL+GLWK  LKE +P+M+  PYGGMM+KI ES
Sbjct  363   VLLQGKST-GKNYFKAKSDFVQNPIPETGLQGLWKRLLKEASPLMLLTPYGGMMSKISES  421

Query  527   ATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDL  354
             A PFPHR GV+ KI YL+ W+ EG+K   KH++WIR++Y YM  YV+ SPR+AYVNY+DL
Sbjct  422   AIPFPHR-GVLFKIQYLSGWQ-EGDKTEAKHMNWIRKLYSYMAPYVTMSPRQAYVNYKDL  479

Query  353   DLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             DLG+NK   NTSF EAS WGY+YFK NF RLV +KT+VDP+NFF HEQSIP L
Sbjct  480   DLGINKKS-NTSFIEASSWGYRYFKDNFNRLVKIKTKVDPNNFFRHEQSIPPL  531



>ref|XP_011013937.1| PREDICTED: tetrahydrocannabinolic acid synthase-like isoform 
X2 [Populus euphratica]
Length=533

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/517 (61%), Positives = 393/517 (76%), Gaps = 8/517 (2%)
 Frame = -2

Query  1742  PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPK  1563
             P+ VS ++Q +F KCVS +S +S   + +        SSF SVLQS+ QNL F +PS PK
Sbjct  19    PFIVSHALQDRFLKCVSRNSESSF--TFSTVLYIPKNSSFTSVLQSSAQNLRFTLPSVPK  76

Query  1562  PLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLR  1383
             P  IFTPL ESH+QA V+C+K+ G+ LRVRSGGHDFEGLSY S++E+P  F+V+DLAKLR
Sbjct  77    PEFIFTPLQESHIQAVVICSKKLGIHLRVRSGGHDFEGLSYVSEIETP--FIVVDLAKLR  134

Query  1382  GIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRK  1203
              I VD+E NS WVQ GATNGE+YYR++EKSK  GFP+G C S+ +GG I+GG YGAMLRK
Sbjct  135   SISVDIEHNSAWVQVGATNGELYYRISEKSKTHGFPSGTCPSVCMGGLISGGGYGAMLRK  194

Query  1202  YGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvt  1023
             YGLAADN +DA I+D  GR+LDR AMGEDLFWAIRGG GGSFGI+ AWK+KLV VP+TVT
Sbjct  195   YGLAADNVVDAHIIDVHGRLLDRKAMGEDLFWAIRGGAGGSFGIVTAWKLKLVSVPSTVT  254

Query  1022  vftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLG  843
             VFTV +TLEQ ATK+LY+WQ++ADKLDEDL ++V+I   N T+ +GKRT+ T+++++FLG
Sbjct  255   VFTVTKTLEQGATKILYRWQEIADKLDEDLFIRVVIQTANVTS-QGKRTIATSYNSLFLG  313

Query  842   KTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFK  663
                +LL+IM  SFPELGLT KDC+E +WI S ++ AL    TPPE  L    L  + +FK
Sbjct  314   DASKLLQIMQRSFPELGLTRKDCIETNWINSTVFMALLQNNTPPEVFLQRTDL-NRWYFK  372

Query  662   AKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             AKS++ + P+PE  L GLW+   +E+ P++V+ PYGGMM++I ES TPFPHRKG    I+
Sbjct  373   AKSDYAKKPIPEKALEGLWEKLFEEENPLIVFTPYGGMMSQISESQTPFPHRKGTKFMIL  432

Query  482   YLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
             Y T W+   E   KH+DW R +Y+YM  YVSK+PREAYVNYRDLDLGMN N  NTSF EA
Sbjct  433   YYTGWQDAKENVAKHIDWTRMVYNYMTPYVSKNPREAYVNYRDLDLGMN-NDSNTSFVEA  491

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             SV+G KYFK NF RLV  KT VDPDNFF HEQSIP L
Sbjct  492   SVFGTKYFKDNFYRLVHAKTEVDPDNFFRHEQSIPPL  528



>gb|KFK36380.1| hypothetical protein AALP_AA4G116000 [Arabis alpina]
Length=535

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/534 (59%), Positives = 399/534 (75%), Gaps = 12/534 (2%)
 Frame = -2

Query  1790  SSPIILSILFTFLTFS---PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfn  1620
             S P  ++ L T L      P + S ++Q  F KC+  +S  S P +++FFS   NA+ F 
Sbjct  6     SKPNAIAFLITLLVAVVSVPLSSSTTLQQDFVKCLVDNSDVSFPITSSFFSPDQNATLFK  65

Query  1619  SVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSY  1440
               L+ST QNL +L PS PKP+ IF PL E+HVQAAVVC K+  +++ VRSGGHD+EGLS+
Sbjct  66    EELESTAQNLRYLTPSNPKPVFIFEPLYETHVQAAVVCAKKLQLRMLVRSGGHDYEGLSF  125

Query  1439  TSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCV  1260
              ++ E+P  FV++DL+KLR I V ++ NS W  AGAT GEVYYR+ EKS+  GFPAG C 
Sbjct  126   VAENETP--FVIVDLSKLRQIDVYLDSNSAWAHAGATIGEVYYRIQEKSQTHGFPAGLCS  183

Query  1259  SLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGS  1080
             SLGIGGH+ GGAYG+M+RK+GL  DN LDARIVDA G++LDRAAMGED+FWAIRGGGGGS
Sbjct  184   SLGIGGHLVGGAYGSMMRKFGLGGDNVLDARIVDANGKILDRAAMGEDIFWAIRGGGGGS  243

Query  1079  FGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNS  900
             FG++LAWKIKLV VP  VTVFTV +TLEQ+ TK+LYKWQ++ADKLD+DL ++V+I   + 
Sbjct  244   FGVILAWKIKLVTVPEIVTVFTVTKTLEQDGTKVLYKWQQIADKLDDDLFIRVIIQPASK  303

Query  899   TAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRT  720
             T   G RT+ T++ A FLG ++RLL++M  SFPELGLT KDC EMSWI+SV+Y A +P +
Sbjct  304   TTKTGSRTISTSYQAQFLGDSNRLLQVMQKSFPELGLTKKDCTEMSWIKSVMYIAGFPNS  363

Query  719   TPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAK  540
               PE LL GK LF K  FKAKS+F+R P+P  GL GLWK FL+ED+P+ +WNPYGGMM++
Sbjct  364   AAPEALLEGKSLF-KNHFKAKSDFVREPIPVEGLEGLWKRFLEEDSPLTIWNPYGGMMSR  422

Query  539   IPESATPFPHRKGVICKIVYLTSWKI-EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNY  363
             IPES  PFPHR G + KI +LT+W   +  + +H++WIR MY YM  YVSK+PR AYVNY
Sbjct  423   IPESEIPFPHRNGTLFKIQWLTTWSDGKASEARHMEWIREMYSYMEQYVSKNPRTAYVNY  482

Query  362   RDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             RDLDLG+N+       S+A  WG KYFKGNFERLV +K   DPDNFF HEQSIP
Sbjct  483   RDLDLGVNEGE-----SDAREWGSKYFKGNFERLVKIKAEFDPDNFFRHEQSIP  531



>ref|XP_006421539.1| hypothetical protein CICLE_v10007159mg [Citrus clementina]
 gb|ESR34779.1| hypothetical protein CICLE_v10007159mg [Citrus clementina]
Length=538

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/532 (61%), Positives = 403/532 (76%), Gaps = 10/532 (2%)
 Frame = -2

Query  1790  SSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVL  1611
             SS  I  ++   L  +    S+S+   F KC++++S   IPFS  +    ++  S   VL
Sbjct  4     SSKCIQGLISVLLLSASGTTSISVLDNFIKCLTINSEVYIPFSNFYTPNNSSFLS---VL  60

Query  1610  QSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSD  1431
             +S+ QNL +LVPS PKP  IFTPL ESHV+AAV+C+++  + LR+RSGGHD+EGLSY S 
Sbjct  61    ESSAQNLRYLVPSMPKPEFIFTPLNESHVRAAVICSRDLRIHLRIRSGGHDYEGLSYVSQ  120

Query  1430  MESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLg  1251
             +E+P  F ++DLAKLR I+VD+ D + WVQAGAT GE+YYR+AEKS   GF AG C S+G
Sbjct  121   IETP--FFLLDLAKLRSIEVDINDKTAWVQAGATIGELYYRIAEKSNTQGFTAGLCPSVG  178

Query  1250  igghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGI  1071
              GGHITGG YG M+RKYGLAADN +DARIVDA+GR+LDR AMGEDLFWAIRGGGGGSFGI
Sbjct  179   SGGHITGGGYGTMMRKYGLAADNVVDARIVDASGRILDREAMGEDLFWAIRGGGGGSFGI  238

Query  1070  LLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAV  891
             +LAWK+KLVPVPATVTVFTV + LEQ ATK+LYKWQ+VADKLDEDL ++V+I   N+   
Sbjct  239   ILAWKVKLVPVPATVTVFTVSKALEQGATKILYKWQQVADKLDEDLFIRVIIQLANA-GP  297

Query  890   KGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP  711
             KGK+TV T+++A+FLG ++RLL++++  FPELGLT  DC+E SWI SV+Y A YP  T P
Sbjct  298   KGKKTVTTSYNALFLGDSERLLQVIHKRFPELGLTRNDCIETSWIRSVLYFAGYPNNTEP  357

Query  710   EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPE  531
             E LL  + L  K +FKAK +F++ PVPE+ L GLWK+ L+ED P+++WNPYGG+M+KI E
Sbjct  358   EILLDVQSL-GKNYFKAKLDFVQEPVPETVLEGLWKMVLEEDIPIILWNPYGGIMSKISE  416

Query  530   SATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRD  357
             +   FPHRKG I  I Y+ +WK   EK   KH+ WIRR+YDYM  YVS  PR AYVNYRD
Sbjct  417   AEIAFPHRKGNIFTIQYMNAWKDGDEKNATKHIGWIRRLYDYMTPYVSMFPRAAYVNYRD  476

Query  356   LDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             LDLG+NK   NTS++EAS WG KYFK NF RLV VK +VDPDN F HEQSIP
Sbjct  477   LDLGINKK-FNTSYTEASAWGTKYFKDNFNRLVRVKIKVDPDNIFRHEQSIP  527



>ref|XP_011013936.1| PREDICTED: tetrahydrocannabinolic acid synthase-like isoform 
X1 [Populus euphratica]
Length=533

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/517 (61%), Positives = 393/517 (76%), Gaps = 8/517 (2%)
 Frame = -2

Query  1742  PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPK  1563
             P+ VS ++Q +F KCVS +S +S   + +        SSF SVLQS+ QNL F +PS PK
Sbjct  19    PFIVSHALQDRFLKCVSRNSESSF--TFSTVLYIPKNSSFTSVLQSSAQNLRFTLPSVPK  76

Query  1562  PLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLR  1383
             P  IFTPL ESH+QA V+C+K+ G+ LRVRSGGHDFEGLSY S++E+P  F+V+DLAKLR
Sbjct  77    PEFIFTPLQESHIQAVVICSKKLGIHLRVRSGGHDFEGLSYVSEIETP--FIVVDLAKLR  134

Query  1382  GIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRK  1203
              I VD+E NS WVQ GATNGE+YYR++EKSK  GFP+G C S+ +GG I+GG YGAMLRK
Sbjct  135   SISVDIEHNSAWVQVGATNGELYYRISEKSKTHGFPSGTCPSVCMGGLISGGGYGAMLRK  194

Query  1202  YGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvt  1023
             YGLAADN +DA I+D  GR+LDR AMGEDLFWAIRGG GGSFGI+ AWK+KLVPVP+ VT
Sbjct  195   YGLAADNVVDAHIIDVHGRLLDRKAMGEDLFWAIRGGAGGSFGIVTAWKVKLVPVPSXVT  254

Query  1022  vftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLG  843
             VFTV +TLEQ ATK+LY+WQ++ADKLDEDL ++V+I   N T+ +GKRT+ T+++++FLG
Sbjct  255   VFTVTKTLEQGATKILYRWQEIADKLDEDLFIRVVIQTANVTS-QGKRTIATSYNSLFLG  313

Query  842   KTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFK  663
                +LL+IM  SFPELGLT KDC+E +WI S ++ AL    TPPE  L    L  + +FK
Sbjct  314   DASKLLQIMQRSFPELGLTRKDCIETNWINSTVFMALLQNNTPPEVFLQRTDL-NRWYFK  372

Query  662   AKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             AKS++ + P+PE  L GLW+   +E+ P++V+ PYGGMM++I ES TPFPHRKG    I+
Sbjct  373   AKSDYAKKPIPEKALEGLWEKLFEEENPLIVFTPYGGMMSQISESQTPFPHRKGTKFMIL  432

Query  482   YLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
             Y T W+   E   KH+DW R +Y+YM  YVSK+PREAYVNYRDLDLGMN N  NTSF EA
Sbjct  433   YYTGWQDAKENVAKHIDWTRMVYNYMTPYVSKNPREAYVNYRDLDLGMN-NDSNTSFVEA  491

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             SV+G KYFK NF RLV  KT VDPDNFF HEQSIP L
Sbjct  492   SVFGTKYFKDNFYRLVHAKTEVDPDNFFRHEQSIPPL  528



>ref|XP_006421540.1| hypothetical protein CICLE_v10007008mg [Citrus clementina]
 gb|ESR34780.1| hypothetical protein CICLE_v10007008mg [Citrus clementina]
Length=541

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/513 (63%), Positives = 397/513 (77%), Gaps = 12/513 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S+SI   F KC+++++   IPFS  +    ++  S   +L+S+ QNL +LVPS PKP  I
Sbjct  24    SISILDNFIKCLTINAEIYIPFSNFYTPNNSSFLS---ILESSAQNLRYLVPSMPKPEFI  80

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPL ESHVQAAV+C ++  + LR+RS GHD+EGLSY S +E+P  F ++DLAKLR I+V
Sbjct  81    FTPLNESHVQAAVICARDLRIHLRIRSRGHDYEGLSYVSQIETP--FFLLDLAKLRSIEV  138

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+   + WVQAGAT GE+YYR++EKS   GF AG C S+GIGGH+TGG YG M+RKYGLA
Sbjct  139   DINSKTAWVQAGATIGELYYRISEKSNIHGFAAGLCPSVGIGGHVTGGGYGTMMRKYGLA  198

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DARIVDA GR+LDR AMGEDLFWAIRGGGGGSFGI+LAWK+KLVPVPATVTVFTV
Sbjct  199   ADNVVDARIVDARGRILDREAMGEDLFWAIRGGGGGSFGIILAWKVKLVPVPATVTVFTV  258

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ ATK+LYKWQ+VADKLDEDL ++V+I   N+   KGKRTV T+++A+FLG ++R
Sbjct  259   SKTLEQGATKILYKWQQVADKLDEDLFIRVIIKLANA-GPKGKRTVTTSYNALFLGDSER  317

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL++M+  FPELGLT  DC+E SWI SV+Y A +   T PE LL  + LF K +FKAKS+
Sbjct  318   LLQVMHMWFPELGLTRNDCIETSWIRSVLYIADFQNNTEPEILLEAEFLF-KNYFKAKSD  376

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F++ P+PES L GLWK+ L+ED PVM+WNPYGGMM+KI E   PFPHRKG I KI YLT 
Sbjct  377   FVKEPIPESVLEGLWKMLLEEDNPVMIWNPYGGMMSKISEYEIPFPHRKGNIFKIQYLTL  436

Query  470   WKIEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASV  300
             WK +G++K   KH  WIRR+YDYM  Y S  PR AYVNYRDLDLG+NK   NTS++EAS 
Sbjct  437   WK-DGDRKNATKHNGWIRRLYDYMAPYASIFPRAAYVNYRDLDLGLNKKF-NTSYTEASA  494

Query  299   WGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             WG KYFK NF RLV VK +VDPDN F HEQSIP
Sbjct  495   WGIKYFKDNFNRLVRVKIKVDPDNIFRHEQSIP  527



>ref|XP_004293697.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Fragaria 
vesca subsp. vesca]
Length=539

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/513 (61%), Positives = 390/513 (76%), Gaps = 13/513 (3%)
 Frame = -2

Query  1718  QHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPL  1539
             Q+ F +C+S HS  SIPFS+ FF+  ++A +   VL ST QNL +LVPS PKP  IFTP 
Sbjct  28    QNSFLQCLSYHSKASIPFSSTFFTPDSSAFTT--VLNSTAQNLRYLVPSKPKPEFIFTPT  85

Query  1538  TESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVED  1359
              +S VQ AV+C+K+ G+ LRVRSGGHD+EGLSY S +E+P  F+++DLAKLR + VD+  
Sbjct  86    HDSQVQYAVICSKQLGIHLRVRSGGHDYEGLSYVSQIETP--FIIVDLAKLRSVNVDIRA  143

Query  1358  NSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNA  1179
             NS W+QAGAT GEVYYR+A+KS+N GFPAG C SLG+GGHITGGAYG M+RKYGLAADN 
Sbjct  144   NSAWIQAGATIGEVYYRIAQKSRNHGFPAGLCTSLGVGGHITGGAYGTMMRKYGLAADNV  203

Query  1178  LDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTL  999
             LDARIVD  GR+L+R  MGEDLFWAIRGGGG SFG++L WKIKLVPVP+TVTVFTV +TL
Sbjct  204   LDARIVDVNGRILNRKTMGEDLFWAIRGGGGASFGVILWWKIKLVPVPSTVTVFTVAKTL  263

Query  998   EQNATKLLYKWQkvadkldedlllkvLI---TAVNSTAVKGKRTVQTAFDAVFLGKTDRL  828
             EQ ATKLL+ WQ+VA    +  L   ++   T ++S +  GKRTV T +   FLG   RL
Sbjct  264   EQGATKLLHIWQQVAATKLDKDLNIRVLIQPTVLDSKS--GKRTVTTLYQGQFLGGVKRL  321

Query  827   LKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEF  648
             L +M   FPEL LT KDC + SW+ SV+Y A Y   T PE LL GKP F K +FK+KS+F
Sbjct  322   LNVMQTGFPELNLTRKDCTQTSWLNSVMYIAGYATGTRPEVLLQGKPTF-KNYFKSKSDF  380

Query  647   LRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSW  468
             ++ P+PE+ L GLWK  L+E  P+++WNPYGGMM+KI ESA PFPHR  V+ KI YLT+W
Sbjct  381   VKDPIPETALEGLWKRLLEETAPLIIWNPYGGMMSKISESAIPFPHRN-VLFKIQYLTTW  439

Query  467   KIEGEKK-KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGY  291
             +   E + KH++WIR++Y YM  YV+KSPR+AYVNY+DLDLG+NK  +NTS +EAS WG 
Sbjct  440   QGANENEAKHINWIRKLYTYMAPYVTKSPRQAYVNYKDLDLGINKK-KNTSIAEASAWGN  498

Query  290   KYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             +YFKGNF RLV +KT+VDP NFF HEQSIP L+
Sbjct  499   RYFKGNFNRLVKIKTKVDPQNFFRHEQSIPPLA  531



>ref|XP_006377926.1| hypothetical protein POPTR_0011s16380g [Populus trichocarpa]
 gb|ERP55723.1| hypothetical protein POPTR_0011s16380g [Populus trichocarpa]
Length=545

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/514 (60%), Positives = 393/514 (76%), Gaps = 8/514 (2%)
 Frame = -2

Query  1733  VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLL  1554
             VS ++Q  F KC+S  S +S PFST  ++   ++ +   VLQS+ QNL F +P+ PKP  
Sbjct  22    VSHALQDSFLKCLSRTSESSFPFSTVLYTPKNSSFTS--VLQSSAQNLRFTLPAVPKPEF  79

Query  1553  IFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIK  1374
             IFTPL ESH+QA V+C+K+ G+ LRVRSGGHDFE LSY S++ESP  F+V+DLAK R I 
Sbjct  80    IFTPLQESHIQAVVICSKQLGIHLRVRSGGHDFEALSYVSEIESP--FIVVDLAKFRSIS  137

Query  1373  VDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGL  1194
             VD+E NS WVQAG+TNGE+YYR++EKSK  GFPAG C SLG+GGHI+GGAYGAMLRKYGL
Sbjct  138   VDIEHNSAWVQAGSTNGELYYRISEKSKIHGFPAGTCTSLGMGGHISGGAYGAMLRKYGL  197

Query  1193  AADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvft  1014
             A DN +DA I+D  GR+LDR AMGEDLFWAIRGG GGSFGI+ AWK+KLVPVP+ VTVFT
Sbjct  198   AVDNVVDAHIIDVHGRLLDRKAMGEDLFWAIRGGAGGSFGIVTAWKVKLVPVPSAVTVFT  257

Query  1013  vPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTD  834
             V +TLEQ ATKLLY+WQ++AD LDEDL ++V I   N ++ +GKRT+ T+++A+FLG  +
Sbjct  258   VTKTLEQGATKLLYRWQEIADHLDEDLFIRVQIRTANVSS-QGKRTITTSYNAMFLGDAN  316

Query  833   RLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKS  654
             RLL++M HSFPELGLT +DC+E +WI S +Y + +   TPPE LL  +    + +FK KS
Sbjct  317   RLLQVMKHSFPELGLTRQDCIETNWINSTVYMSGFANNTPPEVLLQ-RINMDRAYFKGKS  375

Query  653   EFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLT  474
             ++ R P+PE  L GLW+   + ++P++V+ PYGGMM +I ES TPFPHRKG    I+Y +
Sbjct  376   DYARKPIPEKALEGLWEKLFEAESPLVVFTPYGGMMNQISESQTPFPHRKGTKFMILYWS  435

Query  473   SWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             SW+   E   KH++W R++Y YM  YVSK+PREAY NYRDLDLGMN+N + TSF EAS +
Sbjct  436   SWQDATENVAKHINWTRKVYSYMTPYVSKNPREAYANYRDLDLGMNRNSK-TSFVEASAF  494

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             G  YFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  495   GTNYFKDNFNRLVHVKTKVDPDNFFRHEQSIPPL  528



>ref|XP_009354035.1| PREDICTED: inactive tetrahydrocannabinolic acid synthase-like 
[Pyrus x bretschneideri]
Length=534

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/529 (60%), Positives = 398/529 (75%), Gaps = 10/529 (2%)
 Frame = -2

Query  1775  LSILFTFLTFS-PWA-VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQST  1602
             +S L+ FL  S  WA    S Q  F +C+S +S+TSIPFS+ F +   ++ +   VL+S+
Sbjct  7     ISSLYLFLVLSTSWAHPPPSTQENFIQCLSHYSNTSIPFSSDFLTPKNSSFTA--VLESS  64

Query  1601  VQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMES  1422
              QNL +LV S PKP  IFTP+ +SHVQAAV+C K+  + LR RSGGHD+EGLSY S +E+
Sbjct  65    AQNLRYLVSSVPKPDFIFTPVHDSHVQAAVICAKKLRIHLRFRSGGHDYEGLSYVSQIET  124

Query  1421  PAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigg  1242
             P  F V+DLAKLR + VD++ N+ WVQAGAT GE+YYR+AEKS+  G+PAG C SLG+GG
Sbjct  125   P--FAVVDLAKLRSVSVDIKSNTAWVQAGATIGELYYRIAEKSQTHGYPAGICTSLGVGG  182

Query  1241  hitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLA  1062
             HITGGAYG+M+RKYGL ADNA+DARI+D+ G++LDR AMGEDLFWAIRGGGG SFGI+L 
Sbjct  183   HITGGAYGSMMRKYGLGADNAVDARIIDSNGKILDRKAMGEDLFWAIRGGGGASFGIILW  242

Query  1061  WKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             WKIKLVPVP  VTVF+V +TLEQ ATK L++WQ+VA  +DEDL ++V I   N +   G 
Sbjct  243   WKIKLVPVPQNVTVFSVVKTLEQGATKFLHRWQQVAPFVDEDLFIRVFIQVSNDSKT-GN  301

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
              T+ T + A FLG + RLL +M  SFPELGLT  DC E SWI+SV+Y A YP  TP E L
Sbjct  302   NTITTVYQAQFLGDSKRLLNVMQQSFPELGLTRNDCTETSWIKSVLYIAGYPSGTPTEIL  361

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK   PK +FKAKS+F++ P+PE  L GLWK  L+E +PVM+ NPYGGMM++I ESA 
Sbjct  362   LQGKATLPKIYFKAKSDFVKNPIPEIALEGLWKRLLQETSPVMLLNPYGGMMSRISESAI  421

Query  521   PFPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGM  342
             PFPHR  V+ KI YL +W+  G++ +H++WIR++Y YM  YV+  PR+AYVNYRDLDLG 
Sbjct  422   PFPHRN-VLFKIQYLAAWQ-AGDEAEHMEWIRKLYSYMAPYVTTFPRQAYVNYRDLDLGT  479

Query  341   NKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NK   +TSF EA+ WGY+YFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  480   NKKS-STSFIEANSWGYRYFKDNFNRLVKVKTKVDPDNFFRHEQSIPPL  527



>ref|XP_002317736.1| hypothetical protein POPTR_0012s01070g [Populus trichocarpa]
 gb|EEE95956.1| hypothetical protein POPTR_0012s01070g [Populus trichocarpa]
Length=534

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/526 (60%), Positives = 393/526 (75%), Gaps = 7/526 (1%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             I+S+L   L+F  + VSL IQ +F KC+SL+S +S PFST  ++   ++ +   VL ST 
Sbjct  8     IVSVLVILLSFPFFIVSLPIQDKFLKCLSLNSESSFPFSTILYTPNNSSFTN--VLLSTA  65

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL F +PS PKP  IFTPL ESHVQ AVVC+K+ GVQ+RVRSGGHDFEGLSYTS +++P
Sbjct  66    QNLRFALPSVPKPEFIFTPLQESHVQTAVVCSKQLGVQIRVRSGGHDFEGLSYTSVIDTP  125

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               FVV+DL KLR I VD++  S W QAGAT GE++YR++EKSKNLGFPAG C S+G+GGH
Sbjct  126   --FVVVDLGKLRSISVDIKRKSAWAQAGATVGELHYRISEKSKNLGFPAGACPSVGLGGH  183

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ++GG YG + RKYGL+ADN +DARIVD  GR+LDR AMGEDLFWAIRGGGG SFGI+ AW
Sbjct  184   LSGGGYGPLFRKYGLSADNVIDARIVDVQGRLLDRKAMGEDLFWAIRGGGGASFGIITAW  243

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLVPVP+TVTVF V R LEQ ATKLLY+WQ+VA+K D DL L V I    ++   GK+
Sbjct  244   KVKLVPVPSTVTVFRVFRFLEQGATKLLYRWQQVANKFDADLYLVVGIRPAIASDT-GKK  302

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV+T +  +FLG T RLL++M  SFPELGL  KDC+EM WI SV+Y A +P  + PE LL
Sbjct  303   TVRTIYSGLFLGDTSRLLEVMQKSFPELGLARKDCIEMDWIGSVLYEAFFPTNSTPEVLL  362

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
               K LFP  + K+KS+F ++P+ E+ L+GLWKIF +ED    +  PYGGMM KI +S  P
Sbjct  363   QRKNLFP-AYTKSKSDFAQSPISETALKGLWKIFFQEDKLATLLIPYGGMMDKISKSEIP  421

Query  518   FPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             FPHRK  +  + Y T+W    E    +DW R++Y+YM  YVSK+PREAY+N+RD+DLGM 
Sbjct  422   FPHRKSNLFMLEYATNWNDPSESATQIDWARKVYEYMTPYVSKNPREAYLNHRDIDLGMT  481

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             +   NTS  EA VWG KYFKGNF RLV VKTRVDP+NFF +EQSIP
Sbjct  482   EKA-NTSIEEARVWGAKYFKGNFNRLVKVKTRVDPENFFRYEQSIP  526



>ref|XP_006377930.1| hypothetical protein POPTR_0011s16410g [Populus trichocarpa]
 gb|ERP55727.1| hypothetical protein POPTR_0011s16410g [Populus trichocarpa]
Length=539

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/509 (62%), Positives = 393/509 (77%), Gaps = 8/509 (2%)
 Frame = -2

Query  1718  QHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPL  1539
             Q +F +C+S +S +SIPFST  +S   ++ +   +L+S+ QNL F +PS PKP  IFTPL
Sbjct  30    QDRFLQCLSRNSESSIPFSTVLYSPINSSFTA--ILRSSAQNLRFTLPSLPKPEFIFTPL  87

Query  1538  TESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVED  1359
              ESH+QAAV+C+K+ G+ LRVRSGGHD+EGLSY S  E+  PFVV+D+A+L  I VD+++
Sbjct  88    EESHIQAAVICSKQLGIHLRVRSGGHDYEGLSYVS--ETDTPFVVVDIAELHSISVDIDN  145

Query  1358  NSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNA  1179
             NS WVQAGATNGE+YYR+AE+S   G+PAG C SLGIGGHITGGAYG+M+RKYGLA DN 
Sbjct  146   NSAWVQAGATNGELYYRIAEQSTTHGYPAGTCTSLGIGGHITGGAYGSMMRKYGLAVDNV  205

Query  1178  LDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTL  999
             +DARI++  GRVLDR  MGEDL+WAIRGGGGGSFGI+ AWK+KLVPVP+TVT+FTV ++L
Sbjct  206   IDARIINVHGRVLDRQTMGEDLYWAIRGGGGGSFGIITAWKVKLVPVPSTVTIFTVTKSL  265

Query  998   EQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKI  819
             EQ ATKLL++WQ+VADKLDEDL ++V I  VN  + KG RT+ T++DA+FLG  +RLL++
Sbjct  266   EQGATKLLFRWQQVADKLDEDLFIRVNIQTVN-VSNKGGRTITTSYDALFLGDANRLLQV  324

Query  818   MNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRT  639
             M  SFPELGL  +DC+E SWI S +Y   Y   T PE LL  + +  K +FKAKS+F+R 
Sbjct  325   MRESFPELGLARQDCIETSWINSTVYLGGYTINTSPEVLLQRRNIL-KHYFKAKSDFVRQ  383

Query  638   PVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKIE  459
             P+PE+ L+GLW+I L+ED P +V  PYGG M KI ES TPFPHRKG +  I YL +W+  
Sbjct  384   PIPETALKGLWEIMLEEDNPAIVLTPYGGNMGKISESQTPFPHRKGTLFMIQYLANWQDA  443

Query  458   GEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYF  282
              E  +KH DW R +Y YM  YVS  PR+AYVNYRDLDLG+NK   NTSF EASVWG KYF
Sbjct  444   KENVRKHTDWTRMVYRYMKPYVSMFPRQAYVNYRDLDLGINKE-TNTSFPEASVWGTKYF  502

Query  281   KGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             K NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  503   KDNFYRLVRVKTKVDPDNFFRHEQSIPTL  531



>ref|XP_010460885.1| PREDICTED: reticuline oxidase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010460886.1| PREDICTED: reticuline oxidase-like protein isoform X2 [Camelina 
sativa]
Length=527

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/511 (62%), Positives = 392/511 (77%), Gaps = 11/511 (2%)
 Frame = -2

Query  1724  SIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFT  1545
             +IQ  F  C+  +S  S P  ++FF+   NASSF + L+++ QNL +L+PS PKP  IF 
Sbjct  23    TIQQDFVMCLVDNSDASFPMDSSFFTDELNASSFKAALETSAQNLRYLMPSNPKPEFIFE  82

Query  1544  PLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDV  1365
             PL E+HVQAAVVC K+  + LR+RSGGHD+EGLSY S+ME+   FV++DL+KLR I VD+
Sbjct  83    PLYETHVQAAVVCAKKLKLHLRLRSGGHDYEGLSYVSEMETA--FVIVDLSKLRQISVDL  140

Query  1364  EDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAAD  1185
             E NS WV AGA+ GEVYYR+ EKSK  GFPAG C SLGIGGHI GGAYG+M+RK+GL AD
Sbjct  141   ESNSAWVHAGASIGEVYYRIQEKSKIHGFPAGLCTSLGIGGHIIGGAYGSMMRKFGLGAD  200

Query  1184  NALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPR  1005
             N LDARIVDA G++L+RAAMGED+FWAIRGGGGGSFG++LAWKIKLVPVP  VTVFTV R
Sbjct  201   NVLDARIVDADGKILNRAAMGEDVFWAIRGGGGGSFGVILAWKIKLVPVPEIVTVFTVTR  260

Query  1004  TLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLL  825
             TLEQ+ TKLLYKWQ+VADKLDEDL ++V+I   + T    +RT+ T++   FLG  +RLL
Sbjct  261   TLEQDGTKLLYKWQQVADKLDEDLFIRVIIQPASKTPKSKERTISTSYQGQFLGDANRLL  320

Query  824   KIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFL  645
             ++M  SFP+LGLT KDCLE SWI+SV+Y A +P T P E LL GK LF K +FKAKS+++
Sbjct  321   QVMQRSFPQLGLTKKDCLETSWIKSVMYIAGFPSTAPSEALLDGKSLF-KNYFKAKSDYV  379

Query  644   RTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWK  465
               P+P  GL GLW+  L+ED+P+ +WNPYGGMMAKIPE+ TPFPHR G + KI +LT W+
Sbjct  380   EEPIPVEGLEGLWEKLLEEDSPLTIWNPYGGMMAKIPETETPFPHRSGTLFKIQWLTLWQ  439

Query  464   IEGE--KKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGY  291
              +G+  + KH+ W+R MY YM  YVSKSPR AYVNYRDLDLGMN  G      +A  WG 
Sbjct  440   -DGKVSEAKHMGWMREMYSYMEQYVSKSPRSAYVNYRDLDLGMNGKG-----GDAREWGS  493

Query  290   KYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             KYFKGNFERLV +K + DP+NFF HEQSIP 
Sbjct  494   KYFKGNFERLVNIKAKFDPENFFRHEQSIPT  524



>ref|NP_174363.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana]
 gb|AAL15318.1| At1g30760/T5I8_22 [Arabidopsis thaliana]
 gb|AAO42759.1| At1g30760/T5I8_22 [Arabidopsis thaliana]
 gb|AEE31270.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana]
Length=534

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/510 (62%), Positives = 390/510 (76%), Gaps = 9/510 (2%)
 Frame = -2

Query  1724  SIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFT  1545
             +IQ  F  C+  +S  S P  ++FF+   NASSF   L+++ QNL +L+PS PKP  IF 
Sbjct  30    TIQQDFVMCLVDNSDASFPMDSSFFTHDLNASSFKLALETSAQNLRYLMPSNPKPEFIFE  89

Query  1544  PLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDV  1365
             PL E+HVQAAV+C K+  + LR+RSGGHD+EGLSY S+ME+   FV++DL+KLR I VD+
Sbjct  90    PLYETHVQAAVLCAKKLKLHLRLRSGGHDYEGLSYVSEMETA--FVIVDLSKLRQISVDI  147

Query  1364  EDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAAD  1185
             E NS WV AGA+ GEVYYR+ EKSK  GFPAG C SLGIGGHI GGAYG+M+RK+GL AD
Sbjct  148   ESNSAWVHAGASIGEVYYRIQEKSKIHGFPAGLCTSLGIGGHIIGGAYGSMMRKFGLGAD  207

Query  1184  NALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPR  1005
             N LDARIVDA G++L+RAAMGED+FWAIRGGGGGSFG++LAWKIKLVPVP  VTVFTV R
Sbjct  208   NVLDARIVDADGKILNRAAMGEDVFWAIRGGGGGSFGVILAWKIKLVPVPEIVTVFTVTR  267

Query  1004  TLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLL  825
             TLEQ+ TKLLYKWQ+VADKLDEDL ++V+I   + T    +RT+ T++   FLG  +RLL
Sbjct  268   TLEQDGTKLLYKWQQVADKLDEDLFIRVIIQPTSKTPKSKERTISTSYQGQFLGDANRLL  327

Query  824   KIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFL  645
             ++M  SFP+LGLT KDCLE SWI+SV+Y A +P T P E LL GK LF K +FKAKS+++
Sbjct  328   QVMQRSFPQLGLTKKDCLETSWIKSVMYIAGFPSTAPSEALLDGKSLF-KNYFKAKSDYV  386

Query  644   RTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWK  465
               P+P  GL GLW+  L+ED+P+ +WNPYGGMMAKIPE+ TPFPHR G + KI +LT W+
Sbjct  387   EEPIPVEGLEGLWEKLLEEDSPLTIWNPYGGMMAKIPETETPFPHRSGTLFKIQWLTLWQ  446

Query  464   I-EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYK  288
               +  + KH+ W+R MY YM  YVSKSPR AYVNYRDLDLGMN  G     S+A  WG +
Sbjct  447   DGKTSEAKHMGWMREMYSYMEQYVSKSPRSAYVNYRDLDLGMNGKG-----SDAREWGNR  501

Query  287   YFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             YFKGNFERLV +K + DP+NFF HEQSIP 
Sbjct  502   YFKGNFERLVEIKAKFDPENFFRHEQSIPT  531



>ref|XP_002863581.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39840.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=540

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/529 (60%), Positives = 403/529 (76%), Gaps = 9/529 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             IL + F+F T +P +   S+Q QF  CV  ++H   P    FF+ T N S F  VL+ST 
Sbjct  15    ILVLYFSFYTITPTSSLASLQDQFINCVQRNTHVYFPLEKTFFAPTKNVSMFTQVLESTA  74

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL FL  S PKP  IF+PL ESHVQA+++C+K+  + LRVRSGGHD+EGLSY S ++ P
Sbjct  75    QNLRFLKQSMPKPGFIFSPLHESHVQASIICSKKLRMHLRVRSGGHDYEGLSYVSQIDKP  134

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+++DL+K+R + ++++DNS WVQ+GAT GE+YYR+AEKSK  GFPAG C SLGIGGH
Sbjct  135   --FILMDLSKMRQVNINIQDNSAWVQSGATVGELYYRIAEKSKVHGFPAGLCSSLGIGGH  192

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+M+RKYGL ADN LDA+IVDA GR+LDRAAMGED FWAIRGG GGSFGI+L+W
Sbjct  193   ITGGAYGSMMRKYGLGADNVLDAKIVDANGRLLDRAAMGEDTFWAIRGGAGGSFGIILSW  252

Query  1058  KIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             KIKLVPVP TVTVFTV +TL Q+   K++ KWQ+VADKL E+L ++VL    N     G 
Sbjct  253   KIKLVPVPQTVTVFTVTKTLHQDVGNKIISKWQRVADKLVEELFIRVLF---NVAGNGGN  309

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             +TV T+++A+FLG    L+K+M  SFPELGLT KDC+EMSW+ES+ Y + +P  TP   L
Sbjct  310   KTVTTSYNALFLGGKGTLMKVMKKSFPELGLTLKDCIEMSWLESISYISGFPSHTPTSVL  369

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK  +PK  FKAKS+F++TP+PESGL+G++K  LKED P+M+WNPYGGMMAKIPES  
Sbjct  370   LQGKSPYPKVSFKAKSDFVKTPIPESGLQGIFKKLLKEDIPLMIWNPYGGMMAKIPESQI  429

Query  521   PFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
             PFPHRKGV+ K+ Y+TSW ++ +K+  +H++WIR +Y+YM  YVS +PREAYVNYRDLDL
Sbjct  430   PFPHRKGVLFKVQYVTSW-LDSDKRPSRHINWIRDLYNYMTPYVSSNPREAYVNYRDLDL  488

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             G N     T   +A VWG  YFK NF RL+ +K++VDP+NFF HEQSIP
Sbjct  489   GKNTKDVKTCIKQAQVWGANYFKKNFNRLMMIKSKVDPENFFRHEQSIP  537



>ref|XP_010504966.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=529

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/508 (62%), Positives = 390/508 (77%), Gaps = 9/508 (2%)
 Frame = -2

Query  1718  QHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPL  1539
             Q  F +C+  +S  S P + +FFS   NA+ F   L+ST QNL +L PS PKP+ IF PL
Sbjct  27    QQDFMQCLVDNSDVSFPITASFFSPDQNATLFKEELESTAQNLRYLTPSNPKPIFIFEPL  86

Query  1538  TESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVED  1359
              E+HVQAAVVC K+  +QLRVRSGGHD+EGLS+ ++ E+P  FVV+DL+KLR + VD++ 
Sbjct  87    YETHVQAAVVCAKKLQLQLRVRSGGHDYEGLSFVAEDETP--FVVVDLSKLRQVDVDLDS  144

Query  1358  NSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNA  1179
             NS W  AGATNGEVYYR+ EKS+  GFPAG C SLG+GGH+ GGAYG+M+RK+GL ADN 
Sbjct  145   NSAWAHAGATNGEVYYRIQEKSQTHGFPAGLCSSLGMGGHLVGGAYGSMMRKFGLGADNV  204

Query  1178  LDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTL  999
             LDARIVDA G++LDRAAMGED+FWAIRG GGGSFG++LAWKIKLVPVPATVTVFTV +TL
Sbjct  205   LDARIVDANGKILDRAAMGEDVFWAIRGAGGGSFGVILAWKIKLVPVPATVTVFTVTKTL  264

Query  998   EQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKI  819
             EQ+ T +LYKWQ+VADKLD+DL ++V+I+    T     RT+  +F A FLG ++RLL+I
Sbjct  265   EQDGTNVLYKWQQVADKLDDDLFIRVIISPARKTTGSADRTISMSFQAQFLGDSNRLLEI  324

Query  818   MNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRT  639
             M   FPELGLT KDC EMSWI+SV+Y A +P +  PE LL GK LF K  FKAKS+F++ 
Sbjct  325   MQKDFPELGLTEKDCTEMSWIKSVMYIAGFPNSAAPEALLAGKSLF-KNHFKAKSDFVKE  383

Query  638   PVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKI-  462
             P+P  GL GLWK FL+ED+P+ +WNPYGGMM++I ES TPFPHR+G + KI +L++W+  
Sbjct  384   PIPVEGLEGLWKRFLEEDSPLTIWNPYGGMMSRISESETPFPHREGTLFKIQWLSTWQDG  443

Query  461   EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYF  282
             E  + KH+ WIR MYDYM  YVSK+PR+AYVNYRDLDLG NK       S+A  WG KY+
Sbjct  444   EASEAKHMKWIREMYDYMELYVSKNPRQAYVNYRDLDLGTNKEE-----SDAREWGAKYY  498

Query  281   KGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             KGNF+RLV +K   DPDNFF HEQS+P 
Sbjct  499   KGNFDRLVKIKGEFDPDNFFRHEQSVPT  526



>ref|XP_006377916.1| hypothetical protein POPTR_0011s16280g, partial [Populus trichocarpa]
 gb|ERP55713.1| hypothetical protein POPTR_0011s16280g, partial [Populus trichocarpa]
Length=543

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/515 (60%), Positives = 392/515 (76%), Gaps = 8/515 (2%)
 Frame = -2

Query  1733  VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLL  1554
             VS ++Q +F KC+S  S +S PFST  ++   ++ +   VLQS+ QNL F  PS PKP  
Sbjct  32    VSHALQDRFLKCLSRTSESSFPFSTVLYTPKNSSFTS--VLQSSAQNLRFTFPSVPKPEF  89

Query  1553  IFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIK  1374
             IFTPL ESH+QA V+C+K+ G+ LRVRSGGHDFE LSY S++ESP  F+V+DLAK R I 
Sbjct  90    IFTPLQESHIQAVVICSKQLGIHLRVRSGGHDFEALSYVSEIESP--FIVVDLAKFRSIS  147

Query  1373  VDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGL  1194
             VD+E NS WVQAGATNGE+YYR+++KS   GFPAG C SLG+GGHI+GGAYGAMLRKYGL
Sbjct  148   VDIEHNSAWVQAGATNGELYYRISKKSNTHGFPAGTCSSLGMGGHISGGAYGAMLRKYGL  207

Query  1193  AADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvft  1014
             A DN +DA I+D  GR+LDR AMGEDLFWAIRGG GGSFGI+ AWK+ LVPVP+ VTVFT
Sbjct  208   AVDNVVDAHIIDVHGRLLDRKAMGEDLFWAIRGGAGGSFGIVTAWKVNLVPVPSAVTVFT  267

Query  1013  vPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTD  834
             V +TLEQ AT+LLY+WQ++AD+LDEDL ++V I   N ++ +GKRT+ T+++A+FLG  +
Sbjct  268   VTKTLEQGATELLYRWQQIADQLDEDLFIRVQIQTANVSS-QGKRTITTSYNAMFLGDAN  326

Query  833   RLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKS  654
             RLL++M HSFPELGLT +DC+E +WI S +Y + +   TPPE LL  +    + +FK KS
Sbjct  327   RLLQVMKHSFPELGLTRQDCIETNWINSTVYMSGFANNTPPEVLLQ-RINMDRAYFKGKS  385

Query  653   EFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLT  474
             ++ R P+PE  L GLW+   + ++P++V+ PYGGMM +I ES TPFPHRKG    I+Y +
Sbjct  386   DYARKPIPEKALEGLWEKLFEAESPLVVFTPYGGMMNQISESQTPFPHRKGTKFMILYWS  445

Query  473   SWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             SW+   E   KH++W R++Y YM  YVSK+PREAY NYRDLDLGMN+N  NTSF EA  +
Sbjct  446   SWQDATENVAKHINWTRKVYSYMTPYVSKNPREAYANYRDLDLGMNRNS-NTSFVEACAF  504

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             G  YFK NF RLV VKT+VDPDNFF HEQSIP LS
Sbjct  505   GTNYFKDNFYRLVHVKTKVDPDNFFRHEQSIPPLS  539



>ref|XP_006377917.1| hypothetical protein POPTR_0011s16290g [Populus trichocarpa]
 gb|ERP55714.1| hypothetical protein POPTR_0011s16290g [Populus trichocarpa]
Length=533

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/517 (59%), Positives = 392/517 (76%), Gaps = 10/517 (2%)
 Frame = -2

Query  1739  WAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKP  1560
             + VSL IQ +  KC+  +S +S PFS+  ++   ++ +   VLQS+ QN+ F + + PKP
Sbjct  20    FMVSLPIQDRLLKCLPKYSDSSFPFSSILYTQKNSSFTS--VLQSSAQNVRFTLSTVPKP  77

Query  1559  LLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRG  1380
               I TPL ESH+QAAV+C+K+ G+ LRVRSGGHDFEGLSY S++E+P  F+V+DLAKLR 
Sbjct  78    EFILTPLQESHIQAAVICSKKLGIHLRVRSGGHDFEGLSYVSEIETP--FIVVDLAKLRS  135

Query  1379  IKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKY  1200
             I VD+E NS WVQ GATNGE+YYR++EKSK  GFPAG C S+ +GG I+GG YG MLRKY
Sbjct  136   ISVDIEHNSAWVQVGATNGELYYRISEKSKTRGFPAGTCSSVCMGGQISGGGYGTMLRKY  195

Query  1199  GLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtv  1020
             GLAADN +DA I+D  GR+LDR  MGEDLFWAIRGG GGSFGI+ AWK+KLVPVP+ VTV
Sbjct  196   GLAADNVVDAHIIDVHGRLLDRKDMGEDLFWAIRGGAGGSFGIVTAWKVKLVPVPSAVTV  255

Query  1019  ftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGK  840
             FTV +TLEQ ATKLLY+WQ++ D+LD+DL ++V I   N ++ +GKRT+ T+++A+FLG 
Sbjct  256   FTVTKTLEQGATKLLYRWQQIVDQLDKDLFIRVQIQTANVSS-QGKRTITTSYNAMFLGD  314

Query  839   TDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFP-KTFFK  663
              +RLL++M HSFPELGLT +DC+E +WI S +Y A +   TPPE  L  +  +P + +FK
Sbjct  315   ANRLLQVMKHSFPELGLTRQDCIETNWINSTVYIAGFANNTPPEVFL--QRTYPNREYFK  372

Query  662   AKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             AKS++ + PV E  L GLW+   + ++P++V+ PYGGMM++I ES TPFPHRKG    I+
Sbjct  373   AKSDYAKKPVSEKALEGLWEKLSEVESPLVVFTPYGGMMSQISESQTPFPHRKGTKFMIL  432

Query  482   YLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
             Y T W+   E   KH+DW R +Y+YM  YVSK+PREAYVNYRDLDLGMN N  N SF EA
Sbjct  433   YYTGWQDAKENVAKHIDWTRMVYNYMTPYVSKNPREAYVNYRDLDLGMNNNS-NASFVEA  491

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             SV+G KYFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  492   SVFGTKYFKDNFYRLVHVKTKVDPDNFFRHEQSIPPL  528



>ref|NP_199253.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana]
 dbj|BAB10125.1| berberine bridge enzyme [Arabidopsis thaliana]
 gb|AAL60019.1| putative berberine bridge enzyme [Arabidopsis thaliana]
 gb|AED95105.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana]
Length=537

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/529 (59%), Positives = 401/529 (76%), Gaps = 9/529 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             IL + F+  T +P +   S+Q QF  CV  ++H   P    FF+ T N S F+ VL+ST 
Sbjct  12    ILVLYFSLYTITPTSSLASLQDQFINCVQRNTHVYFPLEKTFFAPTKNVSMFSQVLESTA  71

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL FL  S PKP  IF+P+ ESHVQA+++C+K+  + LRVRSGGHD+EGLSY S ++ P
Sbjct  72    QNLRFLKKSMPKPGFIFSPIHESHVQASIICSKKLRMHLRVRSGGHDYEGLSYVSQIDKP  131

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+++DL+K+R + ++++DNS WVQ+GAT GE+YYR+AEKSK  GFPAG C SLGIGGH
Sbjct  132   --FILMDLSKMRQVNINIQDNSAWVQSGATVGELYYRIAEKSKVHGFPAGLCSSLGIGGH  189

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+M+RKYGL ADN LDA+IVDA G++LDRAAMGED FWAIRGG GGSFGI+LAW
Sbjct  190   ITGGAYGSMMRKYGLGADNVLDAKIVDANGKLLDRAAMGEDTFWAIRGGAGGSFGIILAW  249

Query  1058  KIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             KIKLVPVP TVTVFTV +TL+Q+   K++ KWQ+VADKL E+L ++VL    N     G 
Sbjct  250   KIKLVPVPKTVTVFTVTKTLQQDVGNKIISKWQRVADKLVEELFIRVLF---NVAGTGGN  306

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             +TV T+++A+FLG    L+ +M  SFPELGLT KDC+EMSW+ES+ Y + +P  TP   L
Sbjct  307   KTVTTSYNALFLGGKGTLMNVMKKSFPELGLTFKDCIEMSWLESIAYISGFPTHTPTNVL  366

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK  FPK  FKAKS+F++TP+PESGL+G++K  LKED P+M+WNPYGGMMAKIPES  
Sbjct  367   LQGKSPFPKVSFKAKSDFVKTPIPESGLQGIFKKLLKEDIPLMIWNPYGGMMAKIPESQI  426

Query  521   PFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
             PFPHRKGV+ K+ Y+TSW ++ +K+  +H++WIR +Y YM  YVS +PREAYVNYRDLDL
Sbjct  427   PFPHRKGVLFKVQYVTSW-LDSDKRPSRHINWIRDLYSYMTPYVSSNPREAYVNYRDLDL  485

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             G N     T   +A VWG  YFK NF RL+ +K +VDP+NFF HEQSIP
Sbjct  486   GRNTKDVKTCIKQAQVWGANYFKNNFNRLMMIKAKVDPENFFRHEQSIP  534



>ref|XP_006377921.1| hypothetical protein POPTR_0011s16330g [Populus trichocarpa]
 gb|ERP55718.1| hypothetical protein POPTR_0011s16330g [Populus trichocarpa]
Length=545

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/514 (60%), Positives = 393/514 (76%), Gaps = 8/514 (2%)
 Frame = -2

Query  1733  VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLL  1554
             VS ++Q +F KC+S  S +S PFST  ++   ++ +   VLQS+ QNL F  PS PKP  
Sbjct  22    VSHALQDRFLKCLSRTSESSFPFSTVLYTPKNSSFTS--VLQSSAQNLRFTFPSVPKPEF  79

Query  1553  IFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIK  1374
             IFTPL ESH+QA V+C+K+ G+ LRVRSGGHDFE LSY S++ESP  F+++DLAK R I 
Sbjct  80    IFTPLQESHIQAVVICSKQLGIHLRVRSGGHDFEALSYVSEIESP--FILVDLAKFRSIS  137

Query  1373  VDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGL  1194
             VD+E NS WVQAG+TNGE+YYR++EKSK  GFPAG C SLG+GGHI+GGAYGAMLRKYGL
Sbjct  138   VDIEHNSAWVQAGSTNGELYYRISEKSKIHGFPAGTCTSLGMGGHISGGAYGAMLRKYGL  197

Query  1193  AADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvft  1014
             A DN +DA I+D  GR+LDR AMGEDLFWAIRGG GGSFGI+ AWK+KLVPVP+ VTVFT
Sbjct  198   AVDNVVDAHIIDVHGRLLDRKAMGEDLFWAIRGGAGGSFGIVTAWKVKLVPVPSAVTVFT  257

Query  1013  vPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTD  834
             V +TLEQ AT+LLY+WQ++AD+LDEDL ++V I   N ++ +GKRT+ T+++A+FLG  +
Sbjct  258   VTKTLEQGATELLYRWQQIADQLDEDLFIRVQIQTANVSS-QGKRTITTSYNAMFLGDAN  316

Query  833   RLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKS  654
             RLL++M HSFPELGLT +DC+E +WI S +Y + +   TPPE LL  +    + +FK KS
Sbjct  317   RLLQVMKHSFPELGLTRQDCIETNWINSTVYMSGFANNTPPEVLLQ-RINMDRAYFKGKS  375

Query  653   EFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLT  474
             ++ R P+PE  L GLW+   + ++P++V+ PYGGMM +I ES TPFPHR G    I+Y +
Sbjct  376   DYARKPIPEKALEGLWEKLFEAESPLVVFTPYGGMMNQISESQTPFPHRNGTKFMILYWS  435

Query  473   SWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             SW+   E   KH++W R++Y YM  YVSK+PREAY NYRDLDLGMN+N + TSF EAS +
Sbjct  436   SWQDATENVAKHINWTRKVYSYMTPYVSKNPREAYANYRDLDLGMNRNSK-TSFVEASAF  494

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             G  YFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  495   GTNYFKDNFYRLVHVKTKVDPDNFFRHEQSIPPL  528



>ref|XP_004293692.1| PREDICTED: cannabidiolic acid synthase-like 1-like [Fragaria 
vesca subsp. vesca]
Length=545

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/476 (62%), Positives = 369/476 (78%), Gaps = 6/476 (1%)
 Frame = -2

Query  1616  VLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYT  1437
              LQST QNL +L PS PKP  IFTP+ +SHVQAAV+C KE G+ LRVRSGGHD+E LSY 
Sbjct  62    TLQSTAQNLRYLTPSVPKPEFIFTPMLDSHVQAAVICAKELGIHLRVRSGGHDYEALSYV  121

Query  1436  SDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVS  1257
             S  E+P  F+++DLAKLR + +D+EDNS WVQAGA+ GEVYYR+AEKSK  G+PAG C S
Sbjct  122   SQTETP--FIIVDLAKLRSVNIDIEDNSAWVQAGASIGEVYYRIAEKSKTHGYPAGLCTS  179

Query  1256  LgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSF  1077
             LG+GGHITGGAYG M+RKYGL ADN +DA IVDA+GR+ +R +MGEDLFWAIRGGGG SF
Sbjct  180   LGVGGHITGGAYGTMMRKYGLGADNVVDAHIVDASGRIHNRESMGEDLFWAIRGGGGASF  239

Query  1076  GILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNS-  900
             G++L WKIKLVPVP+TVTVF+V +TLEQ ATKLL+++Q+VA    ++ L   +I      
Sbjct  240   GVILWWKIKLVPVPSTVTVFSVVKTLEQGATKLLHRYQQVAATELDEDLFIRVIIQPTVF  299

Query  899   TAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRT  720
              A  G +T+ T + A FLG  DRLL +M  SFPELGLT KDC + SW++SV+Y A YP  
Sbjct  300   DAKSGNKTIMTIYQAQFLGGVDRLLDVMGTSFPELGLTRKDCTQTSWLKSVMYIAGYPSN  359

Query  719   TPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAK  540
             TPPE LL GK  F K +FKAKS+F++ P+PES L G+WK   ++ +P+M++NPYGGMM+K
Sbjct  360   TPPEVLLQGKSTF-KNYFKAKSDFVKDPIPESALEGIWKRLYEQASPLMIFNPYGGMMSK  418

Query  539   IPESATPFPHRKGVICKIVYLTSWKIEGEKK-KHLDWIRRMYDYMGTYVSKSPREAYVNY  363
             I ES  PFPHRKGV+ KI YLT+W+   E + +H+DWIR++Y+YM  YV+  PR+AYVNY
Sbjct  419   ISESEIPFPHRKGVLFKIQYLTTWQNGTEDEAEHMDWIRKLYNYMAPYVTMFPRQAYVNY  478

Query  362   RDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             RDLDLG+NK   NTSF EAS WG +YFK NF +L+ +KT+VDPDNFF HEQSIP L
Sbjct  479   RDLDLGVNKKS-NTSFIEASAWGNRYFKDNFNKLIKIKTKVDPDNFFRHEQSIPPL  533



>ref|XP_010053021.1| PREDICTED: reticuline oxidase-like protein [Eucalyptus grandis]
Length=564

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/519 (61%), Positives = 397/519 (76%), Gaps = 9/519 (2%)
 Frame = -2

Query  1745  SPW-AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSA  1569
             S W +V+ +IQ  F+ C+S +S  S+  + + + T  N SSF S+L ST  NL +L+P+ 
Sbjct  20    SSWTSVAFTIQQTFFHCLSTNSMNSV--ALSSYYTPNNISSFTSILNSTANNLRYLLPTV  77

Query  1568  PKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAK  1389
             PKP++IFTPL+++HVQAAV+C+K+ G+ +RVRSGGHD+E +SY S +ESP  F+V+DLA 
Sbjct  78    PKPVIIFTPLSDAHVQAAVLCSKQLGLAIRVRSGGHDYEAVSYVSQIESP--FLVLDLAG  135

Query  1388  LRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAML  1209
             LR I+VD+   + W QAGAT GEVYYR+AEKSK  GFP G   SLGIGGHITGGAYG M+
Sbjct  136   LRAIEVDIAQGTAWAQAGATVGEVYYRIAEKSKIHGFPMGVSTSLGIGGHITGGAYGTMM  195

Query  1208  RKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpat  1029
             R +GL ADN LD R+VDA G++LDR AMGEDLFWA+RGGGGGSFGI+LAWK+KLV VP T
Sbjct  196   RMFGLGADNVLDVRMVDAEGKILDRKAMGEDLFWALRGGGGGSFGIILAWKLKLVNVPET  255

Query  1028  vtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVF  849
             VTVFTV + LE+ ATKLL KWQK+A KLD+ L ++V+I   +ST +   RTV  ++ A+F
Sbjct  256   VTVFTVTKNLEEGATKLLVKWQKIAPKLDDRLFIRVIIRP-SSTNLTVNRTVTASYMALF  314

Query  848   LGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTF  669
             LG  D LL IM+  FPELGLT  +C +MSWI SV+Y ALYP  T PE LL GKP F +++
Sbjct  315   LGDPDTLLGIMDKRFPELGLTRANCTKMSWIGSVLYMALYPNITAPEVLLQGKPQF-QSY  373

Query  668   FKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICK  489
             FK+KS+F+R  +PE GL GLWK+FL+E+ P+M+WNPYGG M ++P SATPFPHR+G + K
Sbjct  374   FKSKSDFVRALIPEKGLLGLWKMFLEEEMPLMIWNPYGGEMDRVPASATPFPHRRGTLFK  433

Query  488   IVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFS  312
             I Y  SW+   E   +H+ WIR++YDYMG YVSK+PREAYVNYRD DLGMNK G  TS  
Sbjct  434   IQYAVSWQDGAENMSRHISWIRKLYDYMGPYVSKNPREAYVNYRDFDLGMNKKGV-TSLM  492

Query  311   EASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             EAS WG KYFK NF RLV VKTRVDP+NFF HEQSIP L
Sbjct  493   EASSWGLKYFKSNFYRLVQVKTRVDPENFFRHEQSIPPL  531



>ref|XP_006377923.1| hypothetical protein POPTR_0011s16350g [Populus trichocarpa]
 gb|ERP55720.1| hypothetical protein POPTR_0011s16350g [Populus trichocarpa]
Length=543

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/521 (60%), Positives = 397/521 (76%), Gaps = 10/521 (2%)
 Frame = -2

Query  1754  LTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVP  1575
             L  SP+ VS ++Q +F KC+S  S +S PFST  ++   ++ +   VLQS+ QNL F  P
Sbjct  15    LLLSPFIVSHALQDRFLKCLSRTSESSFPFSTVLYAPQNSSFTS--VLQSSAQNLRFTFP  72

Query  1574  SAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDL  1395
             S PKP  IFTPL ESH+QA V+C+K+ G+ LRVRSGGHDFEGLSY S++E+   F+++DL
Sbjct  73    SVPKPEFIFTPLQESHIQAVVICSKQLGIHLRVRSGGHDFEGLSYVSEIETT--FILVDL  130

Query  1394  AKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygA  1215
             AK R I VD+E NS WVQAGATNGE+YYR++EKSK  GFPAG C SLG+GGHI+GGAYGA
Sbjct  131   AKFRSISVDIEHNSAWVQAGATNGELYYRISEKSKTHGFPAGTCSSLGMGGHISGGAYGA  190

Query  1214  MLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvp  1035
             MLRKYGLA DN +DA I+D  GR+LDR AMGEDLFWAIRGG GGSFGI+ AWK+KLVPVP
Sbjct  191   MLRKYGLAVDNVVDAHIIDVHGRLLDRKAMGEDLFWAIRGGAGGSFGIVTAWKVKLVPVP  250

Query  1034  atvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDA  855
             + VTVFTV +TLEQ AT+LLY+WQ++AD+LDEDL ++V I   N ++  GKRT+ T+++A
Sbjct  251   SAVTVFTVTKTLEQGATELLYRWQQIADQLDEDLFIRVQIQTANVSS-HGKRTITTSYNA  309

Query  854   VFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPK  675
             +FLG  +RLL++M HSFPELGLT +DC+E +WI S +Y + +   TPPE LL  +    +
Sbjct  310   MFLGDANRLLQVMKHSFPELGLTRQDCIETNWINSTVYMSGFANNTPPEVLLQ-RINMGR  368

Query  674   TFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVI  495
              +FK KS++ R P+PE  L GLW+   + ++P++V+ PYGGMM++I ES TPFPHRKG  
Sbjct  369   AYFKGKSDYARKPIPEKALEGLWEKLFEAESPLVVFTPYGGMMSQISESQTPFPHRKGTK  428

Query  494   CKIVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTS  318
               I+Y +SW+   E   KH++W R++  YM  YVSK+PREAY NYRDLDLGMN+N  NTS
Sbjct  429   FMILYWSSWQDATENVAKHINWTRKV--YMTPYVSKNPREAYANYRDLDLGMNRNS-NTS  485

Query  317   FSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             F EAS +G  YFK NF RLV VKT+VDP+NFF HEQSIP L
Sbjct  486   FVEASAFGTNYFKDNFYRLVNVKTKVDPENFFRHEQSIPPL  526



>ref|XP_011013934.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Populus 
euphratica]
Length=545

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/514 (60%), Positives = 392/514 (76%), Gaps = 8/514 (2%)
 Frame = -2

Query  1733  VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLL  1554
             VS ++Q +F KC+S  S +S P+ST  +S   ++ +   VLQ + QNL F +PS PKP  
Sbjct  22    VSHALQDRFLKCLSRTSGSSFPYSTVLYSPKNSSFTS--VLQYSAQNLRFTLPSVPKPEF  79

Query  1553  IFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIK  1374
             IFTPL ESH+QA V+C+ + G+ LRVRSGGHDFE LSY S++E+P  F+V+DLAKLR I 
Sbjct  80    IFTPLQESHIQAVVICSMQLGIHLRVRSGGHDFEALSYVSEIETP--FIVVDLAKLRSIS  137

Query  1373  VDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGL  1194
             V +E NS WVQ GATNGE+YYR++EKSK  GFPAG C SLG+GGHI+GGAYGAMLRKYGL
Sbjct  138   VGIEHNSAWVQTGATNGELYYRISEKSKTHGFPAGTCTSLGMGGHISGGAYGAMLRKYGL  197

Query  1193  AADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvft  1014
             AADN +DA I+D  GR+LDR AMGEDLFWAIRGG GGSFGI+ AWK+KLVPVP+ VTVFT
Sbjct  198   AADNVVDAHIIDVHGRLLDRKAMGEDLFWAIRGGAGGSFGIVSAWKVKLVPVPSAVTVFT  257

Query  1013  vPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTD  834
             V +T EQ ATKLLY+WQ++ADKLDEDL ++V I   N ++ +GKRT+ T+++A FLG  +
Sbjct  258   VTKTSEQGATKLLYRWQQIADKLDEDLFIRVQIQTANVSS-QGKRTITTSYNAAFLGDAN  316

Query  833   RLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKS  654
             RLL++M HSFPELGLT +DC+E +WI S +Y + + + TPPE LL  +    + +FK KS
Sbjct  317   RLLQVMKHSFPELGLTRQDCIETNWINSTVYMSGFAKNTPPEVLLQ-RINMDRAYFKGKS  375

Query  653   EFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLT  474
             ++ R P+PE  L GLW+   + ++P++V+ PYGGMM +I ES TPFPHRKG    I+Y +
Sbjct  376   DYARKPIPEKALEGLWEKLFEAESPLVVFTPYGGMMNQISESQTPFPHRKGTKFMILYWS  435

Query  473   SWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             SW+   E   KH++W R++Y YM  YVSK+PREAY NYRDLDLGMN+N  NTSF EAS +
Sbjct  436   SWQDATENVAKHINWTRKVYSYMTPYVSKNPREAYANYRDLDLGMNRNS-NTSFVEASAF  494

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             G  YFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  495   GTSYFKDNFYRLVHVKTKVDPDNFFRHEQSIPPL  528



>ref|XP_006377914.1| hypothetical protein POPTR_0011s16260g [Populus trichocarpa]
 gb|ERP55711.1| hypothetical protein POPTR_0011s16260g [Populus trichocarpa]
Length=533

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/515 (59%), Positives = 390/515 (76%), Gaps = 8/515 (2%)
 Frame = -2

Query  1733  VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLL  1554
             VS ++Q +F KC+S  S +S PFST  ++   ++ +   VLQS+ QNL F  PS  KP  
Sbjct  22    VSHALQDRFLKCLSRTSESSFPFSTVLYTPKNSSFTS--VLQSSAQNLRFTFPSVRKPEF  79

Query  1553  IFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIK  1374
             I TPL ESH+QA V+C+K+ G+ LRVRSGGHDFEGLSY S+ E+P  F+V+DLAKLR I 
Sbjct  80    IVTPLQESHIQAVVICSKQLGIHLRVRSGGHDFEGLSYVSENETP--FIVVDLAKLRSIS  137

Query  1373  VDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGL  1194
             VD+E+NS WVQAGATNGE+YYR++EKSK  GFP+G C ++ +GG I+GG YG+MLRKYGL
Sbjct  138   VDIENNSAWVQAGATNGELYYRISEKSKTHGFPSGTCPTVCMGGLISGGGYGSMLRKYGL  197

Query  1193  AADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvft  1014
             AADN +D  I+D  GR+LDR +MGEDLFWAIRGG GGSFGI+  WK+KLVPVP+ VTVFT
Sbjct  198   AADNVVDVHIIDVHGRLLDRKSMGEDLFWAIRGGAGGSFGIVTTWKVKLVPVPSAVTVFT  257

Query  1013  vPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTD  834
             V +TLEQ AT+LLY+WQ++AD+LD+DL ++V I   N ++  GKRT+ T+++A+FLG  +
Sbjct  258   VTKTLEQGATQLLYRWQQIADQLDKDLFIRVQIQTANVSS-HGKRTITTSYNALFLGDAN  316

Query  833   RLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKS  654
             RLL++M HSFPELGLT +DC+E +WI S +Y A     TPPEF L  +    + +FK KS
Sbjct  317   RLLQVMKHSFPELGLTRQDCIETNWINSTVYMAGLSNNTPPEFFLQ-RTNPDRAYFKGKS  375

Query  653   EFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLT  474
             ++ R P+PE  L GLW+   + ++P++V+ PYGGMM +I ES TPFPHRKG    I+Y +
Sbjct  376   DYARKPIPEKALEGLWQKLFEAESPLVVFTPYGGMMNQISESQTPFPHRKGTKFMILYWS  435

Query  473   SWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             SW+   E   KH++W R++Y YM  YVSK+PREAYVNYRD+DLGMN N  N SF EASV+
Sbjct  436   SWQDAKENVAKHINWTRKVYSYMTPYVSKNPREAYVNYRDIDLGMNNNS-NASFVEASVF  494

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             G KYFK NF RLV VKT+VDPDNFF HEQSIP LS
Sbjct  495   GTKYFKDNFYRLVHVKTKVDPDNFFRHEQSIPPLS  529



>ref|XP_004504722.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Cicer arietinum]
Length=531

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/510 (61%), Positives = 391/510 (77%), Gaps = 9/510 (2%)
 Frame = -2

Query  1718  QHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPL  1539
             Q  F +C++L+S T+ PF T  ++    +     +L +T  NL  L+PS+PKP  IFTPL
Sbjct  27    QENFVQCLNLNSKTTYPFHTTIYTPNDASFKT--ILDTTAMNLRCLLPSSPKPEFIFTPL  84

Query  1538  TESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVED  1359
              +SHVQAAV+C+K+ G+ LRVRSGGHD+EG+SY S+ E+P  F+VIDL KLRGI VD++ 
Sbjct  85    QDSHVQAAVICSKKLGIHLRVRSGGHDYEGVSYVSENETP--FIVIDLLKLRGINVDIKT  142

Query  1358  NSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNA  1179
              + W+QAGAT GEVYYR+ EKS  LG+PAG C SLG+GGHITGGAYG M+RKYGL ADN 
Sbjct  143   KTAWIQAGATIGEVYYRIYEKSSVLGYPAGLCTSLGVGGHITGGAYGTMMRKYGLGADNV  202

Query  1178  LDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTL  999
             LDA IVDA G +LDR  MGEDLFWAIRGGGGGSFGI+L WKIKLV VP TVTVFTV ++L
Sbjct  203   LDAEIVDANGNILDREKMGEDLFWAIRGGGGGSFGIVLWWKIKLVQVPPTVTVFTVTKSL  262

Query  998   EQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKI  819
             EQ ATKLL++WQ+VA  +DE+L ++V+I   +    K +RT+ T ++AVFLG+   LL++
Sbjct  263   EQGATKLLHRWQEVAPFIDENLFIRVIIQPSSVVGNKTQRTITTTYNAVFLGEARTLLQV  322

Query  818   MNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRT  639
             M  SFPELGLT KDC E SWI+SV+Y A +P  TP E LL GKP F K FFKAKS+F++ 
Sbjct  323   MKKSFPELGLTRKDCEETSWIKSVLYIANFPSDTPLEVLLKGKPTF-KNFFKAKSDFVKE  381

Query  638   PVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKIE  459
             P+PE+G+ GLW+  L ED+P+++WNPYGG M++  ES +PFPHR G + KI YLT W+ +
Sbjct  382   PIPENGIEGLWQRLLVEDSPLLIWNPYGGKMSEFSESDSPFPHRNGTLYKIQYLTLWQ-D  440

Query  458   GEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKY  285
             G+K   KH+DWIR++Y+YM  YVSK PREAYVNYRDLDLG+N    +TS+ EAS WGY+Y
Sbjct  441   GDKNAAKHIDWIRKLYNYMTPYVSKFPREAYVNYRDLDLGINSK-NSTSYIEASAWGYRY  499

Query  284   FKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             FK NF +LV +KTRVDP+N F HEQSIP L
Sbjct  500   FKDNFNKLVKIKTRVDPENVFRHEQSIPPL  529



>ref|XP_010441892.1| PREDICTED: cannabidiolic acid synthase-like 2 isoform X1 [Camelina 
sativa]
 ref|XP_010441893.1| PREDICTED: cannabidiolic acid synthase-like 2 isoform X2 [Camelina 
sativa]
Length=540

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/529 (59%), Positives = 399/529 (75%), Gaps = 9/529 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             IL++ F+  T +P +   S+Q QF  CV  ++H   P    FF+   N S F+  L+ST 
Sbjct  15    ILALYFSLYTITPTSSLASLQDQFINCVQRNTHVYFPLEKTFFAPAKNVSMFSQFLESTA  74

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QN+ FL  S PKP  I +P+ ESHVQA+V+C K+  + LRVRSGGHD+EGLSY S +  P
Sbjct  75    QNIRFLKKSLPKPGFIISPIHESHVQASVICAKKLRMHLRVRSGGHDYEGLSYVSQIVKP  134

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+++DL+K+R   ++++DNS WVQ+G+T GE+YYR+AEKSK  GFPAG C SLGIGGH
Sbjct  135   --FILMDLSKMRQADINIKDNSAWVQSGSTLGELYYRIAEKSKVHGFPAGLCSSLGIGGH  192

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+M+RKYGL ADN LDA+IVDA GR+LDRAAMGED FWAIRGG GGSFGI+LAW
Sbjct  193   ITGGAYGSMMRKYGLGADNVLDAKIVDANGRLLDRAAMGEDTFWAIRGGAGGSFGIILAW  252

Query  1058  KIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             KIKLVPVP TVTVFT+ +TL+Q+   K++ KWQ+VADKL E+L ++VL    N     G 
Sbjct  253   KIKLVPVPQTVTVFTITKTLQQDVGHKIITKWQRVADKLVEELFIRVLF---NVAGTGGN  309

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             +TV  +++++FLG    L+K+M  SFPELGLT KDC+EMSW+ES+ Y + +P  TP   L
Sbjct  310   KTVTMSYNSLFLGGKGILMKVMKKSFPELGLTLKDCIEMSWLESIAYISGFPTHTPTNIL  369

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK  FPK  FKAKS+F++TP+PESGL+G+++  LKED P+M+WNPYGGMMAKIPES  
Sbjct  370   LQGKSPFPKVNFKAKSDFVKTPIPESGLKGIFQKLLKEDIPLMIWNPYGGMMAKIPESQI  429

Query  521   PFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
             PFPHRKGV+ K+ Y+TSW ++ +K+  KH++WIR  Y+YM  YVS +PR+AYVNYRDLDL
Sbjct  430   PFPHRKGVLFKVQYVTSW-LDSDKRPSKHMNWIRDFYNYMTPYVSSNPRQAYVNYRDLDL  488

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             G N   R T F +A  WG  YFK NF RLV++K++VDP+NFF HEQSIP
Sbjct  489   GKNTKDRKTCFKQAQGWGANYFKNNFNRLVSIKSKVDPENFFRHEQSIP  537



>ref|XP_006377929.1| hypothetical protein POPTR_0011s16400g [Populus trichocarpa]
 gb|ERP55726.1| hypothetical protein POPTR_0011s16400g [Populus trichocarpa]
Length=533

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/517 (62%), Positives = 393/517 (76%), Gaps = 8/517 (2%)
 Frame = -2

Query  1742  PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPK  1563
             P+ VSL IQ +F KC+S +S TS PFST  ++   ++ +   VLQS+ QNL F  PS PK
Sbjct  19    PFIVSLPIQDRFLKCLSKYSDTSFPFSTVLYTPQNSSFTT--VLQSSAQNLRFTSPSVPK  76

Query  1562  PLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLR  1383
             P  IFTPL ESH+QA V+C+K+ G+ LRVRSGGHD+EGLSY S++E P  FVV+DLAKLR
Sbjct  77    PEFIFTPLQESHIQAVVICSKQLGIHLRVRSGGHDYEGLSYVSEIEKP--FVVVDLAKLR  134

Query  1382  GIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRK  1203
              I VD+E NS WVQ G TNGE+YYR++EKSK  GFPAG C SLG+GGHI+GGAYGAMLRK
Sbjct  135   SISVDIEHNSAWVQVGVTNGELYYRISEKSKTHGFPAGTCTSLGMGGHISGGAYGAMLRK  194

Query  1202  YGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvt  1023
             YGL ADN +DA ++D  GR+L+R  MGEDLFWAIRGG GGSFGI+ AWK+KLVPVP+TVT
Sbjct  195   YGLGADNVVDAHLIDVHGRLLNRKLMGEDLFWAIRGGAGGSFGIVTAWKLKLVPVPSTVT  254

Query  1022  vftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLG  843
             VFTV +TLEQ ATK+LY+WQ++ADKLDEDL +KVLI   N T+ +GKRT+ T+++++FLG
Sbjct  255   VFTVTKTLEQGATKILYRWQEIADKLDEDLFIKVLIQTANVTS-QGKRTIATSYNSLFLG  313

Query  842   KTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFK  663
                RLL+IM  SFPELGLT KDC+E +WI S ++ AL    TPPE  L  K    + +FK
Sbjct  314   DARRLLQIMQRSFPELGLTRKDCIETNWINSTVFMALLQNNTPPEVFLQRKDP-NRRYFK  372

Query  662   AKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             AKS++ + PV E  L GLW+   + ++P +V+ PYGGMM++I ES TPFPHRKG    I+
Sbjct  373   AKSDYAKKPVSEKALEGLWEKLFEVESPAVVFTPYGGMMSQISESQTPFPHRKGTKFMIL  432

Query  482   YLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
             Y T W+   E   KH+DW R +Y+YM  YVSK+PREAY NYRDLDLGMN N  NTSF EA
Sbjct  433   YYTGWQDAKENVAKHIDWTRMVYNYMKPYVSKNPREAYANYRDLDLGMNNNS-NTSFVEA  491

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             S +G KYFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  492   SAFGTKYFKDNFYRLVHVKTKVDPDNFFRHEQSIPPL  528



>ref|XP_010666892.1| PREDICTED: reticuline oxidase-like protein [Beta vulgaris subsp. 
vulgaris]
Length=553

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/533 (60%), Positives = 403/533 (76%), Gaps = 14/533 (3%)
 Frame = -2

Query  1781  IILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQST  1602
             I L +L  F   S  A S  +Q  F  C+S   + S P        T + SSF  +L ST
Sbjct  4     ISLVLLLIFSLCSSVAYSNDLQANFLHCLS--KNISPPNPFPTSCYTPSNSSFTGILNST  61

Query  1601  VQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMES  1422
               NL +L+PS  KP LI+ PL ESHVQAAVVC K+ G+QLRVRSGGHD+EG+SY+S+M  
Sbjct  62    ANNLRYLLPSVEKPQLIYMPLDESHVQAAVVCAKKVGIQLRVRSGGHDYEGVSYSSEMGD  121

Query  1421  PAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigg  1242
             P  FVV+DLAKLR + VD++DNS WV+AGAT GE+YYR++E+SK  GFPAG C SLGIGG
Sbjct  122   P--FVVVDLAKLRSVIVDIDDNSAWVEAGATTGELYYRISEQSKVHGFPAGLCTSLGIGG  179

Query  1241  hitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLA  1062
             HITGGAYG+M+RKYGL  DN +D R+VD  G++LDRA+MGEDLFWA+RGGGGGSFG++LA
Sbjct  180   HITGGAYGSMMRKYGLGVDNVIDVRLVDPFGKILDRASMGEDLFWAVRGGGGGSFGVILA  239

Query  1061  WKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLI---TAVNSTAV  891
             WK+KLVPVP TVT FTV RTL+Q  TKLLYKWQ+VADKLDE+L ++V I   T  N+T  
Sbjct  240   WKVKLVPVPETVTTFTVVRTLDQGLTKLLYKWQQVADKLDENLFIRVEILPGTIPNTT--  297

Query  890   KGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP  711
               ++TVQ  F++++LG  ++L + M  +FPELGLTPKDC EMSWIESV+Y   +P  + P
Sbjct  298   --EKTVQALFNSLYLGNANQLHRTMARTFPELGLTPKDCNEMSWIESVVYIGGFPTGSSP  355

Query  710   EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPE  531
             + LL GKP F + +FKAKS+F++ P+PE+GL GLWK  L+ ++ +M+WNPYGGMM+K+PE
Sbjct  356   DVLLQGKPTF-RDYFKAKSDFVKEPIPEAGLEGLWKKLLEAESYIMIWNPYGGMMSKVPE  414

Query  530   SATPFPHRKGVICKIVYLTSWKI-EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDL  354
             S TPFPHRKG + KI Y+ SW+  +  +  ++ WIR +YDYM  YVSK+PREAYVNYRDL
Sbjct  415   SETPFPHRKGTLFKIQYVASWQDGKASESSNMAWIRDLYDYMEPYVSKNPREAYVNYRDL  474

Query  353   DLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             DLGMNK+G NT+  EA  WG KYFK NF+RLV +KT+ DP+NFF HEQSIP L
Sbjct  475   DLGMNKDG-NTNVDEARAWGLKYFKNNFDRLVKIKTKFDPENFFRHEQSIPPL  526



>gb|ABK94946.1| unknown [Populus trichocarpa]
Length=533

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/515 (59%), Positives = 390/515 (76%), Gaps = 8/515 (2%)
 Frame = -2

Query  1733  VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLL  1554
             VS ++Q +F KC+S  S +S PFST  ++   ++ +   VLQS+ QNL F  PS  KP  
Sbjct  22    VSHALQDRFLKCLSRTSESSFPFSTVLYTPKNSSFTS--VLQSSAQNLRFTFPSVRKPEF  79

Query  1553  IFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIK  1374
             I TPL ESH+QA V+C+K+ G+ LRVRSGGHDFEGLSY S+ E+P  F+V+DLAKLR I 
Sbjct  80    IVTPLQESHIQAVVICSKQLGIHLRVRSGGHDFEGLSYVSENETP--FIVVDLAKLRSIS  137

Query  1373  VDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGL  1194
             VD+E+NS WVQAGATNGE+YYR++EKSK  GFP+G C ++ +GG I+GG YG+MLRKYGL
Sbjct  138   VDIENNSAWVQAGATNGELYYRISEKSKTHGFPSGTCPTVCMGGLISGGGYGSMLRKYGL  197

Query  1193  AADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvft  1014
             AADN +D  I+D  GR+LDR +MGEDLFWAIRGG GGSFGI+  WK+KLVPVP+ VTVFT
Sbjct  198   AADNVVDVHIIDVHGRLLDRKSMGEDLFWAIRGGAGGSFGIVTTWKVKLVPVPSAVTVFT  257

Query  1013  vPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTD  834
             V +TLEQ AT+LLY+WQ++AD+LD+DL ++V I   N ++  GKRT+ T+++A+FLG  +
Sbjct  258   VTKTLEQGATQLLYRWQQIADQLDKDLFIRVQIQTANVSS-HGKRTITTSYNALFLGDAN  316

Query  833   RLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKS  654
             RLL++M HSFPELGLT +DC+E +WI S +Y A     TPPEF L  +    + +FK KS
Sbjct  317   RLLQVMKHSFPELGLTRQDCIETNWINSTVYMAGLSNNTPPEFFLQ-RTNPDRAYFKGKS  375

Query  653   EFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLT  474
             ++ R P+PE  L GLW+   + ++P++V+ PYGGMM +I ES TPFPHRKG    I+Y +
Sbjct  376   DYARKPIPEKALEGLWEKLFEAESPLVVFTPYGGMMNQISESQTPFPHRKGTKFMILYWS  435

Query  473   SWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             SW+   E   KH++W R++Y YM  YVSK+PREAYVNYRD+DLGMN N  N SF EASV+
Sbjct  436   SWQDAKENVAKHINWTRKVYSYMTPYVSKNPREAYVNYRDIDLGMNNNS-NASFVEASVF  494

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             G KYFK NF RLV VKT+VDPDNFF HEQSIP LS
Sbjct  495   GTKYFKDNFYRLVHVKTKVDPDNFFRHEQSIPPLS  529



>ref|XP_010478512.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=527

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/512 (62%), Positives = 391/512 (76%), Gaps = 9/512 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S +IQ  F  C+  +S  S P  ++FF+   NASSF   L+++ QNL +L+PS PKP  I
Sbjct  21    SSTIQQDFVMCLVDNSDASFPMDSSFFTHELNASSFKDALETSAQNLRYLMPSNPKPEFI  80

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             F PL E+HVQAAVVC K+  + LR+RSGGHD+EGLSY S+ME+   FV++DL+KLR I V
Sbjct  81    FEPLYETHVQAAVVCAKKLKLHLRLRSGGHDYEGLSYVSEMETA--FVIVDLSKLRQISV  138

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+E NS WV AGA+ GEVYYR+ EKSK  GFPAG C SLGIGGHI GGAYG+M+RK+GL 
Sbjct  139   DLESNSAWVHAGASIGEVYYRIQEKSKIHGFPAGLCTSLGIGGHIIGGAYGSMMRKFGLG  198

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN LDARIVDA G++L+RAAMGED+FWAIRGGGGGSFG++LAWKIKLVPVP TVTVFTV
Sbjct  199   ADNVLDARIVDADGKILNRAAMGEDVFWAIRGGGGGSFGVILAWKIKLVPVPETVTVFTV  258

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              RTLEQ+ TKLLYKWQ+VADKLDEDL ++V+I   + T    +RT+ T++   FLG  +R
Sbjct  259   TRTLEQDGTKLLYKWQQVADKLDEDLFIRVIIQPASKTPKSKERTIATSYQGQFLGDANR  318

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL++M  SFP+LGLT KDCLE SWI+SV+Y A +P T P E LL GK LF K +FKAKS+
Sbjct  319   LLQVMQRSFPQLGLTKKDCLETSWIKSVMYIAGFPSTAPSEALLDGKSLF-KNYFKAKSD  377

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             ++  P+P  GL GLW+  L+ED+P+ +WNPYGGMMAKIPE+ TPFPHR G + KI +LT 
Sbjct  378   YVEEPIPVEGLEGLWEKILEEDSPLTIWNPYGGMMAKIPENETPFPHRSGTLFKIQWLTL  437

Query  470   WKI-EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWG  294
             W+  +  + KH+ W+R MY YM  YVSKSPR AYVNYRDLDLGMN  G      +A  WG
Sbjct  438   WQDGKASEAKHMGWMREMYSYMEQYVSKSPRSAYVNYRDLDLGMNGKG-----GDAREWG  492

Query  293   YKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
              KYFKGNFERLV +K + DP+NFF HEQSIP 
Sbjct  493   SKYFKGNFERLVNIKAKFDPENFFRHEQSIPT  524



>emb|CDX77568.1| BnaA07g07060D [Brassica napus]
Length=534

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/507 (62%), Positives = 387/507 (76%), Gaps = 9/507 (2%)
 Frame = -2

Query  1715  HQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPLT  1536
               F  C+  +S  S P  ++FF+   NASSF   L+++ QNL +L+PS PKP  IF PL 
Sbjct  33    QDFVMCLVDNSDASFPMDSSFFTHDLNASSFKQALETSAQNLRYLMPSKPKPEFIFEPLY  92

Query  1535  ESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVEDN  1356
             E+HVQAAVVC K+  + LR+RSGGHD+EGLSY S+ME+   FV++DL+KLR I VD+E N
Sbjct  93    ETHVQAAVVCAKKLRLHLRLRSGGHDYEGLSYVSEMETA--FVIVDLSKLRQINVDLESN  150

Query  1355  SVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNAL  1176
             + WV AGA+ GEVYYR+ EKSK  GFPAG C SLGIGGHI GGAYG+M+RK+GL ADN L
Sbjct  151   TAWVHAGASIGEVYYRIQEKSKVHGFPAGLCTSLGIGGHIIGGAYGSMMRKFGLGADNVL  210

Query  1175  DARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTLE  996
             DARIVDA G++L+RAAMGED+FWAIRGGGGGSFG++LAWKIKLVPVP  VTVFTV +TLE
Sbjct  211   DARIVDAKGKILNRAAMGEDVFWAIRGGGGGSFGVILAWKIKLVPVPEIVTVFTVTKTLE  270

Query  995   QNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKIM  816
             Q+ T++LYKWQ+VADKLDE+L ++ +I   + T    +RT+  ++   FLG   RLL++M
Sbjct  271   QDGTRILYKWQQVADKLDENLFIRAIIQPASKTPKSKERTISVSYQGQFLGDAKRLLQVM  330

Query  815   NHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRTP  636
               SFP+LGLT KDCLE SWI+SV+Y A +P T PPE LL GK LF K +FKAKS+++  P
Sbjct  331   QRSFPQLGLTKKDCLETSWIKSVMYIAGFPSTAPPEALLAGKSLF-KNYFKAKSDYVEKP  389

Query  635   VPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKI-E  459
             +P  GL GLWK  L+ED+P+ +WNPYGGMMAKIPE+ TPFPHR G + KI +LT W+  +
Sbjct  390   IPIEGLEGLWKKLLEEDSPLTIWNPYGGMMAKIPETETPFPHRSGTLFKIQWLTLWQDGK  449

Query  458   GEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFK  279
               + KH++W+R MY YM  YVSKSPR AYVNYRDLDLGM  NGR T   +A  WG KYFK
Sbjct  450   ASEAKHMEWMRNMYSYMEKYVSKSPRSAYVNYRDLDLGM--NGRGT---DAREWGKKYFK  504

Query  278   GNFERLVAVKTRVDPDNFFWHEQSIPV  198
             GNFERLV +K + DP+NFF HEQSIP 
Sbjct  505   GNFERLVKIKAKFDPENFFRHEQSIPT  531



>ref|XP_006490234.1| PREDICTED: reticuline oxidase-like protein-like [Citrus sinensis]
Length=538

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/513 (63%), Positives = 394/513 (77%), Gaps = 12/513 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S+SI + F KC++ +S   IPFS  +     +  S   VL+S+ QNL +LVPS PKP  I
Sbjct  24    SISILNNFIKCLTTNSEVYIPFSNFYTPNNPSFLS---VLESSAQNLRYLVPSMPKPEFI  80

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPLTESH+QAAV+C++   + LRVRSGGHD+EGLSY S +E+P  F ++DLAKLR I+V
Sbjct  81    FTPLTESHLQAAVICSRYLRIHLRVRSGGHDYEGLSYVSQIETP--FFLLDLAKLRSIEV  138

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+ + + WVQAGAT GE+YYR++EKS   GF AG C S+GIGGHITGG YG M+RKYGLA
Sbjct  139   DINNKTAWVQAGATIGELYYRISEKSNIHGFAAGLCPSVGIGGHITGGGYGTMMRKYGLA  198

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DARIVDA GR+LDR AMGEDLFWAIRGGGGGSFGI+LAWK+KLVPVPATVTVFTV
Sbjct  199   ADNVVDARIVDAHGRILDREAMGEDLFWAIRGGGGGSFGIILAWKVKLVPVPATVTVFTV  258

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ AT++LYKWQ+VAD LDE L ++V+I   N T  KGKRTV T+++A+FLG  +R
Sbjct  259   SKTLEQGATEILYKWQQVADNLDEHLFIRVIIKLAN-TGPKGKRTVTTSYNALFLGDAER  317

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL++M+  FPELGLT  DC+E SWI+SV+Y A YP  T PE LL  + LF K++FKAKS+
Sbjct  318   LLQVMHKRFPELGLTRNDCIEKSWIKSVLYIAGYPYNTDPEILLEERSLF-KSYFKAKSD  376

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F++ P+PE+ L GLW++ L+   P M+WNPYGGMM+KI E   PFPHRKG + KI YLT 
Sbjct  377   FVKEPIPETVLEGLWEMLLEGHDPEMIWNPYGGMMSKISEYEIPFPHRKGNLFKIQYLTG  436

Query  470   WKIEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASV  300
             WK +G+ +   KH++ IRR+YDYM  YVS  PR AYVNYRDLDLGMNK   NTS+ EA+ 
Sbjct  437   WK-DGDNRTATKHIEGIRRIYDYMAPYVSMFPRAAYVNYRDLDLGMNKKC-NTSYIEAAT  494

Query  299   WGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             WG KYFK NF RLV VK  VDP N F HEQSIP
Sbjct  495   WGVKYFKENFNRLVRVKINVDPGNLFRHEQSIP  527



>ref|XP_010509704.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=529

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/508 (62%), Positives = 385/508 (76%), Gaps = 9/508 (2%)
 Frame = -2

Query  1718  QHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPL  1539
             Q  F +C+  +S  S P + +FFS   NA+ F   L+ST QNL +L PS PKP+ IF PL
Sbjct  27    QQDFMQCLVDNSDVSFPITASFFSPDQNATLFKEELESTAQNLRYLTPSNPKPVFIFEPL  86

Query  1538  TESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVED  1359
              E+HVQA VVC K+  VQLRVRSGGHD+EGLS+ +  E+   FVV+DL+KLR + VD++ 
Sbjct  87    YETHVQAMVVCAKKLQVQLRVRSGGHDYEGLSFVAGDETS--FVVVDLSKLRQVDVDLDS  144

Query  1358  NSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNA  1179
             NS W  AGATNGEVYYR+ EKS+  GFPAG C SLG+GGH+ GGAYG+M+RK+GL ADN 
Sbjct  145   NSAWAHAGATNGEVYYRIQEKSQTHGFPAGLCSSLGMGGHLVGGAYGSMMRKFGLGADNV  204

Query  1178  LDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTL  999
             LDARIVDA G++LDRAAMGED+FWAIRG GGGSFG++LAWKIKLVPVPATVTVFTV +TL
Sbjct  205   LDARIVDANGKILDRAAMGEDVFWAIRGAGGGSFGVILAWKIKLVPVPATVTVFTVTKTL  264

Query  998   EQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKI  819
             EQ+ T +LYKWQ+VADKLD+DL ++V+I+  + T     RT+  +F A FLG + RLL+I
Sbjct  265   EQDGTNVLYKWQQVADKLDDDLFIRVIISPASKTTGSAVRTISMSFQAQFLGDSKRLLEI  324

Query  818   MNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRT  639
             M   FPELGLT KDC EMSWI+SV+Y A +P +  PE LL GK LF K  FKAKS+F++ 
Sbjct  325   MQKDFPELGLTGKDCTEMSWIKSVMYIAGFPNSAAPEALLAGKSLF-KNHFKAKSDFVKE  383

Query  638   PVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKI-  462
             P+P  GL GLWK FL ED+P+ +WNPYGGMM++I ES TPFPHR+G + KI +L++W+  
Sbjct  384   PIPVEGLEGLWKRFLAEDSPLTIWNPYGGMMSRISESETPFPHREGTLFKIQWLSTWQDG  443

Query  461   EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYF  282
             E  + KH+ WIR MYDYM  YVSK PR+AYVNYRDLDLG NK G     S+   WG KY+
Sbjct  444   EASEAKHMKWIREMYDYMEQYVSKDPRQAYVNYRDLDLGTNKEG-----SDVREWGAKYY  498

Query  281   KGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             KGNFERLV +K   DPDNFF HEQS+P 
Sbjct  499   KGNFERLVKIKGEFDPDNFFRHEQSVPT  526



>ref|XP_010499624.1| PREDICTED: reticuline oxidase-like protein [Camelina sativa]
Length=527

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/511 (63%), Positives = 393/511 (77%), Gaps = 11/511 (2%)
 Frame = -2

Query  1724  SIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFT  1545
             +IQ  F  C+  +S  S P  ++FF+   NASSF + L+++ QNL +L+PS PKP  IF 
Sbjct  23    TIQQDFVMCLVDNSDASFPMDSSFFTHELNASSFKAALETSAQNLRYLMPSNPKPEFIFE  82

Query  1544  PLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDV  1365
             PL E+HVQAAVVC K+  + LR+RSGGHD+EGLSY S+ME+   FV++DL+KLR I VD+
Sbjct  83    PLYETHVQAAVVCAKKLKLHLRLRSGGHDYEGLSYVSEMETA--FVIVDLSKLRQISVDL  140

Query  1364  EDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAAD  1185
             E NS WV AGA+ GEVYYR+ EKSK  GFPAG C SLGIGGHI GGAYG+M+RK+GL AD
Sbjct  141   ESNSAWVHAGASIGEVYYRIQEKSKIHGFPAGLCTSLGIGGHIIGGAYGSMMRKFGLGAD  200

Query  1184  NALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPR  1005
             N LDARIVDA G++L+RAAMGED+FWAIRGGGGGSFG++LAWKIKLVPVP TVTVFTV R
Sbjct  201   NVLDARIVDADGKILNRAAMGEDVFWAIRGGGGGSFGVILAWKIKLVPVPETVTVFTVTR  260

Query  1004  TLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLL  825
             TLEQ+ TKLLYKWQ+VADKLDEDL ++V+I   + T    +RT+ T++   FLG  +RLL
Sbjct  261   TLEQDGTKLLYKWQQVADKLDEDLFIRVIIQPASKTPKSKERTIATSYQGQFLGDANRLL  320

Query  824   KIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFL  645
             ++M  SFP+LGLT KDCLE SWI+SV+Y A +P T P E LL GK LF K +FKAKS+++
Sbjct  321   QVMQRSFPQLGLTKKDCLETSWIKSVMYIAGFPSTAPSEALLDGKSLF-KNYFKAKSDYV  379

Query  644   RTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWK  465
               P+P  GL GLW+  L+ED+P+ +WNPYGGMMAKIPE+ TPFPHR G + KI +LT W+
Sbjct  380   EEPIPIEGLEGLWEKLLEEDSPLTIWNPYGGMMAKIPETETPFPHRSGTLFKIQWLTLWQ  439

Query  464   IEGE--KKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGY  291
              +G+  + KH+ W+R MY YM  YVSKSPR AYVNYRDLDLGMN  G N     A  WG 
Sbjct  440   -DGKVSEVKHMGWMREMYSYMEQYVSKSPRSAYVNYRDLDLGMNGKGGN-----AREWGS  493

Query  290   KYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             KYFKGNFERLV +K + DP+NFF HEQSIP 
Sbjct  494   KYFKGNFERLVNIKAKFDPENFFRHEQSIPT  524



>ref|XP_006410631.1| hypothetical protein EUTSA_v10016496mg [Eutrema salsugineum]
 gb|ESQ52084.1| hypothetical protein EUTSA_v10016496mg [Eutrema salsugineum]
Length=534

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/509 (61%), Positives = 386/509 (76%), Gaps = 9/509 (2%)
 Frame = -2

Query  1721  IQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTP  1542
             +Q  F +C+  +S  S P + +FFS   NA+ F   L+ST QNL +L PS PKP+ IF P
Sbjct  31    LQQDFMQCLVDNSDISFPITASFFSPDQNATLFKEELESTAQNLRYLTPSNPKPVFIFEP  90

Query  1541  LTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVE  1362
             L E+HVQAAVVC K+  + LRVRSGGHD+EGLS+ S+ E+P  FV++DL+KLR I VD++
Sbjct  91    LYETHVQAAVVCAKKLQLHLRVRSGGHDYEGLSFVSENETP--FVIVDLSKLRQIDVDLD  148

Query  1361  DNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADN  1182
              NS W  AGAT GEVYYR+ EKS+  GFPAG C SLG+GGH+ GGAYG+M+RK+GL ADN
Sbjct  149   SNSAWAHAGATIGEVYYRIQEKSQTHGFPAGLCSSLGVGGHLVGGAYGSMMRKFGLGADN  208

Query  1181  ALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRT  1002
              LDARIVDA G++LDRAAMGED+FWAIRGGGGGSFG++LAWKIKLVPVPA VTVFTV +T
Sbjct  209   VLDARIVDANGKILDRAAMGEDVFWAIRGGGGGSFGVILAWKIKLVPVPAIVTVFTVTKT  268

Query  1001  LEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLK  822
             LEQ+ TK+LYKWQ+VADKLDEDL ++V+I     T   G RT+ T++   FLG ++RLL+
Sbjct  269   LEQDGTKVLYKWQQVADKLDEDLFIRVIIQTAGKTTKTGNRTISTSYQGQFLGDSNRLLQ  328

Query  821   IMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLR  642
             +M  SFPELGLT KDC+EMSWI+SV+Y A +P +  PE LL GK LF K  FKAKS+F++
Sbjct  329   VMQKSFPELGLTKKDCVEMSWIKSVMYIAGFPNSAAPEALLDGKSLF-KNHFKAKSDFVK  387

Query  641   TPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKI  462
              P+P  GL GLWK  L+ED+P+ +WNPYGGMMA+I ES  PFPHR G + KI +LT+W  
Sbjct  388   EPIPVEGLEGLWKKLLQEDSPLTIWNPYGGMMARIAESEIPFPHRNGTLFKIQWLTTWSD  447

Query  461   -EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKY  285
              +  + KH+ W+R MY YM  YVSK+PR AYVNYRDLDLG+N+       S+A  WG KY
Sbjct  448   GKASEAKHMKWMREMYSYMEKYVSKNPRAAYVNYRDLDLGVNEEE-----SDAREWGSKY  502

Query  284   FKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             FKGNFERLV +K   DP+N F HEQSIP 
Sbjct  503   FKGNFERLVKIKGEFDPENLFRHEQSIPT  531



>ref|XP_006415426.1| hypothetical protein EUTSA_v10007327mg [Eutrema salsugineum]
 gb|ESQ33779.1| hypothetical protein EUTSA_v10007327mg [Eutrema salsugineum]
Length=534

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/510 (61%), Positives = 389/510 (76%), Gaps = 9/510 (2%)
 Frame = -2

Query  1724  SIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFT  1545
             +IQ  F  C+  +S  S P  ++FF+   NASSF   L+++ QNL +L+PS PKP  IF 
Sbjct  30    TIQQDFVMCLVDNSDASFPMDSSFFTNDLNASSFKLALETSAQNLRYLMPSNPKPEFIFE  89

Query  1544  PLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDV  1365
             PL E+HVQAAV C K+  + LR+RSGGHD+EGLSY S+ME+   FV++DL+KLR I VD+
Sbjct  90    PLYETHVQAAVFCAKKLRLHLRLRSGGHDYEGLSYVSEMETA--FVIVDLSKLRHINVDL  147

Query  1364  EDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAAD  1185
             E N+ WV AGA+ GEVYYR+ EKSK  GFPAG C SLGIGGHI GGAYG+M+RK+GL AD
Sbjct  148   ESNTAWVHAGASIGEVYYRIQEKSKIHGFPAGLCTSLGIGGHIIGGAYGSMMRKFGLGAD  207

Query  1184  NALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPR  1005
             N LDARIV+A G++L+RAAMGED+FWAIRGGGGGSFG++LAWKIKLVPVP  VTVFTV R
Sbjct  208   NVLDARIVNADGKILNRAAMGEDVFWAIRGGGGGSFGVILAWKIKLVPVPEIVTVFTVTR  267

Query  1004  TLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLL  825
             TLEQ+ TK+L+ WQ+VADKLD+DL ++V+I   + TA   +RT+ T++   FLG  +RLL
Sbjct  268   TLEQDGTKVLHTWQQVADKLDDDLFIRVIIQPASKTAKSKERTISTSYQGQFLGDANRLL  327

Query  824   KIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFL  645
             ++M  SFP+LGLT KDCLE SWI+SV+Y A YP T P E LL GK LF K +FKAKS+++
Sbjct  328   QVMQRSFPQLGLTKKDCLETSWIKSVMYIAGYPSTAPSEALLDGKSLF-KNYFKAKSDYV  386

Query  644   RTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWK  465
               P+P  GL GLWK  L+ED+P+ +WNPYGGMMA+IPE+ TPFPHR G + KI +LT W+
Sbjct  387   EEPIPIEGLEGLWKKLLEEDSPLTIWNPYGGMMARIPETETPFPHRSGTLFKIQWLTLWQ  446

Query  464   I-EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYK  288
               +  + KH++W+R MY YM  YVSK+PR AYVNYRDLDLG N  G     S+A  WG K
Sbjct  447   DGKASEAKHMEWMREMYSYMEQYVSKNPRSAYVNYRDLDLGTNGKG-----SDAREWGNK  501

Query  287   YFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             YFKGNFERLV VK + DP+NFF HEQSIP 
Sbjct  502   YFKGNFERLVKVKAKFDPENFFRHEQSIPT  531



>ref|XP_011001957.1| PREDICTED: tetrahydrocannabinolic acid synthase-like isoform 
X3 [Populus euphratica]
Length=534

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/526 (59%), Positives = 391/526 (74%), Gaps = 7/526 (1%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             I+S+L   L+F  + VSL IQ +F KC+SL+S +S PFST  ++   ++ +   VL ST 
Sbjct  8     IVSMLVILLSFPFFIVSLPIQDKFLKCLSLYSESSFPFSTILYTPNNSSFTN--VLLSTA  65

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL F +PS PKP  IFTPL ESHVQ AVVC+K+ GV +RVRSGGHDFEGLSYTS +++P
Sbjct  66    QNLRFALPSVPKPEFIFTPLQESHVQTAVVCSKQLGVHIRVRSGGHDFEGLSYTSVIDTP  125

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DL KLR I VD++  S W  AGAT GE++YR++EKSKNLGF AG C S+G+GGH
Sbjct  126   --FIVVDLGKLRSISVDIKRKSAWAHAGATVGELHYRISEKSKNLGFLAGACPSVGLGGH  183

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ++GG YG + RKYGL+ADN +DARIVD  GR+LDR AMGEDLFWAIRGGGG SFGI+ AW
Sbjct  184   LSGGGYGPLFRKYGLSADNVIDARIVDVQGRLLDRIAMGEDLFWAIRGGGGASFGIITAW  243

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLVPVP+TVTVF V R LEQ ATKLLY+WQ+VA+K D DL L V I    ++   GK+
Sbjct  244   KVKLVPVPSTVTVFRVFRFLEQGATKLLYRWQQVANKFDVDLYLVVGIRPAIASDT-GKK  302

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV+T +   FLG T RLL++M  SFPELGL  KDC+EM WI SV++ A +P  + PE LL
Sbjct  303   TVRTIYSGFFLGDTSRLLEVMQKSFPELGLARKDCIEMEWIGSVLHEAFFPANSTPEVLL  362

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
               K LFP  + K+KS+F ++P+ E+ L+GLWKIF +ED    +  PYGGMM KI +S  P
Sbjct  363   QRKNLFP-AYTKSKSDFAQSPISETALKGLWKIFFQEDKLATLLIPYGGMMDKISKSEIP  421

Query  518   FPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             FPHRKG +  + Y T+W    E    +DW R++Y+YM  YVSK+PREAY+N+RD+DLGMN
Sbjct  422   FPHRKGNLFMLEYATNWNDPSESATQIDWARKVYEYMTPYVSKNPREAYLNHRDIDLGMN  481

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             +   NTS  EA VWG KYFKGNF RLV VKTRVDP+NFF +EQSIP
Sbjct  482   EKA-NTSIEEARVWGTKYFKGNFNRLVKVKTRVDPENFFRYEQSIP  526



>ref|XP_010519048.1| PREDICTED: reticuline oxidase-like protein [Tarenaya hassleriana]
Length=533

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/532 (59%), Positives = 398/532 (75%), Gaps = 13/532 (2%)
 Frame = -2

Query  1787  SPIILSILFTF-LTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVL  1611
             +P  +++L T    FS    S +++  F  C+  ++  + P S+A F+   NA+ +  VL
Sbjct  7     TPTAIALLLTITFAFSASPTSATLRQDFVMCLVENADIAFPISSALFARDVNATLYKQVL  66

Query  1610  QSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSD  1431
             +ST QNL +L  S+PKP  IF PL E+HVQAAV+C K+  + LRVRSGGHD+EG+SY S+
Sbjct  67    ESTAQNLRYLTASSPKPEFIFEPLYETHVQAAVLCGKKLRLNLRVRSGGHDYEGVSYVSE  126

Query  1430  MESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLg  1251
             M++P  FV++DL KLR + VDV+ NS WV AGAT GE+YYR+ EKS+  GFPAG C SLG
Sbjct  127   MKTP--FVIVDLCKLRQVDVDVDSNSAWVHAGATVGELYYRIQEKSRIHGFPAGLCTSLG  184

Query  1250  igghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGI  1071
             +GGHITGGAYG+M+RKYGL ADN LDARIV A G++L+RAAMGEDLFWA+RGGGGGSFG+
Sbjct  185   VGGHITGGAYGSMMRKYGLGADNVLDARIVAADGKILNRAAMGEDLFWALRGGGGGSFGV  244

Query  1070  LLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAV  891
             +LAWKIKLVPVP TVTVFTV +TLEQ+ T++LY+WQ+ ADKLD+DL ++V+I     +  
Sbjct  245   ILAWKIKLVPVPETVTVFTVTKTLEQDGTRVLYRWQQAADKLDDDLFIRVIIQTAKKSPK  304

Query  890   KGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP  711
               +RTV T++   FLG+ +RLL++M   FPELGLT KDC+E SWI+SV+Y A +P  TP 
Sbjct  305   GSERTVSTSYQGQFLGEANRLLQVMQRGFPELGLTRKDCIETSWIKSVMYIAGFPSGTPA  364

Query  710   EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPE  531
             E LL GK LF K +FKAKS+F+R P+P  GL GLWK F++ED+P+ +WNPYGGMMA+IPE
Sbjct  365   EALLAGKSLF-KNYFKAKSDFVREPIPVHGLEGLWKKFMEEDSPLTIWNPYGGMMARIPE  423

Query  530   SATPFPHRKGVICKIVYLTSWKIEGE--KKKHLDWIRRMYDYMGTYVSKSPREAYVNYRD  357
               TPFPHRKG +  I +LTSW+  GE  K+KH+ W+R MY YMG YVSK+PR AYVNYRD
Sbjct  424   DETPFPHRKGTLFMIQWLTSWREGGEGVKEKHMAWMRDMYGYMGAYVSKNPRCAYVNYRD  483

Query  356   LDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             L+LG N  G          WG KYFKGNFERLV VK  VDP NFF HEQSIP
Sbjct  484   LELGTNNGG-------GREWGRKYFKGNFERLVKVKAEVDPYNFFRHEQSIP  528



>gb|KEH31332.1| FAD-binding berberine family protein [Medicago truncatula]
Length=532

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/510 (61%), Positives = 390/510 (76%), Gaps = 9/510 (2%)
 Frame = -2

Query  1718  QHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPL  1539
             Q  F +C++++S  + PF T  ++    + +   +L S   NL  L PS PKP  IFTP 
Sbjct  28    QDSFVQCLNMNSDRTYPFHTTIYTPNEPSFAT--ILDSLAMNLRCLAPSTPKPEFIFTPS  85

Query  1538  TESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVED  1359
              +SHVQAAV+C+K+ G+ LRVRSGGHD+EGLSY S +E+P  F+V+DL KLRGI +D + 
Sbjct  86    QDSHVQAAVICSKKLGIHLRVRSGGHDYEGLSYVSKIETP--FIVVDLIKLRGISIDTKT  143

Query  1358  NSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNA  1179
             N+ WVQ+GAT GEVYYR+ EKS  LG+PAG C SLG+GGHITGGAYG ++RKYGL  DN 
Sbjct  144   NTAWVQSGATIGEVYYRIYEKSSVLGYPAGLCTSLGVGGHITGGAYGTLMRKYGLGVDNV  203

Query  1178  LDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTL  999
             LDARIVDA G +LDR AMGEDLFWAIRGGGGGSFGILL WKIKLVPVP TVTVFTV +TL
Sbjct  204   LDARIVDAKGNILDRKAMGEDLFWAIRGGGGGSFGILLWWKIKLVPVPPTVTVFTVTKTL  263

Query  998   EQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKI  819
             EQ ATK+L++WQ+VA  +DE+L ++V+I    S   K +RT+  +++AVFLG+   LL++
Sbjct  264   EQGATKILHRWQEVAPFIDENLFIRVIIQPAASVGNKTQRTITNSYNAVFLGEARTLLQV  323

Query  818   MNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRT  639
             M  SFPELGLT KDC E SWI+SV+Y A +P  TPPE LL GKP F K  FKAKS+F+R 
Sbjct  324   MKTSFPELGLTRKDCQETSWIKSVLYIAGFPSDTPPEVLLKGKPTF-KNSFKAKSDFVRE  382

Query  638   PVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKIE  459
             P+PE+G+ GLW+  L ED+P+M+WNPYGG M++  ES +PFPHR G + KI YL+ W+ E
Sbjct  383   PIPETGIEGLWQRLLSEDSPLMIWNPYGGKMSEFSESDSPFPHRNGTLYKIQYLSIWQ-E  441

Query  458   GEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKY  285
             G+K   KH+DWIR++Y+YM  YVSK PREAYVNYRDLDLG+N    +TS+ EA+ WGY+Y
Sbjct  442   GDKNVAKHVDWIRKLYNYMTPYVSKFPREAYVNYRDLDLGINSK-NSTSYIEATGWGYRY  500

Query  284   FKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             FKGNF +LV +KTRVDP+N F HEQSIP L
Sbjct  501   FKGNFNKLVQIKTRVDPENVFRHEQSIPPL  530



>ref|XP_008365994.1| PREDICTED: inactive tetrahydrocannabinolic acid synthase-like 
[Malus domestica]
Length=534

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/529 (59%), Positives = 395/529 (75%), Gaps = 10/529 (2%)
 Frame = -2

Query  1775  LSILFTFLTFS-PWA-VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQST  1602
             +S L+ FL  S  WA    S Q  F +C+S +S+TSIPFS+ F +   ++ +   VL+S+
Sbjct  7     ISSLYLFLVLSTSWAHPPPSTQENFIQCLSHYSNTSIPFSSDFLTPKNSSFTA--VLESS  64

Query  1601  VQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMES  1422
              QNL +LV S PKP  IFTP+ +SHVQAAV+C K+  + LR RSGGHD+EGLSY S +E+
Sbjct  65    AQNLRYLVSSVPKPDFIFTPVHDSHVQAAVICAKKLRIHLRFRSGGHDYEGLSYVSQIET  124

Query  1421  PAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigg  1242
             P  F V+DLA LR + VD++ N+ WVQAGAT GE+YYR+AEKS+  G+PAG C SLG+GG
Sbjct  125   P--FAVVDLANLRSVSVDIKSNTAWVQAGATIGELYYRIAEKSQTHGYPAGICTSLGVGG  182

Query  1241  hitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLA  1062
             HITGGAYG+M+RKYGL ADN +DARI+D+ G++LDR  MGEDLFWAIRGGGG SFGI+L 
Sbjct  183   HITGGAYGSMMRKYGLGADNVVDARIIDSNGKILDRKTMGEDLFWAIRGGGGASFGIILW  242

Query  1061  WKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             WKIKLVPVP  VTVF+V +TLEQ ATK L++WQ+VA  +DEDL ++V I   N +   G 
Sbjct  243   WKIKLVPVPQNVTVFSVAKTLEQGATKFLHRWQQVAPFVDEDLFIRVFIQVSNDSKT-GN  301

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             +T+ T + A FLG +  LL +M  SFPELGLT  DC E SWI+SV+Y A YP  TP E L
Sbjct  302   KTITTVYQAQFLGDSKXLLNVMQKSFPELGLTRNDCTETSWIKSVLYIAGYPSGTPTEIL  361

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK   PK +FKAKS+F++ P+PE  L GLWK  L+E +PVM+ NPYGGMM++I ESA 
Sbjct  362   LQGKATLPKIYFKAKSDFVKDPIPEITLEGLWKRLLQETSPVMILNPYGGMMSRISESAI  421

Query  521   PFPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGM  342
             PFPHR  V+ KI YLT W+  G++ +H++WIR++Y YM  YV+  PR+AYVNYRDLDLG 
Sbjct  422   PFPHRN-VLFKIQYLTVWQ-AGDEAEHMEWIRKLYSYMAPYVTMFPRQAYVNYRDLDLGT  479

Query  341   NKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NK   +T+F EA+ WGY+YFK NF RLV VKT++DPDNFF HEQSIP L
Sbjct  480   NKKS-STNFIEANSWGYRYFKDNFNRLVKVKTKIDPDNFFRHEQSIPPL  527



>gb|KDO52567.1| hypothetical protein CISIN_1g046361mg [Citrus sinensis]
Length=539

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/513 (62%), Positives = 392/513 (76%), Gaps = 12/513 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S+SI + F KC++ +S   IPFS  +     +  S   VL+S+ QNL +LVPS PKP  I
Sbjct  24    SISILNNFIKCLTANSEVYIPFSNFYTPNNPSFLS---VLESSAQNLRYLVPSMPKPEFI  80

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPLTESH+QAAV+C++   + LR RSGGHD+EG+SY S +E+P  F ++DLAKLR I+V
Sbjct  81    FTPLTESHLQAAVICSRHLRIHLRARSGGHDYEGVSYVSQIETP--FFLLDLAKLRSIEV  138

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+ + + WVQAGAT GE+YYR++EKS   GF AG C S+GIGGHITGG YG M+RKYGLA
Sbjct  139   DINNKTAWVQAGATIGELYYRISEKSNIHGFAAGLCPSVGIGGHITGGGYGTMMRKYGLA  198

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DARIVDA GR+LDR AMGEDLFWAIRGGGGGSFGI+LAWK+KLVPVPATVTVFTV
Sbjct  199   ADNVVDARIVDARGRILDREAMGEDLFWAIRGGGGGSFGIILAWKVKLVPVPATVTVFTV  258

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ AT++LYKWQ+VAD LDE L ++V+I   N T  KGKRTV T+++A+FLG  +R
Sbjct  259   SKTLEQGATEILYKWQQVADNLDEHLFIRVIIKLAN-TGPKGKRTVTTSYNALFLGDAER  317

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL++M+  FPELGLT  DC+E SWI+SV+Y A YP  T PE LL  + LF K++FKAKS+
Sbjct  318   LLQVMHKKFPELGLTRNDCIEKSWIKSVLYIAGYPNYTEPEILLEERSLF-KSYFKAKSD  376

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F++ P+ E+ L GLW++ L+   P M+WNPYGGMM+KI E   PFPHRKG + KI YLT 
Sbjct  377   FVKEPIAETVLEGLWEMLLEGHDPEMIWNPYGGMMSKISEYEIPFPHRKGNLFKIQYLTG  436

Query  470   WKIEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASV  300
             WK +G+ +   KH++ IRR+YDYM  YVS  PR AYVNYRDLDLGMNK   NTS+ EA+ 
Sbjct  437   WK-DGDNRTATKHIEGIRRIYDYMAPYVSMFPRAAYVNYRDLDLGMNKKC-NTSYIEAAT  494

Query  299   WGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             WG KYFK NF RLV VK  VDP N F HEQSIP
Sbjct  495   WGVKYFKENFNRLVRVKINVDPGNLFRHEQSIP  527



>ref|XP_009143741.1| PREDICTED: reticuline oxidase-like protein [Brassica rapa]
Length=532

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/527 (59%), Positives = 397/527 (75%), Gaps = 9/527 (2%)
 Frame = -2

Query  1775  LSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQ  1596
             ++   T L  S    S ++Q  F +C+  +S  S P + AF+S   NA+ F   L+ST Q
Sbjct  11    MAFAVTLLLVSIPMSSSTLQQDFLQCLVENSDISFPITAAFYSPDQNATLFKEELESTAQ  70

Query  1595  NLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPA  1416
             NL +L PS PKP+ IF P+ E+HVQAAVVC K+  + +RVRSGGHD+EGLS+ S+ E+P 
Sbjct  71    NLRYLTPSNPKPVFIFEPMYETHVQAAVVCAKKLQLHMRVRSGGHDYEGLSFVSENETP-  129

Query  1415  PFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghi  1236
              FV++DL+KLR I VDV+ NS W  AGAT GEVYYR+ EKS+  GFPAG C SLGIGGH+
Sbjct  130   -FVIVDLSKLRQIDVDVDSNSAWAHAGATVGEVYYRIQEKSQTHGFPAGLCSSLGIGGHL  188

Query  1235  tggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWK  1056
              GGAYG+M+RK+GL ADN LDARI+DA G++LDRAAMGED+FWA+RGGGGGSFG++LAWK
Sbjct  189   VGGAYGSMMRKFGLGADNVLDARIIDANGKILDRAAMGEDVFWALRGGGGGSFGVILAWK  248

Query  1055  IKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRT  876
             IKLVPVPATVTVFTV +TLEQ+ TK+LYKWQ+VADKLDEDL ++V+I   + T   G RT
Sbjct  249   IKLVPVPATVTVFTVTKTLEQDGTKVLYKWQQVADKLDEDLFIRVIIQTASKTTKPGNRT  308

Query  875   VQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLH  696
             + T++   FLG ++RL+++M  SFPELGLT KDC EMSWI+SV+Y A +P +  PE LL 
Sbjct  309   ISTSYQGQFLGDSNRLMQVMQKSFPELGLTKKDCTEMSWIKSVMYIAGFPSSAAPEALLD  368

Query  695   GKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPF  516
             GK LF K++FKAKS+F+  P+P  GL GLWK  L+ED+P+ +WNPYGG+M++I ES  PF
Sbjct  369   GKSLF-KSYFKAKSDFVEEPIPVEGLEGLWKKLLEEDSPLTIWNPYGGVMSRIAESEIPF  427

Query  515   PHRKGVICKIVYLTSWKI-EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             PHRKG + KI +L+SW   +   ++H+ W+R MY YM  YVSK+PR AYVNYRDLDLG+N
Sbjct  428   PHRKGTLFKIQWLSSWSDGKASDERHMKWMREMYSYMEKYVSKNPRRAYVNYRDLDLGVN  487

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             +       S+A  WG KYFKGNFERLV +K   DP+NFF HEQSIP 
Sbjct  488   EEE-----SDAREWGTKYFKGNFERLVKIKGEFDPENFFRHEQSIPT  529



>ref|XP_006398052.1| hypothetical protein EUTSA_v10000846mg [Eutrema salsugineum]
 gb|ESQ39505.1| hypothetical protein EUTSA_v10000846mg [Eutrema salsugineum]
Length=540

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/530 (58%), Positives = 403/530 (76%), Gaps = 8/530 (2%)
 Frame = -2

Query  1778  ILSILFTF-LTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQST  1602
             +L++ F+F  T +P + S S+QH F +C+  +++   P    FF+   N S F+ VL+ST
Sbjct  15    LLALSFSFYCTITPTS-STSLQHDFIECIHRNTNVDFPLEKTFFTPARNVSIFSEVLEST  73

Query  1601  VQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMES  1422
              QNL FL  S PKP  IFTP+ ESHVQA+++C+K+  + LRVRSGGHD+EGLSY S++E 
Sbjct  74    AQNLRFLTNSMPKPGFIFTPVHESHVQASIICSKKLRIHLRVRSGGHDYEGLSYVSEIEK  133

Query  1421  PAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigg  1242
             P  F+++DL+KLR I V+++DN+ WVQAGAT GE+YYR+AEKSK  GFPAG C SLGIGG
Sbjct  134   P--FILLDLSKLRQINVNIKDNNAWVQAGATVGELYYRIAEKSKVHGFPAGLCSSLGIGG  191

Query  1241  hitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLA  1062
             HITGGAYG+++RK+GLA DN LDA+IVDA G++LDR++MGED+FWAI GGGG SFG++LA
Sbjct  192   HITGGAYGSLMRKFGLAGDNVLDAKIVDANGKLLDRSSMGEDMFWAISGGGGASFGVILA  251

Query  1061  WKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             WKIKLVPV  TVTVFTV +TLEQ+AT++L KWQ+VADKL E+L ++V+     S    G 
Sbjct  252   WKIKLVPVSKTVTVFTVTKTLEQDATRILSKWQEVADKLVEELFIRVIFNVAGSL---GN  308

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             +TV T+++ +FLG  D L+K+M  SFPELGLT KDC+EMSWIES++Y A +P  TP   L
Sbjct  309   KTVTTSYNTLFLGDKDALMKVMKRSFPELGLTRKDCVEMSWIESIVYIAGFPSGTPTNVL  368

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK  FPK  FKAKS+F++ P+PE GL G++K  LKED+P M+W PYGGMMA+I ES  
Sbjct  369   LQGKSPFPKINFKAKSDFVKNPIPELGLIGMFKKLLKEDSPTMMWTPYGGMMARISESQI  428

Query  521   PFPHRKGVICKIVYLTSWKIEGEKK-KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLG  345
             PFPHR+GVI KI Y+T W    ++  +H+ WIR +Y +M  YVS +PR+AYVNYRDLDLG
Sbjct  429   PFPHREGVIFKIQYITVWPDSDKRPIRHIKWIRDLYKFMTPYVSSNPRQAYVNYRDLDLG  488

Query  344   MNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              NK   +++   A VWG +YFK NF RLV +K++VDP+NFF HEQSIP L
Sbjct  489   KNKKNASSNLKNARVWGRQYFKNNFNRLVRIKSKVDPENFFRHEQSIPPL  538



>ref|XP_002881357.1| EDA28/MEE23 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57616.1| EDA28/MEE23 [Arabidopsis lyrata subsp. lyrata]
Length=532

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/511 (61%), Positives = 396/511 (77%), Gaps = 11/511 (2%)
 Frame = -2

Query  1724  SIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFT  1545
             ++Q  F KC+  +S  S P + +FFS   NA+ F   L+ST QNL +L PS PKP+ IF 
Sbjct  28    TLQQDFVKCLVDNSDVSFPITASFFSPDQNATLFKEELESTAQNLRYLTPSYPKPVFIFE  87

Query  1544  PLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDV  1365
             PL E+HVQAAVVC K+  + LR+RSGGHD+EGLS+ ++ E+P  FV++DL+KLR + VD+
Sbjct  88    PLYETHVQAAVVCAKKLQLHLRLRSGGHDYEGLSFVAEDETP--FVIVDLSKLRQVDVDL  145

Query  1364  EDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAAD  1185
             + NS W  AGAT GEVYYR+ EKS++ GFPAG C SLGIGGH+ GGAYG+M+RK+GL AD
Sbjct  146   DSNSAWAHAGATIGEVYYRIQEKSQSHGFPAGLCSSLGIGGHLVGGAYGSMMRKFGLGAD  205

Query  1184  NALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPR  1005
             N LDARIVDA G++LDRAAMGED+FWAIRGGGGGSFG++LAWKIKLVPVPATVTVFTV +
Sbjct  206   NVLDARIVDANGQILDRAAMGEDVFWAIRGGGGGSFGVILAWKIKLVPVPATVTVFTVTK  265

Query  1004  TLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLL  825
             TLEQ+ TK+LYKWQ+VADKLD+DL ++V+I+  + T   G RT+  ++ A FLG ++RLL
Sbjct  266   TLEQDGTKVLYKWQQVADKLDDDLFIRVIISPASKTTKPGNRTISMSYQAQFLGDSNRLL  325

Query  824   KIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFL  645
             ++M  SFPELGLT KDC EMSWI+SV+Y A +P + PPE LL GK LF K  FKAKS+F+
Sbjct  326   QVMQKSFPELGLTKKDCTEMSWIKSVMYIAGFPNSAPPEALLAGKSLF-KNHFKAKSDFV  384

Query  644   RTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWK  465
             + P+P  GL GLW+ FL+ED+P+ +WNPYGGMM++I ES  PFPHR G + KI +L++W+
Sbjct  385   KEPIPVEGLEGLWERFLEEDSPLTIWNPYGGMMSRISESEIPFPHRNGTLFKIQWLSTWQ  444

Query  464   IEGE--KKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGY  291
              +G+  + +H+ WIR MY YM  YVSK+PR+AYVNYRDLDLG N+       S+A  WG 
Sbjct  445   -DGKVSETRHMKWIREMYSYMEQYVSKNPRQAYVNYRDLDLGTNEGE-----SDAREWGA  498

Query  290   KYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             KY+KGNFERLV +K   DPDNFF HEQS+P 
Sbjct  499   KYYKGNFERLVKIKGEFDPDNFFRHEQSVPT  529



>ref|XP_006421541.1| hypothetical protein CICLE_v10006703mg [Citrus clementina]
 gb|ESR34781.1| hypothetical protein CICLE_v10006703mg [Citrus clementina]
Length=538

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/513 (62%), Positives = 392/513 (76%), Gaps = 12/513 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S+SI + F KC++ +S   IPFS  +     +  S   VL+S+ QNL +LVPS PKP  I
Sbjct  24    SISILNNFIKCLTANSEVYIPFSNFYTPNNPSFLS---VLESSAQNLRYLVPSMPKPEFI  80

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTPLTESH+QAAV+C++   + LR RSGGHD+EG+SY S +E+P  F ++DLAKLR I+V
Sbjct  81    FTPLTESHLQAAVICSRHLRIHLRARSGGHDYEGVSYVSQIETP--FFLLDLAKLRSIEV  138

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+ + + WVQAGAT GE+YYR++EKS   GF AG C S+GIGGHITGG YG M+RKYGLA
Sbjct  139   DINNKTAWVQAGATIGELYYRISEKSNIHGFAAGLCPSVGIGGHITGGGYGTMMRKYGLA  198

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DARIVDA GR+LDR AMGEDLFWAIRGGGGGSFGI+LAWK+KLVPVPATVTVFTV
Sbjct  199   ADNVVDARIVDARGRILDREAMGEDLFWAIRGGGGGSFGIILAWKVKLVPVPATVTVFTV  258

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ AT++LYKWQ+VAD LDE L ++V+I   N T  KGKRTV T+++A+FLG  +R
Sbjct  259   SKTLEQGATEILYKWQQVADNLDEHLFIRVIIKLAN-TGPKGKRTVTTSYNALFLGDAER  317

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL++M+  FPELGLT  DC+E SWI+SV+Y A YP  T PE LL  + LF K++FKAKS+
Sbjct  318   LLQVMHKKFPELGLTRNDCIEKSWIKSVLYIAGYPNYTEPEILLEERSLF-KSYFKAKSD  376

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F++ P+ E+ L GLW++ L+   P M+WNPYGGMM+KI E   PFPHRKG + KI YLT 
Sbjct  377   FVKEPIAETVLEGLWEMLLEGHDPEMIWNPYGGMMSKISEYEIPFPHRKGNLFKIQYLTG  436

Query  470   WKIEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASV  300
             WK +G+ +   KH++ IRR+YDYM  YVS  PR AYVNYRDLDLGMNK   NTS+ EA+ 
Sbjct  437   WK-DGDNRTATKHIEGIRRIYDYMAPYVSMFPRAAYVNYRDLDLGMNKKC-NTSYIEAAT  494

Query  299   WGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             WG KYFK NF RLV VK  VDP N F HEQSIP
Sbjct  495   WGVKYFKENFNRLVRVKINVDPGNLFRHEQSIP  527



>ref|XP_006293979.1| hypothetical protein CARUB_v10022971mg [Capsella rubella]
 gb|EOA26877.1| hypothetical protein CARUB_v10022971mg [Capsella rubella]
Length=532

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/528 (59%), Positives = 400/528 (76%), Gaps = 11/528 (2%)
 Frame = -2

Query  1775  LSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQ  1596
             ++ L T L  S    + ++Q  F +C+  +S  S P + +F+S   NA+ F   L+ST Q
Sbjct  11    IAFLVTLLLVSVPLSTSTLQKDFMQCLVDNSDISFPITASFYSPDQNATLFKEELESTAQ  70

Query  1595  NLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPA  1416
             NL +L PS PKP+ IF PL E+HVQAAVVC K+  + LR+RSGGHD+EGLS+ ++ E+P 
Sbjct  71    NLRYLTPSNPKPVFIFEPLYETHVQAAVVCAKKLQLHLRLRSGGHDYEGLSFVAEGETP-  129

Query  1415  PFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghi  1236
              FVV+DL+KLR + VD++ NS W  AGAT GEVYYR+ EKS+  GFPAG C SLGIGGH+
Sbjct  130   -FVVVDLSKLRQVDVDLDSNSAWAHAGATIGEVYYRIQEKSQTHGFPAGLCSSLGIGGHL  188

Query  1235  tggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWK  1056
              GGAYG+M+RK+GL ADN LDARIVDA G++LDRAAMGED+FWAIRGGGGGSFG++LAWK
Sbjct  189   VGGAYGSMMRKFGLGADNVLDARIVDANGQILDRAAMGEDVFWAIRGGGGGSFGVILAWK  248

Query  1055  IKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRT  876
             IKLVPVPATVTVFTV +TLEQ+ T +LYKWQ+VADKLD+DL ++V+I+  + T   G RT
Sbjct  249   IKLVPVPATVTVFTVTKTLEQDGTNVLYKWQQVADKLDDDLFIRVIISPASKTTKPGNRT  308

Query  875   VQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLH  696
             +  ++ A FLG ++RL+++M  SFPELGLT KDC EMSWI+SV+Y A +P +  PE LL 
Sbjct  309   ISMSYQAQFLGDSNRLMQVMQKSFPELGLTNKDCTEMSWIKSVMYIAGFPNSAAPEALLA  368

Query  695   GKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPF  516
             GK LF K  FKAKS+F++ P+P  GL GLWK FL ED+P+ +WNPYGGMM++I ES  PF
Sbjct  369   GKSLF-KNHFKAKSDFVKEPIPVEGLEGLWKRFLVEDSPLTIWNPYGGMMSRISESEIPF  427

Query  515   PHRKGVICKIVYLTSWKIEGE--KKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGM  342
             PHR G + KI +L++W+ +G+  + KH+ WIR MY YM  YVSKSPR+AYVNYRDLDLG 
Sbjct  428   PHRNGTLFKIQWLSTWQ-DGKVSEAKHMTWIREMYSYMEQYVSKSPRQAYVNYRDLDLGT  486

Query  341   NKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             N+ G     S+A  WG KY+KGNFERLV +K   DPDNFF HEQS+P 
Sbjct  487   NEEG-----SDAREWGAKYYKGNFERLVKIKGEFDPDNFFRHEQSVPT  529



>ref|XP_004295436.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Fragaria 
vesca subsp. vesca]
Length=534

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/529 (59%), Positives = 397/529 (75%), Gaps = 13/529 (2%)
 Frame = -2

Query  1766  LFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLV  1587
             LF  L+ S      S Q++F +C+S HS+ S+PFS+ FF++ ++A +   +L ST QNL 
Sbjct  12    LFILLSSSSAKPPSSKQNRFIQCLSYHSNASVPFSSTFFTSNSSAFTT--ILNSTAQNLR  69

Query  1586  FLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFV  1407
             +L+ S PKP  IFTP  +S VQ AVVC+K+ G+ LRVRSGGHD+EGLSY S +E+P  F+
Sbjct  70    YLLLSKPKPEFIFTPTDDSQVQKAVVCSKQLGIHLRVRSGGHDYEGLSYVSQIETP--FI  127

Query  1406  VIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitgg  1227
             V+DL+KLR + VD++ NS W+QAGAT GEVYYR+AEKS+  GFPAG   SLG+GGHITGG
Sbjct  128   VVDLSKLRSVNVDIQSNSAWIQAGATIGEVYYRIAEKSRTHGFPAGLYTSLGVGGHITGG  187

Query  1226  aygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKL  1047
             AYG M+RKYGLAADN LDARIVD  GR+LDR  MG+DLFWAIRGGGG SFG++L WKIKL
Sbjct  188   AYGTMMRKYGLAADNVLDARIVDVNGRILDRKTMGKDLFWAIRGGGGASFGVILWWKIKL  247

Query  1046  vpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLI---TAVNSTAVKGKRT  876
             VPVP+TVTVF+V +TLEQ ATKLL++WQ+VA    +  L   ++   T V+S  + GKRT
Sbjct  248   VPVPSTVTVFSVSKTLEQGATKLLHRWQQVAATKLDRHLNIRVLIQPTVVDS--ISGKRT  305

Query  875   VQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLH  696
             + T F   FLG   RLL +M   FPEL LT KDC E +W+ SV+Y A Y   T PE LL 
Sbjct  306   ITTLFQGQFLGGVKRLLNVMQTGFPELNLTRKDCTESNWLNSVMYIAGYANGTRPEVLLQ  365

Query  695   GKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPF  516
             GKP F K++FKAKS+F++ P+PE+ L G+WK  L+E + +++WNPYGG+M++I ESA PF
Sbjct  366   GKPPF-KSYFKAKSDFVKDPIPETALEGIWKRMLEETSSLIIWNPYGGVMSEISESAIPF  424

Query  515   PHRKGVICKIVYLTSWKIEGEKK-KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             PHRK V+ KI YLT W    E + KH+DWIR++Y YM  YV+KSPR+AYVNYRDLDLG+N
Sbjct  425   PHRK-VLFKIQYLTGWLAANEDEAKHIDWIRKLYSYMTPYVTKSPRQAYVNYRDLDLGIN  483

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             K  +NTS +EAS WG +YFK NF RL+ +KT+VDP NFF HEQSIP L+
Sbjct  484   KK-KNTSIAEASAWGTRYFKDNFYRLIKIKTKVDPHNFFRHEQSIPPLA  531



>ref|XP_002890896.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67155.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=535

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/511 (62%), Positives = 390/511 (76%), Gaps = 11/511 (2%)
 Frame = -2

Query  1724  SIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFT  1545
             ++Q  F  C+  +S  S P  ++FF+   NASSF   L+++ QNL +L+PS PKP  IF 
Sbjct  31    TMQQDFVMCLVDNSDASFPMDSSFFTHDLNASSFKLALETSAQNLRYLMPSNPKPEFIFE  90

Query  1544  PLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDV  1365
             PL E+HVQAAV+C K+  + LR+RSGGHD+EGLSY S+ME+   FV++DL+KLR I VD+
Sbjct  91    PLYETHVQAAVLCAKKLKLHLRLRSGGHDYEGLSYVSEMETA--FVIVDLSKLRQISVDI  148

Query  1364  EDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAAD  1185
             E NS WV AGA+ GEVYYR+ EKSK  GFPAG C SLGIGGHI GGAYG+M+RK+GL AD
Sbjct  149   ESNSAWVHAGASIGEVYYRIQEKSKIHGFPAGLCTSLGIGGHIIGGAYGSMMRKFGLGAD  208

Query  1184  NALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPR  1005
             N LDARIVDA G++L+RAAMGED+FWAIRGGGGGSFG++LAWKIKLVPVP  VTVFTV R
Sbjct  209   NVLDARIVDADGKILNRAAMGEDVFWAIRGGGGGSFGVILAWKIKLVPVPEVVTVFTVTR  268

Query  1004  TLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLL  825
             TLEQ+ TKLL KWQ+VADKLDEDL ++V+I   + T    +RT+ T++   FLG  +RLL
Sbjct  269   TLEQDGTKLLSKWQQVADKLDEDLFIRVIIQPTSKTPKSKERTISTSYQGQFLGDANRLL  328

Query  824   KIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFL  645
             ++M  SFP+LGLT KDCLE SWI+SV+Y A +P T P E LL GK LF K +FKAKS+++
Sbjct  329   QVMQRSFPQLGLTKKDCLETSWIKSVMYIAGFPSTAPSEALLDGKSLF-KNYFKAKSDYV  387

Query  644   RTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWK  465
               P+P  GL GLW+  L+ED+P+ +WNPYGGMMAKIPE+ TPFPHR G + KI +LT W+
Sbjct  388   EEPIPIEGLEGLWEKLLEEDSPLTIWNPYGGMMAKIPETETPFPHRSGTLFKIQWLTLWQ  447

Query  464   IEGE--KKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGY  291
              +G+  + KH+DW+R MY YM  YVSKSPR AYVNYRDLDLG N  G     S+A  WG 
Sbjct  448   -DGKVSEAKHMDWMREMYSYMEQYVSKSPRSAYVNYRDLDLGRNGKG-----SDAREWGN  501

Query  290   KYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             KYFKGNFERLV +K   DP+NFF HEQSIP 
Sbjct  502   KYFKGNFERLVQIKATFDPENFFSHEQSIPT  532



>ref|XP_010494464.1| PREDICTED: cannabidiolic acid synthase-like 2 [Camelina sativa]
 ref|XP_010494465.1| PREDICTED: cannabidiolic acid synthase-like 2 [Camelina sativa]
Length=540

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/529 (59%), Positives = 399/529 (75%), Gaps = 9/529 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             IL++ F+  T +P +   S+Q QF  CV  ++H   P    FF+   N S F+ VL+ST 
Sbjct  15    ILALYFSLYTITPTSSLASLQDQFINCVQRNTHVYFPLEKTFFAPAKNVSMFSQVLESTA  74

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QN+ FL  S PKP  I +P+ ESHVQA+V+C K+  + LRVRSGGHD+EGLSY S +  P
Sbjct  75    QNIRFLKKSLPKPGFIISPIHESHVQASVICAKKLRMHLRVRSGGHDYEGLSYVSQIVKP  134

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+++DL+K+R   ++++DN+ WVQ+G+T GE+YYR+AEKSK  GFPAG C SLGIGGH
Sbjct  135   --FILLDLSKMRQADINIKDNTAWVQSGSTVGELYYRIAEKSKVHGFPAGLCSSLGIGGH  192

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYGAM+RKYGL ADN LDA+IVDA GR+LDRAAMGED FWAIRGG GGSFGI+LAW
Sbjct  193   ITGGAYGAMMRKYGLGADNVLDAKIVDANGRLLDRAAMGEDTFWAIRGGAGGSFGIILAW  252

Query  1058  KIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             KIKLVPVP TVTVFTV +TL+Q+   K++ KWQ+VADKL E+L ++VL    N     G 
Sbjct  253   KIKLVPVPQTVTVFTVTKTLQQDVGHKIISKWQRVADKLVEELFIRVLF---NVAGTGGN  309

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             +TV  +++++FLG    L+K+M  SFPELGLT KDC+EMSW+ES+ Y + +P  TP   L
Sbjct  310   KTVTMSYNSLFLGGKGTLMKVMKKSFPELGLTLKDCIEMSWLESIAYISGFPTHTPTNIL  369

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK  FPK  FKAKS+F++TP+PESGL+G+++  LKED P+M+WNPYGGMMAKIPES  
Sbjct  370   LQGKSPFPKVNFKAKSDFVKTPIPESGLKGMFQKLLKEDIPLMIWNPYGGMMAKIPESQI  429

Query  521   PFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
             PFPHRKGV+ K+ Y+TSW ++ +K+  KH++WIR  Y+YM  YVS +PR+AYVNYRDLDL
Sbjct  430   PFPHRKGVLFKVQYVTSW-LDSDKRPSKHMNWIRDFYNYMTPYVSSNPRQAYVNYRDLDL  488

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             G N     T + +A  WG  YFK NF RLV++K++VDP+NFF HEQSIP
Sbjct  489   GKNTKDTKTCYKQAQGWGANYFKNNFNRLVSIKSKVDPENFFRHEQSIP  537



>ref|XP_009102687.1| PREDICTED: reticuline oxidase-like protein [Brassica rapa]
Length=534

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/507 (61%), Positives = 385/507 (76%), Gaps = 9/507 (2%)
 Frame = -2

Query  1715  HQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPLT  1536
               F  C+  +S  S    ++FF+   NASSF   L+++ QNL +L+PS PKP  IF PL 
Sbjct  33    QDFVMCLVDNSDASFAMDSSFFTHDLNASSFKQALETSAQNLRYLMPSKPKPEFIFEPLY  92

Query  1535  ESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVEDN  1356
             E+HVQAAVVC K+  + LR+RSGGHD+EGLSY S+ME+   FV++DL+KLR I VD+E N
Sbjct  93    ETHVQAAVVCAKKLRLHLRLRSGGHDYEGLSYVSEMETA--FVIVDLSKLRQINVDLESN  150

Query  1355  SVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNAL  1176
             + WV AGA+ GEVYYR+ EKSK  GFPAG C SLGIGGHI GGAYG+M+RK+GL ADN L
Sbjct  151   TAWVHAGASIGEVYYRIQEKSKVHGFPAGLCTSLGIGGHIIGGAYGSMMRKFGLGADNVL  210

Query  1175  DARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTLE  996
             DARIVDA G++L+RAAMGED+FWAIRGGGGGSFG++LAWKIKLVPVP  VTVFTV +TLE
Sbjct  211   DARIVDAKGKILNRAAMGEDVFWAIRGGGGGSFGVILAWKIKLVPVPEIVTVFTVTKTLE  270

Query  995   QNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKIM  816
             Q+ T++LYKWQ+VADKLDE+L ++ +I   + T    +RT+  ++   FLG   RLL++M
Sbjct  271   QDGTRILYKWQQVADKLDENLFIRAIIQPASKTPKSKERTISVSYQGQFLGDAKRLLQVM  330

Query  815   NHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRTP  636
               SFP+LGLT KDCLE SWI+SV+Y A +P T PPE LL GK LF K +FKAKS+++  P
Sbjct  331   QRSFPQLGLTKKDCLETSWIKSVMYIAGFPSTAPPEALLAGKSLF-KNYFKAKSDYVEKP  389

Query  635   VPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKI-E  459
             +P  GL GLWK  L+ED+P+ +WNPYGGMMAKIPE+ TPFP R G + KI +LT W+  +
Sbjct  390   IPIEGLEGLWKKLLEEDSPLTIWNPYGGMMAKIPETETPFPRRSGTLFKIQWLTLWQDGK  449

Query  458   GEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFK  279
               + KH++W+R MY YM  YVSKSPR AYVNYRDLDLGM  NGR T   +A  WG KYFK
Sbjct  450   ASEAKHMEWMRNMYSYMEKYVSKSPRSAYVNYRDLDLGM--NGRGT---DAREWGKKYFK  504

Query  278   GNFERLVAVKTRVDPDNFFWHEQSIPV  198
             GNFERLV +K + DP+NFF HEQSIP 
Sbjct  505   GNFERLVKIKAKFDPENFFRHEQSIPT  531



>ref|XP_010481680.1| PREDICTED: cannabidiolic acid synthase-like 2 [Camelina sativa]
Length=540

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/529 (58%), Positives = 399/529 (75%), Gaps = 9/529 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             IL++ F+  T +P +   S+Q QF  CV  ++H   P    FF+   N S F+ VL+ST 
Sbjct  15    ILALYFSLYTITPTSSLASLQDQFINCVQRNTHVYFPLEKTFFAPAKNVSMFSQVLESTA  74

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QN+ FL  S PKP  I +P+ ESHVQA+V+C K+  + LRVRSGGHD+EGLSY S +  P
Sbjct  75    QNIRFLKKSLPKPGFIISPIHESHVQASVICAKKLRLHLRVRSGGHDYEGLSYVSQIVKP  134

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+++DL+K+R   ++++DNS WVQ+G+T GE+YYR+AEKSK  GFPAG C SLGIGGH
Sbjct  135   --FILLDLSKMRQADINIKDNSAWVQSGSTVGELYYRIAEKSKVHGFPAGLCSSLGIGGH  192

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+M+RKYGL ADN LDA+IVDA GR+LDRAAMGED FWAIRGG GGSFGI+LAW
Sbjct  193   ITGGAYGSMMRKYGLGADNVLDAKIVDANGRLLDRAAMGEDTFWAIRGGAGGSFGIILAW  252

Query  1058  KIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             KIKLVPVP TVTVFTV +TL+Q+   K++ KWQ+VADKL E+L ++VL    N     G 
Sbjct  253   KIKLVPVPQTVTVFTVTKTLQQDVGHKIISKWQRVADKLVEELFIRVLF---NVAGTGGN  309

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             +TV  +++++FLG    L+K+M  SFPELGLT KDC+EMSW++S+ Y + +P  TP   L
Sbjct  310   KTVTMSYNSMFLGGKGTLMKVMKKSFPELGLTLKDCIEMSWLDSIAYISGFPIHTPTNIL  369

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK  FPK  FKAKS+F++TP+PESGL+G+++  LKED P+M+WNPYGGMMA+IPES  
Sbjct  370   LQGKSPFPKVNFKAKSDFVKTPIPESGLKGIFQKLLKEDIPLMIWNPYGGMMARIPESQI  429

Query  521   PFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
             PFPHRKGV+ K+ Y+TSW ++ +K+  KH++WIR  Y+YM  YVS +PR+AYVNYRDLDL
Sbjct  430   PFPHRKGVLFKVQYVTSW-LDSDKRPSKHMNWIRDFYNYMTPYVSSNPRQAYVNYRDLDL  488

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             G N     T F +A  WG  YFK NF RLV++K++VDP+NFF HEQSIP
Sbjct  489   GKNTKDTKTCFKQAQGWGANYFKNNFNRLVSIKSKVDPENFFRHEQSIP  537



>emb|CDY67309.1| BnaCnng54420D [Brassica napus]
Length=534

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/508 (61%), Positives = 387/508 (76%), Gaps = 9/508 (2%)
 Frame = -2

Query  1718  QHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPL  1539
             Q  F  C+  +S  S P  ++FF+   NASSF   L+++ QNL +L+PS PKP  IF PL
Sbjct  32    QQDFVMCLVDNSDASFPMDSSFFTRDLNASSFKQALETSAQNLRYLMPSKPKPEFIFEPL  91

Query  1538  TESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVED  1359
              E+HVQAAVVC K+  + LR+RSGGHD+EGLSY S+ME+   FV++DL+KLR I VD+E 
Sbjct  92    YETHVQAAVVCAKKLRLHLRLRSGGHDYEGLSYVSEMETA--FVIVDLSKLRQINVDLES  149

Query  1358  NSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNA  1179
             N+ W+ AGA+ GEVYYR+ EKSK  GFPAG C SLGIGGHI GGAYG+M+RK+GL ADN 
Sbjct  150   NTAWIHAGASIGEVYYRIQEKSKVHGFPAGLCTSLGIGGHIIGGAYGSMMRKFGLGADNV  209

Query  1178  LDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTL  999
             LDARIVDA G++L+RAAMGED+FWAIRGGGGGSFG++LAWKIKLVPVP  VTVFTV +TL
Sbjct  210   LDARIVDAKGKILNRAAMGEDVFWAIRGGGGGSFGVILAWKIKLVPVPDVVTVFTVTKTL  269

Query  998   EQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKI  819
             EQ+ T++LYKWQ+VADKLDE+L ++ +I   + T    +RT+  ++   FLG   RLL++
Sbjct  270   EQDGTRVLYKWQQVADKLDENLFIRAIIQPASKTPKSKERTISVSYQGQFLGDAKRLLQV  329

Query  818   MNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRT  639
             M  SFP+LGL  KDCLE SWI+SV+Y A +P T PPE LL GK LF K +FKAKS+++  
Sbjct  330   MQRSFPQLGLKKKDCLETSWIKSVMYIAGFPSTAPPEALLAGKSLF-KNYFKAKSDYVEK  388

Query  638   PVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKI-  462
             P+P  GL GLWK  L+ED+P+ +WNPYGGMMAKIPE+ TPFPHR G + KI +LT W+  
Sbjct  389   PIPIEGLEGLWKKLLEEDSPLTIWNPYGGMMAKIPETETPFPHRSGTLFKIQWLTLWQDG  448

Query  461   EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYF  282
             +  + KH++W+R MY YM  YVSK+PR AYVNYRDLDLGM  NGR T   +A  WG KYF
Sbjct  449   KASEAKHMEWMRNMYSYMEKYVSKNPRSAYVNYRDLDLGM--NGRGT---DAREWGNKYF  503

Query  281   KGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             KGNFERLV +K + DP+NFF HEQSIP 
Sbjct  504   KGNFERLVKIKAKFDPENFFRHEQSIPT  531



>ref|XP_009115049.1| PREDICTED: reticuline oxidase-like protein [Brassica rapa]
 emb|CDY02326.1| BnaA09g25760D [Brassica napus]
Length=534

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/512 (60%), Positives = 389/512 (76%), Gaps = 9/512 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S +IQ  F  C+  +S  S P  ++FF+   NASS+   L+++ QNL +L+PS PKP  I
Sbjct  28    SSTIQQDFVMCLVDNSDASFPMDSSFFTRDLNASSYKMALETSAQNLRYLMPSNPKPEFI  87

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             F PL E+HVQAAV C K+  + LR+RSGGHD+EGLSY S+ME+   FV++DL+KLR I V
Sbjct  88    FEPLYETHVQAAVACAKKLQLHLRLRSGGHDYEGLSYVSEMETA--FVIVDLSKLRHINV  145

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+E N+ WV AGA+ GEVYYR+ EKSK  GFPAG C SLGIGGHI GGAYG+M+RK+GL 
Sbjct  146   DLESNTAWVHAGASIGEVYYRIQEKSKVHGFPAGLCTSLGIGGHIIGGAYGSMMRKFGLG  205

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN LDARIVDA G++L+RAAMGED+FWAIRGGGGGSFG++LAWKIKLVPVP TVTVFTV
Sbjct  206   ADNVLDARIVDADGKILNRAAMGEDVFWAIRGGGGGSFGVILAWKIKLVPVPETVTVFTV  265

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ+ T++LYKWQ+VADKLDEDL ++ +I   + T    +RT+  ++   FLG  +R
Sbjct  266   TKTLEQDGTRILYKWQQVADKLDEDLFIRAIIQPASKTPKSKERTISVSYQGQFLGDVNR  325

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             L+++M  SFP+LGL  KDC+E SWI+SV+Y A +P T PPE LL GK LF K +FKAKS+
Sbjct  326   LMQVMQRSFPQLGLMKKDCVETSWIKSVMYIAGFPSTAPPEALLDGKSLF-KNYFKAKSD  384

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             ++   +P  GL GLWK  L+ED+P+ +WNPYGGMMAKIPE+ TPFPHR G + KI +LT 
Sbjct  385   YVEEAIPIEGLEGLWKKLLEEDSPLTIWNPYGGMMAKIPETETPFPHRSGTLYKIQWLTL  444

Query  470   WKI-EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWG  294
             W+  +  + KH++W+R MY YM  YVSK+PR AYVNYRDLDLGMN  G     S+A  WG
Sbjct  445   WQDGKASEAKHMEWMRDMYSYMEQYVSKNPRAAYVNYRDLDLGMNGKG-----SDAREWG  499

Query  293   YKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
              KYFKGNFERLV +K + DP+NFF HEQSIP 
Sbjct  500   NKYFKGNFERLVKIKAKFDPENFFRHEQSIPT  531



>ref|NP_181025.1| protein MATERNAL EFFECT EMBRYO ARREST 23 [Arabidopsis thaliana]
 gb|AAC12819.1| putative berberine bridge enzyme [Arabidopsis thaliana]
 gb|AAO42058.1| putative FAD-linked oxidoreductase [Arabidopsis thaliana]
 gb|AAO50720.1| putative FAD-linked oxidoreductase [Arabidopsis thaliana]
 gb|AEC09022.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana]
Length=532

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/525 (59%), Positives = 400/525 (76%), Gaps = 11/525 (2%)
 Frame = -2

Query  1766  LFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLV  1587
             L T L  S    S ++Q  F KC+  +S  S P + +FFS   NA+ F   L+ST QNL 
Sbjct  14    LVTLLLISVPLSSSTLQQDFVKCLVDNSDVSFPITASFFSPDQNATLFKEELESTAQNLR  73

Query  1586  FLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFV  1407
             +L PS PKP+ IF PL E+HVQAAVVC K+  + LR+RSGGHD+EGLS+ ++ E+P  FV
Sbjct  74    YLTPSNPKPVFIFEPLYETHVQAAVVCAKKLQLHLRLRSGGHDYEGLSFVAEDETP--FV  131

Query  1406  VIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitgg  1227
             ++DL+KLR + VD++ NS W  AGAT GEVYYR+ EKS+  GFPAG C SLGIGGH+ GG
Sbjct  132   IVDLSKLRQVDVDLDSNSAWAHAGATIGEVYYRIQEKSQTHGFPAGLCSSLGIGGHLVGG  191

Query  1226  aygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKL  1047
             AYG+M+RK+GL ADN LDARIVDA G++LDRAAMGED+FWAIRGGGGGSFG++LAWKIKL
Sbjct  192   AYGSMMRKFGLGADNVLDARIVDANGQILDRAAMGEDVFWAIRGGGGGSFGVILAWKIKL  251

Query  1046  vpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQT  867
             VPVPATVTVFTV +TLEQ+ TK+LYKW+++ADKLD+DL ++V+I+  + T   G RT+  
Sbjct  252   VPVPATVTVFTVTKTLEQDGTKVLYKWEQIADKLDDDLFIRVIISPASKTTKPGNRTISM  311

Query  866   AFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKP  687
             ++ A FLG ++RLL++M  SFPELGLT KDC EMSWI+SV+Y A +P +  PE LL GK 
Sbjct  312   SYQAQFLGDSNRLLQVMQKSFPELGLTKKDCTEMSWIKSVMYIAGFPNSAAPEALLAGKS  371

Query  686   LFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHR  507
             LF K  FKAKS+F++ P+P  GL GLW+ FL+ED+P+ +WNPYGGMM++I ES  PFPHR
Sbjct  372   LF-KNHFKAKSDFVKEPIPVEGLEGLWERFLEEDSPLTIWNPYGGMMSRISESEIPFPHR  430

Query  506   KGVICKIVYLTSWKIEGE--KKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKN  333
              G + KI +L++W+ +G+  +++H+ WIR MY YM  YVSK+PR+AYVNYRDLDLG N+ 
Sbjct  431   NGTLFKIQWLSTWQ-DGKVSEERHMKWIREMYSYMEQYVSKNPRQAYVNYRDLDLGTNEG  489

Query  332   GRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
                   ++A  WG KY+KGNFERLV +K   DPDNFF HEQS+P 
Sbjct  490   E-----TDAREWGAKYYKGNFERLVKIKGEFDPDNFFRHEQSVPT  529



>gb|KFK44880.1| hypothetical protein AALP_AA1G315000 [Arabis alpina]
Length=535

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/509 (61%), Positives = 392/509 (77%), Gaps = 10/509 (2%)
 Frame = -2

Query  1721  IQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTP  1542
             IQ  F  C+  +S  S P  ++FF+   NASSF   L+++ QNL +L+PS+PKP  IF P
Sbjct  33    IQQDFVMCIVDNSDASFPMESSFFTHDLNASSFKLALETSAQNLRYLMPSSPKPEFIFEP  92

Query  1541  LTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVE  1362
             L E+HVQAAV+C K+  + LR+RSGGHD+EGLSY S++ES   FV++DL+KLR I VDVE
Sbjct  93    LYETHVQAAVLCAKKLRLHLRLRSGGHDYEGLSYVSEIESA--FVIVDLSKLRNIDVDVE  150

Query  1361  DNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADN  1182
              NS WV AGA+ GEVYYR+ EKSK  GFPAG C SLGIGGHI GGAYG+M+RK+GL ADN
Sbjct  151   SNSAWVHAGASIGEVYYRIQEKSKLHGFPAGLCTSLGIGGHIIGGAYGSMMRKFGLGADN  210

Query  1181  ALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRT  1002
              LDARIVDA G++L+RAAMGED+FWA+RG GGGSFG++LAWK+KLVPVP TVTVFTV +T
Sbjct  211   VLDARIVDANGKILNRAAMGEDVFWALRGSGGGSFGVILAWKLKLVPVPETVTVFTVTKT  270

Query  1001  LEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLK  822
             LEQ+ TKLL+KWQ+VADKLDEDL ++V+I+   ++  K +RT+ T++   FLG   RLL+
Sbjct  271   LEQDGTKLLHKWQQVADKLDEDLFIRVIISPAKTSKSK-ERTISTSYQGQFLGDPSRLLQ  329

Query  821   IMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLR  642
             +M  SFPELGLT KDCLE SWI+SV+Y A +P T P E LL GK LF K +FKAKS+++ 
Sbjct  330   VMQKSFPELGLTKKDCLETSWIKSVMYIAGFPSTAPSEALLAGKSLF-KNYFKAKSDYVE  388

Query  641   TPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKI  462
              P+P  GL GLW+ FL+ED+P+ +WNPYGGMMAKIPE+ TPFPHR G + KI +LT W+ 
Sbjct  389   EPIPIEGLEGLWEKFLQEDSPLTIWNPYGGMMAKIPETETPFPHRSGTLFKIQWLTLWQD  448

Query  461   -EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKY  285
              +  + +H++W++ MY YM  YVSK+PR AYVNYRDLDLGMN  G     ++A  WG KY
Sbjct  449   GKASETRHMEWMKDMYSYMEKYVSKNPRSAYVNYRDLDLGMNGKG-----NDAREWGNKY  503

Query  284   FKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             FKGNFERLV +K   DP+NFF HEQSIP 
Sbjct  504   FKGNFERLVKIKAEFDPENFFRHEQSIPT  532



>gb|KHN14309.1| Reticuline oxidase-like protein [Glycine soja]
Length=519

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/529 (56%), Positives = 384/529 (73%), Gaps = 35/529 (7%)
 Frame = -2

Query  1775  LSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQ  1596
             L+ L   L+ S  A S S++  F +C+S +S  + PF  + ++    + +   +L+S+ Q
Sbjct  8     LATLILLLSVS-MAASASLEENFVQCLSFYSDKAAPFYASIYTPQNASFNK--ILESSAQ  64

Query  1595  NLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPA  1416
             NL +LVPSA KP LIFTP T+SHVQ AV C+K+ G+ LR+RSGGHD+EGLSY S++E+  
Sbjct  65    NLRYLVPSAHKPELIFTPSTDSHVQVAVTCSKKLGIHLRIRSGGHDYEGLSYVSEVETH-  123

Query  1415  PFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghi  1236
              F+++DL+KLR + VD+EDN+ W+QAGAT GEVYY++ EKS   GFPAG C SLG+GGHI
Sbjct  124   -FIIVDLSKLRAVNVDIEDNTAWIQAGATIGEVYYKIYEKSSVHGFPAGLCTSLGVGGHI  182

Query  1235  tggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWK  1056
             TGGAYG+M+RKYGL ADN LDARIVDA G++LDR AMGEDLFWAIR       G+     
Sbjct  183   TGGAYGSMMRKYGLGADNVLDARIVDANGQILDREAMGEDLFWAIR-------GVFTV--  233

Query  1055  IKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRT  876
                             R+LEQ+AT++L++WQ+VA  +DEDL ++V+I    +   K +RT
Sbjct  234   ---------------TRSLEQDATRILHRWQEVAPYIDEDLFIRVIIQPA-TVGNKTERT  277

Query  875   VQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLH  696
             + T+++A FLG  DRLL++M  SFPEL LT KDCLE SWI+SV+Y A YP  TPPE LL 
Sbjct  278   ITTSYNAQFLGGADRLLQVMKESFPELVLTKKDCLETSWIKSVLYIAGYPNDTPPEVLLQ  337

Query  695   GKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPF  516
             GK  F K +FKAKS+F+R  +PE+GL+GLW+  L+ED+P+M+WNPYGGMM+K  ES  PF
Sbjct  338   GKSTF-KNYFKAKSDFVRDTIPETGLKGLWQRLLEEDSPLMIWNPYGGMMSKFSESDIPF  396

Query  515   PHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGM  342
             PHR G + KI YLT W+ +G+K   KH+DWIR++Y+YM  YVSK PREAYVNYRDLDLGM
Sbjct  397   PHRNGTLYKIQYLTLWQ-DGDKNASKHIDWIRKLYNYMTPYVSKFPREAYVNYRDLDLGM  455

Query  341   NKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NK   +TS+ +A+ WG  YFK NF RLV +KT+VDPDN F HEQSIP L
Sbjct  456   NKKN-STSYIQATAWGNMYFKDNFNRLVKIKTKVDPDNVFRHEQSIPPL  503



>ref|XP_011005454.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Populus 
euphratica]
Length=533

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/526 (59%), Positives = 387/526 (74%), Gaps = 7/526 (1%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             I+ +    L F    VSL IQ +F +C+S++S +S PFS+  ++   ++ +   VL ST 
Sbjct  7     IIPVFLIVLLFPSSIVSLPIQGRFLRCLSINSESSFPFSSILYTPKNSSFTG--VLLSTA  64

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL F +PSAPKP  IFTPL ESHVQAAV+C+K  G+Q+R+RSGGHDFEG+SYTS +++P
Sbjct  65    QNLRFALPSAPKPKFIFTPLQESHVQAAVICSKALGIQIRIRSGGHDFEGISYTSVIDTP  124

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DLA LR I VD++  S W QAGAT GE+++R++EKSKNL FPAG C S+G+GGH
Sbjct  125   --FIVVDLANLRSISVDIKHKSAWAQAGATVGELHFRISEKSKNLAFPAGACPSVGLGGH  182

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             I+GG YG + RKYGL+ADN +DA IVD  GR+LDR +MGEDLFWAIRGGGG SFGI+ AW
Sbjct  183   ISGGGYGPLFRKYGLSADNVIDAHIVDVHGRLLDRKSMGEDLFWAIRGGGGASFGIVTAW  242

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLVPVP+TVTVF V R L+Q  TKLLY+WQ+VA K DEDL L V I    ++A  GK+
Sbjct  243   KVKLVPVPSTVTVFRVLRFLDQGLTKLLYRWQQVAHKFDEDLYLIVGIRPGIASAT-GKK  301

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV+T +  +FLG T+RLLK+M  SFPEL LT KDC+EM WI SV+Y A +P  + PE LL
Sbjct  302   TVRTVYSGLFLGDTNRLLKVMAKSFPELNLTRKDCIEMDWISSVLYEAFFPANSTPEVLL  361

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
               K LFP  + K+K +F R  + E+ L GLW  F++ED    +  PYGG+M +I  S TP
Sbjct  362   QRKNLFP-VYTKSKPDFARKLIKETALEGLWDFFIQEDKLATLLVPYGGVMGRISNSETP  420

Query  518   FPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             FPHRKGV+  + Y TSW    E   H+DW R++Y+YM  YVSK+PREAY+N+RDLDLGMN
Sbjct  421   FPHRKGVLFMLEYATSWNDPSESATHIDWARKVYEYMTPYVSKNPREAYLNHRDLDLGMN  480

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             +   NTS  EA VWG KYFK NF RLV VKTRVDPDNFF HEQSIP
Sbjct  481   EK-VNTSVEEARVWGAKYFKCNFNRLVKVKTRVDPDNFFRHEQSIP  525



>ref|XP_006280276.1| hypothetical protein CARUB_v10026198mg [Capsella rubella]
 gb|EOA13174.1| hypothetical protein CARUB_v10026198mg [Capsella rubella]
Length=540

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/546 (58%), Positives = 403/546 (74%), Gaps = 13/546 (2%)
 Frame = -2

Query  1826  MQSSLHIAMASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffs  1647
             M+SS    + S+ S  IL++ F+  T +P + S S+Q QF KCV  ++H   P    FF 
Sbjct  1     MKSSRPFTVFSFLS--ILALYFSLYTITPTSSSPSLQDQFIKCVQRNTHVYFPLEKTFFD  58

Query  1646  tttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSG  1467
                N S F+ VL+ST QNL FL  S PKP  I  P+ ESHVQA+++C K+ G+  RVRSG
Sbjct  59    PAKNVSMFSQVLESTAQNLRFLKKSLPKPWFIINPIHESHVQASIICAKKLGMHHRVRSG  118

Query  1466  GHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKN  1287
             GHD+EGLSY S +  P  F+++DL+K+R + V+++DN+ WVQ+GAT GE+YYR+AEKSK 
Sbjct  119   GHDYEGLSYVSQIVKP--FILLDLSKMRQVDVNIKDNTAWVQSGATVGELYYRIAEKSKV  176

Query  1286  LGFPAGNCVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFW  1107
              GFPAG C SLG+GGHITGGAYG+M+RKYGL ADN LDA+IVDA GR+LDRAAMGED FW
Sbjct  177   HGFPAGLCSSLGVGGHITGGAYGSMMRKYGLGADNVLDAKIVDANGRLLDRAAMGEDTFW  236

Query  1106  AIRggggGSFGILLAWKIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedll  930
             AIRGG GGSFGI+LAWKIKLVPVP TVTVFTV +TL+Q+   K++ KWQ+VADKL E+L 
Sbjct  237   AIRGGAGGSFGIILAWKIKLVPVPKTVTVFTVTKTLQQDVGNKIISKWQRVADKLVEELF  296

Query  929   lkvLITAVNSTAVKGK-RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIE  753
                 I  + + A  GK +TV  +++ +FLG    L+ +M  SFPELGLT KDC+EMSW+E
Sbjct  297   ----IRVLFNVAGTGKNKTVTMSYNTLFLGGKGTLMNVMKKSFPELGLTLKDCIEMSWLE  352

Query  752   SVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVM  573
             S+ Y + +P  TP   LL GK  +PK  FK+KS+F++TP+PESGL+G++K  LKED P+M
Sbjct  353   SISYISGFPVHTPTNVLLKGKSPYPKISFKSKSDFVKTPIPESGLQGIFKKLLKEDIPLM  412

Query  572   VWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTY  399
             +W PYGGMMAKIPES  PFPHRKGV+ KI Y+TSW ++ +K   +H++W+R +++YM  Y
Sbjct  413   IWTPYGGMMAKIPESQIPFPHRKGVLFKIQYVTSW-LDNDKMPSRHINWVRDLHNYMTPY  471

Query  398   VSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFW  219
             VS +PR+AYVNYRDLDLG N     T F +A  WG  YFK NF RLV +KT+VDP NFF 
Sbjct  472   VSSNPRQAYVNYRDLDLGKNTKDTKTCFKQAQGWGANYFKNNFNRLVRIKTKVDPKNFFR  531

Query  218   HEQSIP  201
             HEQSIP
Sbjct  532   HEQSIP  537



>ref|XP_011001955.1| PREDICTED: tetrahydrocannabinolic acid synthase-like isoform 
X1 [Populus euphratica]
Length=536

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/524 (59%), Positives = 386/524 (74%), Gaps = 7/524 (1%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             I+S+L   L+F  + VSL IQ +F KC+SL+S +S PFST  ++   ++ +   VL ST 
Sbjct  8     IVSMLVILLSFPFFIVSLPIQDKFLKCLSLYSESSFPFSTILYTPNNSSFTN--VLLSTA  65

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL F +PS PKP  IFTPL ESHVQ AVVC+K+ GV +RVRSGGHDFEGLSYTS +++P
Sbjct  66    QNLRFALPSVPKPEFIFTPLQESHVQTAVVCSKQLGVHIRVRSGGHDFEGLSYTSVIDTP  125

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DL KLR I VD++  S W  AGAT GE++YR++EKSKNLGF AG C S+G+GGH
Sbjct  126   --FIVVDLGKLRSISVDIKRKSAWAHAGATVGELHYRISEKSKNLGFLAGACPSVGLGGH  183

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ++GG YG + RKYGL+ADN +DARIVD  GR+LDR AMGEDLFWAIRGGGG SFGI+ AW
Sbjct  184   LSGGGYGPLFRKYGLSADNVIDARIVDVQGRLLDRIAMGEDLFWAIRGGGGASFGIITAW  243

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLVPVP+TVTVF V R LEQ ATKLLY+WQ+VA+K D DL L V I    ++   GK+
Sbjct  244   KVKLVPVPSTVTVFRVFRFLEQGATKLLYRWQQVANKFDVDLYLVVGIRPAIASDT-GKK  302

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV+T +   FLG T RLL++M  SFPELGL  KDC+EM WI SV++ A +P  + PE LL
Sbjct  303   TVRTIYSGFFLGDTSRLLEVMQKSFPELGLARKDCIEMEWIGSVLHEAFFPANSTPEVLL  362

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
               K LFP  + K+KS+F ++P+ E+ L+GLWKIF +ED    +  PYGGMM KI +S  P
Sbjct  363   QRKNLFP-AYTKSKSDFAQSPISETALKGLWKIFFQEDKLATLLIPYGGMMDKISKSEIP  421

Query  518   FPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             FPHRKG +  + Y T+W    E    +DW R++Y+YM  YVSK+PREAY+N+RD+DLGMN
Sbjct  422   FPHRKGNLFMLEYATNWNDPSESATQIDWARKVYEYMTPYVSKNPREAYLNHRDIDLGMN  481

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQS  207
             +   NTS  EA VWG KYFKGNF RLV VKTRVDP+NFF    S
Sbjct  482   EKA-NTSIEEARVWGTKYFKGNFNRLVKVKTRVDPENFFRSSHS  524



>ref|XP_010690430.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Beta vulgaris 
subsp. vulgaris]
Length=553

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/543 (57%), Positives = 386/543 (71%), Gaps = 13/543 (2%)
 Frame = -2

Query  1775  LSILFTFLTFSPWA-VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             LS L     +  WA    SIQ  F KC   ++ ++ P   + +S T ++ S   +LQST 
Sbjct  11    LSALLVVTIYGSWASADSSIQQNFLKCFHRNAESNTPLPPSCYSPTNSSFSA--ILQSTA  68

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL +L PS  KP LI  P  ESH+QAAV+C K+ GVQ+RVRSGGHD+E  SY S+ME P
Sbjct  69    QNLRYLFPSVKKPELIIMPTDESHIQAAVICAKKLGVQVRVRSGGHDYEAASYASEMEDP  128

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               FV++D+AKLR + V +ED S WVQAGAT GE+YYR++ +SK  GFPAG C SLG+GGH
Sbjct  129   --FVILDMAKLRMVTVSIEDKSAWVQAGATIGELYYRISVESKVHGFPAGLCNSLGVGGH  186

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG ++RKYGL ADNA+D R+VDA G VLDR +MGEDLFWAIRGGGGG+FGI+LAW
Sbjct  187   ITGGAYGPLMRKYGLGADNAIDVRMVDANGEVLDRESMGEDLFWAIRGGGGGNFGIILAW  246

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             KI+LV VP  VTVFTV +TLEQ  TK+  KWQ        D  L + +   NS   KG  
Sbjct  247   KIRLVAVPEKVTVFTVAKTLEQGLTKISSKWQ--QVVDKLDENLFIRVIMQNSKTPKGNN  304

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV   F A+FLG+ D+LLK+M   FPELGL  KD  E+SWIESV+Y A YP  T PE LL
Sbjct  305   TVIGLFQALFLGRADQLLKVMQRDFPELGLQKKDTSEISWIESVVYIANYPSGTKPEILL  364

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
               KP F   +FKAKS+++RTP+PESGL GLWK  ++++  +M+W PYGGMM+KIPES  P
Sbjct  365   EAKPTF-LNYFKAKSDYVRTPIPESGLNGLWKRIMEDEGALMIWTPYGGMMSKIPESQIP  423

Query  518   FPHRKGVICKIVYLTSWKIEGE--KKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLG  345
             FPHR G I  I Y+ SW+ +GE  K +H++W+R++Y+YM  YVS  PREAYVNYRDLDLG
Sbjct  424   FPHRNGTIFMIQYVVSWQ-DGETSKSRHMEWVRKLYNYMTPYVSMFPREAYVNYRDLDLG  482

Query  344   MNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS*LCMYVF*V  165
             M+K+G NT+F +AS WG  Y+K NF RLV +KT+VDP+NFF +EQSIP L  +   +  V
Sbjct  483   MSKDG-NTNFIQASAWGAMYYKDNFNRLVKIKTKVDPENFFRNEQSIPPLPVMENKIC-V  540

Query  164   QCD  156
              CD
Sbjct  541   HCD  543



>ref|XP_011001956.1| PREDICTED: tetrahydrocannabinolic acid synthase-like isoform 
X2 [Populus euphratica]
Length=535

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/519 (59%), Positives = 385/519 (74%), Gaps = 7/519 (1%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             I+S+L   L+F  + VSL IQ +F KC+SL+S +S PFST  ++   ++ +   VL ST 
Sbjct  8     IVSMLVILLSFPFFIVSLPIQDKFLKCLSLYSESSFPFSTILYTPNNSSFTN--VLLSTA  65

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL F +PS PKP  IFTPL ESHVQ AVVC+K+ GV +RVRSGGHDFEGLSYTS +++P
Sbjct  66    QNLRFALPSVPKPEFIFTPLQESHVQTAVVCSKQLGVHIRVRSGGHDFEGLSYTSVIDTP  125

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DL KLR I VD++  S W  AGAT GE++YR++EKSKNLGF AG C S+G+GGH
Sbjct  126   --FIVVDLGKLRSISVDIKRKSAWAHAGATVGELHYRISEKSKNLGFLAGACPSVGLGGH  183

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ++GG YG + RKYGL+ADN +DARIVD  GR+LDR AMGEDLFWAIRGGGG SFGI+ AW
Sbjct  184   LSGGGYGPLFRKYGLSADNVIDARIVDVQGRLLDRIAMGEDLFWAIRGGGGASFGIITAW  243

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLVPVP+TVTVF V R LEQ ATKLLY+WQ+VA+K D DL L V I    ++   GK+
Sbjct  244   KVKLVPVPSTVTVFRVFRFLEQGATKLLYRWQQVANKFDVDLYLVVGIRPAIASDT-GKK  302

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV+T +   FLG T RLL++M  SFPELGL  KDC+EM WI SV++ A +P  + PE LL
Sbjct  303   TVRTIYSGFFLGDTSRLLEVMQKSFPELGLARKDCIEMEWIGSVLHEAFFPANSTPEVLL  362

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
               K LFP  + K+KS+F ++P+ E+ L+GLWKIF +ED    +  PYGGMM KI +S  P
Sbjct  363   QRKNLFP-AYTKSKSDFAQSPISETALKGLWKIFFQEDKLATLLIPYGGMMDKISKSEIP  421

Query  518   FPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             FPHRKG +  + Y T+W    E    +DW R++Y+YM  YVSK+PREAY+N+RD+DLGMN
Sbjct  422   FPHRKGNLFMLEYATNWNDPSESATQIDWARKVYEYMTPYVSKNPREAYLNHRDIDLGMN  481

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFF  222
             +   NTS  EA VWG KYFKGNF RLV VKTRVDP+NFF
Sbjct  482   EKA-NTSIEEARVWGTKYFKGNFNRLVKVKTRVDPENFF  519



>ref|XP_011001959.1| PREDICTED: tetrahydrocannabinolic acid synthase-like isoform 
X4 [Populus euphratica]
Length=521

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/519 (59%), Positives = 385/519 (74%), Gaps = 7/519 (1%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             I+S+L   L+F  + VSL IQ +F KC+SL+S +S PFST  ++   ++ +   VL ST 
Sbjct  8     IVSMLVILLSFPFFIVSLPIQDKFLKCLSLYSESSFPFSTILYTPNNSSFTN--VLLSTA  65

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL F +PS PKP  IFTPL ESHVQ AVVC+K+ GV +RVRSGGHDFEGLSYTS +++P
Sbjct  66    QNLRFALPSVPKPEFIFTPLQESHVQTAVVCSKQLGVHIRVRSGGHDFEGLSYTSVIDTP  125

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DL KLR I VD++  S W  AGAT GE++YR++EKSKNLGF AG C S+G+GGH
Sbjct  126   --FIVVDLGKLRSISVDIKRKSAWAHAGATVGELHYRISEKSKNLGFLAGACPSVGLGGH  183

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ++GG YG + RKYGL+ADN +DARIVD  GR+LDR AMGEDLFWAIRGGGG SFGI+ AW
Sbjct  184   LSGGGYGPLFRKYGLSADNVIDARIVDVQGRLLDRIAMGEDLFWAIRGGGGASFGIITAW  243

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLVPVP+TVTVF V R LEQ ATKLLY+WQ+VA+K D DL L V I    ++   GK+
Sbjct  244   KVKLVPVPSTVTVFRVFRFLEQGATKLLYRWQQVANKFDVDLYLVVGIRPAIASDT-GKK  302

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV+T +   FLG T RLL++M  SFPELGL  KDC+EM WI SV++ A +P  + PE LL
Sbjct  303   TVRTIYSGFFLGDTSRLLEVMQKSFPELGLARKDCIEMEWIGSVLHEAFFPANSTPEVLL  362

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
               K LFP  + K+KS+F ++P+ E+ L+GLWKIF +ED    +  PYGGMM KI +S  P
Sbjct  363   QRKNLFP-AYTKSKSDFAQSPISETALKGLWKIFFQEDKLATLLIPYGGMMDKISKSEIP  421

Query  518   FPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             FPHRKG +  + Y T+W    E    +DW R++Y+YM  YVSK+PREAY+N+RD+DLGMN
Sbjct  422   FPHRKGNLFMLEYATNWNDPSESATQIDWARKVYEYMTPYVSKNPREAYLNHRDIDLGMN  481

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFF  222
             +   NTS  EA VWG KYFKGNF RLV VKTRVDP+NFF
Sbjct  482   EKA-NTSIEEARVWGTKYFKGNFNRLVKVKTRVDPENFF  519



>ref|XP_010540643.1| PREDICTED: cannabidiolic acid synthase-like 1 [Tarenaya hassleriana]
Length=535

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/530 (59%), Positives = 399/530 (75%), Gaps = 14/530 (3%)
 Frame = -2

Query  1781  IILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQST  1602
             ++L+I F F   S  A   ++Q  F  C+  +S  S P + AFF+   NA+S+  VL+ST
Sbjct  13    LLLTIAFAFTVSSTHA---TLQEDFVLCLVDNSDISFPIAAAFFTRDLNATSYKQVLEST  69

Query  1601  VQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMES  1422
              QNL +L  S+PKP  IF PL E+HVQAAV+C K+ G+ LRVRSGGHD+EGLSY S++E+
Sbjct  70    AQNLRYLTASSPKPEFIFEPLYETHVQAAVLCAKKLGLHLRVRSGGHDYEGLSYVSEIET  129

Query  1421  PAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigg  1242
             P  FV++DL KLR + VD++ NS WV AGAT GEVYYR+ E SK  GFPAG C SLG+GG
Sbjct  130   P--FVIVDLRKLRQVDVDLDSNSAWVHAGATVGEVYYRIQENSKTRGFPAGLCTSLGVGG  187

Query  1241  hitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLA  1062
             HITGGAYG+M+RKYGL ADN +DARIV A G++LDRAAMGED+FWA+RGGGGGSFG++LA
Sbjct  188   HITGGAYGSMMRKYGLGADNVIDARIVVADGKILDRAAMGEDVFWALRGGGGGSFGVILA  247

Query  1061  WKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             WKI LVPVP TVTVFTV +TLEQ+ T++LYKWQ+VADKLD+DL ++V+I   + +    +
Sbjct  248   WKINLVPVPETVTVFTVTKTLEQDGTRVLYKWQQVADKLDDDLFIRVIIQTASKSPKGSE  307

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             +TV T++   FLG  +RLL++M  SFPELGLT KDC E SWI+SV+Y A +P +TPPE L
Sbjct  308   KTVSTSYQGQFLGDVNRLLQVMQKSFPELGLTRKDCTETSWIKSVMYIAGFPSSTPPEAL  367

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK LF K +FKAKS+F++ P+P  GL GLWK  ++ED+P+ +WNPYGGMM +I E+ T
Sbjct  368   LDGKSLF-KNYFKAKSDFVKEPIPIGGLEGLWKKLMEEDSPLTIWNPYGGMMGRISETET  426

Query  521   PFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
             PFPHR G +  I +LT W+ +GEK   KH+ W+R  Y YM  YVSK+PR AYVNYRDL+L
Sbjct  427   PFPHRNGTLFMIQWLTLWQ-DGEKSQDKHMKWMRDTYSYMEQYVSKNPRGAYVNYRDLEL  485

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             GMN        S+A  WG +YFKGNFERLV +K ++DP+NFF HEQSIP 
Sbjct  486   GMNYKE-----SDAREWGSRYFKGNFERLVNIKGKLDPENFFRHEQSIPT  530



>ref|XP_002299033.1| hypothetical protein POPTR_0001s46740g [Populus trichocarpa]
 gb|EEE83838.1| hypothetical protein POPTR_0001s46740g [Populus trichocarpa]
Length=538

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/524 (60%), Positives = 390/524 (74%), Gaps = 9/524 (2%)
 Frame = -2

Query  1766  LFTFLTFSP-WAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNL  1590
             +F  L  SP   +SL IQ  F +C+  +S  S PFST  +S   ++     +LQS+ QNL
Sbjct  11    IFGVLLLSPSLIISLPIQDSFLQCLQKNSDISFPFSTLLYSPANSSFIS--ILQSSAQNL  68

Query  1589  VFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPF  1410
              F +   PKP LI+ P+ ESH+QAAV+C+K+ G+ LRVRSGGHD EGLSY S +++P  F
Sbjct  69    RFTLSLTPKPELIYKPVEESHIQAAVICSKQLGIHLRVRSGGHDREGLSYVSQIDTP--F  126

Query  1409  VVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitg  1230
             +V+DL  LR I +D++ NS WVQAGAT GE+YYR++EKSKN GFPAG C S+G+GGHITG
Sbjct  127   IVVDLDMLRSISIDIDGNSAWVQAGATIGELYYRISEKSKNHGFPAGVCPSVGVGGHITG  186

Query  1229  gaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIK  1050
             G YG+M RKYGLAADN +DARI+DA GRVLDR  MGEDLFWAIRGGGGGSFGI+ AWK+K
Sbjct  187   GGYGSMFRKYGLAADNVIDARIIDAQGRVLDRKVMGEDLFWAIRGGGGGSFGIISAWKVK  246

Query  1049  LvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQ  870
             LVPVP+TVTVF V +TLEQ ATKLLY+WQ+VADKLD+DL L V +   N+   KGK+T+ 
Sbjct  247   LVPVPSTVTVFRVAKTLEQGATKLLYRWQQVADKLDDDLFLSVSVQLANA-GKKGKKTMS  305

Query  869   TAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGK  690
             T++DA+FLG T RLL++M  SFPELGL  +DC+E SWI SV+Y + +P  T PE LL   
Sbjct  306   TSYDAMFLGDTKRLLQVMQESFPELGLQQQDCIETSWINSVLYMSFFPNNTTPEILLQRN  365

Query  689   PLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPH  510
              LF K + K KS++++ P+PE+ L GLW+   +E+ P MV  PYGGMM KI E   P+PH
Sbjct  366   NLF-KRYLKGKSDYVKEPIPETALEGLWERLFEEENPSMVLIPYGGMMNKISEYQIPYPH  424

Query  509   RKGVICKIVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKN  333
             RKG +  I Y TSWK   E   KH+DW++++Y+YM  YVS +PREAY NYRDLDLGMN+ 
Sbjct  425   RKGNLFMIDYSTSWKDPSENAAKHIDWVKKIYEYMAPYVSMNPREAYGNYRDLDLGMNEK  484

Query  332   GRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
               NTS  EASVWG KYFK NF RLV VKTRVDPDNFF HEQSIP
Sbjct  485   -TNTSCEEASVWGTKYFKDNFYRLVQVKTRVDPDNFFRHEQSIP  527



>ref|XP_006374300.1| hypothetical protein POPTR_0015s05820g [Populus trichocarpa]
 gb|ERP52097.1| hypothetical protein POPTR_0015s05820g [Populus trichocarpa]
Length=530

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/526 (58%), Positives = 387/526 (74%), Gaps = 7/526 (1%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             I+ +    L F    VSL IQ +F +C+S++S +S PFS+  ++   ++ +   VL ST 
Sbjct  7     IIPVFLVVLLFPSSIVSLPIQGRFLRCLSINSESSFPFSSILYTPKNSSFTD--VLLSTA  64

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL F +PS PKP  IF PL ESHVQAAV+C+KE G+Q+R+RSGGHDFEG+SYTS +++P
Sbjct  65    QNLRFALPSVPKPKFIFAPLQESHVQAAVICSKELGIQIRIRSGGHDFEGISYTSVIDTP  124

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DLA LR I VD++  S W QAGAT GE+++R++EKSKNL FPAG C S+G+GGH
Sbjct  125   --FIVVDLANLRSISVDIKHKSAWAQAGATVGELHFRISEKSKNLAFPAGACPSVGLGGH  182

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ++GG YG + RKYGL+ADN +DA IVD  GR+LDR +MGEDLFWAIRGGGG SFGI+ AW
Sbjct  183   LSGGGYGPLFRKYGLSADNVIDAHIVDVHGRLLDRKSMGEDLFWAIRGGGGASFGIITAW  242

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K+KLVPVP+TVTVF V + L+Q  TKLLY+WQ+VA K DEDL L V I    ++A  GK+
Sbjct  243   KVKLVPVPSTVTVFRVLKFLDQGLTKLLYRWQQVAHKFDEDLYLIVGIRPGIASAT-GKK  301

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV+T +  +FLG T RLLK+M  SFPEL +T KDC+EM WI SV+Y A +P  + PE LL
Sbjct  302   TVRTVYSGLFLGDTSRLLKVMAKSFPELNVTRKDCIEMDWISSVLYEAFFPANSTPEVLL  361

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
               K LFP  + K+K +F R  + E+ L GLW  F++ED    +  PYGG+M +I +S TP
Sbjct  362   QRKNLFP-VYTKSKPDFARKLINETALEGLWDFFIQEDKLATLLVPYGGVMDRISKSETP  420

Query  518   FPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             FPHRKGV+  + Y TSW    E   H+DW R++Y+YM  YVSK+PREAY+N+RDLDLGMN
Sbjct  421   FPHRKGVLFMLEYATSWNDPSESATHIDWARKVYEYMTPYVSKNPREAYLNHRDLDLGMN  480

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             +   NTS  EA VWG KYFKGNF RLV VKTRVDPDNFF +EQSIP
Sbjct  481   EK-VNTSVEEARVWGAKYFKGNFNRLVKVKTRVDPDNFFRNEQSIP  525



>ref|XP_007211598.1| hypothetical protein PRUPE_ppa005451mg [Prunus persica]
 gb|EMJ12797.1| hypothetical protein PRUPE_ppa005451mg [Prunus persica]
Length=460

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/460 (65%), Positives = 367/460 (80%), Gaps = 9/460 (2%)
 Frame = -2

Query  1568  PKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAK  1389
             PKP  IFTP+ +SHVQAAV+C+K+  + LRVRSGGHD+EGLSY S +E+P  F+V+DLAK
Sbjct  2     PKPEFIFTPVHDSHVQAAVICSKKLQIHLRVRSGGHDYEGLSYVSQIETP--FIVVDLAK  59

Query  1388  LRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAML  1209
             LR + VD+++N+ W+QAGAT GEVYYRVAEKSK  GFPAG C SLG+GGHITGGAYG+M+
Sbjct  60    LRSVNVDIKNNAAWIQAGATIGEVYYRVAEKSKTHGFPAGLCTSLGVGGHITGGAYGSMM  119

Query  1208  RKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpat  1029
             RKYGLAADNA+DARIVD  G++LDR AMGEDLFWAIRGGGG SFGI+L WKIKLVPVPAT
Sbjct  120   RKYGLAADNAIDARIVDVKGKILDRKAMGEDLFWAIRGGGGASFGIILWWKIKLVPVPAT  179

Query  1028  vtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVF  849
             VTVF V +TLE  ATKLL++WQ+VA  +DEDL ++V I   N T   G +TV T + A F
Sbjct  180   VTVFAVAKTLETGATKLLHRWQQVAPVIDEDLFIRVFIQLANGTKT-GSKTVTTVYQAQF  238

Query  848   LGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTF  669
             LG  DRL+ +M  SFPELG+T KDC E SWI++V++ A YP  TP E LL GK    K +
Sbjct  239   LGGADRLVHVMQKSFPELGVTRKDCTETSWIKAVLFIAGYPSGTPTEVLLQGKST-GKNY  297

Query  668   FKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICK  489
             FKAKS+F++ P+PE+GL+GLWK  L+E +P+M+  PYGGMM+KI ESA PFPHR GV+ K
Sbjct  298   FKAKSDFVQNPIPETGLQGLWKRLLQEASPLMILTPYGGMMSKISESAIPFPHR-GVLFK  356

Query  488   IVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSF  315
             I Y++ W+ EG+K   KH++WIR++Y YM  YV+ SPR+AYVNY+DLDLG+NK   NTSF
Sbjct  357   IQYVSGWQ-EGDKTEAKHMNWIRKLYSYMAPYVTMSPRQAYVNYKDLDLGINKK-SNTSF  414

Query  314   SEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              EAS WGY+YFK NF RLV +KT+VDP+NFF HEQSIP L
Sbjct  415   IEASSWGYRYFKDNFNRLVKIKTKVDPNNFFRHEQSIPPL  454



>ref|XP_006381464.1| hypothetical protein POPTR_0006s13080g [Populus trichocarpa]
 gb|ERP59261.1| hypothetical protein POPTR_0006s13080g [Populus trichocarpa]
Length=524

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/515 (59%), Positives = 386/515 (75%), Gaps = 22/515 (4%)
 Frame = -2

Query  1736  AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPL  1557
             +VS+ IQ  F KC+  +S +  PFST  ++   +  +   +LQS+ QNL F +PS+PKP 
Sbjct  23    SVSIPIQDSFLKCLERNSESPFPFSTLLYTPKNSTFTT--ILQSSAQNLRFTLPSSPKPE  80

Query  1556  LIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGI  1377
              IFTPL ESH+QA V+C+KE G+ LR+RSGGHD+EGLSY S++E P  F V+DLAKLR I
Sbjct  81    FIFTPLKESHIQAVVICSKELGIHLRIRSGGHDYEGLSYVSEIERP--FSVVDLAKLRSI  138

Query  1376  KVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYG  1197
             ++D+EDNS WVQAGATNGE+YYR++EKS+  GFPAG C SLG+GGH++GGAYGAMLRKYG
Sbjct  139   RIDIEDNSAWVQAGATNGELYYRISEKSETHGFPAGTCTSLGMGGHVSGGAYGAMLRKYG  198

Query  1196  LAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvf  1017
             LAADN +DARI+D  GR+LDR AMGEDLFWAIRGG GGSFGIL AWK+KLV VP+TVTVF
Sbjct  199   LAADNVIDARIIDVHGRLLDRKAMGEDLFWAIRGGAGGSFGILTAWKVKLVLVPSTVTVF  258

Query  1016  tvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKT  837
             TV +TLEQ ATK+L KWQ++ADKLDEDL ++V +   N T+ +GKRT+ T+++A+FLG  
Sbjct  259   TVAKTLEQGATKILCKWQQIADKLDEDLFIRVYVQTAN-TSNEGKRTITTSYNALFLGDA  317

Query  836   DRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAK  657
             DRLL              +DC+E +WI S +Y   +P  T PE  L  + L  KT+FK K
Sbjct  318   DRLL--------------QDCIETNWINSTVYLDGFPNNTLPEVFLERRNLL-KTYFKGK  362

Query  656   SEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYL  477
             S++ R  +PE+ L GLW+   + ++P+++  PYGGMM+KIPES TPFPHRKG   KI+Y 
Sbjct  363   SDYAREVIPETALEGLWEKLFEVESPLVILTPYGGMMSKIPESQTPFPHRKGTKFKILYW  422

Query  476   TSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASV  300
             + W+   E    H+DW R++Y ++  YVSKSPREAYVNYRDLDLGMNKN R+TS  EAS 
Sbjct  423   SRWQDAEENVANHIDWTRKVYKFLTPYVSKSPREAYVNYRDLDLGMNKN-RSTSVEEASA  481

Query  299   WGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             +G KYFK NF RLV VKT VDPDNFF HEQSIP L
Sbjct  482   FGTKYFKDNFYRLVLVKTEVDPDNFFRHEQSIPPL  516



>ref|XP_009115996.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Brassica 
rapa]
Length=536

 Score =   535 bits (1379),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 305/530 (58%), Positives = 391/530 (74%), Gaps = 8/530 (2%)
 Frame = -2

Query  1775  LSILFTFLTFSPWA-VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             L++ F+  T +P +  S S+Q  F  C+  +++        FF+   N S FN VL+ST 
Sbjct  8     LALFFSSYTITPTSSTSGSLQDDFIDCLHKNTNVDFSLEQTFFTPGKNVSVFNEVLESTA  67

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL FL  S PKP+ IF P  ESHVQA+++C+K+ GV +RVRSGGHD+EGLSY S++E P
Sbjct  68    QNLRFLARSMPKPVFIFNPTDESHVQASIICSKKLGVHIRVRSGGHDYEGLSYVSEIEKP  127

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+V+DL+KLR I V++ DNS WVQAGAT GE+YYR+AEKSK  GFPAG C SLGIGGH
Sbjct  128   --FIVMDLSKLRKINVNIRDNSAWVQAGATVGELYYRIAEKSKVHGFPAGLCTSLGIGGH  185

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+M+RKYGL  DN +DA IVDA G++L+R++MGED+FWA+RGGGG SFG +LAW
Sbjct  186   ITGGAYGSMMRKYGLGGDNVIDASIVDAKGKLLNRSSMGEDMFWAMRGGGGASFGTILAW  245

Query  1058  KIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             KIKLVPVP TVTVFTV +TLEQ+   K+L KWQ VADKL E+L ++      N     G 
Sbjct  246   KIKLVPVPKTVTVFTVTKTLEQDVGNKILSKWQVVADKLVEELFIR---VIFNVAENNGS  302

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             +TV  +++A+FLG    L+K+MN SFPELGLT  DC++MSWIES +Y + +P  TP   L
Sbjct  303   KTVTMSYNALFLGNKGMLMKVMNKSFPELGLTSSDCVQMSWIESTVYISGFPSETPTSIL  362

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L GK   PK  FKAKS+F++ P+PESGL G++   LKEDTP M+W+PYGG M+++ ES  
Sbjct  363   LQGKSPNPKINFKAKSDFVKNPIPESGLIGMFSKLLKEDTPSMIWSPYGGRMSEVHESEI  422

Query  521   PFPHRKGVICKIVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLG  345
             PFPHRKGVI KI+Y+T W    ++  +H++WIR MY YM  YVS +PR++YVNYRDLDLG
Sbjct  423   PFPHRKGVIFKILYVTIWPNSDKRPSRHINWIRDMYSYMMPYVSSNPRQSYVNYRDLDLG  482

Query  344   MNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              N     ++F  A VWG  YFKGNF+RLV +K+RVDP+NFF HEQSIP+L
Sbjct  483   QNMKNTKSNFKNAQVWGTNYFKGNFDRLVRIKSRVDPENFFRHEQSIPLL  532



>ref|XP_011039284.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Populus 
euphratica]
Length=540

 Score =   534 bits (1375),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 316/537 (59%), Positives = 399/537 (74%), Gaps = 11/537 (2%)
 Frame = -2

Query  1808  IAMASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnas  1629
             + ++S++S  I  +L   L +    +SL IQ  F +C+  +S+ S PFST  +S   ++ 
Sbjct  1     MILSSYTSLWISGVL---LLYPSLIISLPIQDSFLQCLQKNSNISFPFSTLLYSPVNSSF  57

Query  1628  sfnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEG  1449
             +   +LQS+ QNL F +P  P+P LI+ P+ ESH+QAAV+C+K+ G+ LRVRSGGHD EG
Sbjct  58    TA--ILQSSAQNLRFTLPLTPRPELIYKPVEESHIQAAVICSKQLGIHLRVRSGGHDREG  115

Query  1448  LSYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAG  1269
             LSY +++++P  F+V+DL  LR I VD++ NSVWVQAG+T GE+YYR++EKSKN GFPAG
Sbjct  116   LSYVTEIDTP--FIVVDLDMLRSISVDIDGNSVWVQAGSTIGELYYRISEKSKNHGFPAG  173

Query  1268  NCVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggg  1089
              C S+GIGGHITGG YG+MLRKYGLAADN +DARI+DA GRV DR  MGEDLFWAIRGGG
Sbjct  174   VCPSVGIGGHITGGGYGSMLRKYGLAADNVIDARIIDAQGRVFDRKVMGEDLFWAIRGGG  233

Query  1088  gGSFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITA  909
             GGSFGI+ AWKI LVPVP+TVTVF V +TLE  AT LLY+WQ+VADKLD+DL L V +  
Sbjct  234   GGSFGIISAWKINLVPVPSTVTVFRVAKTLELGATTLLYRWQQVADKLDDDLFLSVSVQL  293

Query  908   VNSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALY  729
              N+   KGK+T+ T++DA+FLG T RLL++M  SFPELGL  +DC+E SWI SV+Y + +
Sbjct  294   ANA-GKKGKKTLSTSYDALFLGDTKRLLQVMQESFPELGLQQQDCIETSWINSVLYMSFF  352

Query  728   PRTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGM  549
             P  T PE LL    LF K + K KS++++ P+PE+ L GLW+   +E+ P +V  PYGGM
Sbjct  353   PNNTTPEILLQRNNLF-KRYLKGKSDYVKEPIPETALEGLWEWLFEEENPSLVLIPYGGM  411

Query  548   MAKIPESATPFPHRKGVICKIVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAY  372
             M KI E   P+PHRKG +  I Y TSWK   E   KH+DWIR++Y+YM  YVS +PREAY
Sbjct  412   MNKISEYQIPYPHRKGNLFMIDYSTSWKDPSENAAKHIDWIRKIYEYMAPYVSMNPREAY  471

Query  371   VNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
              NYRDLDLGMN+   NTS  EASVWG KYFK NF RLV VKTRVDPDNFF HEQSIP
Sbjct  472   GNYRDLDLGMNEK-TNTSCEEASVWGTKYFKDNFYRLVQVKTRVDPDNFFRHEQSIP  527



>emb|CDX84280.1| BnaC04g10420D [Brassica napus]
Length=509

 Score =   532 bits (1370),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 300/527 (57%), Positives = 377/527 (72%), Gaps = 32/527 (6%)
 Frame = -2

Query  1775  LSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQ  1596
             ++   T L  S    S ++Q  F +C+  +S  S P + AF+S   NA+ F   L+ST Q
Sbjct  11    MAFAVTLLLVSIPMSSSTLQQDFLQCLVENSDISFPITAAFYSPDQNATLFKEELESTAQ  70

Query  1595  NLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPA  1416
             NL +L PS PKP+ IF P+ E+HVQAAVVC K+  + LR+RSGGHD+EGLS+ ++ E+P 
Sbjct  71    NLRYLTPSNPKPVFIFEPMYETHVQAAVVCAKKLQLHLRLRSGGHDYEGLSFVAENETP-  129

Query  1415  PFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghi  1236
              FV++DL+KLR I VDV+ NS W  AGAT GEVYYR+ EKS+  GFPAG C SLGIGGH+
Sbjct  130   -FVIVDLSKLRQIDVDVDSNSAWAHAGATVGEVYYRIQEKSQTHGFPAGLCSSLGIGGHL  188

Query  1235  tggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWK  1056
              GGAYG+M+RK+GL ADN LDARI+DA G+ LDRAAMGED+FWA+RGGGGGSFG++LAWK
Sbjct  189   VGGAYGSMMRKFGLGADNVLDARIIDANGKTLDRAAMGEDVFWALRGGGGGSFGVILAWK  248

Query  1055  IKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRT  876
             IKLVPVPATVTVFTV +TLEQ+ TK   K                       T   G RT
Sbjct  249   IKLVPVPATVTVFTVTKTLEQDGTKTASK-----------------------TTRPGNRT  285

Query  875   VQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLH  696
             + T++   FLG ++RL+++M  SFPELGLT KDC EMSWI+SV+Y A +P +  PE LL 
Sbjct  286   ISTSYQGQFLGDSNRLMQVMQKSFPELGLTKKDCTEMSWIKSVMYIAGFPSSAAPEALLD  345

Query  695   GKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPF  516
             GK LF K++FKAKS+F+  P+P  GL GLWK  L+ED+P+ +WNPYGGMMA+IPES  PF
Sbjct  346   GKSLF-KSYFKAKSDFVEEPIPVEGLEGLWKKLLEEDSPLTIWNPYGGMMARIPESEIPF  404

Query  515   PHRKGVICKIVYLTSWKI-EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             PHRKG + KI +L+SW   +  ++KH+ W+R MY YM  YVSK+PR AYVNYRDLDLG+N
Sbjct  405   PHRKGTLFKIQWLSSWSDGKASEEKHMKWMREMYSYMEKYVSKNPRRAYVNYRDLDLGVN  464

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             +       S+A  WG KYFKGNFERLV +K   DP+NFF HEQSIP 
Sbjct  465   EEE-----SDAREWGSKYFKGNFERLVKIKAEFDPENFFRHEQSIPT  506



>ref|XP_002317090.2| hypothetical protein POPTR_0011s16220g [Populus trichocarpa]
 gb|EEE97702.2| hypothetical protein POPTR_0011s16220g [Populus trichocarpa]
Length=533

 Score =   532 bits (1370),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 309/510 (61%), Positives = 384/510 (75%), Gaps = 10/510 (2%)
 Frame = -2

Query  1721  IQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTP  1542
             IQ  F +C+S +S  S PFST  ++   ++ +   +LQS+ QN  F  PS PKP  IFTP
Sbjct  27    IQDSFLQCLSQNSELSFPFSTILYTPKNSSYTT--ILQSSAQNPRFTTPSLPKPEFIFTP  84

Query  1541  LTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVE  1362
             L ESH+QAAV+C+K+ G+ LRV SGGHD+EGLSY S++E P  F+V++LA LR I VD++
Sbjct  85    LQESHIQAAVICSKQIGIHLRVLSGGHDYEGLSYVSEIEKP--FIVVNLANLRSISVDID  142

Query  1361  DNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADN  1182
             D+S WV+ GATNGE+YYR+AEKSK  GFPAG C ++GIGGHITGGAYG ++RKYGLAADN
Sbjct  143   DSSAWVEVGATNGELYYRIAEKSKTHGFPAGLCTTIGIGGHITGGAYGYLMRKYGLAADN  202

Query  1181  ALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRT  1002
              +DARIVD  GRVLDR AMG+DLFWAIRGGGGGSFGI+ AWK+KLVPVP+TVTVF + +T
Sbjct  203   VIDARIVDVHGRVLDRKAMGKDLFWAIRGGGGGSFGIITAWKVKLVPVPSTVTVFQITKT  262

Query  1001  LEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLK  822
             LEQ A K+L +WQ+VADKL+EDL ++V +    +    GKRTV T + ++FLG   RLL+
Sbjct  263   LEQGAIKILNRWQQVADKLNEDLFIRVTLQLAGARN-GGKRTVSTTYISLFLGDAKRLLR  321

Query  821   IMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLR  642
             +M  SFPELGLT +DC+E SWI SV++ A Y   T PEFLL  K ++ K +FKAKS++ +
Sbjct  322   VMQDSFPELGLTRQDCIETSWINSVLFVAGYSNDTTPEFLLERKNIY-KGYFKAKSDYAK  380

Query  641   TPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKI  462
              P+PE+ L GLW+  L+E+ P +   PYGGMM+KI E+ TPFPHRKG +  I Y+TSW  
Sbjct  381   EPIPETILEGLWERLLEEERPNIALTPYGGMMSKISENQTPFPHRKGTLFMIRYMTSWDH  440

Query  461   EGEKK-KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKY  285
               +   KHLDWIR +Y+YM  YV   PR AYVNYRDLDLGMNK   NTSF EASVWG KY
Sbjct  441   PSKNDAKHLDWIRNVYEYMKPYV--QPRTAYVNYRDLDLGMNKK-TNTSFKEASVWGTKY  497

Query  284   FKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             FK NF RL  VKT+VDPDNFF HEQSIP L
Sbjct  498   FKDNFRRLGLVKTKVDPDNFFRHEQSIPPL  527



>ref|XP_010052547.1| PREDICTED: cannabidiolic acid synthase-like 2 [Eucalyptus grandis]
 gb|KCW76617.1| hypothetical protein EUGRSUZ_D01005 [Eucalyptus grandis]
Length=535

 Score =   531 bits (1369),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 302/519 (58%), Positives = 389/519 (75%), Gaps = 12/519 (2%)
 Frame = -2

Query  1736  AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPL  1557
             A  +S    F +C+SLHS  +   + + F  T   SS++SVL  T+QNL FL PSAPKPL
Sbjct  24    AFDISTPENFLQCLSLHSRNA--SAISKFVYTPINSSYSSVLDITIQNLRFLTPSAPKPL  81

Query  1556  LIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGI  1377
              I TPL  SHVQA ++C+++  +Q+R RSGGHD+EGLSY S++    PFV++D+A  R I
Sbjct  82    FIMTPLDISHVQATIICSRQYRLQMRTRSGGHDYEGLSYLSEV----PFVIVDMANFRSI  137

Query  1376  KVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYG  1197
              VD ED + WVQ+GAT GE+YYR+AEKSK LGFPAG C ++G+GGH +GG YG +LRKYG
Sbjct  138   SVDAEDKTAWVQSGATVGELYYRIAEKSKTLGFPAGLCPTVGVGGHFSGGGYGTLLRKYG  197

Query  1196  LAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvf  1017
             LAADN +D ++VDA GR+LDR +MGEDLFWAIRGGGGGSFG++++WK+KLVPVP+TVTVF
Sbjct  198   LAADNVIDVQLVDAQGRLLDRESMGEDLFWAIRGGGGGSFGVVVSWKVKLVPVPSTVTVF  257

Query  1016  tvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKT  837
             T+ RTLEQNATKL+++WQ VA+KL  DL +++++ + NS    G RT+Q  F+ ++LG  
Sbjct  258   TILRTLEQNATKLVHQWQLVANKLPNDLFIRLILQSYNS-GPNGTRTMQAIFNTLYLGGV  316

Query  836   DRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAK  657
             D LL++     PEL +T +DC EMSWIESV+Y A +P  TP E LL+ +    KTFFK K
Sbjct  317   DSLLEVTRSRLPELNVTRQDCTEMSWIESVLYFAGFPSGTPLEVLLN-RSSNTKTFFKNK  375

Query  656   SEFLRTPVPESGLRGLWKIFLKED--TPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             S++++ P+PESGL G+W+ F +ED   P+M+WNPYGG MA+I ESA PFPHR GV+ KI 
Sbjct  376   SDYVKEPIPESGLEGIWERFFEEDQGVPIMIWNPYGGKMAEISESAIPFPHRAGVLYKIQ  435

Query  482   YLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSE  309
             ++T+W   G +   KH+ WIR  Y YM  YVSKSPREAY+NYRDLD+GMN    NTS+ +
Sbjct  436   HITAWTTGGNEVAPKHVSWIRSFYSYMAQYVSKSPREAYINYRDLDIGMNNVIGNTSYKQ  495

Query  308   ASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             ASVWG KYFK NF+RLV VKT VDPDNFF HEQSIP  S
Sbjct  496   ASVWGKKYFKNNFDRLVRVKTAVDPDNFFRHEQSIPPFS  534



>gb|EYU23052.1| hypothetical protein MIMGU_mgv1a023470mg [Erythranthe guttata]
Length=554

 Score =   531 bits (1367),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 300/524 (57%), Positives = 382/524 (73%), Gaps = 19/524 (4%)
 Frame = -2

Query  1721  IQHQFYKCVSLHSHTSIPfstaffstttnassf---nSVLQSTVQNLVFLVPSAPKPLLI  1551
             IQ  F  CV+  S T IP ++   +     +      ++ +ST QNL    PS PKP+LI
Sbjct  30    IQESFPICVAKQSKTLIPQNSTTTNNNFFTTKSPSYTTIFESTAQNLRCSSPSMPKPILI  89

Query  1550  FTPLTESHVQAAVVCTKEAG-VQLRVRSGGHDFEGLSYTSDM---ESPAPFVVIDLAKLR  1383
             FTPL+ESHVQAAVVC +  G +QLR+RSGGHD+EG+SYTS +   +SP PFV+IDL  LR
Sbjct  90    FTPLSESHVQAAVVCARALGNIQLRLRSGGHDYEGISYTSQLLKSQSP-PFVLIDLRNLR  148

Query  1382  GIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRK  1203
              + V + +N+ W QAGAT GE+YYR+++KS+  GFPAG C  LG+GGHITGG YGA++RK
Sbjct  149   TVNVSIPENAAWAQAGATIGELYYRISQKSRTHGFPAGICTGLGVGGHITGGGYGALMRK  208

Query  1202  YGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvt  1023
             YGL ADN +DARIVDA G +LDR  MGEDLFWAIRGGGGGSFGI+LAWK++LV VP  VT
Sbjct  209   YGLGADNVIDARIVDAKGNILDRKTMGEDLFWAIRGGGGGSFGIILAWKVRLVKVPLIVT  268

Query  1022  vftvPRTLEQN----ATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDA  855
             VFTV +T++Q       K+L KWQKVADK+DE+L ++V+I   N  A    R++QT + A
Sbjct  269   VFTVSKTVDQQDRQGGNKILEKWQKVADKIDENLFIRVIIQPTN--ADNNTRSIQTIYSA  326

Query  854   VFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPK  675
             +FLG   +LL+  N  FPELGLT  DC+EMSWIESV+Y+  YPR T P  LL   P   +
Sbjct  327   LFLGGAKKLLETTNAGFPELGLTKDDCVEMSWIESVLYSVGYPRNTSPAVLLQVGPSPFR  386

Query  674   TFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVI  495
              +FKAKS+F + P+PE+GL GLWKIFL+E++P+M+W PYGG+M++I E+ TPFPHR G +
Sbjct  387   NYFKAKSDFFKQPIPENGLNGLWKIFLEEESPIMIWTPYGGIMSRIQETETPFPHRNGFV  446

Query  494   CKIVYLTSWKIEGE--KKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGR--  327
                 YLT+W+ +    + +   W+RR+Y YMG Y SK PREAYVNYRD++LGMN+ GR  
Sbjct  447   FMAQYLTTWRSDNASVRSERYGWMRRLYGYMGGYASKFPREAYVNYRDVELGMNR-GRLG  505

Query  326   NTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NTSF +   WG KYFKGNF+RL  VK+ VDPDNFFWHEQSIPVL
Sbjct  506   NTSFVDGQKWGVKYFKGNFKRLARVKSSVDPDNFFWHEQSIPVL  549



>emb|CDY31642.1| BnaA05g09050D [Brassica napus]
Length=509

 Score =   528 bits (1361),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 298/527 (57%), Positives = 376/527 (71%), Gaps = 32/527 (6%)
 Frame = -2

Query  1775  LSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQ  1596
             ++   T L  S    S ++Q  F +C+  +S  S P + AF+S   NA+ F   L+ST Q
Sbjct  11    MAFAVTLLLVSIPMSSSTLQQDFLQCLVENSDISFPITAAFYSPDQNATLFKEELESTAQ  70

Query  1595  NLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPA  1416
             NL +L PS PKP+ IF P+ E+HVQAAVVC K+  + +RVRSGGHD+EGLS+ S+ E+P 
Sbjct  71    NLRYLTPSNPKPVFIFEPMYETHVQAAVVCAKKLQLHMRVRSGGHDYEGLSFVSENETP-  129

Query  1415  PFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghi  1236
              FV++DL+KLR I VDV+ NS W  AGAT GEVYYR+ EKS+  GFPAG C SLGIGGH+
Sbjct  130   -FVIVDLSKLRQIDVDVDSNSAWAHAGATVGEVYYRIQEKSQTHGFPAGLCSSLGIGGHL  188

Query  1235  tggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWK  1056
              GGAYG+M+RK+GL ADN LDARI+DA G++LDRAAMGED+FWA+RGGGGGSFG++LAWK
Sbjct  189   VGGAYGSMMRKFGLGADNVLDARIIDANGKILDRAAMGEDVFWALRGGGGGSFGVILAWK  248

Query  1055  IKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRT  876
             IKLVPVPATVTVFTV +TLEQ+ TK   K                       T   G RT
Sbjct  249   IKLVPVPATVTVFTVTKTLEQDGTKTASK-----------------------TTKPGNRT  285

Query  875   VQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLH  696
             + T++   FLG ++RL+++M  SFPELGLT KDC EMSWI+SV+Y A +P +  PE LL 
Sbjct  286   ISTSYQGQFLGDSNRLMQVMQKSFPELGLTKKDCTEMSWIKSVMYIAGFPNSAAPEALLD  345

Query  695   GKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPF  516
             GK LF K++FKAKS+F+  P+P  GL GLWK  L+ED+P+ +WNPYGGMM++I ES  PF
Sbjct  346   GKSLF-KSYFKAKSDFVEEPIPVEGLEGLWKKLLEEDSPLTIWNPYGGMMSRIAESEIPF  404

Query  515   PHRKGVICKIVYLTSWKI-EGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             PHRKG + KI +L+SW   +   ++H+ W+R MY YM  YVSK+PR AYVNYRDLDLG+N
Sbjct  405   PHRKGTLFKIQWLSSWSDGKASDERHMKWMREMYSYMEKYVSKNPRRAYVNYRDLDLGVN  464

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             +       S+A  WG KYFKGNFERLV +K   DP+NFF HEQSIP 
Sbjct  465   EEE-----SDAREWGTKYFKGNFERLVKIKGEFDPENFFRHEQSIPT  506



>ref|XP_006398051.1| hypothetical protein EUTSA_v10000851mg [Eutrema salsugineum]
 gb|ESQ39504.1| hypothetical protein EUTSA_v10000851mg [Eutrema salsugineum]
Length=538

 Score =   529 bits (1362),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 302/529 (57%), Positives = 388/529 (73%), Gaps = 10/529 (2%)
 Frame = -2

Query  1775  LSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQ  1596
             +++ F+F T +P + S SIQ  F KC+  ++H   P    FF+   NAS F  VL+STVQ
Sbjct  14    IALYFSFYTITPIS-SNSIQDDFIKCLHRNTHVDFPLEKTFFTPERNASIFIEVLESTVQ  72

Query  1595  NLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPA  1416
             N   L  S PKP+ IF P+ ESHVQA+++C+K+ G+ LRVRSGGHDFEG+SY S ME+  
Sbjct  73    NQRLLTKSLPKPIFIFKPVHESHVQASIICSKKLGIHLRVRSGGHDFEGVSYVSQMETS-  131

Query  1415  PFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghi  1236
              FV++D +KLR IKVD+ED+S WVQAGAT GE+YYR+AEKS   GFPAG C ++GIGG+I
Sbjct  132   -FVLLDFSKLRQIKVDIEDSSAWVQAGATLGELYYRIAEKSNRHGFPAGLCSTVGIGGYI  190

Query  1235  tggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWK  1056
             TGG YG ++RKYGLAADN LDA+IVDA G++LDR  MGEDLFWAIRGGGG SFG++LAWK
Sbjct  191   TGGGYGPLMRKYGLAADNVLDAKIVDANGKLLDRIGMGEDLFWAIRGGGGASFGVILAWK  250

Query  1055  IKLvpvpatvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             IKLVP+P TVTVFTV +TLEQ+A  K L KWQ++ADKL E+L ++V+I     + + G +
Sbjct  251   IKLVPLPETVTVFTVNKTLEQDAKFKTLSKWQRIADKLVEELFIRVII---RPSGIVGNK  307

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV T++ ++FLG    L+K+MN  FPELGLT KDC+EM WIES +YNA +P  T  E LL
Sbjct  308   TVTTSYRSLFLGAKGFLMKVMNKGFPELGLTRKDCIEMKWIESTVYNAEFPANTSIEALL  367

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKED-TPVMVWNPYGGMMAKIPESAT  522
                  F K  FK+KS+F++ P+P  GLRG++K  ++ED +  + W PYGGMMAK PES  
Sbjct  368   QAISPFGKPSFKSKSDFVKNPIPVLGLRGIFKRMIQEDSSSFLAWTPYGGMMAKFPESEI  427

Query  521   PFPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGM  342
             PFPHR G I KI+Y T    E    KH++W+R +Y +M  YVS +PR++YVNY+DLDLG 
Sbjct  428   PFPHRSGTIFKILYYTD--TEKRPSKHINWLRHLYSFMTPYVSSNPRQSYVNYKDLDLGK  485

Query  341   NKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NKN    +F +A VWG KYFK NF+RLV +K++VDP N F HEQSIP L
Sbjct  486   NKNNSKVNFKKAQVWGTKYFKDNFDRLVKIKSKVDPHNVFRHEQSIPSL  534



>ref|XP_006398044.1| hypothetical protein EUTSA_v10000840mg [Eutrema salsugineum]
 gb|ESQ39497.1| hypothetical protein EUTSA_v10000840mg [Eutrema salsugineum]
Length=551

 Score =   528 bits (1361),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 303/531 (57%), Positives = 393/531 (74%), Gaps = 9/531 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             +L + F+F T +P + S S+Q  F KC+  +++   P    FF+   NAS F+ VL+ST 
Sbjct  21    VLLLYFSFYTITPVS-SKSLQDDFIKCLHRNTYVEFPLKKTFFTPDRNASIFDDVLESTA  79

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL +L  S PKP+ IFTP+ ESHVQA+++C+K+  + LRVRSGGHD+EGLSY S +E+P
Sbjct  80    QNLRYLTNSVPKPVFIFTPVHESHVQASIICSKKLRLHLRVRSGGHDYEGLSYVSQIETP  139

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F+++DL+KLR I VD+E+NS WVQAGAT GE+YYR+AEKSK  GFPAG C SLGIGGH
Sbjct  140   --FILMDLSKLRQINVDIEENSAWVQAGATVGELYYRIAEKSKVHGFPAGLCSSLGIGGH  197

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+++RK+GLA DN LDA+IVDA G++LDR++MGED+FWAIRGGGG SFGI+LAW
Sbjct  198   ITGGAYGSLMRKFGLAGDNVLDAKIVDANGKLLDRSSMGEDVFWAIRGGGGASFGIILAW  257

Query  1058  KIKLvpvpatvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             KI+LVPVP T+TVFTV +TLEQ+A  K+L KWQ+VADK+ E+L ++V    +      G 
Sbjct  258   KIRLVPVPETLTVFTVTKTLEQDAGHKILSKWQRVADKVVEELFIRVFFRVL--VGENGN  315

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             +TV T++   FLG+   L+++MN  FPELGLT +DC E+SWIESV+ NA +P+ +P E L
Sbjct  316   KTVATSYIGQFLGEKGTLIEVMNKDFPELGLTQEDCTEISWIESVVSNAGFPQRSPIEVL  375

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L  K    K +FKAKS+F+   +P  GL+G++K  L+E+   M+W PYGGMM+ IPES  
Sbjct  376   LQAKSPLRKEYFKAKSDFINEVIPTLGLKGMFKRLLEEEASFMIWTPYGGMMSTIPESEI  435

Query  521   PFPHRKGVICKIVYLTSW-KIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLD  351
             PFPHR G I    Y T W + E EK   KH+ WIR +Y YM  YVS +PR+AYVNYRDLD
Sbjct  436   PFPHRNGTIFMTNYYTGWSETENEKSANKHIKWIRDLYGYMMPYVSSNPRQAYVNYRDLD  495

Query  350   LGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             LG+NK     SF E+ VWG KYFK NF RLV +KT+ DP+NFF HEQSIP+
Sbjct  496   LGVNKKSTKLSFKESQVWGAKYFKNNFNRLVKIKTKFDPENFFRHEQSIPL  546



>ref|XP_011006005.1| PREDICTED: inactive tetrahydrocannabinolic acid synthase-like 
[Populus euphratica]
Length=533

 Score =   528 bits (1359),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 307/514 (60%), Positives = 383/514 (75%), Gaps = 10/514 (2%)
 Frame = -2

Query  1733  VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLL  1554
             +SL +Q  F +C+S +S  S PFST  ++   ++ +   +LQS+ QN  F  PS PKP  
Sbjct  23    LSLQVQDSFLQCLSKNSELSFPFSTILYAPKNSSYTT--ILQSSAQNPRFTTPSLPKPEF  80

Query  1553  IFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIK  1374
             IFTPL ESH+QAAV+C+K+ G+ LRV SGGHD+EGLSY S++E P  F+V++LA LR I 
Sbjct  81    IFTPLQESHIQAAVICSKQLGIHLRVLSGGHDYEGLSYVSEIEKP--FIVVNLANLRSIS  138

Query  1373  VDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGL  1194
             VD++DNS WVQAGATNGE+YYR+AEKS+  GFPAG C ++GIGGHITGGAYG+MLRKYGL
Sbjct  139   VDIDDNSAWVQAGATNGELYYRIAEKSRTHGFPAGLCTTIGIGGHITGGAYGSMLRKYGL  198

Query  1193  AADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvft  1014
             A DN +DARIVD  GRVLDR AMG+DLFWAIRGGGGGSFGI+ AWK+KLVPVP+TVTVF 
Sbjct  199   AVDNVIDARIVDVHGRVLDRKAMGKDLFWAIRGGGGGSFGIITAWKVKLVPVPSTVTVFQ  258

Query  1013  vPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTD  834
             + +TLEQ A K+L +WQ+VADKLDEDL ++V +  ++     GKRTV T + ++FLG   
Sbjct  259   ITKTLEQGAIKILNRWQQVADKLDEDLFIRVHL-QLDGAGNGGKRTVSTTYGSLFLGDAK  317

Query  833   RLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKS  654
             +LL++M +SFPELGLT +DC+E SWI SV++ A Y   T PEFLL  K ++   +FKAKS
Sbjct  318   KLLQVMQNSFPELGLTRQDCIETSWINSVLHLAGYSNDTAPEFLLERKNIY-SNYFKAKS  376

Query  653   EFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLT  474
             +F + P+PES L  L K+ L+++ P +   PYGGMM+KI E  TPFPHRKG +  I Y+T
Sbjct  377   DFAKQPIPESTLEELCKMLLEQEIPQIALTPYGGMMSKISEKQTPFPHRKGNLFMIHYMT  436

Query  473   SWKIEGEKK-KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
              W    +   KHLDW+R++Y+YM  YV   PR AYVNYRDLDLGMNK   NTS  EASVW
Sbjct  437   IWTSPSDNSAKHLDWVRKVYEYMTPYV--QPRTAYVNYRDLDLGMNKK-TNTSLKEASVW  493

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             G KYFK NF RL  VK   DPDNFF HEQSIP L
Sbjct  494   GSKYFKDNFYRLAFVKATADPDNFFRHEQSIPPL  527



>gb|KCW77261.1| hypothetical protein EUGRSUZ_D01617, partial [Eucalyptus grandis]
Length=515

 Score =   526 bits (1356),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 304/503 (60%), Positives = 383/503 (76%), Gaps = 9/503 (2%)
 Frame = -2

Query  1745  SPW-AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSA  1569
             S W +V+ +IQ  F+ C+S +S  S+  + + + T  N SSF S+L ST  NL +L+P+ 
Sbjct  20    SSWTSVAFTIQQTFFHCLSTNSMNSV--ALSSYYTPNNISSFTSILNSTANNLRYLLPTV  77

Query  1568  PKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAK  1389
             PKP++IFTPL+++HVQAAV+C+K+ G+ +RVRSGGHD+E +SY S +ESP  F+V+DLA 
Sbjct  78    PKPVIIFTPLSDAHVQAAVLCSKQLGLAIRVRSGGHDYEAVSYVSQIESP--FLVLDLAG  135

Query  1388  LRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAML  1209
             LR I+VD+   + W QAGAT GEVYYR+AEKSK  GFP G   SLGIGGHITGGAYG M+
Sbjct  136   LRAIEVDIAQGTAWAQAGATVGEVYYRIAEKSKIHGFPMGVSTSLGIGGHITGGAYGTMM  195

Query  1208  RKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpat  1029
             R +GL ADN LD R+VDA G++LDR AMGEDLFWA+RGGGGGSFGI+LAWK+KLV VP T
Sbjct  196   RMFGLGADNVLDVRMVDAEGKILDRKAMGEDLFWALRGGGGGSFGIILAWKLKLVNVPET  255

Query  1028  vtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVF  849
             VTVFTV + LE+ ATKLL KWQK+A KLD+ L ++V+I   +ST +   RTV  ++ A+F
Sbjct  256   VTVFTVTKNLEEGATKLLVKWQKIAPKLDDRLFIRVIIRP-SSTNLTVNRTVTASYMALF  314

Query  848   LGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTF  669
             LG  D LL IM+  FPELGLT  +C +MSWI SV+Y ALYP  T PE LL GKP F +++
Sbjct  315   LGDPDTLLGIMDKRFPELGLTRANCTKMSWIGSVLYMALYPNITAPEVLLQGKPQF-QSY  373

Query  668   FKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICK  489
             FK+KS+F+R  +PE GL GLWK+FL+E+ P+M+WNPYGG M ++P SATPFPHR+G + K
Sbjct  374   FKSKSDFVRALIPEKGLLGLWKMFLEEEMPLMIWNPYGGEMDRVPASATPFPHRRGTLFK  433

Query  488   IVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFS  312
             I Y  SW+   E   +H+ WIR++YDYMG YVSK+PREAYVNYRD DLGMNK G  TS  
Sbjct  434   IQYAVSWQDGAENMSRHISWIRKLYDYMGPYVSKNPREAYVNYRDFDLGMNKKGV-TSLM  492

Query  311   EASVWGYKYFKGNFERLVAVKTR  243
             EAS WG KYFK NF RLV VKTR
Sbjct  493   EASSWGLKYFKSNFYRLVQVKTR  515



>ref|XP_010051866.1| PREDICTED: cannabidiolic acid synthase-like 2 [Eucalyptus grandis]
Length=533

 Score =   526 bits (1354),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 299/519 (58%), Positives = 385/519 (74%), Gaps = 12/519 (2%)
 Frame = -2

Query  1736  AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPL  1557
             A  ++    F +C+SLHS  +   + +    T   SS++SVL  TVQNL FL PSAPKP 
Sbjct  22    AFDINTPENFLQCLSLHSRNA--SAISKLVYTPINSSYSSVLDITVQNLRFLTPSAPKPS  79

Query  1556  LIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGI  1377
              I  PL  SHVQA ++C+++ G+Q+R RSGGHD+EGLSY S++    PFV++D+A  R I
Sbjct  80    FIVMPLDVSHVQATIICSRQYGLQMRTRSGGHDYEGLSYLSEV----PFVIVDMANFRSI  135

Query  1376  KVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYG  1197
              VDVED + WVQ+G T GE+YYR+AEKSK LGFPAG C ++GIGGH +GG YG +LRKYG
Sbjct  136   SVDVEDKTAWVQSGVTVGELYYRIAEKSKTLGFPAGICPTVGIGGHFSGGGYGTLLRKYG  195

Query  1196  LAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvf  1017
             LAADN +D ++VDA GR+ DR +MGEDLFWAIRGGGGGSFG++++WK+KLVPVP+TVTVF
Sbjct  196   LAADNVIDVQLVDAQGRLQDRVSMGEDLFWAIRGGGGGSFGVVVSWKVKLVPVPSTVTVF  255

Query  1016  tvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKT  837
             T+ RTLEQNATKL+++WQ VA KL  DL +++++ + NS    G RT+Q  F+ ++LG  
Sbjct  256   TILRTLEQNATKLVHQWQLVASKLPNDLFIRLILQSYNS-GPNGTRTMQAIFNTLYLGGV  314

Query  836   DRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAK  657
             D LL++    FPEL +T +DC EMSWIESV+Y   +P  TP E LL+ +    KTFFK K
Sbjct  315   DSLLEVTRSRFPELNVTRQDCTEMSWIESVLYFTGFPSGTPLEVLLN-RSSNTKTFFKNK  373

Query  656   SEFLRTPVPESGLRGLWKIFLKED--TPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             S++++ P+PESGL G+W+ F +ED   P+M+WNPYGG MA+I ESA PFPHR GV+ KI 
Sbjct  374   SDYVKEPIPESGLEGMWERFFEEDQGVPLMIWNPYGGKMAEISESAIPFPHRAGVLYKIQ  433

Query  482   YLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSE  309
             ++T+W   G +   KH+ WIR  Y YM  YVSKSPREAY+NYRDLD+GMN    +TS+ +
Sbjct  434   HITAWTTGGNEVAPKHVSWIRSFYSYMAQYVSKSPREAYINYRDLDIGMNNVIGDTSYKQ  493

Query  308   ASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             ASVWG KYFK NF+RLV VKT VDPDNFF HEQSIP  S
Sbjct  494   ASVWGKKYFKNNFDRLVRVKTAVDPDNFFRHEQSIPPFS  532



>gb|KCW75697.1| hypothetical protein EUGRSUZ_D00070 [Eucalyptus grandis]
Length=535

 Score =   526 bits (1354),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 299/519 (58%), Positives = 385/519 (74%), Gaps = 12/519 (2%)
 Frame = -2

Query  1736  AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPL  1557
             A  ++    F +C+SLHS  +   + +    T   SS++SVL  TVQNL FL PSAPKP 
Sbjct  24    AFDINTPENFLQCLSLHSRNA--SAISKLVYTPINSSYSSVLDITVQNLRFLTPSAPKPS  81

Query  1556  LIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGI  1377
              I  PL  SHVQA ++C+++ G+Q+R RSGGHD+EGLSY S++    PFV++D+A  R I
Sbjct  82    FIVMPLDVSHVQATIICSRQYGLQMRTRSGGHDYEGLSYLSEV----PFVIVDMANFRSI  137

Query  1376  KVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYG  1197
              VDVED + WVQ+G T GE+YYR+AEKSK LGFPAG C ++GIGGH +GG YG +LRKYG
Sbjct  138   SVDVEDKTAWVQSGVTVGELYYRIAEKSKTLGFPAGICPTVGIGGHFSGGGYGTLLRKYG  197

Query  1196  LAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvf  1017
             LAADN +D ++VDA GR+ DR +MGEDLFWAIRGGGGGSFG++++WK+KLVPVP+TVTVF
Sbjct  198   LAADNVIDVQLVDAQGRLQDRVSMGEDLFWAIRGGGGGSFGVVVSWKVKLVPVPSTVTVF  257

Query  1016  tvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKT  837
             T+ RTLEQNATKL+++WQ VA KL  DL +++++ + NS    G RT+Q  F+ ++LG  
Sbjct  258   TILRTLEQNATKLVHQWQLVASKLPNDLFIRLILQSYNS-GPNGTRTMQAIFNTLYLGGV  316

Query  836   DRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAK  657
             D LL++    FPEL +T +DC EMSWIESV+Y   +P  TP E LL+ +    KTFFK K
Sbjct  317   DSLLEVTRSRFPELNVTRQDCTEMSWIESVLYFTGFPSGTPLEVLLN-RSSNTKTFFKNK  375

Query  656   SEFLRTPVPESGLRGLWKIFLKED--TPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             S++++ P+PESGL G+W+ F +ED   P+M+WNPYGG MA+I ESA PFPHR GV+ KI 
Sbjct  376   SDYVKEPIPESGLEGMWERFFEEDQGVPLMIWNPYGGKMAEISESAIPFPHRAGVLYKIQ  435

Query  482   YLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSE  309
             ++T+W   G +   KH+ WIR  Y YM  YVSKSPREAY+NYRDLD+GMN    +TS+ +
Sbjct  436   HITAWTTGGNEVAPKHVSWIRSFYSYMAQYVSKSPREAYINYRDLDIGMNNVIGDTSYKQ  495

Query  308   ASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             ASVWG KYFK NF+RLV VKT VDPDNFF HEQSIP  S
Sbjct  496   ASVWGKKYFKNNFDRLVRVKTAVDPDNFFRHEQSIPPFS  534



>ref|NP_199251.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana]
 dbj|BAB10123.1| berberine bridge enzyme-like protein [Arabidopsis thaliana]
 gb|AAM13126.1| berberine bridge enzyme-like protein [Arabidopsis thaliana]
 dbj|BAE98656.1| berberine bridge enzyme-like protein [Arabidopsis thaliana]
 gb|AED95103.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana]
Length=541

 Score =   526 bits (1354),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 296/533 (56%), Positives = 389/533 (73%), Gaps = 10/533 (2%)
 Frame = -2

Query  1787  SPIILSIL-FTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVL  1611
             S II+S+L F+F   +P + S SIQ QF  CV  ++H S P     F+   N S FN VL
Sbjct  11    SCIIVSVLYFSFYCITPTSSSASIQDQFINCVKRNTHVSFPLEKTLFTPAKNVSLFNQVL  70

Query  1610  QSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSD  1431
             +ST QNL FL  S PKP  IF P+ +S VQA+++C+K+ G+  RVRSGGHDFE LSY S 
Sbjct  71    ESTAQNLQFLAKSMPKPGFIFRPIHQSQVQASIICSKKLGIHFRVRSGGHDFEALSYVSR  130

Query  1430  MESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLg  1251
             +E P  F+++DL+KL+ I VD+E NS WVQ GAT GE+YYR+AEKSK  GFPAG C S+G
Sbjct  131   IEKP--FILLDLSKLKQINVDIESNSAWVQPGATLGELYYRIAEKSKIHGFPAGLCTSVG  188

Query  1250  igghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGI  1071
             IGG++TGG YG ++RKYGLA DN LD ++VDA G++LDRAAMGEDLFWAIRGGGG SFGI
Sbjct  189   IGGYMTGGGYGTLMRKYGLAGDNVLDVKMVDANGKLLDRAAMGEDLFWAIRGGGGASFGI  248

Query  1070  LLAWKIKLvpvpatvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLITAVNSTA  894
             +LAWKIKLVPVP TVTVFTV +TLEQ+A  K + KWQ+++ K+ E++ ++V++ A  +  
Sbjct  249   VLAWKIKLVPVPKTVTVFTVTKTLEQDARLKTISKWQQISSKIIEEIHIRVVLRAAGN--  306

Query  893   VKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTP  714
               G +TV   +   FLG+   LLK+M  +FPELGLT KDC EMSWIE+ +++  +P  +P
Sbjct  307   -DGNKTVTMTYLGQFLGEKGTLLKVMEKAFPELGLTQKDCTEMSWIEAALFHGGFPTGSP  365

Query  713   PEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIP  534
              E LL  K    K +FKA S+F++ P+P  GL+G++K  ++ +T  + W PYGGMM+KIP
Sbjct  366   IEILLQLKSPLGKDYFKATSDFVKEPIPVIGLKGIFKRLIEGNTTFLNWTPYGGMMSKIP  425

Query  533   ESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYR  360
             ESA PFPHR G + KI+Y  +W +E +K   + ++WI+ +Y+YM  YVS +PR+AYVNYR
Sbjct  426   ESAIPFPHRNGTLFKILYYANW-LENDKTSSRKINWIKEIYNYMAPYVSSNPRQAYVNYR  484

Query  359   DLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             DLD G NKN    +F EA +WG KYFKGNF+RLV +KT+VDP+NFF HEQSIP
Sbjct  485   DLDFGQNKNNAKVNFIEAKIWGPKYFKGNFDRLVKIKTKVDPENFFRHEQSIP  537



>ref|XP_003531073.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Glycine 
max]
Length=523

 Score =   524 bits (1350),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 305/514 (59%), Positives = 384/514 (75%), Gaps = 16/514 (3%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S S+Q  F +C++L+S  + PF+   ++  + + +   VL S+ +N   LVPS PKP  I
Sbjct  22    SASLQENFVQCLNLNSDRTFPFNPLIYTPKSPSFTS--VLDSSGKNQRLLVPSTPKPKFI  79

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTP  +SHVQAAV+C+K+ G+ LRV SGGHDFEG+SY S++ESP  F+V+DL KLR I V
Sbjct  80    FTPTRDSHVQAAVICSKKLGIHLRVLSGGHDFEGVSYVSEIESP--FIVVDLIKLRDINV  137

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D++ N+ WVQAGATNGE+YYR+ EKS   GFPAG C SLGIGGHITGGAYG+M+RKYGL 
Sbjct  138   DIKSNTAWVQAGATNGELYYRIYEKSSLHGFPAGTCTSLGIGGHITGGAYGSMVRKYGLG  197

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN LDA+IVDA GR+LDR AMGEDLFWAIRGGGGGSFGILL WK+KLVPVP TVTVFTV
Sbjct  198   ADNVLDAKIVDANGRILDRKAMGEDLFWAIRGGGGGSFGILLWWKVKLVPVPPTVTVFTV  257

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ ATKLL++WQ+VA  LDE+L ++V I    S       TV T+++ +FLG   +
Sbjct  258   KKTLEQGATKLLHRWQEVAPFLDENLFIRVRIQRAQS-------TVTTSYEGLFLGGARK  310

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LLKIM  SFPELG+T KDC+E SWI+SV+Y A +P  TPPE LL GKP+  K FFK KS+
Sbjct  311   LLKIMKTSFPELGVTRKDCMETSWIKSVLYIAGFPSGTPPEVLLKGKPI-AKFFFKGKSD  369

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F+R P+PE+GL GL +  L ED+P+++W+PYGG M +  ES TPFP+R G +   +Y++ 
Sbjct  370   FVRKPIPETGLEGLRQRLLVEDSPLILWSPYGGRMNQFSESDTPFPYRNGTLFISLYISL  429

Query  470   WKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             W+ EGEK   KH+DWI  +++YMG YV   PR  YVNYRDLDLG+N    NT   + S W
Sbjct  430   WQ-EGEKNVAKHIDWIGNLHNYMGAYVPSFPRGQYVNYRDLDLGINTK-NNTGNIQESAW  487

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             GY+YFK NF+RLV +KT+VDP N F HEQSIP L
Sbjct  488   GYRYFKNNFDRLVKIKTKVDPQNVFRHEQSIPPL  521



>gb|KHN39150.1| Reticuline oxidase-like protein [Glycine soja]
Length=523

 Score =   524 bits (1349),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 304/514 (59%), Positives = 383/514 (75%), Gaps = 16/514 (3%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S S+Q  F +C++L+S  + PF+   ++  + + +   VL S+ +N   LVPS PKP  I
Sbjct  22    SASLQENFVQCLNLNSDRTFPFNPLIYTPKSPSFTS--VLDSSGKNQRLLVPSTPKPKFI  79

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
             FTP  +SHVQAAV+C+K+ G+ LRV SGGHDFEG+SY S++ESP  F+V+DL KLR I V
Sbjct  80    FTPTRDSHVQAAVICSKKLGIHLRVLSGGHDFEGVSYVSEIESP--FIVVDLIKLRDINV  137

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D++ N+ WVQAGATNGE+YYR+ EKS   GFPAG C SLGIGGHITGGAYG+M+RKYGL 
Sbjct  138   DIKSNTAWVQAGATNGELYYRIYEKSSLHGFPAGTCTSLGIGGHITGGAYGSMVRKYGLG  197

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN LDA+IVDA GR+LDR AMGEDLFWAIRGGGGGSFGILL WK+KLVPVP TV VFTV
Sbjct  198   ADNVLDAKIVDANGRILDRKAMGEDLFWAIRGGGGGSFGILLWWKVKLVPVPPTVIVFTV  257

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              +TLEQ ATKLL++WQ+VA  LDE+L ++V I    S       TV T+++ +FLG   +
Sbjct  258   KKTLEQGATKLLHRWQEVAPFLDENLFIRVRIQRAQS-------TVTTSYEGLFLGGARK  310

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LLKIM  SFPELG+T KDC+E SWI+SV+Y A +P  TPPE LL GKP+  K FFK KS+
Sbjct  311   LLKIMKTSFPELGVTRKDCMETSWIKSVLYIAGFPSGTPPEVLLKGKPI-AKFFFKGKSD  369

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F+R P+PE+GL GL +  L ED+P+++W+PYGG M +  ES TPFP+R G +   +Y++ 
Sbjct  370   FVRKPIPETGLEGLRQRLLVEDSPLILWSPYGGRMNQFSESDTPFPYRNGTLFISLYISL  429

Query  470   WKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
             W+ EGEK   KH+DWI  +++YMG YV   PR  YVNYRDLDLG+N    NT   + S W
Sbjct  430   WQ-EGEKNVAKHIDWIGNLHNYMGAYVPSFPRGQYVNYRDLDLGINTK-NNTGNIQESAW  487

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             GY+YFK NF+RLV +KT+VDP N F HEQSIP L
Sbjct  488   GYRYFKNNFDRLVKIKTKVDPQNVFRHEQSIPPL  521



>gb|KDP36335.1| hypothetical protein JCGZ_09755 [Jatropha curcas]
Length=495

 Score =   522 bits (1345),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 290/470 (62%), Positives = 370/470 (79%), Gaps = 8/470 (2%)
 Frame = -2

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL +L+PS PKP  IFTPL E+H+QAAV+C+K+ G+ LRVRSGGHD+EGLSY +++++P
Sbjct  29    QNLRYLLPSVPKPEFIFTPLKETHIQAAVICSKQLGIHLRVRSGGHDYEGLSYATEIDNP  88

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F VIDL++LR + V+++DNS WVQ GAT GEVYYR+AEKS+  GFPAG   SLG+GGH
Sbjct  89    --FFVIDLSRLRSVDVNIDDNSAWVQTGATIGEVYYRIAEKSQTHGFPAGLYTSLGVGGH  146

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG M+RKYGL ADN +DA I+D  GR+LDR AMGEDLFWAIRGG GGSFGI+++W
Sbjct  147   ITGGAYGGMMRKYGLGADNVIDAHIIDVNGRLLDRQAMGEDLFWAIRGGAGGSFGIIVSW  206

Query  1058  KIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             K++LV VP+TVTVFTV RTLEQN TK+L++W +VADKLDEDL ++V+IT  N       R
Sbjct  207   KLQLVQVPSTVTVFTVTRTLEQNGTKILHRWTEVADKLDEDLFIRVIITPSN-VGNPVAR  265

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV T++  +FLG  +RLL +  +SFPELGLT  D  EMSW++SV+Y A YP  T PE LL
Sbjct  266   TVSTSYQGLFLGDVNRLLNVTENSFPELGLTRNDSTEMSWLKSVLYTAGYPTNTAPEVLL  325

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATP  519
               K LF K +FKAKS+F++ P+ E+ L GLWKIFL+++TP+M+WNP+GG +++I ES  P
Sbjct  326   QHKSLF-KNYFKAKSDFVKEPISEAALEGLWKIFLEDETPLMIWNPFGGKLSEISESEIP  384

Query  518   FPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLG  345
             FP+RKG++  I Y ++W+ +G+K   KH+DWIR++Y+YM   V  +PR AYVNYRDLDLG
Sbjct  385   FPNRKGILFMIQYASNWQ-DGQKSEAKHIDWIRKLYNYMEPLVGNNPRTAYVNYRDLDLG  443

Query  344   MNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             +N    N S +EASVWG KYFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  444   INTK-NNFSVTEASVWGIKYFKNNFNRLVQVKTKVDPDNFFRHEQSIPPL  492



>ref|XP_010657063.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Vitis vinifera]
Length=545

 Score =   523 bits (1346),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 292/539 (54%), Positives = 392/539 (73%), Gaps = 12/539 (2%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassf  1623
             M + SS I L  + + +    WA S SI   F +C+SL+S+ + P S   ++    + S 
Sbjct  12    MGASSSAIFLPFV-SLVVLVSWATSSSIHENFLQCLSLNSNHTTPISNVLYTPKNLSYSA  70

Query  1622  nSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLS  1443
               +L+ST++NL F   + PKPLLI TPL  SH+QAAV+C+K+ G+ +RVRSGGHD+EGLS
Sbjct  71    --ILESTIENLRFSSSATPKPLLILTPLHVSHIQAAVICSKKYGMNIRVRSGGHDYEGLS  128

Query  1442  YTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNC  1263
             Y S++    PF++IDL +LR I + +ED + WV+AGAT GEVYYR+A+KS+  GFPAG+C
Sbjct  129   YVSEI----PFIIIDLVELRSINISIEDGTAWVEAGATVGEVYYRIAQKSRTYGFPAGSC  184

Query  1262  VSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggG  1083
              ++G+GGH +GG YG ++RKYGL+ADN +DA IV + GRVL+R +MGEDLFWAIRGGGG 
Sbjct  185   PTVGVGGHFSGGGYGTLMRKYGLSADNIIDAYIVVSDGRVLNRESMGEDLFWAIRGGGGA  244

Query  1082  SFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVN  903
             SFGI+L+WKIKLVPVP  VTVFTV RTLEQ A K+  KWQ+V  +L ED+ +     AV 
Sbjct  245   SFGIILSWKIKLVPVPPIVTVFTVGRTLEQGALKVFLKWQQVGSRLQEDIFIGATFGAV-  303

Query  902   STAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR  723
             S + +G+RT++ +F ++FLG T +LL +M  SFPELGL  KDCLEMSWIESV+Y      
Sbjct  304   SGSQEGERTIEVSFKSLFLGNTSQLLSLMKKSFPELGLEAKDCLEMSWIESVLYYTDL-S  362

Query  722   TTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMA  543
               P   LL+  P F K +FKAKS++++ P+ E+GL+G+WK+  +E+  +M+ +PYGG M 
Sbjct  363   GEPVNVLLNRIPQF-KNYFKAKSDYVQEPISETGLQGVWKMLYQEEAGIMILSPYGGRMN  421

Query  542   KIPESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYV  369
             +I E+  PFPHRKG + KI YL SW  EG++  +K ++WIR++Y YM  YVSK PR AY+
Sbjct  422   EISETEVPFPHRKGNLYKIQYLVSWDEEGDRVSQKRINWIRKLYAYMAPYVSKFPRAAYL  481

Query  368   NYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             NYRDLDLG+NK   NTS+++AS+WG KYF  NF RLV VKT+VDP NFF +EQSIP LS
Sbjct  482   NYRDLDLGINKLKGNTSYAQASIWGIKYFSCNFNRLVHVKTKVDPSNFFRNEQSIPSLS  540



>ref|XP_010261630.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Nelumbo 
nucifera]
Length=529

 Score =   521 bits (1343),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 291/539 (54%), Positives = 387/539 (72%), Gaps = 14/539 (3%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassf  1623
             M S S+  ILS+ F  L   PWA S S++ +F +C+SLHS  S P S   +S   ++   
Sbjct  1     MGSSSTSAILSLFF-ILVLVPWATSASVEERFLQCLSLHSDPSSPISAVVYSPNNSSYLS  59

Query  1622  nSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLS  1443
               +  ST+ +L FL  SA KPL I TP TESHVQ AV+C KE G+++R+R GGHD+E LS
Sbjct  60    --IYTSTITSLRFLQSSARKPLFIITPSTESHVQTAVICAKENGLEIRIRGGGHDYEALS  117

Query  1442  YTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNC  1263
               +++    PFV++D++ L+ I VD+EDNS WVQAGAT GE+YYR+AEKS   GFP G C
Sbjct  118   SMAEV----PFVIVDMSNLKTITVDIEDNSAWVQAGATLGELYYRIAEKSNVHGFPGGVC  173

Query  1262  VSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggG  1083
              ++G+ G + GG YG MLRKYGL AD  +DA++VDA G++L+R  MGEDLFWAIRGGG  
Sbjct  174   HTVGVSGFLGGGGYGYMLRKYGLGADQVIDAQMVDANGKILNRETMGEDLFWAIRGGGAA  233

Query  1082  SFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVN  903
             SFGI+L WK++LVPVP  VTVF   +T+E+ ATKL+++WQ VA KL ED+ +++ + A+ 
Sbjct  234   SFGIILRWKVRLVPVPPVVTVFNPSKTIEEGATKLVHRWQYVAHKLHEDIFMRINL-ALT  292

Query  902   STAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR  723
             ST+  GK TV   F ++FLG  DRLL +MN SFPELGL  +DC EMSWI+++ Y   +P 
Sbjct  293   STSSGGK-TVNVEFSSMFLGTIDRLLPLMNESFPELGLKREDCTEMSWIDAMKYLGGFPD  351

Query  722   TTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMA  543
             +T  E LL+ + L  K+  K KS++++ P+PES   G+WK FL+ + PVM  NPYGG M+
Sbjct  352   ST-LEVLLN-RTLQSKSLSKNKSDYVKKPIPESAFEGIWKRFLQMEIPVMQLNPYGGRMS  409

Query  542   KIPESATPFPHRKGVICKIVYLTSWKIEG--EKKKHLDWIRRMYDYMGTYVSKSPREAYV  369
             +I ESATPFPHRKG I KI Y+  W+  G  E K+H++W+R +Y YM  YVSKSPREAY+
Sbjct  410   EISESATPFPHRKGNIYKIQYIIIWQQNGTQEIKRHINWVRELYKYMTPYVSKSPREAYL  469

Query  368   NYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             NYRDLD+G N  G NTS+S+AS+WG KYFK NF+RLV VK++VDP NFF +EQSIP ++
Sbjct  470   NYRDLDIGKNNKG-NTSYSQASIWGRKYFKNNFDRLVYVKSKVDPGNFFRNEQSIPAVT  527



>ref|XP_011006004.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Populus 
euphratica]
Length=540

 Score =   521 bits (1342),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 304/509 (60%), Positives = 382/509 (75%), Gaps = 9/509 (2%)
 Frame = -2

Query  1721  IQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTP  1542
             IQ  F +C+S +S  S PFST F++   ++ +   +LQS+ QN  F  PS PKP  IFTP
Sbjct  27    IQDSFLQCLSKNSEFSFPFSTIFYTPKNSSYTT--ILQSSAQNPRFTTPSLPKPEFIFTP  84

Query  1541  LTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVE  1362
             L ESH+QAAV+C+K+ G+ LRV SGGHD+EGLSY S++E P  F+V++LA LR I VD++
Sbjct  85    LQESHIQAAVICSKQLGIHLRVLSGGHDYEGLSYVSEIEKP--FIVVNLANLRSISVDID  142

Query  1361  DNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADN  1182
             DNS WVQAGAT GE+YYR++E+SKN GFPAG C ++G+GGHI GG YG + RKYGLAADN
Sbjct  143   DNSAWVQAGATIGELYYRISERSKNHGFPAGICPTVGVGGHIAGGGYGPIFRKYGLAADN  202

Query  1181  ALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRT  1002
              +DARI+DA GRVLDR AMG+DLFWAIRGGGGGSFGI+ AWK+K+VPVP TVT F V +T
Sbjct  203   VIDARIIDAHGRVLDRKAMGKDLFWAIRGGGGGSFGIITAWKVKVVPVPPTVTFFEVSKT  262

Query  1001  LEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLK  822
             LEQ A KLL KWQ++ADKLDEDL L+V+I   N++  KGKRTV T + A+FLG   RLL 
Sbjct  263   LEQGAIKLLCKWQQIADKLDEDLYLQVVIRLANASD-KGKRTVSTTYKALFLGGATRLLH  321

Query  821   IMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLR  642
             +M  S PELGLT KDC+E SWI+S++Y A  P  T PE LL  K LF K +FK KS++ +
Sbjct  322   VMQESLPELGLTRKDCMESSWIDSMLYEAYLPNNTSPEILLERKNLF-KNYFKIKSDYAK  380

Query  641   TPVPESGLRGLWKIFL-KEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWK  465
               + E+ L GL+++ L  E++P ++  PYGG+M+KI ES TP+PHRKG +  I Y++SWK
Sbjct  381   ELISETALEGLFEMLLTSEESPRIILVPYGGVMSKISESQTPYPHRKGNLFLIAYMSSWK  440

Query  464   -IEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYK  288
              +     KH+DWI+++Y+YM  YVS +PREAY NYRDLDLGMN   R     E+S WG K
Sbjct  441   DVSENAAKHIDWIKKVYEYMTPYVSMNPREAYANYRDLDLGMNNRTRPI-VEESSAWGTK  499

Query  287   YFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             YFK NF RLV VKTRVDPDNFF HEQSIP
Sbjct  500   YFKDNFYRLVRVKTRVDPDNFFRHEQSIP  528



>ref|XP_010052550.1| PREDICTED: cannabidiolic acid synthase-like 2 [Eucalyptus grandis]
Length=535

 Score =   521 bits (1342),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 295/519 (57%), Positives = 382/519 (74%), Gaps = 12/519 (2%)
 Frame = -2

Query  1736  AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPL  1557
             A  +S    F +C+SLHS  +   + +    T   SS++SVL  T+QNL FL PSAPKPL
Sbjct  24    AFDISTPENFLQCLSLHSRNA--SAISKLVYTPINSSYSSVLDITIQNLRFLTPSAPKPL  81

Query  1556  LIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGI  1377
              I TPL  SHVQA ++C+++  +Q+R RSGGHD+EGLSY S++    PFV++D+A  R I
Sbjct  82    FIVTPLNISHVQATIICSRQYKLQMRTRSGGHDYEGLSYLSEV----PFVIVDMANFRSI  137

Query  1376  KVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYG  1197
              VD ED + WVQ+GAT GE+YYR+AEKS  LGFPAG C ++G+GGH +GG YG +LRKYG
Sbjct  138   SVDAEDKTAWVQSGATVGELYYRIAEKSNTLGFPAGVCPTVGVGGHFSGGGYGTLLRKYG  197

Query  1196  LAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvf  1017
             LAADN +D ++VDA GR+LDR +MGEDLFWAIRGGGGGSFG++++WK+KLVPVP+TVTVF
Sbjct  198   LAADNVIDVQLVDAQGRLLDRESMGEDLFWAIRGGGGGSFGVVVSWKVKLVPVPSTVTVF  257

Query  1016  tvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKT  837
             T+ RTLEQNATKL ++WQ VA+K   DL +++ + + N++   G RT+Q  F+ ++L   
Sbjct  258   TILRTLEQNATKLAHQWQLVANKFPNDLFMRLTLQS-NNSGPNGTRTMQAIFNTLYLAGV  316

Query  836   DRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAK  657
             D LL++    FPEL +T +DC EMSWIESV+Y A +P  TP E LL+ +    KTFFK K
Sbjct  317   DSLLEVTRSRFPELNVTRQDCTEMSWIESVLYFAGFPTGTPLEVLLN-RSSNTKTFFKNK  375

Query  656   SEFLRTPVPESGLRGLWKIFLKED--TPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             S++++ P+PESGL G+W+ F +ED   P+M WNPYGG MA+I ESA PFPHR GV+  I 
Sbjct  376   SDYVKEPIPESGLEGMWERFFEEDQGVPIMEWNPYGGKMAEISESAIPFPHRAGVLYMIQ  435

Query  482   YLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSE  309
             ++T W   G +   KH+ WIR  Y YM  YVSKSPREAY+N+RDLD+GMN    +TS+ +
Sbjct  436   HITIWTTGGNEVAPKHVSWIRSFYSYMAQYVSKSPREAYINFRDLDIGMNNVIGDTSYKQ  495

Query  308   ASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             ASVWG KYFK NF+RLV VKT VDPDNFF HEQSIP  S
Sbjct  496   ASVWGKKYFKENFDRLVRVKTAVDPDNFFQHEQSIPPFS  534



>ref|XP_006398049.1| hypothetical protein EUTSA_v10000841mg [Eutrema salsugineum]
 gb|ESQ39502.1| hypothetical protein EUTSA_v10000841mg [Eutrema salsugineum]
Length=547

 Score =   521 bits (1343),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 301/541 (56%), Positives = 384/541 (71%), Gaps = 14/541 (3%)
 Frame = -2

Query  1796  SWSSPIILSILFTFLTFSPWAV----SLSIQHQFYKCVSLHSHTSIPfstaffstttnas  1629
             S S P I  I F  L FS + +    S S+Q  F KC+  +++   P    FFS   NAS
Sbjct  10    SKSFPAIFYISFIALYFSLYTITPIFSNSLQDNFIKCLEKNTYVDFPLEKTFFSPKRNAS  69

Query  1628  sfnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEG  1449
              F  VL+ST+QN   L  S PKP+ IF P+ ESHVQA+++C+ + G+ LRVRSGGHDFEG
Sbjct  70    IFKEVLESTIQNQRLLTKSLPKPICIFKPVHESHVQASIICSNKLGIHLRVRSGGHDFEG  129

Query  1448  LSYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAG  1269
             LSY S ME+   FV++D +KLR IKVD+EDNS WVQAGAT GE+YYR+AEKS   GFPAG
Sbjct  130   LSYVSQMETS--FVLLDFSKLRQIKVDIEDNSAWVQAGATLGELYYRIAEKSNRHGFPAG  187

Query  1268  NCVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggg  1089
              C ++G+GG+ITGG YG ++RKYGLAADN LDA+IVDA G++LDR AMGEDLFWAIRGGG
Sbjct  188   LCSTVGVGGYITGGGYGPLMRKYGLAADNVLDAKIVDANGKLLDRIAMGEDLFWAIRGGG  247

Query  1088  gGSFGILLAWKIKLvpvpatvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLIT  912
             G SFG++LAWKIKL PVP T+TVFTV +TLEQ+A  K L KWQ++A KL E+L ++V I+
Sbjct  248   GASFGVILAWKIKLAPVPETLTVFTVIKTLEQDANFKTLSKWQRIAHKLVEELFIRVTIS  307

Query  911   AVNSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNAL  732
              + +      +TV T +  +FLG    L+K+MN  F ELGLT KDC EMSWIES +YNA 
Sbjct  308   PIGNGE---NKTVMTMYRGLFLGGKGTLMKVMNKGFLELGLTRKDCTEMSWIESTVYNAD  364

Query  731   YPRTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDT--PVMVWNPY  558
             +P  TP E L+     F K  FK+KS+F++ P+P SGL+G++K  ++ED+    + W PY
Sbjct  365   FPANTPIEVLIQAISPFEKLSFKSKSDFVKEPIPVSGLKGIFKRMMQEDSLASFLAWTPY  424

Query  557   GGMMAKIPESATPFPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPRE  378
             GGMMAK  ES  PFPHR+G + KI Y T+   E    KH++W+R +Y +M  YVS +PR+
Sbjct  425   GGMMAKFSESEIPFPHRRGTLFKIFYNTN--TEKRPSKHINWLRDLYSFMTPYVSSNPRQ  482

Query  377   AYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             +YVNYRDLDLG NKN    +F +A +WG KYFK NF+RLV +K +VDP N F HEQSIP 
Sbjct  483   SYVNYRDLDLGKNKNNSKANFKKAQIWGTKYFKDNFDRLVKIKLKVDPHNVFRHEQSIPT  542

Query  197   L  195
             L
Sbjct  543   L  543



>ref|XP_010275367.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Nelumbo 
nucifera]
Length=543

 Score =   521 bits (1341),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 292/540 (54%), Positives = 387/540 (72%), Gaps = 23/540 (4%)
 Frame = -2

Query  1778  ILSILFTF-----LTFSPWAVSLSIQHQFYKCVSLHSHT----SIPfstaffstttnass  1626
             I++++F+      L    WA   S    F +C+ +HS++    SIP S   ++    + S
Sbjct  6     IIAVIFSLFSVLRLCSVSWAAPDSAHWNFLQCLHVHSNSDSEPSIPISEVLYTPNNFSYS  65

Query  1625  fnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGL  1446
                +LQ ++QNL F + S P+PLLI TP   SH+QA V+C+++AG+QLRVRSGGHD+EGL
Sbjct  66    S--LLQHSIQNLRFSLSSTPEPLLIITPTNVSHIQATVICSRKAGLQLRVRSGGHDYEGL  123

Query  1445  SYTSDMESPAPFVVIDLAKLRGIKVDVEDN-SVWVQAGATNGEVYYRVAEKSKNLGFPAG  1269
             SY SD+    PF+++DL   R I VD+EDN + W+QAGA  GEVYYRVAE SK  GFPAG
Sbjct  124   SYVSDV----PFIIVDLLNFRSIDVDIEDNGTAWIQAGAVLGEVYYRVAETSKIHGFPAG  179

Query  1268  NCVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggg  1089
             +C ++G+GGH +GG +G M RKYGLAADN +DA +VD  GR+L+R +MGEDLFWAIRGGG
Sbjct  180   SCPTVGVGGHFSGGGFGLMFRKYGLAADNIIDAYLVDVNGRILNRESMGEDLFWAIRGGG  239

Query  1088  gGSFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITA  909
             G SFGI+++W++KLVPVP  VT  TV RTLEQ ATKL+++WQ +ADKL ED+ L + I A
Sbjct  240   GASFGIVVSWRVKLVPVPPVVTACTVDRTLEQGATKLIHQWQFIADKLHEDIFLHINIAA  299

Query  908   VNSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALY  729
             +N    KG  TV+ +F+++FLG +++LL++MN SFPELGL  +DC EMSWI+SV+Y A +
Sbjct  300   INQ---KGNTTVRASFESMFLGGSEKLLQMMNASFPELGLKKEDCAEMSWIQSVLYFAGF  356

Query  728   PRTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGM  549
               +   E LL  +P   K+FFKAKS++++ P+ E+GL G+WK   + D   M+W PYGG 
Sbjct  357   STSESLEVLLDRRPQ-SKSFFKAKSDYVKEPISETGLEGIWKRLYQGDGAYMIWTPYGGR  415

Query  548   MAKIPESATPFPHRKGVICKIVYLTSWKIEG--EKKKHLDWIRRMYDYMGTYVSKSPREA  375
             M +IPES  PFPHRKG I KI Y+ SW+ EG    K+H+ WIR +Y YMG YVS SPR A
Sbjct  416   MDEIPESEIPFPHRKGNIYKIQYMVSWEDEGIEASKRHIGWIRMLYKYMGPYVSNSPRAA  475

Query  374   YVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             Y+NYRDLDLG N  G NTS+S+  +WG KYFK NF+RLV VK+ VDP NFF +EQSIP +
Sbjct  476   YLNYRDLDLGTNSKG-NTSYSQGRIWGEKYFKSNFKRLVHVKSMVDPGNFFRYEQSIPSI  534



>gb|KDP34623.1| hypothetical protein JCGZ_11146 [Jatropha curcas]
Length=531

 Score =   520 bits (1339),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 303/535 (57%), Positives = 397/535 (74%), Gaps = 11/535 (2%)
 Frame = -2

Query  1790  SSPIILSILFTFLTFSPWAV-SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSV  1614
             +S I  SIL  FL  SP  + S  I   F +C++L+S  SIPFST+F++   ++ S   V
Sbjct  2     ASSISYSILIFFLLLSPSCILSGPIVDSFLQCLTLNSEVSIPFSTSFYTPNNSSFSE--V  59

Query  1613  LQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTS  1434
             LQ T QNL FL+PS PKPL IF P  E+H+QA+V+C+K+ G+ LRVRSGG+D EGLSYT+
Sbjct  60    LQYTAQNLRFLLPSVPKPLFIFIPSHENHIQASVICSKQLGIHLRVRSGGNDVEGLSYTT  119

Query  1433  DMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSL  1254
             ++++P  F +ID++ LR + V+++DNS WVQ GAT GE+YYR+AEKS+  GFPA    ++
Sbjct  120   EIDNP--FFIIDMSALRSVDVNIDDNSAWVQTGATLGELYYRIAEKSETHGFPAVLLSTI  177

Query  1253  gigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFG  1074
             G+GGHIT GAYGAM+RKYGLAADN +DA I+D  GR+L+R AMG+DLFWAIRGG GGSFG
Sbjct  178   GVGGHITAGAYGAMVRKYGLAADNVIDAHIIDVHGRLLEREAMGDDLFWAIRGGAGGSFG  237

Query  1073  ILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTA  894
             I+++WK+KLV VP+TVT FTV +TLEQN TK+L +W +VADKLD+DL L+V I+  N   
Sbjct  238   IIVSWKLKLVQVPSTVTAFTVKKTLEQNGTKILQRWTEVADKLDDDLFLRVAISPAN-IG  296

Query  893   VKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTP  714
                 RTV +A+  +FLG  +RLL IM +SF ELGLT  DC EMSW++SV+Y   YP  T 
Sbjct  297   NSTVRTVSSAYHGLFLGDVNRLLNIMENSFSELGLTRNDCAEMSWLKSVLYTTGYPPNTT  356

Query  713   PEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIP  534
             PE LL GKPLF K + K K++F++ P+PE+ L GL KI L+++TPV+   P+GG M +I 
Sbjct  357   PEVLLQGKPLF-KDYSKVKTDFVKEPIPEAALEGLSKILLEDETPVVTLIPFGGKMNEIS  415

Query  533   ESATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYR  360
             ES  PFPHRKG +  I Y + W ++G+K   +H+DWIR++Y+YM  +V+ +PR AY  +R
Sbjct  416   ESEIPFPHRKGTLFTIYYASQW-VDGQKSEARHIDWIRKLYNYMQPFVTNNPRSAYAGFR  474

Query  359   DLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             DLDLG+N N  N S +EASVWG KYFK NF RLV VKT+VDPDNFF HEQSIP L
Sbjct  475   DLDLGIN-NKNNFSVTEASVWGIKYFKDNFNRLVQVKTKVDPDNFFRHEQSIPPL  528



>emb|CDY13105.1| BnaA09g17120D [Brassica napus]
Length=540

 Score =   520 bits (1340),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 314/539 (58%), Positives = 391/539 (73%), Gaps = 14/539 (3%)
 Frame = -2

Query  1787  SPIILSILFTFLTFSPWAV----SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfn  1620
             +P +  I F  L FS + V    S S+Q  F  C+  H++   P    FF+   NAS F 
Sbjct  7     APAVSYISFLALYFSFYKVASTSSNSLQDDFINCLHQHTNVDFPLDKTFFTPDRNASMFI  66

Query  1619  SVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSY  1440
              VL ST QN  +L  S PKP  IF P+ ESHVQA+++C+K+ G+ LRVRSGGHDFEGLSY
Sbjct  67    EVLNSTAQNQRYLTTSMPKPDFIFKPVHESHVQASIICSKKLGIHLRVRSGGHDFEGLSY  126

Query  1439  TSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCV  1260
              S +E+P  F++IDL+KLR I +D+EDNSVWVQAGAT GE+YYR++EKSK  G PAG   
Sbjct  127   VSHIETP--FIIIDLSKLRQINIDIEDNSVWVQAGATVGELYYRISEKSKIHGCPAGIYP  184

Query  1259  SLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGS  1080
             SLGIGGHITGGAYG++LRKYGLAADN LDA+IVDA G++LDR AMGED+FWAIRGG GGS
Sbjct  185   SLGIGGHITGGAYGSLLRKYGLAADNVLDAKIVDANGKLLDRTAMGEDMFWAIRGGAGGS  244

Query  1079  FGILLAWKIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAVN  903
             FGI+LAWKIKLVPVP T+TVFTV +TL+Q+   K+L KWQ+VADKL EDLLL+V  T V 
Sbjct  245   FGIILAWKIKLVPVPQTLTVFTVTKTLDQDPGFKILSKWQQVADKLVEDLLLRVFFTIVG  304

Query  902   STAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR  723
             +      +TV  ++   FLG+   L+++M+  FPELGLT +DC+EM+WIESVIYN+ +P 
Sbjct  305   NNE---NKTVAMSYIGQFLGEKGNLMEVMHKDFPELGLTQEDCIEMNWIESVIYNSGFPT  361

Query  722   TT--PPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGM  549
             +T  PPE LL  K    + +FKAKS+F + P+P  GL+G+ K  L+E+  +MVW PYGGM
Sbjct  362   STPPPPEVLLQAKSPMGEVYFKAKSDFAKEPIPILGLKGMIKKILEEEAALMVWTPYGGM  421

Query  548   MAKIPESATPFPHRKGVICKIVYLTSW-KIEGEKKKHLDWIRRMYDYMGTYVSKSPREAY  372
             M KIPES  PFPHR G    I+Y  SW   E      + WIR +Y+YM  YVS +PR+AY
Sbjct  422   MDKIPESEIPFPHRSGTSFMILYYRSWSDTEKRPDMRIRWIRELYNYMTPYVSSNPRQAY  481

Query  371   VNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             VNYRDLDLG N N + TSF++A VWG KYFK NF RLV +KT+VDP+NFF HEQSIP L
Sbjct  482   VNYRDLDLGQNNNLK-TSFNQAQVWGAKYFKDNFNRLVKIKTKVDPENFFRHEQSIPPL  539



>ref|XP_006398048.1| hypothetical protein EUTSA_v10000844mg [Eutrema salsugineum]
 gb|ESQ39501.1| hypothetical protein EUTSA_v10000844mg [Eutrema salsugineum]
Length=541

 Score =   520 bits (1339),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 301/530 (57%), Positives = 390/530 (74%), Gaps = 11/530 (2%)
 Frame = -2

Query  1775  LSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQ  1596
             L++ F+F T +P + S SIQ  F KC+  ++H   P    FF+   NAS F  +L+ST Q
Sbjct  16    LALYFSFYTITPIS-SNSIQDDFIKCLHRNTHVDFPLEKTFFTPERNASIFVEILESTAQ  74

Query  1595  NLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPA  1416
             N  FL  S PKP+LIF P+  SHVQA+++C+K+ G+ LRVRSGGHDFEG+SY S ME+  
Sbjct  75    NQRFLTKSLPKPILIFKPVHVSHVQASIICSKKLGMGLRVRSGGHDFEGMSYVSQMETS-  133

Query  1415  PFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghi  1236
              FV++DL+K+R IKVD+EDNS WVQAGAT GE+YYR+A+KS   GFPAG C ++GIGG+I
Sbjct  134   -FVLLDLSKMRQIKVDIEDNSAWVQAGATLGELYYRIAKKSNRHGFPAGLCSTVGIGGYI  192

Query  1235  tggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWK  1056
             TGG YG+++RKYGL+ADN LDA+IVDA G++LDR++MGE+LFWAIRGGGG SFG++LAWK
Sbjct  193   TGGGYGSLVRKYGLSADNVLDAKIVDANGKLLDRSSMGENLFWAIRGGGGASFGVILAWK  252

Query  1055  IKLvpvpatvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             IKLVPVP TVTVFTV +T EQ+A  K+L KWQ V DKL E+L ++V I  + +    G +
Sbjct  253   IKLVPVPETVTVFTVTKTREQDADFKILSKWQHVVDKLVEELFIRVAIRPIGNG---GNK  309

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL  699
             TV T++  +FLG    L+K+MN  FPEL LT KDC EMSWIES +YNA +P  TP E L+
Sbjct  310   TVMTSYRGLFLGGQGTLMKVMNKGFPELRLTRKDCTEMSWIESTVYNAEFPANTPIEVLI  369

Query  698   HGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPV--MVWNPYGGMMAKIPESA  525
               K  F K  FK+KS+F++ P+P SGL+ ++K  ++ED+P   + W PYGG MAKI ES 
Sbjct  370   QVKSPFGKLSFKSKSDFVKEPIPVSGLKRIFKKMMQEDSPASFLGWTPYGGKMAKISESE  429

Query  524   TPFPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLG  345
              PFPHR   I  I+Y T    E E  KH++W+R +Y +M  YVS +PR++YVNYRDLDLG
Sbjct  430   IPFPHRNDTIFIILYNTD--TETEPSKHINWLRDLYSFMTPYVSSNPRQSYVNYRDLDLG  487

Query  344   MNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              N+     +F +A VWG KYFK NFERLV VK++VDP+NFF HEQSIP+L
Sbjct  488   KNEENSKVNFKKAQVWGTKYFKDNFERLVMVKSKVDPENFFRHEQSIPIL  537



>ref|XP_008445653.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Cucumis 
melo]
Length=543

 Score =   518 bits (1334),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 295/537 (55%), Positives = 391/537 (73%), Gaps = 14/537 (3%)
 Frame = -2

Query  1781  IILSILFTFLTFS-PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQS  1605
             +I S L  F+  S  WA S      F  C+S HS  +   S +    T    S++SVL  
Sbjct  4     LITSFLHIFIVLSFAWAASAHNHESFLHCLSHHSPNT--SSISKIIYTPTNPSYSSVLNF  61

Query  1604  TVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDME  1425
             ++ NL F  P  PKP +I TP   S +QA+++C K+ G Q+R RSGGHD+EGLSY SD+ 
Sbjct  62    SIHNLRFTSPKTPKPHIIVTPFLVSQIQASIICAKKTGFQIRTRSGGHDYEGLSYVSDVS  121

Query  1424  SPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgig  1245
                  VV+DL  LR I VD E+N  WVQ+GAT GE+YYR+AEKSK LGFPAG C ++G+G
Sbjct  122   F----VVVDLINLRSISVDAENNVAWVQSGATIGELYYRIAEKSKTLGFPAGVCPTVGVG  177

Query  1244  ghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILL  1065
             GH +GG YG MLRK+GLAADN +DA  +D  G++ DR +MGED+FWAIRGGGG SFGI+L
Sbjct  178   GHFSGGGYGLMLRKFGLAADNVIDAYFIDVNGKLHDRKSMGEDVFWAIRGGGGASFGIVL  237

Query  1064  AWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVK-  888
             AWKIKL+PVP+ VTVFT+ RTLEQNAT L+++WQ V+ K D+ L +++++T +N+T  + 
Sbjct  238   AWKIKLLPVPSIVTVFTITRTLEQNATDLIHRWQYVSSKQDDKLFIRIILTGINTTNSQH  297

Query  887   -GKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP  711
               KRT++ AF+++FLGK + L+ IM  +FPELGLT +DC+EMSWIESV+Y A + R  P 
Sbjct  298   GNKRTIEAAFNSLFLGKIEELVPIMEKTFPELGLTKEDCIEMSWIESVLYFAGFSRGQPL  357

Query  710   EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKE--DTPVMVWNPYGGMMAKI  537
               LL  +PL PK FFKAKS+++  P+P++GL G+W++F +E  +  V++ +PYGG+M KI
Sbjct  358   NVLLDRRPLTPKRFFKAKSDYVNEPIPKAGLEGIWELFDEEEAEAAVLILSPYGGIMDKI  417

Query  536   PESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNY  363
              ES  PFPHR G + KI +L  W  EGE   K+H++WIR++Y YM  +VSK+PR AY+NY
Sbjct  418   SESEIPFPHRAGNLYKIQHLVYWDEEGEDIAKRHINWIRKLYSYMAPFVSKNPRAAYINY  477

Query  362   RDLDLGMN-KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             RDLD+G N KNGRNTS++EASVWG KYFKGNF+RLV+VKT+VDP NFF +EQSIP L
Sbjct  478   RDLDIGTNEKNGRNTSYNEASVWGVKYFKGNFKRLVSVKTKVDPSNFFKNEQSIPSL  534



>ref|XP_010494451.1| PREDICTED: tetrahydrocannabinolic acid synthase-like isoform 
X1 [Camelina sativa]
Length=541

 Score =   516 bits (1329),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 290/537 (54%), Positives = 382/537 (71%), Gaps = 15/537 (3%)
 Frame = -2

Query  1784  PIILSILFTFLTFSPWAV------SLSIQHQFYKCVSLHSHTSIPfstaffstttnassf  1623
             P I  I F  L FS + +      S S+Q +F  CV  ++H   P  T  F+   N S F
Sbjct  8     PTISCISFLVLYFSFYCITPTSSSSASLQDEFISCVKTNTHVDFPLETTLFAPAKNVSMF  67

Query  1622  nSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLS  1443
             + VL+ST QNL FL  S PKP  IF P+ ES VQA+++C+K+ G+  RVRSGGHDFE +S
Sbjct  68    DQVLESTAQNLRFLAKSMPKPGFIFRPVHESQVQASIICSKKLGIHFRVRSGGHDFEAMS  127

Query  1442  YTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNC  1263
             + S +E P  F++ID +KLR I VD+EDNS WVQAGAT GE+YYR+AEKSK  GFPAG C
Sbjct  128   FVSRIERP--FILIDFSKLRQIDVDIEDNSTWVQAGATLGELYYRIAEKSKIHGFPAGLC  185

Query  1262  VSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggG  1083
              S+GIGG++TGG YG+++RKYGLA DN LD ++VDA G++L+R +MGEDLFWA+RGGGG 
Sbjct  186   TSVGIGGYMTGGGYGSLMRKYGLAGDNVLDVKMVDANGKLLNRTSMGEDLFWALRGGGGA  245

Query  1082  SFGILLAWKIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAV  906
             SFGI+LAWKIKLVPVP T+T+FTV +T +Q+   K++ KWQ++A  + E+L ++V  TAV
Sbjct  246   SFGIVLAWKIKLVPVPETLTMFTVTKTPKQDPGMKIISKWQRIASNVMEELHIRVEFTAV  305

Query  905   NSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYP  726
              +   KG RTV  ++   FLG+   L+K+MN  FPELGLT +DC EMSWIES + N  + 
Sbjct  306   GN---KGNRTVMMSYKGQFLGEKVTLMKVMNKVFPELGLTLEDCTEMSWIESALRNGGFA  362

Query  725   RTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMM  546
               +  + LL  +    K +FKAKS+F++ P+   GL+G++K  +KEDTP + W PYGGMM
Sbjct  363   NGSSIDILLQLQSPLGKNYFKAKSDFVKEPISPLGLKGMFKRLIKEDTPFLNWTPYGGMM  422

Query  545   AKIPESATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAY  372
             A+IPES  PFPHR G++ KI+Y T+W  E +K+  +H++WIR +Y YM  YVS +PR+AY
Sbjct  423   ARIPESEIPFPHRNGILFKILYQTNWP-ENDKRPSRHINWIRELYSYMAPYVSSNPRQAY  481

Query  371   VNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             VNYRDLDLG N N    +  EA  WG KYFK N+ RLV +KT+VDPDNFF +EQSIP
Sbjct  482   VNYRDLDLGQNMNNAKVNSIEAKTWGAKYFKDNYNRLVKIKTKVDPDNFFRYEQSIP  538



>ref|XP_010261629.1| PREDICTED: inactive tetrahydrocannabinolic acid synthase-like 
[Nelumbo nucifera]
Length=531

 Score =   515 bits (1326),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 278/521 (53%), Positives = 377/521 (72%), Gaps = 15/521 (3%)
 Frame = -2

Query  1742  PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPK  1563
             PWA S S++  F +C+SL S+ S P S   +S+  ++     +  ST+QNL FL    PK
Sbjct  20    PWATSASVEETFLQCLSLRSNPSSPISALVYSSNNSSYQS--IYTSTIQNLRFLQSDTPK  77

Query  1562  PLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLR  1383
             PL I TPL ESHVQ AV+C KE G+++R+R GGHD+EGLSY +++    PF+++D++ L+
Sbjct  78    PLFIITPLNESHVQTAVICAKENGLEIRIRGGGHDYEGLSYRAEV----PFLIVDMSNLK  133

Query  1382  GIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRK  1203
              I VD+EDNS WVQAGAT GE+YYR+AEKS   GFP G C ++G+ G + GG YG MLRK
Sbjct  134   TITVDIEDNSAWVQAGATLGELYYRIAEKSNVHGFPGGVCHTVGVSGFLGGGGYGYMLRK  193

Query  1202  YGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvt  1023
             YGL AD  +DA++VDA G++L+R  MGEDLFWAIRGGG  SFGI+L WK+KLVPVP  VT
Sbjct  194   YGLGADQVIDAQMVDANGQILNRETMGEDLFWAIRGGGAASFGIILRWKVKLVPVPPVVT  253

Query  1022  vftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLG  843
             +F   +T+E+ ATKL+++WQ +ADKL ED+ ++  +   N+++  G +T++  F ++FLG
Sbjct  254   IFNPSKTIEEGATKLVHRWQYIADKLHEDVFIRANLELTNTSS--GGKTIKVTFSSMFLG  311

Query  842   KTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFK  663
               D LL +MN SFPELGL  +DC EMSWI++V     +P +T  E LL+ + L  K+ +K
Sbjct  312   TIDTLLPLMNESFPELGLKREDCTEMSWIDAVKNLGGFPDST-VEVLLN-RSLQSKSTYK  369

Query  662   AKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
              KS++++ P+PES   G+WK FL+ +TP+M  NPYG  M++I ESATPFPHRKG I KI 
Sbjct  370   MKSDYVKQPIPESAFEGIWKRFLQVETPIMQLNPYGARMSEISESATPFPHRKGNIYKIQ  429

Query  482   YLTSWKIEG----EKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSF  315
             YL  W+  G    E K+H++WIR +Y YM  YVSK PREAY+NYRDLD+G N  G NTS+
Sbjct  430   YLVYWQQNGTHDEETKRHINWIRELYKYMTPYVSKFPREAYLNYRDLDIGTNNRG-NTSY  488

Query  314   SEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             ++AS+WG KYFK NF+RLV VK++VDP NFF +EQSIP ++
Sbjct  489   AQASIWGRKYFKNNFDRLVYVKSKVDPGNFFRNEQSIPAVT  529



>ref|XP_009787052.1| PREDICTED: cannabidiolic acid synthase-like 1 [Nicotiana sylvestris]
Length=534

 Score =   514 bits (1325),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 292/538 (54%), Positives = 385/538 (72%), Gaps = 19/538 (4%)
 Frame = -2

Query  1796  SWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnS  1617
             SW S   L +L    + + WA S     QF +C+S  + TSI         T N SS++S
Sbjct  4     SWFS--FLLVLLVVFSSTSWAASADTHEQFLQCLSRSNQTSI--------YTPNNSSYSS  53

Query  1616  VLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYT  1437
             +LQ ++QNL F     PKPL+I TP++ES VQ  ++C KE G+ +RVR  GHD+EGLSY 
Sbjct  54    ILQFSIQNLRFNTTGTPKPLVIVTPVSESEVQRVILCAKETGMHVRVRGAGHDYEGLSYV  113

Query  1436  SDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVS  1257
             S++    PF ++DL  LR I V+ ED S WV+AG+T GE+YY++AEKSK LGFPAG C +
Sbjct  114   SEV----PFAIVDLINLRTITVNAEDKSAWVEAGSTIGELYYKIAEKSKTLGFPAGVCPT  169

Query  1256  LgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSF  1077
             +G+GGH +GG YG MLRKYGLAADN +DAR++DATGR+LDR +MGEDLFWAIRGGGG SF
Sbjct  170   VGVGGHFSGGGYGVMLRKYGLAADNIVDARLIDATGRILDRDSMGEDLFWAIRGGGGNSF  229

Query  1076  GILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNST  897
             G++LAWKIKLV VP  VTVFT+ +TLEQNATKL++KWQ VA +  EDL +++LI+ VNS+
Sbjct  230   GLVLAWKIKLVDVPEKVTVFTLGKTLEQNATKLVHKWQYVASRFHEDLFIRILISRVNSS  289

Query  896   AVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTT  717
                 K+TV  +F+++FLG  DRLL IM  SFPELGL  +DC+EMSWIES++Y A +PR  
Sbjct  290   EGGNKQTVVASFNSIFLGGVDRLLPIMQESFPELGLKREDCIEMSWIESILYFAGFPRGE  349

Query  716   PPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKE--DTPVMVWNPYGGMMA  543
               + LL    L  + +FKAKS++++ P+PE GL GLW++F +   +   ++ +PYGG M 
Sbjct  350   SLDVLLSRIQLSTR-YFKAKSDYVQKPIPEGGLEGLWRLFFENGAEGAEVILSPYGGKMD  408

Query  542   KIPESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYV  369
             +I  SA PFPHR G + KI +L  W  +GE+  ++H+ WIRR+Y YM  +VSK PR AY+
Sbjct  409   EIATSAIPFPHRAGNLYKIQHLVFWDEQGEEVAERHISWIRRLYSYMAPFVSKFPRAAYI  468

Query  368   NYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NYRDLD+G+N     TS+ +A VWG KYFK NF+RLV VKT+VDP NFF +EQSIP L
Sbjct  469   NYRDLDIGVNNIKGYTSYVQAKVWGIKYFKNNFDRLVHVKTKVDPSNFFRNEQSIPSL  526



>ref|XP_002863582.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39841.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   513 bits (1322),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 304/530 (57%), Positives = 387/530 (73%), Gaps = 9/530 (2%)
 Frame = -2

Query  1775  LSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQ  1596
             L++  +F+T +P A S S+Q  F KC+  +++   P    FF+   N+S F  V +ST Q
Sbjct  16    LALYISFVTITP-ASSTSLQDDFIKCLHKNTNVRFPLDKTFFTPERNSSIFTEVFESTAQ  74

Query  1595  NLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPA  1416
             N   L  + PKP  IF P+ ESHVQA+V+C+K+ G+  RVRSGGHD+EG+SY S +E P 
Sbjct  75    NQRLLTKAMPKPGFIFRPIHESHVQASVICSKKLGIHFRVRSGGHDYEGVSYVSRIEKP-  133

Query  1415  PFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghi  1236
              FV+IDL+KLR I +D+EDNS WVQAGAT GE+YYR+AEKSK  GFPAG   SLGIGGHI
Sbjct  134   -FVLIDLSKLRQINIDIEDNSAWVQAGATIGELYYRIAEKSKIHGFPAGVYPSLGIGGHI  192

Query  1235  tggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWK  1056
             TGGAYG+++RKYGLAADN LDA+IVDA G++LDRAAMGEDLFWAIRGG GGSFGI+L+WK
Sbjct  193   TGGAYGSLMRKYGLAADNVLDAKIVDANGKLLDRAAMGEDLFWAIRGGSGGSFGIILSWK  252

Query  1055  IKLvpvpatvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLITAVNSTAVKGKR  879
             IKLVPVP T+TVFTV +TL+Q+ + K+L+KWQ+VADKL E+L L+V  T V +   K  +
Sbjct  253   IKLVPVPETITVFTVTKTLKQDVSFKILFKWQQVADKLVEELFLRVFFTVVGN---KANK  309

Query  878   TVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP--EF  705
             TV  A+   FLG+   L+++M   FPELGLT KDC+EM+WI+S+IY++ +P ++PP  E 
Sbjct  310   TVSMAYIGQFLGEKGTLMEVMEKDFPELGLTQKDCIEMNWIKSIIYSSGFPTSSPPPIEI  369

Query  704   LLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESA  525
             LL  K    K +FKAKS+F +  +P  GL+G++K  L+ED  +++W PYGG M KI ES 
Sbjct  370   LLQAKSPLGKVYFKAKSDFAKELIPVLGLKGMFKKLLEEDAALVIWTPYGGKMNKISESE  429

Query  524   TPFPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLG  345
              PFPHR G    I Y  SW    E  K + WIR +Y YM  YVS +PR+AYVNYRDLDLG
Sbjct  430   IPFPHRNGTNFMIQYYRSWSDSEESNKRIKWIRELYSYMTPYVSSNPRQAYVNYRDLDLG  489

Query  344   MNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              NKN   ++F EA  WG KYFK NF+RLV +KT+VDPDNFF HEQSIP L
Sbjct  490   QNKNNSKSNFLEAKRWGAKYFKDNFKRLVRIKTKVDPDNFFRHEQSIPTL  539



>ref|XP_002277310.1| PREDICTED: inactive tetrahydrocannabinolic acid synthase-like 
[Vitis vinifera]
Length=537

 Score =   513 bits (1322),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 298/542 (55%), Positives = 398/542 (73%), Gaps = 15/542 (3%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFSPWAVSLSIQHQ-FYKCVSLHSHTSIPfstaffstttnass  1626
             M S SS     ++FT L  S    + S  HQ F +C++L+S++S P +   ++   ++  
Sbjct  1     MGSSSSAETYILVFTLLFSSVSWAASSSVHQNFLQCLTLNSNSSTPITKVLYTPKNSSYE  60

Query  1625  fnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGL  1446
                VL  ++QNL F     PKP +I TPL  SH+QAAV+C+K+ G+Q+R RSGGHD+EGL
Sbjct  61    T--VLDFSIQNLRFTSSCTPKPQIIVTPLHVSHIQAAVICSKKYGLQIRARSGGHDYEGL  118

Query  1445  SYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGN  1266
             SY S++    PF+++DL +LR I VDVED S WV+AGAT GEVYY +A K+   GFPAG 
Sbjct  119   SYVSEV----PFIIVDLLELRSINVDVEDGSAWVEAGATLGEVYYSIANKTAIHGFPAGI  174

Query  1265  CVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRgggg  1086
             C ++G+GGH++GG YG +LRKYGLAADN +DA IVD+ G +L+R +MGEDLFWAIRGGGG
Sbjct  175   CPTVGVGGHLSGGGYGTLLRKYGLAADNIIDAYIVDSNGTLLNRESMGEDLFWAIRGGGG  234

Query  1085  GSFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAV  906
              SFGI+++WKIKLVPVP+TVTVF V RTLEQ+A K+L KWQ+VADKL EDL ++V + AV
Sbjct  235   ASFGIIVSWKIKLVPVPSTVTVFRVTRTLEQDAEKILLKWQQVADKLHEDLFIRVYVQAV  294

Query  905   NSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYP  726
             N +  +G+RT+ + ++++FLG T  LL +MN SFPELGL   DC E SWIESV+Y A + 
Sbjct  295   NGSQ-EGERTISSTYESLFLGNTSGLLSLMNESFPELGLAADDCNETSWIESVLYFAGF-  352

Query  725   RTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIF--LKEDTPVMVWNPYGG  552
              +  P  +L  +    K +FK KS+FL+ P+PE+GL+G+WK+F  +K  T +M+ +PYGG
Sbjct  353   -SGQPLDVLLNRSQTSKNYFKNKSDFLKEPIPETGLQGIWKLFYQVKNATALMIISPYGG  411

Query  551   MMAKIPESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPRE  378
              M +IPE+ TPFPHRKG +  I Y+ +W  EG+K  K+H+DW R+++ YM  YVSKSPR 
Sbjct  412   RMNEIPETETPFPHRKGSLYSIQYVVAWLEEGKKVSKRHIDWARKLHKYMAPYVSKSPRA  471

Query  377   AYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             AY+NYRDLDLG NKNG NTS+++AS+WG KY+K NF RLV VKT+VDP NFF +EQSIP 
Sbjct  472   AYLNYRDLDLGRNKNG-NTSYAQASIWGLKYYKINFNRLVQVKTKVDPSNFFRNEQSIPP  530

Query  197   LS  192
             LS
Sbjct  531   LS  532



>emb|CAN63058.1| hypothetical protein VITISV_004191 [Vitis vinifera]
Length=545

 Score =   513 bits (1322),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 289/539 (54%), Positives = 387/539 (72%), Gaps = 12/539 (2%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassf  1623
             M + SS I L  + + +    WA S SI   F +C+SL+S+ + P S   ++    + S 
Sbjct  12    MGASSSAIFLPFV-SLVVLVSWATSSSIHENFLQCLSLNSNHTTPISNVLYTPKNLSYSA  70

Query  1622  nSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLS  1443
               +L+ST++NL F   + PKPLLI TPL  SH+QAAV+C+K+ G+ +RVRSGGHD+EGLS
Sbjct  71    --ILESTIENLRFSSSATPKPLLILTPLHVSHIQAAVICSKKFGMNIRVRSGGHDYEGLS  128

Query  1442  YTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNC  1263
             Y S++    PF++IDL +LR I + +ED + WV+AGAT GEVYYR+A+KS+  GFPAG+C
Sbjct  129   YVSEI----PFIIIDLVELRSINISIEDGTAWVEAGATVGEVYYRIAQKSRTYGFPAGSC  184

Query  1262  VSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggG  1083
              ++G+GGH +GG  G ++RKYGL+ADN +DA IV + GRVL+R +MGEDLFWAIRGGGG 
Sbjct  185   PTVGVGGHFSGGGXGTLMRKYGLSADNIIDAYIVVSDGRVLNRESMGEDLFWAIRGGGGA  244

Query  1082  SFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVN  903
             SFGI+L+WKI LVPVP  VTVFTV RTLEQ A K+  KWQ+V  +L ED+ +     AV 
Sbjct  245   SFGIILSWKIILVPVPPIVTVFTVGRTLEQGALKVFLKWQQVGSRLQEDIFIGAXFGAV-  303

Query  902   STAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR  723
             S + +G+RT++ +F ++FLG T +LL +M  SFPELGL  KDCLEMSWIESV+Y      
Sbjct  304   SGSQEGERTIEVSFKSLFLGNTSQLLSLMKKSFPELGLEAKDCLEMSWIESVLYYTDL-S  362

Query  722   TTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMA  543
               P   LL+  P F K +FKAKS++++ P+ E+GL+G+WK+  +E+  +M+ +PYGG M 
Sbjct  363   GEPVNVLLNRIPQF-KNYFKAKSDYVQEPISETGLQGVWKMLYQEEAGIMILSPYGGRMN  421

Query  542   KIPESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYV  369
             +I E+  PFP RKG + KI YL SW  EG++   K ++WIR++Y YM  YVSK PR AY+
Sbjct  422   EISETEVPFPXRKGNLYKIQYLVSWDEEGDRVSXKRINWIRKLYAYMAPYVSKFPRAAYL  481

Query  368   NYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             NYRDLDLG NK   NTS+++AS+WG KYF  NF RLV VKT+VDP NFF +EQSIP LS
Sbjct  482   NYRDLDLGXNKLKGNTSYAQASIWGIKYFSCNFNRLVHVKTKVDPSNFFRNEQSIPSLS  540



>ref|XP_010481746.1| PREDICTED: tetrahydrocannabinolic acid synthase [Camelina sativa]
Length=541

 Score =   513 bits (1320),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 285/529 (54%), Positives = 383/529 (72%), Gaps = 10/529 (2%)
 Frame = -2

Query  1775  LSILFTFLTFSPWAVS-LSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             L + F+F   +P + S  S+Q++F  CV  ++H   P  T  F+   N S FN VL+ST 
Sbjct  16    LVLYFSFYCITPTSSSSASLQNEFISCVKTNTHVDFPLETTLFAPAKNVSMFNQVLESTA  75

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QNL FL  S PKP  IF P+ ES VQA+++C+K+ G+  RVRSGGHDFE +S+ S +E+P
Sbjct  76    QNLRFLAKSMPKPGFIFRPIHESQVQASIICSKKLGIHFRVRSGGHDFEAMSFVSRIETP  135

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F++ID +KLR I VD+EDNS WVQAGAT GE+YYR+AEKSK  GFPAG C S+GIGG+
Sbjct  136   --FILIDFSKLRQIDVDIEDNSTWVQAGATLGELYYRIAEKSKIHGFPAGLCTSVGIGGY  193

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             +TGG YG+++RKYGLA DN LD ++VDA G++L+R +MGEDLFWA+RGGGG SFGI+LAW
Sbjct  194   MTGGGYGSLMRKYGLAGDNVLDVKMVDANGKLLNRTSMGEDLFWALRGGGGASFGIVLAW  253

Query  1058  KIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
              IKLVPVP T+T+FTV +T +Q+   K++ KWQ++A K+ E+L ++V  TAV +   KG 
Sbjct  254   NIKLVPVPETLTMFTVTKTPKQDPGMKIISKWQRMASKVMEELHIRVEFTAVGN---KGN  310

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFL  702
             RTV  ++   FLG+   L+K+MN  FPELGLT +DC EMSWIES + N  +   +  + L
Sbjct  311   RTVMMSYKGQFLGEKVTLMKVMNKVFPELGLTDQDCTEMSWIESALRNGGFANGSSIDVL  370

Query  701   LHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESAT  522
             L  +    K +FKAKS+F++ P+   G++G++K  +KEDTP + W PYGGMMA+IPES  
Sbjct  371   LQLQSPLGKNYFKAKSDFVKEPISPLGIKGMFKRLIKEDTPFLNWTPYGGMMARIPESEI  430

Query  521   PFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDL  348
             PFPHR G++ +I+Y T+W  E +K+  +H++WIR +Y YM  YVS +PR+AYVNYRDLDL
Sbjct  431   PFPHRNGILFQILYQTNWP-ENDKRPSRHINWIRELYSYMAPYVSSNPRQAYVNYRDLDL  489

Query  347   GMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             G N N    +  EA  WG KYFK N+ RLV +KT+VDP+NFF +EQSIP
Sbjct  490   GQNMNNAKVNSIEAKTWGAKYFKDNYNRLVKIKTKVDPENFFRYEQSIP  538



>ref|XP_010250637.1| PREDICTED: cannabidiolic acid synthase-like 1 [Nelumbo nucifera]
Length=533

 Score =   512 bits (1319),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 295/536 (55%), Positives = 385/536 (72%), Gaps = 16/536 (3%)
 Frame = -2

Query  1790  SSPIILSILFTFLTFS---PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfn  1620
             SS  + S+L+  L  S    WA S S    F +C+ +HS +SIP S   +S   ++ S  
Sbjct  4     SSFAVFSLLYILLLCSVSWSWATSDSTHWTFLQCLEIHSQSSIPISEVLYSPNNSSYSS-  62

Query  1619  SVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSY  1440
              +L   V NL F +PS PKPLL+ TPL  SH+Q  V+C+++A +QLRVRSGGHD+EGLSY
Sbjct  63    -LLLYPVHNLRFSLPSTPKPLLLITPLNVSHIQETVICSRKADLQLRVRSGGHDYEGLSY  121

Query  1439  TSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCV  1260
              SD+    PF+++DL   R + V +EDNS W+QAGAT GEVYYR+AE SK  GFPAG+C 
Sbjct  122   VSDV----PFIIVDLLNFRSVDVSIEDNSAWIQAGATLGEVYYRIAEASKIHGFPAGSCS  177

Query  1259  SLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGS  1080
             ++G+GGH +GG +G + RKYGLAADN +DA +VD  GR+L+R +MGEDLFWAIRGGGG S
Sbjct  178   TVGVGGHFSGGGFGLLFRKYGLAADNIIDAYLVDVNGRILNRESMGEDLFWAIRGGGGAS  237

Query  1079  FGILLAWKIKLvpvpatvtvftvPRTLEQNA-TKLLYKWQkvadkldedlllkvLITAVN  903
             FGI+++WK+KLVPVP  VTVF+V R L     TKL++KWQ VADKL ED+ L + I    
Sbjct  238   FGIIVSWKVKLVPVPPVVTVFSVDRALGHGGTTKLIHKWQFVADKLHEDIFLHIYIA--T  295

Query  902   STAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR  723
             +T  KG R+VQ +FD++FLG +++LL++M+  FPELGL  +DC+EMSWI+SV+Y A +  
Sbjct  296   TTDQKGNRSVQASFDSMFLGGSEKLLQMMDARFPELGLKREDCIEMSWIQSVLYYAGFST  355

Query  722   TTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMA  543
             + P E LL  +P F K+FFKAKS+F++ P+ E+GL G+WK   +++   M+W PYGG M 
Sbjct  356   SEPLEVLLDRRPQF-KSFFKAKSDFVKEPISETGLEGIWKRLYEDEGASMIWTPYGGKMN  414

Query  542   KIPESATPFPHRKGVICKIVYLTSWKIEG--EKKKHLDWIRRMYDYMGTYVSKSPREAYV  369
             +IPES  PFPHRKG I KI Y  +W+  G    ++H+ WIR++Y YM  YVSKSPR AYV
Sbjct  415   EIPESEIPFPHRKGNIYKIQYGVNWEEGGIQASRRHIGWIRKLYRYMRPYVSKSPRAAYV  474

Query  368   NYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             NYRDLDLG N  G NTS+S A +WG KYFK NF+RLV VK+ VDP NFF HEQSIP
Sbjct  475   NYRDLDLGTNSKG-NTSYSRARIWGEKYFKSNFKRLVHVKSMVDPGNFFRHEQSIP  529



>ref|XP_009615787.1| PREDICTED: cannabidiolic acid synthase-like [Nicotiana tomentosiformis]
Length=534

 Score =   512 bits (1319),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 289/540 (54%), Positives = 385/540 (71%), Gaps = 20/540 (4%)
 Frame = -2

Query  1796  SWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnS  1617
             SW S   L +L    + + WA S     QF +C+S  + TSI         T N SS++S
Sbjct  4     SWFS--FLLVLLVVFSSTSWAASADTHEQFLQCLSRSNQTSI--------YTPNNSSYSS  53

Query  1616  VLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYT  1437
             +LQ ++QNL F     PKPL+I TP++ES VQ  ++C K+ G+ +RVR GGHD+EGLSY 
Sbjct  54    ILQFSIQNLRFNTTGTPKPLVIVTPVSESEVQRVILCAKDTGMHVRVRGGGHDYEGLSYV  113

Query  1436  SDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVS  1257
             S++    PF ++DL  LR I V+ ED S WV+AG+T GE+YY++AEKSK LGFPAG C +
Sbjct  114   SEV----PFAIVDLINLRTITVNAEDKSAWVEAGSTIGELYYKIAEKSKTLGFPAGVCPT  169

Query  1256  LgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSF  1077
             +G+GGH +GG YG MLRKYGLAADN +DAR++DA GR+LDR +MGEDLFWAIRGGGG SF
Sbjct  170   VGVGGHFSGGGYGVMLRKYGLAADNIVDARLIDANGRILDRDSMGEDLFWAIRGGGGNSF  229

Query  1076  GILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNST  897
             G++LAWKIKLV VP  VTVFT+ +TLEQNATKL++KWQ VA +  EDL +++LI+ VNS+
Sbjct  230   GLVLAWKIKLVDVPEKVTVFTLDKTLEQNATKLVHKWQYVASRFHEDLFIRILISRVNSS  289

Query  896   -AVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRT  720
                  K+TV  +F+++FLG  DRLL IM  SFPELGL  +DC+EMSWIES++Y A +PR 
Sbjct  290   EGGNNKQTVVASFNSIFLGGVDRLLHIMQESFPELGLKREDCIEMSWIESILYFAGFPRG  349

Query  719   TPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDT--PVMVWNPYGGMM  546
                + +L  +      +FKAKS++++ P+PE G  GLW++F +++     ++ +PYGG M
Sbjct  350   ESLD-VLRSRVQLSTRYFKAKSDYVQKPIPEGGFEGLWRLFFEDEAKGAQVILSPYGGKM  408

Query  545   AKIPESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAY  372
              +I  SA PFPHR G + KI +L  W  EGE+  ++H+ WIRR+Y YM  +VSK PR AY
Sbjct  409   DEIAASAIPFPHRAGNLYKIQHLAYWDEEGEEVAERHISWIRRLYSYMAPFVSKFPRAAY  468

Query  371   VNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             +NYRDLD+G+N     TS+ +A VWG KYFK NF+RLV VKT+VDP NFF +EQSIP L+
Sbjct  469   INYRDLDIGVNNVKGYTSYVQAKVWGIKYFKNNFDRLVHVKTKVDPSNFFRNEQSIPSLT  528



>ref|XP_002863584.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39843.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   511 bits (1315),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 287/534 (54%), Positives = 382/534 (72%), Gaps = 10/534 (2%)
 Frame = -2

Query  1790  SSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVL  1611
             S  + L + F+F   +P + S S+Q QF  CV  ++H S P  T  F+   N S F+ VL
Sbjct  11    SCILFLVLYFSFYCITPTSSSASLQDQFINCVKRNTHVSFPLETTLFTPAKNVSMFSQVL  70

Query  1610  QSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSD  1431
             +ST QNL FL  S PKP  IF P+ ES VQA+++C+K+ G+  RVRSGGHDFE LSY S 
Sbjct  71    ESTAQNLQFLAKSLPKPGFIFRPIHESQVQASIICSKKLGIHFRVRSGGHDFEALSYVSR  130

Query  1430  MESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLg  1251
             +E P  F++IDL+KLR + VD+E NS WVQ GAT GE+YYR+AEKSK  GFPAG C S+G
Sbjct  131   IEKP--FILIDLSKLRQVDVDIETNSAWVQPGATLGELYYRIAEKSKVHGFPAGLCTSVG  188

Query  1250  igghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGI  1071
             IGG++TGG YG+++RK+GLA DN LD ++VDA G++LDR AMGEDLFWA+RGGGG SFGI
Sbjct  189   IGGYMTGGGYGSLMRKFGLAGDNVLDVKMVDANGKLLDRTAMGEDLFWALRGGGGASFGI  248

Query  1070  LLAWKIKLvpvpatvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLITAVNSTA  894
             +LAWKIKLVPVP TVT+FTV +TL+Q+A  K++ KWQ++A KL E+L +++++ AV +  
Sbjct  249   VLAWKIKLVPVPETVTIFTVTKTLKQDARLKIISKWQQIASKLVEELHIRLVLRAVGNN-  307

Query  893   VKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTP  714
               G +T+  ++   FLG+   L+K+M   FPELGLT KDC EMSWIES +++  +P  +P
Sbjct  308   --GNKTITMSYLGQFLGEKGTLMKVMEKDFPELGLTQKDCTEMSWIESTLFHGGFPTGSP  365

Query  713   PEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIP  534
              E LL  K    K +FKA S+F++ P+P  GL+G++K  ++     + W PYGGMM+KI 
Sbjct  366   IEILLQRKSPLGKDYFKATSDFVKEPIPVLGLKGIFKRLIEGKIEFLNWTPYGGMMSKIS  425

Query  533   ESATPFPHRKGVICKIVYLTSWKIEGEK---KKHLDWIRRMYDYMGTYVSKSPREAYVNY  363
             ESA PFPHR G + KI+Y  +W +E +K    + ++ I+ +Y YM  YVS +PREAYVNY
Sbjct  426   ESAIPFPHRNGTLFKILYYANW-LENDKTSMSRKINSIKEIYSYMAPYVSSNPREAYVNY  484

Query  362   RDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             RDLD G N+N    +F EA +WG KYFK NF RLV +KT+VDP+NFF HEQSIP
Sbjct  485   RDLDFGQNENNSKFNFIEAKIWGPKYFKDNFNRLVKIKTKVDPNNFFRHEQSIP  538



>ref|XP_004135722.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
Length=543

 Score =   510 bits (1314),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 290/531 (55%), Positives = 385/531 (73%), Gaps = 14/531 (3%)
 Frame = -2

Query  1766  LFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLV  1587
             +F  LTF+ WA S      F  C+S HS  +   S +    T    S++SVL  ++ NL 
Sbjct  11    IFIVLTFA-WAASAHNHESFLHCLSHHSPNT--SSISKIIYTPTNPSYSSVLNFSIHNLR  67

Query  1586  FLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFV  1407
             F  P  PKP +I TP   S +QA+++C K  G Q+R RSGGHD+EGLSY SD+      V
Sbjct  68    FTSPKTPKPQVIVTPFHVSQIQASIICAKNTGFQIRTRSGGHDYEGLSYVSDVSF----V  123

Query  1406  VIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitgg  1227
             V+DL  LR I VD E+N  WVQ+GAT GE+YYR+AEKSK LGFPAG C ++G+GGH +GG
Sbjct  124   VVDLINLRSISVDAENNVAWVQSGATIGELYYRIAEKSKTLGFPAGVCPTVGVGGHFSGG  183

Query  1226  aygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKL  1047
              YG MLRK+GLAADN +DA  +D  G++ DR +MGED+FWAIRG GG S+GI+LAWKIKL
Sbjct  184   GYGLMLRKFGLAADNVIDAYFIDVNGKLHDRKSMGEDVFWAIRGSGGASYGIVLAWKIKL  243

Query  1046  vpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVK--GKRTV  873
             +PVP  VTVFT+ RTLEQNAT ++++WQ V+ K D+ L +++++T +N+T  +   KRT+
Sbjct  244   LPVPPIVTVFTIARTLEQNATDIIHRWQYVSSKQDDKLFIRIILTGINTTNSQHGNKRTI  303

Query  872   QTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHG  693
             + AF+++FLGK + L+ IM  +FPELGLT +DC+EMSWIESV+Y A + R  P   LL  
Sbjct  304   EAAFNSLFLGKIEELVPIMQKTFPELGLTKEDCIEMSWIESVLYFAGFSRGQPLNVLLDR  363

Query  692   KPLFPKTFFKAKSEFLRTPVPESGLRGLWKIF--LKEDTPVMVWNPYGGMMAKIPESATP  519
             +PL PK FFKAKS+++  P+P++GL G+W+ F   + +  V++ +PYGG+M KI ES  P
Sbjct  364   RPLTPKRFFKAKSDYVNEPIPKAGLEGIWEFFNEEEAEAAVLILSPYGGIMDKISESEIP  423

Query  518   FPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLG  345
             FPHR G + KI +L  W  EGE   K+H++WIR++Y YM  +VSK+PR AY+NYRDLD+G
Sbjct  424   FPHRAGNLYKIQHLVYWDEEGEDIAKRHINWIRKLYSYMAPFVSKNPRAAYINYRDLDIG  483

Query  344   MN-KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              N KNGRNTS++EASVWG KYFKGNF+RLV+VKT+VDP NFF +EQSIP L
Sbjct  484   TNEKNGRNTSYNEASVWGIKYFKGNFKRLVSVKTKVDPSNFFKNEQSIPSL  534



>ref|XP_010481679.1| PREDICTED: cannabidiolic acid synthase-like 2 [Camelina sativa]
Length=554

 Score =   510 bits (1314),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 308/539 (57%), Positives = 387/539 (72%), Gaps = 14/539 (3%)
 Frame = -2

Query  1784  PIILSILFTFLTFSPWAV-----SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfn  1620
             PII  I F  L  S +A      S S+Q  F +C+  +++   P    FF++  NAS+F 
Sbjct  17    PIISCISFFSLYISLYATITPTSSASVQDGFIECLQRNTNVGFPVEKTFFTSERNASNFI  76

Query  1619  SVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSY  1440
              V +ST QN  FL  S PKP  IF P+ ESHVQA+++C K+ G+   VRSGGHD+EG+SY
Sbjct  77    EVFESTAQNQRFLTNSMPKPGFIFKPVHESHVQASIICCKKLGIHFLVRSGGHDYEGVSY  136

Query  1439  TSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCV  1260
              S +E+P  FV+IDL+KLR I VD+EDNS WVQ+GAT GE+YYR+AEKSK  GFPAG   
Sbjct  137   VSQIETP--FVLIDLSKLRQINVDIEDNSAWVQSGATIGELYYRIAEKSKIHGFPAGVFP  194

Query  1259  SLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGS  1080
             SLGIGGHITGGAYG+++RKYGLAADN LDA+IVD  G++LDR AMGEDLFWAIRGG GGS
Sbjct  195   SLGIGGHITGGAYGSLMRKYGLAADNVLDAKIVDVNGKLLDRNAMGEDLFWAIRGGSGGS  254

Query  1079  FGILLAWKIKLvpvpatvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLITAVN  903
             FGI+L+WKIKLVPVP T+TVFTV +TL+Q+A+ K+L KWQ+VADKL E+L L+V  +   
Sbjct  255   FGIILSWKIKLVPVPKTLTVFTVTKTLKQDASFKILSKWQRVADKLVEELFLRVFFSVDG  314

Query  902   STAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR  723
             + A    +TV+ A+   FLGK   LL++M   FPELGLT KDC+EMSWI+S++YN+ +P 
Sbjct  315   NNA---NKTVKMAYIGQFLGKKGTLLEVMKKGFPELGLTQKDCIEMSWIKSIVYNSGFPT  371

Query  722   TTPP--EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGM  549
             + PP  E LL       K +FKAKS+F + P+P  GL+G+ K  L+ED  +++W PYGG 
Sbjct  372   SPPPPLEILLQANSPIGKVYFKAKSDFAKEPIPIVGLKGMIKKLLEEDVALVIWTPYGGK  431

Query  548   MAKIPESATPFPHRKGVICKIVYLTSWKI-EGEKKKHLDWIRRMYDYMGTYVSKSPREAY  372
             M KIPES  PFPHR G I  I Y  SW   E    + + WIR +Y YM  YVS +PR+AY
Sbjct  432   MDKIPESEIPFPHRNGTIFMIQYYRSWSANEKRPNRRIKWIRELYSYMKPYVSSNPRQAY  491

Query  371   VNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             VNYRDLDLG N+N  N++F EA +WG  YFKGNF RLV +KT+VDPDNFF HEQSIP L
Sbjct  492   VNYRDLDLGQNRNNSNSNFVEAKLWGANYFKGNFNRLVKIKTKVDPDNFFRHEQSIPTL  550



>ref|XP_010441896.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Camelina 
sativa]
Length=542

 Score =   509 bits (1312),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 288/538 (54%), Positives = 382/538 (71%), Gaps = 16/538 (3%)
 Frame = -2

Query  1784  PIILSILFTFLTFSPWAVS-------LSIQHQFYKCVSLHSHTSIPfstaffstttnass  1626
             P I  I F  L FS + ++         +Q +F  CV  ++H   P  T  F+   N S 
Sbjct  8     PTISCISFLVLYFSLYCITPISSSSASLLQDEFISCVKTNTHVDFPLETTLFAPAKNVSM  67

Query  1625  fnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGL  1446
             F+ VL+ST QNL FL  S PKP  IF P+ ES VQA+++C+K+ G+  RVRSGGHDFE +
Sbjct  68    FDQVLESTAQNLRFLAKSMPKPGFIFRPIHESQVQASIICSKKLGIHFRVRSGGHDFEAM  127

Query  1445  SYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGN  1266
             S+ S +E+P  F++ID +KLR I VD+EDNS WVQAGAT GE+YYR+AEKSK  GFPAG 
Sbjct  128   SFVSRIETP--FILIDFSKLRQIDVDIEDNSTWVQAGATLGELYYRIAEKSKVHGFPAGL  185

Query  1265  CVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRgggg  1086
             C S+GIGG++TGG YG+++RKYGLA DN LD ++VDA G++L+R +MGEDLFWA+RGGGG
Sbjct  186   CTSVGIGGYMTGGGYGSLMRKYGLAGDNVLDVKMVDANGKLLNRTSMGEDLFWALRGGGG  245

Query  1085  GSFGILLAWKIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITA  909
              SFGI+LAWKIKLVPVP T+T+FTV +T +Q+   K++ KWQ++A K+ E+L ++V  TA
Sbjct  246   ASFGIVLAWKIKLVPVPETLTMFTVTKTPKQDPGMKIISKWQRIASKVMEELHIRVEFTA  305

Query  908   VNSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALY  729
             V +   KG RTV  ++   FLG+   L+K+MN  FPELGLT  DC EMSWIES + N  +
Sbjct  306   VGN---KGNRTVMMSYKGQFLGEKVTLMKVMNKVFPELGLTDLDCTEMSWIESALRNGGF  362

Query  728   PRTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGM  549
                +  + LL  +    K +FKAKS+F++ P+   GL+G++K  +KEDTP + W PYGGM
Sbjct  363   ANGSSIDVLLQLQSPLGKNYFKAKSDFVKEPISPLGLKGMFKRLIKEDTPFLNWTPYGGM  422

Query  548   MAKIPESATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREA  375
             MA+IPES  PFPHRKG++  I+Y T+W  E +K+  +H++WIR +Y YM  YVS +PR+A
Sbjct  423   MARIPESEIPFPHRKGILFLILYQTNWP-ENDKRPSRHINWIRELYSYMAPYVSSNPRQA  481

Query  374   YVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             YVNYRDLDLG N N    +  EA  WG KYFK N+ RLV +KT+VDP+NFF +EQSIP
Sbjct  482   YVNYRDLDLGQNMNNAKVNSIEAKTWGAKYFKDNYNRLVKIKTKVDPENFFRYEQSIP  539



>ref|XP_009113919.1| PREDICTED: cannabidiolic acid synthase-like 2 [Brassica rapa]
Length=540

 Score =   509 bits (1312),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 306/540 (57%), Positives = 389/540 (72%), Gaps = 14/540 (3%)
 Frame = -2

Query  1790  SSPIILSILFTFLTFSPWAVSL----SIQHQFYKCVSLHSHTSIPfstaffstttnassf  1623
             S+P+I  I F  L FS + V+L    S+Q  F  C+  +++   P   AFFS   NAS F
Sbjct  6     SAPVISYISFLALYFSFYTVALTSSNSLQDDFINCLHQNTNVDFPLEKAFFSPERNASMF  65

Query  1622  nSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLS  1443
               VL ST QN  +L  S PKP  IF P+ E+HVQA+++C+K+ G+ LRVRSGGHD+EG+S
Sbjct  66    IEVLNSTAQNQRYLTKSMPKPGFIFKPVHETHVQASIICSKKLGIHLRVRSGGHDYEGVS  125

Query  1442  YTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNC  1263
             Y S +E   PF++IDL+KLR I VD+EDNSVWV+AGAT GE+YYR++EKSK  G PAG  
Sbjct  126   YVSQIE--IPFIIIDLSKLRQINVDIEDNSVWVEAGATTGELYYRISEKSKTHGCPAGIY  183

Query  1262  VSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggG  1083
              SLGIGGHITGGA+G+++RKYGLAADN LDA++VD  G++LDR AMGED FWAIRGG GG
Sbjct  184   PSLGIGGHITGGAHGSLMRKYGLAADNVLDAKLVDVNGKLLDRTAMGEDTFWAIRGGAGG  243

Query  1082  SFGILLAWKIKLvpvpatvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLITAV  906
             SFGI+L+WKIKLVPVP T+TVFTV +TL+Q+A  K+L KWQ+VADKL EDLLL+V  T  
Sbjct  244   SFGIILSWKIKLVPVPKTLTVFTVTKTLDQDAGFKILSKWQQVADKLVEDLLLRVFFTIA  303

Query  905   NSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYP  726
              +      RTV  ++   FLG+   L+++M+  FPELGLT +DC+EM+WIES++Y++ + 
Sbjct  304   GNNE---NRTVAMSYIGQFLGEKGNLMEVMSKGFPELGLTLEDCIEMNWIESIMYSSGFS  360

Query  725   RTT--PPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGG  552
              TT  PPE LL  K    + +FKAKS+F + P+P  GL+G+ K  L+E+  VM+W PYGG
Sbjct  361   TTTPPPPEVLLQAKSPLGEVYFKAKSDFAKEPIPVLGLKGMIKKILEEEAAVMIWTPYGG  420

Query  551   MMAKIPESATPFPHRKGVICKIVYLTSWK-IEGEKKKHLDWIRRMYDYMGTYVSKSPREA  375
             MM KIPES  PFPHR G    I+Y  SW   E      + WIR +Y+YM  YVS +PR+A
Sbjct  421   MMDKIPESEIPFPHRSGTSFMILYYRSWSDTEKRPDMRIKWIRELYNYMTPYVSSNPRQA  480

Query  374   YVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             YVNYRDLDLG N N + TS  +A VWG KYFK NF RLV +KT+VDP+NFF HEQSIP L
Sbjct  481   YVNYRDLDLGQNNNLK-TSLKQAQVWGAKYFKDNFNRLVKIKTKVDPENFFRHEQSIPPL  539



>gb|KDP34622.1| hypothetical protein JCGZ_11145 [Jatropha curcas]
Length=531

 Score =   509 bits (1311),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 296/535 (55%), Positives = 386/535 (72%), Gaps = 11/535 (2%)
 Frame = -2

Query  1790  SSPIILSILFTFLTFSPWAV-SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSV  1614
             +S I  S+L  FL  SP  + S  I   F +C++L+S  SIPFST+ ++   ++ S   V
Sbjct  2     ASSISYSVLIFFLLLSPSCILSGPIVASFIQCLTLNSKVSIPFSTSLYTPNNSSFSE--V  59

Query  1613  LQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTS  1434
             LQST  NL FL+PS  KP  IF P  E H+QAAV+C+KE  + LRVRSGGHD EGLSY S
Sbjct  60    LQSTAWNLRFLLPSVLKPEFIFIPSHEPHIQAAVICSKELPIHLRVRSGGHDLEGLSYRS  119

Query  1433  DMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSL  1254
             ++++P  F +ID++ LR + V+++DNS WVQ GAT GE+YYR+AEKS+  GFPAG   S+
Sbjct  120   EIDNP--FFIIDMSALRSVDVNIDDNSAWVQTGATLGELYYRIAEKSQTHGFPAGLYNSV  177

Query  1253  gigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFG  1074
             G+GGHITGG YGAMLRKYGLAADN +DA+I+D  GR+LDR AMGEDLFWAIRGG GG+FG
Sbjct  178   GVGGHITGGGYGAMLRKYGLAADNVIDAQIIDVHGRLLDRQAMGEDLFWAIRGGAGGNFG  237

Query  1073  ILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTA  894
             I+++WK+KLV +P+TV  F   +T EQN TK+L +W +VA KLDEDL ++VLI+  N   
Sbjct  238   IIVSWKLKLVQIPSTVIFFKATKTSEQNGTKILQRWTEVAHKLDEDLFIRVLISPAN-IG  296

Query  893   VKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTP  714
                 RTV T+++  FLG  +RLLK+  +SFPELGL   DC E SW++SV+Y   YP  + 
Sbjct  297   NSTVRTVSTSYEGFFLGDLNRLLKVTENSFPELGLARNDCTETSWVKSVLYTTGYPTNSK  356

Query  713   PEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIP  534
             PE LL GK LF KT +K+KS+F++ P+ E+ L GLWKI L+E+TP M+W P+GG M +I 
Sbjct  357   PEVLLQGKYLF-KTSYKSKSDFVKEPIAEAALEGLWKILLEEETPFMIWTPFGGKMNEIS  415

Query  533   ESATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYR  360
             ES  PFP+R G +  I Y +SW+  G+K   KH+D +R++Y+YM  +V  +PR AY NYR
Sbjct  416   ESEIPFPNRNGTLFMIHYASSWQ-NGQKNEAKHIDGVRKLYNYMEHFVPNNPRTAYANYR  474

Query  359   DLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             DLDLGMN    N + ++ASVWG KY+K NF RL+ VKT VDPDNFF HEQSIP L
Sbjct  475   DLDLGMNSK-NNFNVTQASVWGIKYYKDNFNRLIQVKTEVDPDNFFRHEQSIPPL  528



>ref|XP_010441894.1| PREDICTED: cannabidiolic acid synthase-like 2 [Camelina sativa]
Length=553

 Score =   507 bits (1305),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 311/559 (56%), Positives = 393/559 (70%), Gaps = 21/559 (4%)
 Frame = -2

Query  1814  LHIAMA-----SWSSPIILSILFTFLTFSPWAV-----SLSIQHQFYKCVSLHSHTSIPf  1665
             +HI +A     S   P I  I F  L  S +A      S S+Q  F +C+  +++   P 
Sbjct  1     MHILLAARMGISKQLPTISCISFFSLYISLYATITPTSSASVQDGFIECLQRNTNVGFPI  60

Query  1664  staffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQ  1485
                FF++  NAS+F  V +ST QN  FL  S PKP  IF P+ ESHVQA+++C+K+ G+ 
Sbjct  61    EKTFFTSERNASNFIEVFESTAQNQRFLTNSMPKPGFIFKPVHESHVQASIICSKKLGIH  120

Query  1484  LRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRV  1305
               VRSGGHD+EG+SY S +E+P  FV+IDL+KLR I VD EDNS WVQ+GAT GE+YYR+
Sbjct  121   FLVRSGGHDYEGVSYVSQIETP--FVLIDLSKLRQINVDFEDNSAWVQSGATIGELYYRI  178

Query  1304  AEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAM  1125
             AEKSK  GFPAG   SLGIGGHITG AYG+++RKYGLAADN LDA+IVDA G++LDRAAM
Sbjct  179   AEKSKIHGFPAGVFPSLGIGGHITGRAYGSLMRKYGLAADNVLDAKIVDANGKLLDRAAM  238

Query  1124  GEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTLEQNAT-KLLYKWQkvadk  948
             GEDLFWAIRGG GGSFGI+L+WKIKLVPVP T+TVFTV +TL+Q A+ K+L KWQ+VADK
Sbjct  239   GEDLFWAIRGGSGGSFGIILSWKIKLVPVPKTLTVFTVTKTLKQEASFKILSKWQRVADK  298

Query  947   ldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLE  768
             L E+L L+V  +     A    +TV+ A+   FLG    LL++M   FPELG+T KDC+E
Sbjct  299   LVEELFLRVFFSVDGKNA---NKTVKMAYIGQFLGNKGTLLEVMKKGFPELGITQKDCIE  355

Query  767   MSWIESVIYNALYPRTTPP--EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFL  594
             MSWI+S++YN+ +P + PP  E LL  K    K +FK KS+F + P+P  GL+G+ K  L
Sbjct  356   MSWIKSIVYNSGFPTSPPPPLEILLQAKSPIGKVYFKGKSDFAKEPIPIVGLQGMIKKLL  415

Query  593   KEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRM  420
             +ED  +++W PYGG M KIPES  PFPHR G I  I Y  SW  + EK+  + + WIR +
Sbjct  416   EEDAALVIWTPYGGKMDKIPESEIPFPHRNGTIFMIQYYRSWS-DNEKRPNRRIKWIREL  474

Query  419   YDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRV  240
             Y YM  YVS + R+AYVNYRDLDLG N+N  N++F EA +WG  YFKGNF RLV +KT+V
Sbjct  475   YSYMKPYVSNNARQAYVNYRDLDLGQNRNNSNSNFVEAKLWGANYFKGNFNRLVKIKTKV  534

Query  239   DPDNFFWHEQSIPVLS*LC  183
             DPDNFF HEQSIP L   C
Sbjct  535   DPDNFFRHEQSIPTLPVRC  553



>ref|XP_006279601.1| hypothetical protein CARUB_v10026133mg, partial [Capsella rubella]
 gb|EOA12499.1| hypothetical protein CARUB_v10026133mg, partial [Capsella rubella]
Length=588

 Score =   508 bits (1308),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 284/533 (53%), Positives = 386/533 (72%), Gaps = 11/533 (2%)
 Frame = -2

Query  1784  PIILSILFTFL-TFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQ  1608
             PII  + F  L   +P + S S+Q QF  CV  ++H S+P     F+ T N S F+ VL+
Sbjct  59    PIISCVTFLVLYCVTPTSSSASLQEQFISCVKSNTHVSLPLDKTIFTPTKNVSMFDQVLE  118

Query  1607  STVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDM  1428
             ST QNL FL  S PKP  IF P+ ES VQA+++C+K+  +  RVRSGGHDFE +S+ S +
Sbjct  119   STAQNLRFLAKSMPKPGFIFRPVHESQVQASIICSKKLKIHFRVRSGGHDFEAMSFVSRI  178

Query  1427  ESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgi  1248
             E P  F++ID AKLR + VD+++NS WVQAGAT GE+YYR+AEKSK  G+PAG C S+GI
Sbjct  179   ERP--FILIDFAKLRRVDVDIKNNSTWVQAGATLGELYYRIAEKSKVHGYPAGLCTSVGI  236

Query  1247  gghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGIL  1068
             GG++TGG YG+++RKYGLA DN LD +++DA G++L+RA MGEDLFWA+RGGGG SFGI+
Sbjct  237   GGYMTGGGYGSLMRKYGLAGDNVLDVKMIDANGKLLNRATMGEDLFWALRGGGGASFGIV  296

Query  1067  LAWKIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAVNSTAV  891
             LAWKIKLVPVP T+T+FTV +T +Q+   +++ KWQ++A K+ E+L ++V  TAV +   
Sbjct  297   LAWKIKLVPVPETLTMFTVTKTPKQDPGLEIISKWQRIASKVMEELHIRVEFTAVGN---  353

Query  890   KGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP  711
             KG RTV  ++   FLGK   L+K+MN  FPELGLT +DC EMSWIE+ + N  +   +  
Sbjct  354   KGNRTVMMSYKGQFLGKKVTLMKVMNKVFPELGLTQEDCTEMSWIEAALVNGGFKNGSTI  413

Query  710   EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPE  531
             + LL  +    KT++KAKS+F++ P+P  GL+GL++  ++ED P + W PYGGMMA+IPE
Sbjct  414   DVLLQLQSPLGKTYYKAKSDFVKEPIPALGLQGLFERLIQEDIPFVNWTPYGGMMARIPE  473

Query  530   SATPFPHRKGVICKIVYLTSWKIEGEK-KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDL  354
             S  PFPHR G + KI+Y  +W    ++  +H++W+R +Y YM  YVS +PR+AYVNYRDL
Sbjct  474   SEIPFPHRNGTLFKILYQINWPANDKRPSRHVNWMRELYSYMAPYVSSNPRQAYVNYRDL  533

Query  353   DLG--MNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             DLG  MN N +  S  EA +WG KYFKGN++RLV +KT+VDP+NFF +EQSIP
Sbjct  534   DLGQNMNNNAKVNSI-EAKIWGAKYFKGNYDRLVKIKTKVDPENFFRNEQSIP  585



>ref|XP_010052551.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Eucalyptus 
grandis]
Length=549

 Score =   506 bits (1304),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 293/529 (55%), Positives = 379/529 (72%), Gaps = 14/529 (3%)
 Frame = -2

Query  1763  FTFLTFSPW-AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLV  1587
             F FL  +P  A ++S    F +C+SLHS  +   + +    T   SS+ SVL  T+QNL 
Sbjct  14    FLFLLAAPLVAFAISTSDDFLQCLSLHSGNA--SAISKLVYTPVNSSYYSVLDITIQNLR  71

Query  1586  FLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFV  1407
             FL PSAPKP  I TPL  SHVQA++ C+++ G+Q+R RSGGHD+EGLSY S++    PFV
Sbjct  72    FLTPSAPKPNYIVTPLDVSHVQASIFCSRQYGLQMRTRSGGHDYEGLSYLSEV----PFV  127

Query  1406  VIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitgg  1227
             ++D+A  R I VD +D + WVQ+GAT GE+YYR+AEKSK LGFPAG C ++G+GGH +GG
Sbjct  128   ILDMANFRAISVDAKDKTAWVQSGATIGELYYRIAEKSKTLGFPAGLCPTVGVGGHFSGG  187

Query  1226  aygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKL  1047
              YG +LRKYGLAADN +DA++VDA GR+LDR +MGEDLFWAIRGGGGGSF ++++WK+KL
Sbjct  188   GYGTLLRKYGLAADNVIDAQLVDAQGRLLDRESMGEDLFWAIRGGGGGSFCVVVSWKVKL  247

Query  1046  vpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQT  867
             VPVP+TVTVF + RTLEQNATKL+++WQ V  KL +D+ + + + + NS+   G  T+Q 
Sbjct  248   VPVPSTVTVFKILRTLEQNATKLVHQWQLVTSKLPDDIFISLTLQSYNSSP-DGMMTMQA  306

Query  866   AFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKP  687
              FD ++LG  D LLK+ +  FPEL +T  DC EMSWIESV+  A +    P E LL+ + 
Sbjct  307   IFDTLYLGGVDSLLKVTSSRFPELNVTRLDCTEMSWIESVLNFAGF-SGEPLEVLLN-RS  364

Query  686   LFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPV--MVWNPYGGMMAKIPESATPFP  513
                K FFK KS++++ P+PESGL G+W+ F +ED  V  M W P GG MA+I ESA PF 
Sbjct  365   SNTKIFFKKKSDYVKEPIPESGLEGMWERFFEEDQGVHMMTWVPSGGKMAEISESAIPFS  424

Query  512   HRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             HR GV+ KI++ T W   G +   KH+ WIR  Y YM  YVSKSPREAY+N RDLD+GMN
Sbjct  425   HRAGVLYKILHATEWTTGGNEVAPKHVSWIRSFYGYMAQYVSKSPREAYINSRDLDIGMN  484

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
                 +TS+ +ASVWG KYFK NF+RLV VKT +DPDNFF HEQSIP  S
Sbjct  485   NVIGDTSYKQASVWGKKYFKNNFDRLVRVKTAIDPDNFFRHEQSIPPFS  533



>ref|XP_002277294.1| PREDICTED: inactive tetrahydrocannabinolic acid synthase-like 
[Vitis vinifera]
Length=536

 Score =   506 bits (1302),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 297/542 (55%), Positives = 397/542 (73%), Gaps = 15/542 (3%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFSPWAVSLSIQHQ-FYKCVSLHSHTSIPfstaffstttnass  1626
             M S S      ++FT L  S    + S  HQ F +C++L+S++S P +   ++   ++  
Sbjct  1     MGSSSCAETYILVFTLLFSSVSWAASSSVHQNFLQCLTLNSNSSTPITKVVYTPHNSSYE  60

Query  1625  fnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGL  1446
                VL  ++QNL F     P+P +I TPL  SH+QAAV+C+K+ G+Q+R RSGGHD+EGL
Sbjct  61    T--VLDFSIQNLRFTSSCTPRPQVIVTPLLVSHIQAAVICSKKYGLQIRARSGGHDYEGL  118

Query  1445  SYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGN  1266
             SY S++    PF+++DL +LR I VDVED S WV+AGAT GEVYY +A K+   GFPAG 
Sbjct  119   SYVSEV----PFIIVDLLELRSINVDVEDGSAWVEAGATLGEVYYSIANKTATHGFPAGI  174

Query  1265  CVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRgggg  1086
             C ++G+GGH++GG YG +LRKYGLAADN +DA IVD+ G +L+R +MGEDLFWAIRGGGG
Sbjct  175   CPTVGVGGHLSGGGYGTLLRKYGLAADNIIDAYIVDSNGTLLNRESMGEDLFWAIRGGGG  234

Query  1085  GSFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAV  906
              SFGI+++WKIKLVPVP+TVTVFTV RTLEQ+A K+L KWQ+VADKL EDL ++V + AV
Sbjct  235   ASFGIIVSWKIKLVPVPSTVTVFTVTRTLEQDAEKILLKWQQVADKLHEDLFIRVYVQAV  294

Query  905   NSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYP  726
             N +  +G+RT+ + ++++FLG T  LL +MN SFPELGL   DC E SWIESV+Y A + 
Sbjct  295   NGSQ-EGERTISSTYESLFLGNTSGLLSLMNESFPELGLAADDCNETSWIESVLYFAGF-  352

Query  725   RTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIF--LKEDTPVMVWNPYGG  552
              +  P  +L  +    K +FK KS+FL+ P+PE+GL G+WK+F  LK  T +++ +PYGG
Sbjct  353   -SGQPLDVLLNRSQTSKNYFKNKSDFLKEPIPETGLHGIWKLFYELKNATGMIIISPYGG  411

Query  551   MMAKIPESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPRE  378
              M +IPE+ TPFPHRKG +  I Y+ +W  EGE+  K+H+DW R++Y YM  YVSKSPR 
Sbjct  412   RMNEIPETETPFPHRKGSLYSIQYVVNWLEEGEEVSKRHIDWTRKLYKYMAPYVSKSPRA  471

Query  377   AYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             AY+NYRDLDLG NKNG NTS+++AS+WG KY+K NF RLV VKT+VDP NFF +EQSIP+
Sbjct  472   AYLNYRDLDLGRNKNG-NTSYAQASIWGLKYYKINFNRLVQVKTKVDPSNFFRNEQSIPL  530

Query  197   LS  192
              S
Sbjct  531   SS  532



>ref|XP_002267904.2| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=537

 Score =   505 bits (1301),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 281/517 (54%), Positives = 384/517 (74%), Gaps = 11/517 (2%)
 Frame = -2

Query  1739  WAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKP  1560
             WA S S+   F +C+S HS  S P S   ++   ++ S   VL+S ++NL F  P+ PKP
Sbjct  22    WAASDSVHGAFLQCLSSHSQPSHPISAVIYTPDNSSYSS--VLESYIRNLRFNTPATPKP  79

Query  1559  LLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRG  1380
              LI T   ESH+QAAV+C+K+ G+++++RSGGHD+EG+SY SD    APF ++D+  LR 
Sbjct  80    CLIITATHESHIQAAVICSKKHGLEIKIRSGGHDYEGMSYVSD----APFFILDMFNLRS  135

Query  1379  IKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKY  1200
             I VD+ED S WV AGAT GE+YYR+AEKSK  GFP+G C ++G GGH +GG YG M+RKY
Sbjct  136   ISVDIEDESSWVHAGATIGEIYYRIAEKSKTRGFPSGLCPTVGAGGHFSGGGYGNMMRKY  195

Query  1199  GLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtv  1020
             GL+ DN +DA +VD  GR+L+R +MGEDLFWAIRGGGG S+G+++++KIKLV VPATVTV
Sbjct  196   GLSVDNIVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPATVTV  255

Query  1019  ftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGK  840
             F V RTLEQNAT ++YKWQ++ADK+DEDL +++++  VN +   G++TV+  F ++FLG 
Sbjct  256   FRVARTLEQNATNIVYKWQQIADKVDEDLFIRLILDVVNDSR-SGEKTVRATFLSLFLGS  314

Query  839   TDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKA  660
             ++RLL IMN SFPELGL   DC EMSW ESV+++A +   TP E LL+ +    +  FK 
Sbjct  315   SERLLSIMNTSFPELGLQSSDCTEMSWAESVLFSADFAIGTPVEALLN-RTRRVQYHFKR  373

Query  659   KSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVY  480
             KS++L+ P+P++GL GLWK  ++ +TP + +NPYGG MA+I  +ATPFPHR G ICKI+Y
Sbjct  374   KSDYLKEPIPKAGLEGLWKKMIELETPFLKFNPYGGKMAEISPAATPFPHRAGNICKIMY  433

Query  479   LTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
              T+W  EG +  +++L+  R+++ YM  +VSKSPREA++NYRD DLG+N NG+N S+ E 
Sbjct  434   ATNWHEEGSEAAERYLNLTRQLHSYMTPFVSKSPREAFLNYRDRDLGINHNGKN-SYLEG  492

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              V+G KYFK NF RLV +KT+VDP NFF +EQSIP L
Sbjct  493   RVYGIKYFKKNFNRLVHIKTKVDPGNFFRNEQSIPTL  529



>emb|CAN63059.1| hypothetical protein VITISV_004192 [Vitis vinifera]
Length=536

 Score =   504 bits (1298),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 297/542 (55%), Positives = 395/542 (73%), Gaps = 15/542 (3%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFSPWAVSLSIQHQ-FYKCVSLHSHTSIPfstaffstttnass  1626
             M S S      ++FT L  S    + S  HQ F +C++L+S++S P +   ++   ++  
Sbjct  1     MGSSSXAETYILVFTLLFSSVSWAASSSVHQNFLQCLTLNSNSSTPITKVVYTPHNSSYE  60

Query  1625  fnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGL  1446
                VL  ++QNL F     P+P +I TPL  SH+QAAV C+K  G+Q+R RSGGHD+EGL
Sbjct  61    T--VLDFSIQNLRFTSSCTPRPQVIVTPLLVSHIQAAVXCSKXYGLQIRARSGGHDYEGL  118

Query  1445  SYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGN  1266
             SY S++    PF+++DL +LR I VDVED S WV+AGAT GEVYY +A K+   GFPAG 
Sbjct  119   SYVSEV----PFIIVDLLELRSINVDVEDGSAWVEAGATLGEVYYSIANKTATHGFPAGI  174

Query  1265  CVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRgggg  1086
             C ++G+GGH++GG YG +LRKYGLAADN +DA IVD+ G +L+R +MGEDLFWAIRGGGG
Sbjct  175   CPTVGVGGHLSGGGYGTLLRKYGLAADNIIDAYIVDSNGTLLNRESMGEDLFWAIRGGGG  234

Query  1085  GSFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAV  906
              SFGI+++WKIKLVPVP+TVTVFTV RTLEQ+A K+L KWQ+VADKL EDL ++V + AV
Sbjct  235   ASFGIIVSWKIKLVPVPSTVTVFTVTRTLEQDAEKILLKWQQVADKLHEDLFIRVYVQAV  294

Query  905   NSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYP  726
             N +  +G+RT+ + ++++FLG T  LL +MN SFPELGL   DC E SWIESV+Y A + 
Sbjct  295   NGSQ-EGERTISSTYESLFLGNTSGLLSLMNESFPELGLAADDCNETSWIESVLYFAGF-  352

Query  725   RTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIF--LKEDTPVMVWNPYGG  552
              +  P  +L  +    K +FK KS+FL+ P+PE+GL G+WK+F  LK  T +++ +PYGG
Sbjct  353   -SGQPLDVLLNRSQTSKNYFKNKSDFLKEPIPETGLHGIWKLFYELKNATGMIIISPYGG  411

Query  551   MMAKIPESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPRE  378
              M +IPE+ TPFPHRKG +  I Y+ +W  EGE+  K+H+DW R++Y YM  YVSKSPR 
Sbjct  412   RMNEIPETETPFPHRKGSLYSIQYVVNWLEEGEEVSKRHIDWTRKLYKYMAPYVSKSPRA  471

Query  377   AYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             AY+NYRDLDLG NKNG NTS+++AS+WG KY+K NF RLV VKT+VDP NFF +EQSIP+
Sbjct  472   AYLNYRDLDLGRNKNG-NTSYAQASIWGLKYYKINFNRLVQVKTKVDPSNFFRNEQSIPL  530

Query  197   LS  192
              S
Sbjct  531   SS  532



>ref|XP_010261633.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Nelumbo 
nucifera]
Length=530

 Score =   503 bits (1296),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 287/516 (56%), Positives = 380/516 (74%), Gaps = 12/516 (2%)
 Frame = -2

Query  1739  WAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKP  1560
             WA S SI   F  C+SL S  S+P ST  ++  +++ S   + +S + N+ FL  ++ KP
Sbjct  23    WAASDSIHESFLHCLSLQSDPSLPISTVVYTPNSSSYSS--IFESNIGNIRFLSANSLKP  80

Query  1559  LLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRG  1380
               I TPLTESHVQAAV+C++   +Q+R RSGGHD+EGLSY S++    PFV++D+A LR 
Sbjct  81    QFIITPLTESHVQAAVICSRIHDLQIRSRSGGHDYEGLSYVSEI----PFVIVDMANLRS  136

Query  1379  IKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKY  1200
             I VD+EDNS WVQA AT GEVYY++AEKS+  GFP+G C S+   GH +GG YG ++RK+
Sbjct  137   IHVDIEDNSAWVQADATIGEVYYKIAEKSRIHGFPSGFCPSVAAAGHFSGGGYGTLMRKF  196

Query  1199  GLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtv  1020
             GL+ADN +DA +VD  GR+L+R +MGEDLFWAIRGGGG S+GI+L+WKI+LVPVP TVTV
Sbjct  197   GLSADNIVDAYLVDVRGRILNRESMGEDLFWAIRGGGGASYGIILSWKIRLVPVPPTVTV  256

Query  1019  ftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGK  840
             FTV +T+E+ AT+L+ +WQ +ADK+ EDL ++V++  VNS    G++T Q  F+++FLG 
Sbjct  257   FTVSKTIEEGATELVNRWQYIADKVHEDLFIRVILILVNS-GQSGRKTGQAQFNSLFLGG  315

Query  839   TDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKA  660
              D+LL +MN SFPELGL   DC+EMSWIES +Y +     +  E LL  +P   K  FKA
Sbjct  316   VDKLLPLMNESFPELGLKRSDCIEMSWIESTVYFSGSSNLS-LEVLLDRRPQ-SKRMFKA  373

Query  659   KSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVY  480
             KS++++ P+PE G+ G+WK F + + PVM+ NPYGG M++I ESA PFPHRKG   KI Y
Sbjct  374   KSDYVKEPIPEIGIMGIWKRFHQVEDPVMILNPYGGRMSEIAESAIPFPHRKGNKYKIQY  433

Query  479   LTSWKIEG--EKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
             L  W+ +G    +KH+ WIR +Y YM  YVSKSPREAY+NYRDLDLG N  G NTS+ +A
Sbjct  434   LVYWEEKGIEASQKHIGWIRNLYSYMTPYVSKSPREAYLNYRDLDLGTNNIG-NTSYLQA  492

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             SVWG+KYFK NF+RL+ VKT+VDP NFF +EQSIPV
Sbjct  493   SVWGHKYFKNNFQRLIDVKTKVDPSNFFRNEQSIPV  528



>ref|XP_002523160.1| Reticuline oxidase precursor, putative [Ricinus communis]
 gb|EEF39191.1| Reticuline oxidase precursor, putative [Ricinus communis]
Length=540

 Score =   503 bits (1295),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 278/533 (52%), Positives = 375/533 (70%), Gaps = 8/533 (2%)
 Frame = -2

Query  1790  SSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVL  1611
             S  + +S+L   L     A S S+  +F +C S H   S P S       ++  S   VL
Sbjct  4     SKIVSISLLVILLALVCSATSNSVDVKFLQCFSSHLRNSKPISQVILPRNSSRYSS--VL  61

Query  1610  QSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSD  1431
             QS+++NL F   SA KP  I TP  ESH+QAAVVC K   + +R RSGGHD+EGLSY SD
Sbjct  62    QSSIRNLRFSSTSALKPEFIITPFNESHIQAAVVCAKAYNMLIRTRSGGHDYEGLSYVSD  121

Query  1430  MESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLg  1251
              +    FV++DLA LR I VD+E  S WV++GAT GE+YY++AEKS   GFPAG+C ++G
Sbjct  122   EK----FVLVDLASLRSISVDIESESAWVESGATLGELYYKIAEKSNVYGFPAGSCPTVG  177

Query  1250  igghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGI  1071
             +GGHI+GG +G + RKYGLA+D  +DA++V+  G +LDR +MGEDLFWAIRGGGG SFGI
Sbjct  178   VGGHISGGGFGTIFRKYGLASDAVIDAKLVNVNGEILDRESMGEDLFWAIRGGGGASFGI  237

Query  1070  LLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAV  891
             +L+WK++LV VP TVTVF+  RTLEQ  +KLL+KWQ V ++L EDL L   +T V  ++ 
Sbjct  238   ILSWKVRLVSVPPTVTVFSAARTLEQGGSKLLHKWQTVGNQLPEDLFLHA-VTGVVVSSP  296

Query  890   KGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP  711
                RT+Q +FDA++LG  ++++ +M   FPELG+T ++C EMSWI+SV+Y A +P+    
Sbjct  297   NSNRTIQISFDALYLGTAEQVIPLMQSKFPELGITRENCTEMSWIQSVLYFAGFPKNESL  356

Query  710   EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPE  531
             + LL+ K   PK F KAK+++++ P+ E+GL GL+K  L+ +T +++  PYGG M++I E
Sbjct  357   DVLLNRKTQ-PKEFSKAKADYVQEPISETGLEGLYKRLLESETSMLILTPYGGRMSEISE  415

Query  530   SATPFPHRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLD  351
             S  PFPHR G + KI YL +W +E E K+H++WIR +Y YM  YVSK PR AY+NYRDLD
Sbjct  416   SEIPFPHRNGNLYKIQYLVTWDVEEETKQHIEWIRSLYSYMAAYVSKLPRAAYLNYRDLD  475

Query  350   LGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             LG NK   NTSF++ASVWG KYFK NF+RLV VKT +DP NFF +EQSIP+ S
Sbjct  476   LGRNKKKGNTSFAQASVWGLKYFKNNFKRLVNVKTAIDPSNFFRNEQSIPLHS  528



>ref|XP_010655774.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=531

 Score =   503 bits (1294),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 278/517 (54%), Positives = 379/517 (73%), Gaps = 11/517 (2%)
 Frame = -2

Query  1739  WAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKP  1560
             WA S S+   F +C+S HS +S P S A ++   ++ S   VL+S ++NL F   + PKP
Sbjct  22    WAASDSVHGAFLQCLSTHSQSSHPISAALYTPDNSSYSS--VLESYIRNLRFNTSTTPKP  79

Query  1559  LLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRG  1380
              LI T   ESH+QAA++C+K+ G+Q+++RSGGHDFEG+SY SD+    PF ++D+  LR 
Sbjct  80    RLIITATHESHIQAAIICSKKHGLQMKIRSGGHDFEGVSYVSDV----PFFILDMFNLRS  135

Query  1379  IKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKY  1200
             I VD+ED S WVQAGAT GE+YYR+AEKSK  GFPAG C ++G GGH +GG YG M+RKY
Sbjct  136   ISVDIEDESAWVQAGATLGEMYYRIAEKSKTHGFPAGVCPTVGAGGHFSGGGYGNMMRKY  195

Query  1199  GLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtv  1020
             GL+ DN +DA +VD  GR+L+R +MGEDLFWAI  GGG S+G+++++KIKLV VPATVTV
Sbjct  196   GLSVDNIVDAELVDVNGRLLNRKSMGEDLFWAIIAGGGASYGVIVSYKIKLVQVPATVTV  255

Query  1019  ftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGK  840
             F V RTLEQNAT ++Y+WQ+VADK+D DL +++ +  VNS+   G++TV+  F ++FLG 
Sbjct  256   FRVARTLEQNATNIVYQWQQVADKVDGDLFIRLTMDVVNSSR-SGEKTVRATFLSLFLGS  314

Query  839   TDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKA  660
             ++RLL IMN   PELGL   DC EMSW+ESV++   +   TP E LL   P    T  K 
Sbjct  315   SERLLSIMNTRLPELGLQSSDCTEMSWVESVLFWTEFATGTPVEALLDRNPQV-LTHLKR  373

Query  659   KSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVY  480
             KS++L+ P+P++GL G+WK  ++  TP +V+NPYGG MA+I  SATPFPHR G +CKI+Y
Sbjct  374   KSDYLKEPIPKAGLEGIWKKMIELQTPYLVFNPYGGKMAEISPSATPFPHRAGNLCKIMY  433

Query  479   LTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
              T+W  EG +  +++++  +++Y YM  +VSKSPREA++NYRDLDLG+N NG+N S+ E 
Sbjct  434   ATNWDEEGSEAAERYINLTQKLYSYMTPFVSKSPREAFLNYRDLDLGVNHNGKN-SYLEG  492

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              ++G KYFK NF RLV +KT+VDP NFF +EQSIP L
Sbjct  493   RIYGIKYFKENFNRLVRIKTKVDPGNFFRNEQSIPTL  529



>ref|XP_004158101.1| PREDICTED: reticuline oxidase-like protein-like, partial [Cucumis 
sativus]
Length=513

 Score =   501 bits (1291),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 274/481 (57%), Positives = 362/481 (75%), Gaps = 11/481 (2%)
 Frame = -2

Query  1616  VLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYT  1437
             VL  ++ NL F  P  PKP +I TP   S +QA+++C K  G Q+R RSGGHD+EGLSY 
Sbjct  28    VLNFSIHNLRFTSPKTPKPQVIVTPFHVSQIQASIICAKNTGFQIRTRSGGHDYEGLSYV  87

Query  1436  SDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVS  1257
             SD+      VV+DL  LR I VD E+N  WVQ+GAT GE+YYR+AEKSK LGFPAG C +
Sbjct  88    SDVSF----VVVDLINLRSISVDAENNVAWVQSGATIGELYYRIAEKSKTLGFPAGVCPT  143

Query  1256  LgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSF  1077
             +G+GGH +GG YG MLRK+GLAADN +DA  +D  G++ DR +MGED+FWAIRG GG S+
Sbjct  144   VGVGGHFSGGGYGLMLRKFGLAADNVIDAYFIDVNGKLHDRKSMGEDVFWAIRGSGGASY  203

Query  1076  GILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNST  897
             GI+LAWKIKL+PVP  VTVFT+ RTLEQNAT ++++WQ V+ K D+ L +++++T +N+T
Sbjct  204   GIVLAWKIKLLPVPPIVTVFTIARTLEQNATDIIHRWQYVSSKQDDKLFIRIILTGINTT  263

Query  896   AVK--GKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR  723
               +   KRT++ AF+++FLGK + L+ IM  +FPELGLT +DC+EMSWIESV+Y A + R
Sbjct  264   NSQHGNKRTIEAAFNSLFLGKIEELVPIMQKTFPELGLTKEDCIEMSWIESVLYFAGFSR  323

Query  722   TTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIF--LKEDTPVMVWNPYGGM  549
               P   LL  +PL PK FFKAKS+++  P+P++GL G+W+ F   + +  V++ +PYGG+
Sbjct  324   GQPLNVLLDRRPLTPKRFFKAKSDYVNEPIPKAGLEGIWEFFNEEEAEAAVLILSPYGGI  383

Query  548   MAKIPESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREA  375
             M KI ES  PFPHR G + KI +L  W  EGE   K+H++WIR++Y YM  +VSK+PR A
Sbjct  384   MDKISESEIPFPHRAGNLYKIQHLVYWDEEGEDIAKRHINWIRKLYSYMAPFVSKNPRAA  443

Query  374   YVNYRDLDLGMN-KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             Y+NYRDLD+G N KNGRNTS++EASVWG KYFKGNF+RLV+VKT+VDP NFF +EQSIP 
Sbjct  444   YINYRDLDIGTNEKNGRNTSYNEASVWGIKYFKGNFKRLVSVKTKVDPSNFFKNEQSIPS  503

Query  197   L  195
             L
Sbjct  504   L  504



>ref|XP_006280269.1| hypothetical protein CARUB_v10026190mg [Capsella rubella]
 gb|EOA13167.1| hypothetical protein CARUB_v10026190mg [Capsella rubella]
Length=545

 Score =   503 bits (1294),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 306/526 (58%), Positives = 383/526 (73%), Gaps = 12/526 (2%)
 Frame = -2

Query  1757  FLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLV  1578
             + T +P + S S+Q  F +C+  +++   P    FF+   NAS F  V +ST QN  FL 
Sbjct  23    YATITPTS-SASLQDSFIECLQRNTNVGFPLERTFFTHERNASLFKEVFESTAQNQRFLT  81

Query  1577  PSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVID  1398
              S PKP  IF P+ ESHVQA++VC K+ G+   VRSGGHD+EG+SY S +E+   FV+ID
Sbjct  82    NSMPKPGFIFKPVHESHVQASIVCAKKLGIHFLVRSGGHDYEGVSYVSQIETQ--FVLID  139

Query  1397  LAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggayg  1218
             L+KLR + VD+EDNS WVQAGAT GE+YYR+AEKSK  GFPAG   SLG+GGHITGGAYG
Sbjct  140   LSKLRQVNVDIEDNSAWVQAGATIGELYYRIAEKSKIHGFPAGVFPSLGVGGHITGGAYG  199

Query  1217  AMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpv  1038
             +++RKYGLAADN LDA+IVDA G++LDRAAMGEDLFWAIRGG GGSFGI+L+WKIKLVPV
Sbjct  200   SLMRKYGLAADNVLDAKIVDANGKLLDRAAMGEDLFWAIRGGSGGSFGIILSWKIKLVPV  259

Query  1037  patvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAF  861
             P T+TVFTV +TLEQ+A+ K+L KWQ+VADKL E+L L+V  T V + A K   TV+ A+
Sbjct  260   PETITVFTVTKTLEQDASFKILSKWQRVADKLVEELFLRVFFTVVGNNAYK---TVKMAY  316

Query  860   DAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRT--TPPEFLLHGKP  687
                FLG+   LL++M   FPELGLT KDC+EMSWIES++YN+ +P +   P E LL  K 
Sbjct  317   IGQFLGEKGTLLEVMKKGFPELGLTQKDCIEMSWIESIVYNSGFPTSPLPPLEILLQAKS  376

Query  686   LFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHR  507
                K +FKAKS+F + P+   GL G+ K FL+ED  ++VW PYGG M KIPE   PFPHR
Sbjct  377   PIGKIYFKAKSDFAKEPIHILGLIGMVKKFLEEDAVLVVWTPYGGKMNKIPECEIPFPHR  436

Query  506   KGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKN  333
              G I  I Y  SW  + EK+  + + W+R +Y YM  YVS +PR+AYVNYRDLDLG N+N
Sbjct  437   NGTIFMIQYYRSWS-DNEKRPNRRIKWMRELYSYMTPYVSSNPRQAYVNYRDLDLGQNRN  495

Query  332   GRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
                ++F EA +WG KYFK NF RLV +KT+VDPDNFF HEQSIP L
Sbjct  496   SSKSNFLEAKIWGAKYFKDNFSRLVRIKTKVDPDNFFRHEQSIPTL  541



>ref|XP_010054501.1| PREDICTED: cannabidiolic acid synthase-like 2 [Eucalyptus grandis]
 gb|KCW76616.1| hypothetical protein EUGRSUZ_D01004 [Eucalyptus grandis]
Length=534

 Score =   502 bits (1293),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 291/519 (56%), Positives = 383/519 (74%), Gaps = 13/519 (3%)
 Frame = -2

Query  1736  AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPL  1557
             A  +S    F +C+SLHS  +   + +    T   SS++SVL  T+QNL FL PSAPKPL
Sbjct  24    AFVMSTPENFQQCLSLHSENT--TAISKLVYTPINSSYSSVLDITIQNLRFLTPSAPKPL  81

Query  1556  LIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGI  1377
             LI TPL  SHVQAA+ C++  G+Q+R+RSGGHD+EGLSY S +    PFV++D+  LR I
Sbjct  82    LIVTPLHVSHVQAAITCSRRYGLQMRIRSGGHDYEGLSYLSKV----PFVIMDMVNLRSI  137

Query  1376  KVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYG  1197
              VDVED + WVQ+GAT GE+YYR+AEKSK LGFPAG C ++G+GGH +GG YG MLRKYG
Sbjct  138   AVDVEDETAWVQSGATVGELYYRIAEKSKTLGFPAGVCPTVGVGGHFSGGGYGTMLRKYG  197

Query  1196  LAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvf  1017
             LA DN +DA++V+A GR+LDR +MGEDLFWAIRGGGGGSFG++++WK+KLVPVP+TVTVF
Sbjct  198   LAVDNVIDAQLVNAQGRLLDRESMGEDLFWAIRGGGGGSFGVVVSWKVKLVPVPSTVTVF  257

Query  1016  tvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKT  837
             T+ RTLEQ+ATKL+++WQ + ++L  DL ++V++ + NS    G RT++ +F+ ++LG  
Sbjct  258   TLLRTLEQHATKLVHQWQLIGNELPNDLFMRVILQSSNS-GPNGTRTMEASFNTLYLGGV  316

Query  836   DRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAK  657
             D LL++   SFPEL +T +DC EMSWIES++Y A +    P E LL+ +    K +FK K
Sbjct  317   DALLEVTRSSFPELNVTRQDCTEMSWIESILYFAGF-SGEPLEVLLN-RSSNTKLYFKHK  374

Query  656   SEFLRTPVPESGLRGLWKIFLKEDTPV--MVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
             S++++ P+P+SGL G+W+ F +ED  V  M+WN YGG M++I ESA PFPHR GV+ KI 
Sbjct  375   SDYVKEPIPKSGLEGMWERFFEEDVGVAQMIWNHYGGRMSEISESALPFPHRAGVLYKIQ  434

Query  482   YLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSE  309
             +LTSW   G++   KH+ WIR  Y YM  YVSKSPREAY+NYRDLD+G N    +T + +
Sbjct  435   HLTSWTDGGDEVASKHVSWIRSFYSYMAPYVSKSPREAYINYRDLDIGTNNVKGDTGYKQ  494

Query  308   ASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             AS WG KYFK NF+RLV VKT VD  NFF HEQSIP  S
Sbjct  495   ASAWGKKYFKNNFDRLVRVKTAVDRGNFFRHEQSIPPFS  533



>emb|CAN60572.1| hypothetical protein VITISV_000229 [Vitis vinifera]
Length=531

 Score =   502 bits (1292),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 278/517 (54%), Positives = 377/517 (73%), Gaps = 11/517 (2%)
 Frame = -2

Query  1739  WAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKP  1560
             WA S S+   F +C+S HS +S P S   ++   ++ S   VL+S ++NL F   + PKP
Sbjct  22    WAASDSVHGAFLQCLSTHSQSSHPISAVLYTPDNSSYSS--VLESYIRNLRFNTSTTPKP  79

Query  1559  LLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRG  1380
              LI T   ESH++AA++C+K+ G+Q+++RSGGHD+EG+SY SD+    PF ++D+  LR 
Sbjct  80    RLIITATHESHIKAALICSKKHGLQMKIRSGGHDYEGVSYVSDV----PFFILDMFNLRS  135

Query  1379  IKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKY  1200
             I VD+ED S WVQAGAT GE+YYR+AEKSK  GFPAG C  +G GGH +GG YG M+RKY
Sbjct  136   ISVDIEDESAWVQAGATLGEIYYRIAEKSKIHGFPAGVCPRVGAGGHFSGGGYGNMMRKY  195

Query  1199  GLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtv  1020
             GL+ DN +DA +VD  GR+L+R +MGEDLFWAIRGGGG S+G+++++KIKLV VP TVTV
Sbjct  196   GLSVDNIVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPDTVTV  255

Query  1019  ftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGK  840
             F V RTLEQNAT ++Y+WQ+VADK+D DL +++ +  VN +   G++TV+  F ++FLG 
Sbjct  256   FRVARTLEQNATNIVYQWQQVADKVDGDLFIRLTMDVVNRSR-SGEKTVRATFRSLFLGS  314

Query  839   TDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKA  660
             ++RLL IMN S PELGL   DC EMSW+ESV++   +   TP E LL  KP    T  K 
Sbjct  315   SERLLSIMNTSLPELGLQSSDCTEMSWVESVLFWTNFATGTPVEALLDRKPQV-LTHLKR  373

Query  659   KSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVY  480
             KS++L+ P+P++GL G+WK  ++  TP + +NPYGG MA+I  SATPFPHR G +CKI Y
Sbjct  374   KSDYLKEPIPKAGLEGIWKKMIELQTPALAFNPYGGKMAEISPSATPFPHRAGNLCKIQY  433

Query  479   LTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
              T+W  EG +  +++++  R++Y YM  +VSKSPREA++NYRDLDLG+N NG+N S+ E 
Sbjct  434   ATNWDEEGSEAAERYINLTRQLYSYMTPFVSKSPREAFLNYRDLDLGINHNGKN-SYLEG  492

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              V+G KYFK NF RLV +KT+VDP NFF +EQSIP L
Sbjct  493   RVYGIKYFKKNFNRLVRIKTKVDPGNFFRNEQSIPTL  529



>ref|XP_004242239.1| PREDICTED: cannabidiolic acid synthase-like [Solanum lycopersicum]
Length=538

 Score =   502 bits (1292),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 284/537 (53%), Positives = 382/537 (71%), Gaps = 20/537 (4%)
 Frame = -2

Query  1775  LSILFTFLTFSP--WAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQST  1602
              S +F  L  S   W+       +F +C+S ++ TS          T N SSF S+LQ +
Sbjct  6     FSFIFVLLVLSSASWSTLADNHEEFIQCLSHNNQTS------SNIYTPNNSSFQSILQFS  59

Query  1601  VQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMES  1422
             +QNL F     PKPL+I TP++ES VQ  ++C K+ G+ +RVR  GHD+EGLSY S++  
Sbjct  60    IQNLRFNTSETPKPLVIVTPVSESEVQRVILCAKKTGMHVRVRGAGHDYEGLSYVSEV--  117

Query  1421  PAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigg  1242
               PFV++DL  LR I VDV D S WV+AG+T GE+YYR+AEKSK LGFPAG C ++G+GG
Sbjct  118   --PFVIVDLINLRTINVDVNDKSAWVEAGSTIGELYYRIAEKSKTLGFPAGVCPTVGVGG  175

Query  1241  hitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLA  1062
             H +GG YG MLRKYGLAADN +DAR++DA GR+LDRA+MGEDLFWAIRGGGG SFG++LA
Sbjct  176   HFSGGGYGVMLRKYGLAADNIVDARLIDANGRILDRASMGEDLFWAIRGGGGNSFGLVLA  235

Query  1061  WKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAV---  891
             WK+KLV VP  VTVFT+ +TLEQNATKL++KWQ VA +  +DL +++L++ +NS+     
Sbjct  236   WKVKLVDVPEIVTVFTLDKTLEQNATKLVHKWQYVAPRFHQDLFIRILVSRLNSSNQGDD  295

Query  890   KGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP  711
               ++T+  +F+++FLG  DRLL IM  +FPELGL   DC+EMSWIES++Y A +P   P 
Sbjct  296   NNQQTIVASFNSIFLGGIDRLLPIMQENFPELGLRRADCIEMSWIESILYFAGFPTDGPL  355

Query  710   EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKED--TPVMVWNPYGGMMAKI  537
             + LL    L  + +FKAKS+++  P+PE GL G+W+ F +++  +  ++ +PYGG M +I
Sbjct  356   DVLLSRVQLSTR-YFKAKSDYVYQPIPEGGLDGIWRFFFEDEAQSSQVILSPYGGRMDEI  414

Query  536   PESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNY  363
               SA PFPHR G + KI +L  W  EGE+  ++H+ WIRR+Y YM  +VSKSPR AY+NY
Sbjct  415   SPSAIPFPHRAGNLYKIQHLVYWDEEGEEVAERHISWIRRLYSYMAPFVSKSPRAAYINY  474

Query  362   RDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             RDLD+G+N     TS+ +A VWG KYFK NF+RLV VKT+VDP NFF +EQSIP L+
Sbjct  475   RDLDIGVNNIKGYTSYVQAKVWGIKYFKNNFDRLVHVKTKVDPSNFFRNEQSIPSLT  531



>emb|CAN80091.1| hypothetical protein VITISV_015121 [Vitis vinifera]
Length=531

 Score =   501 bits (1291),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 278/517 (54%), Positives = 379/517 (73%), Gaps = 11/517 (2%)
 Frame = -2

Query  1739  WAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKP  1560
             WA S S+   F +C+S HS +S P S   ++   ++ S   VL+S ++NL F   + PKP
Sbjct  22    WAASDSVHGAFLQCLSTHSQSSHPISAVLYTPDNSSYSS--VLESYIRNLRFNTSATPKP  79

Query  1559  LLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRG  1380
              LI T   ESH++AA++C+K+ G+Q+++RSGGHD+EG+SY SD+    PF ++D+  LR 
Sbjct  80    RLIITATHESHIKAAIICSKKHGLQMKIRSGGHDYEGVSYVSDV----PFFILDMFNLRS  135

Query  1379  IKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKY  1200
             I VD+ED S WVQAGAT GE+YYR+AEKSK  GFPAG C ++G GGH +GG YG M+RKY
Sbjct  136   ISVDIEDESAWVQAGATLGEIYYRIAEKSKTHGFPAGVCPTVGAGGHFSGGGYGNMMRKY  195

Query  1199  GLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtv  1020
             GL+ DN +DA +VD  GR+L+R +MGEDLFWAIRGGGG S+G+++++KIKLV VPATVTV
Sbjct  196   GLSVDNIVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPATVTV  255

Query  1019  ftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGK  840
             F V RTLEQNAT ++Y+WQ+VADK+D+DL +++ +  VNS+   G++TV+  F ++FLG 
Sbjct  256   FRVARTLEQNATNIVYQWQQVADKVDDDLFIRLTMDVVNSSR-SGEKTVRATFLSLFLGS  314

Query  839   TDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKA  660
             ++RLL IMN S PELGL   DC EMSW+ESV++   +   TP E LL   P    T  K 
Sbjct  315   SERLLSIMNTSLPELGLQSSDCTEMSWVESVLFWTNFAIGTPVEALLDRNPQV-LTHLKR  373

Query  659   KSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVY  480
             KS++L+ P+P++GL G+WK  ++  TP + +NPYGG MA+I  SATPFPHR G +CKI Y
Sbjct  374   KSDYLKEPIPKAGLEGIWKKMIELQTPALTFNPYGGKMAEISPSATPFPHRAGNLCKIQY  433

Query  479   LTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
              T+W  EG +  +++++  R++Y YM  +VSK PREA++NYRDLDLG+N NG+N S+ E 
Sbjct  434   ATNWDEEGSEAAERYINLTRQLYSYMTPFVSKFPREAFLNYRDLDLGINHNGKN-SYLEG  492

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              V+G KYFK NF RLV +KT+VDP NFF +EQSIP L
Sbjct  493   RVYGIKYFKKNFNRLVRIKTKVDPGNFFRNEQSIPTL  529



>ref|XP_009113914.1| PREDICTED: cannabidiolic acid synthase-like 2 isoform X1 [Brassica 
rapa]
Length=541

 Score =   501 bits (1291),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 301/539 (56%), Positives = 382/539 (71%), Gaps = 13/539 (2%)
 Frame = -2

Query  1787  SPIILSILFTFLTFSPWAV----SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfn  1620
             +P +  I F  L FS + V    S S+Q  F  C+  +++        FF+   NAS F 
Sbjct  7     APAVSYISFLALYFSFYTVASTSSNSLQDDFINCLHQNTNVDFLLDKTFFTPDRNASMFI  66

Query  1619  SVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSY  1440
              VL ST QN  +L  S PKP  IF P  ESHVQA+++C+K+ G+  RVRSGGHDFEGLSY
Sbjct  67    EVLNSTAQNQRYLTTSMPKPDFIFKPAHESHVQASIICSKKLGIHHRVRSGGHDFEGLSY  126

Query  1439  TSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCV  1260
              S +E+P  F++IDL+KLR I VD+EDNSVWVQAG+T GE+YYR++EKSK  G PAG   
Sbjct  127   VSYIETP--FIIIDLSKLRQINVDIEDNSVWVQAGSTVGELYYRISEKSKIHGCPAGIYP  184

Query  1259  SLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGS  1080
             +LGIGGHITGGAYG+++RKYGLAA+N LDA+IVDA G++LDR AMGED+FWAIRGG GGS
Sbjct  185   NLGIGGHITGGAYGSLMRKYGLAAENVLDAKIVDANGKLLDRTAMGEDMFWAIRGGAGGS  244

Query  1079  FGILLAWKIKLvpvpatvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLITAVN  903
             FGI+L+WKIKLVPVP T+TVFTV +TL+Q+A  K+L KWQ+VADKL E+L L+V  T   
Sbjct  245   FGIILSWKIKLVPVPQTLTVFTVTKTLDQDAGFKILSKWQQVADKLVEELFLRVFFTIAG  304

Query  902   STAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR  723
             +      RTV  ++   FLG+   L+++M+  FPELGLT +DC+EM+WIES++Y++ +  
Sbjct  305   NNE---NRTVAMSYIGQFLGEKGNLMEVMSKGFPELGLTLEDCIEMNWIESIMYSSGFST  361

Query  722   TT--PPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGM  549
             TT  PPE LL  K    + +FKAKS+F + P+P  GL+G+ K  L+E+  +MVW PYGGM
Sbjct  362   TTPPPPEVLLQAKSPLGEVYFKAKSDFAKEPIPVLGLKGMIKKILEEEAALMVWTPYGGM  421

Query  548   MAKIPESATPFPHRKGVICKIVYLTSWK-IEGEKKKHLDWIRRMYDYMGTYVSKSPREAY  372
             M KIPES  PFPHR G    I+Y  SW   E      + WIR +Y+YM  YVS +PR+AY
Sbjct  422   MDKIPESEIPFPHRSGTSFMILYYRSWSDTEKRPDMRIKWIRELYNYMTPYVSSNPRQAY  481

Query  371   VNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             VNYRDLDLG N N   TS  +A VWG KYFK NF RLV +KT+ DP+NFF HEQSIP L
Sbjct  482   VNYRDLDLGQNSNNSKTSLKQAQVWGAKYFKDNFNRLVKIKTKSDPENFFRHEQSIPSL  540



>gb|KCW76622.1| hypothetical protein EUGRSUZ_D01011, partial [Eucalyptus grandis]
Length=504

 Score =   499 bits (1286),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 287/512 (56%), Positives = 375/512 (73%), Gaps = 21/512 (4%)
 Frame = -2

Query  1721  IQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTP  1542
             I   F +C+SLHS  +   + +    T   S + SVL  T+QNL FL PSAPKP  I TP
Sbjct  1     IPDDFLQCLSLHSRNT--SAISKLVYTPINSWYYSVLDITIQNLRFLTPSAPKPNYIVTP  58

Query  1541  LTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVE  1362
             L  SHVQA ++C+++ G+Q+R RSGGHD+EGLSY S++    PFV++D+A  + I VDVE
Sbjct  59    LDVSHVQATIICSQQYGLQMRTRSGGHDYEGLSYLSEV----PFVIVDMANFQLISVDVE  114

Query  1361  DNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADN  1182
             D + WVQ+GAT GE+YYR+AEKSK LGFPAG C ++G+GGH +GG YG +LRKYGLAADN
Sbjct  115   DKTAWVQSGATVGELYYRIAEKSKTLGFPAGLCPTVGVGGHFSGGGYGTLLRKYGLAADN  174

Query  1181  ALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRT  1002
              +D ++VDA GR+LDR AMGEDLFWAIRGGGGGSFG++++WK+KL PVP+TVTVFT+ RT
Sbjct  175   VIDVQLVDAQGRLLDRVAMGEDLFWAIRGGGGGSFGVVVSWKVKLAPVPSTVTVFTILRT  234

Query  1001  LEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLK  822
             LEQNATKL+++WQ VA++L +DL +++++ + NS    G RT+Q  FD ++LG  + LL+
Sbjct  235   LEQNATKLVHQWQLVANELPDDLFIRLILQSYNS-GPNGTRTMQAIFDTLYLGGVNSLLE  293

Query  821   IMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLR  642
             +    FPEL +T +DC EMSWIESV+Y A +P  TP E LL+ +    KTFFK KS++++
Sbjct  294   VTRSRFPELNVTRQDCTEMSWIESVLYFAGFPSGTPLEVLLN-RSSNTKTFFKNKSDYVK  352

Query  641   TPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKI  462
              P+PE+           +  P+M+WNPYGG MA+I E+A PFPHR G++ KI ++T+W  
Sbjct  353   EPIPEN-----------QGVPMMIWNPYGGKMAEISEAAIPFPHRAGILYKIQHITAWTT  401

Query  461   EGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYK  288
              G +   KH+ WIR  Y YM  YVSKSPREAY+NYRDLD+GMN    +TS+ +ASVWG K
Sbjct  402   GGNEAAPKHVSWIRSFYGYMEQYVSKSPREAYINYRDLDIGMNNVIGDTSYKQASVWGEK  461

Query  287   YFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             YFK N  RLV VKT VDPDNFF HEQSIP  S
Sbjct  462   YFKNNLNRLVRVKTAVDPDNFFRHEQSIPPFS  493



>gb|KCW76619.1| hypothetical protein EUGRSUZ_D01008, partial [Eucalyptus grandis]
Length=527

 Score =   500 bits (1288),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 289/523 (55%), Positives = 375/523 (72%), Gaps = 14/523 (3%)
 Frame = -2

Query  1763  FTFLTFSPW-AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLV  1587
             F FL  +P  A ++S    F +C+SLHS  +   + +    T   SS+ SVL  T+QNL 
Sbjct  14    FLFLLAAPLVAFAISTSDDFLQCLSLHSGNA--SAISKLVYTPVNSSYYSVLDITIQNLR  71

Query  1586  FLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFV  1407
             FL PSAPKP  I TPL  SHVQA++ C+++ G+Q+R RSGGHD+EGLSY S++    PFV
Sbjct  72    FLTPSAPKPNYIVTPLDVSHVQASIFCSRQYGLQMRTRSGGHDYEGLSYLSEV----PFV  127

Query  1406  VIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitgg  1227
             ++D+A  R I VD +D + WVQ+GAT GE+YYR+AEKSK LGFPAG C ++G+GGH +GG
Sbjct  128   ILDMANFRAISVDAKDKTAWVQSGATIGELYYRIAEKSKTLGFPAGLCPTVGVGGHFSGG  187

Query  1226  aygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKL  1047
              YG +LRKYGLAADN +DA++VDA GR+LDR +MGEDLFWAIRGGGGGSF ++++WK+KL
Sbjct  188   GYGTLLRKYGLAADNVIDAQLVDAQGRLLDRESMGEDLFWAIRGGGGGSFCVVVSWKVKL  247

Query  1046  vpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQT  867
             VPVP+TVTVF + RTLEQNATKL+++WQ V  KL +D+ + + + + NS+   G  T+Q 
Sbjct  248   VPVPSTVTVFKILRTLEQNATKLVHQWQLVTSKLPDDIFISLTLQSYNSSP-DGMMTMQA  306

Query  866   AFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKP  687
              FD ++LG  D LLK+ +  FPEL +T  DC EMSWIESV+  A +    P E LL+ + 
Sbjct  307   IFDTLYLGGVDSLLKVTSSRFPELNVTRLDCTEMSWIESVLNFAGF-SGEPLEVLLN-RS  364

Query  686   LFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPV--MVWNPYGGMMAKIPESATPFP  513
                K FFK KS++++ P+PESGL G+W+ F +ED  V  M W P GG MA+I ESA PF 
Sbjct  365   SNTKIFFKKKSDYVKEPIPESGLEGMWERFFEEDQGVHMMTWVPSGGKMAEISESAIPFS  424

Query  512   HRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMN  339
             HR GV+ KI++ T W   G +   KH+ WIR  Y YM  YVSKSPREAY+N RDLD+GMN
Sbjct  425   HRAGVLYKILHATEWTTGGNEVAPKHVSWIRSFYGYMAQYVSKSPREAYINSRDLDIGMN  484

Query  338   KNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQ  210
                 +TS+ +ASVWG KYFK NF+RLV VKT +DPDNFF HEQ
Sbjct  485   NVIGDTSYKQASVWGKKYFKNNFDRLVRVKTAIDPDNFFRHEQ  527



>ref|XP_010054195.1| PREDICTED: cannabidiolic acid synthase-like 2 [Eucalyptus grandis]
 gb|KCW75698.1| hypothetical protein EUGRSUZ_D00071 [Eucalyptus grandis]
Length=534

 Score =   500 bits (1288),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 289/516 (56%), Positives = 382/516 (74%), Gaps = 13/516 (3%)
 Frame = -2

Query  1727  LSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIF  1548
             +S    F +C+SLHS  +   + +    T   SS++SVL  T+QNL FL PSAPKPLLI 
Sbjct  27    MSTPENFLQCLSLHSENA--TAISKLVYTPINSSYSSVLDITIQNLRFLTPSAPKPLLIV  84

Query  1547  TPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVD  1368
             TPL  SHVQAA+ C++  G+Q+R+RSGGHD+EGLSY S +    PFV++D+  LR I VD
Sbjct  85    TPLHVSHVQAAITCSQRYGLQMRIRSGGHDYEGLSYLSKV----PFVIMDMVNLRFIAVD  140

Query  1367  VEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAA  1188
             VED + WVQ+GAT GE+YYR+AEKSK LGFPAG C ++G+GGH +GG YG MLRKYGLA 
Sbjct  141   VEDETAWVQSGATVGELYYRIAEKSKTLGFPAGVCPTVGVGGHFSGGGYGTMLRKYGLAV  200

Query  1187  DNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvP  1008
             DN +DA++V+A GR+LDR +MGEDLFWAIRGGGGGSFG++++WK+KLVPVP+TVTVFT+ 
Sbjct  201   DNVIDAQLVNAQGRLLDRESMGEDLFWAIRGGGGGSFGVVVSWKVKLVPVPSTVTVFTLL  260

Query  1007  RTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRL  828
             RTLEQ+ATKL+++WQ + +++  DL ++V++ + NS    G RT++ +F+ ++LG  D L
Sbjct  261   RTLEQHATKLVHQWQLIGNEIPNDLFMRVILQSSNS-GPNGTRTMEASFNTLYLGGVDAL  319

Query  827   LKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEF  648
             L++   SFPEL +T +DC EMSWIES++Y A +    P E LL+ +    K +FK KS++
Sbjct  320   LEVTRSSFPELNVTRQDCTEMSWIESILYFAGF-SGEPLEVLLN-RSSNTKLYFKHKSDY  377

Query  647   LRTPVPESGLRGLWKIFLKEDTPV--MVWNPYGGMMAKIPESATPFPHRKGVICKIVYLT  474
             ++ P+P+SGL G+W+ F +ED  V  M+WN YGG M++I ESA PFPHR GV+ KI +LT
Sbjct  378   VKEPIPKSGLEGMWERFFEEDVGVAQMIWNHYGGRMSEISESALPFPHRAGVLYKIQHLT  437

Query  473   SWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASV  300
             SW   G++   KH+ WIR  Y YM  YVSKSPREAY+NYRDLD+G N    +T + +AS 
Sbjct  438   SWTDGGDEVASKHVSWIRSFYSYMAPYVSKSPREAYINYRDLDIGTNNVKGDTGYKQASA  497

Query  299   WGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             WG KYFK NF+RLV VKT VD  NFF HEQSIP  S
Sbjct  498   WGKKYFKNNFDRLVRVKTAVDRGNFFRHEQSIPPFS  533



>ref|XP_006370482.1| FAD-binding domain-containing family protein [Populus trichocarpa]
 gb|ERP67051.1| FAD-binding domain-containing family protein [Populus trichocarpa]
Length=527

 Score =   499 bits (1286),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 279/521 (54%), Positives = 375/521 (72%), Gaps = 14/521 (3%)
 Frame = -2

Query  1739  WAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKP  1560
             W  S      F +C+   +  SI    +    T   SS++S+LQ ++QNL F   S PKP
Sbjct  14    WVTSAHTHESFLQCLDSQNSHSI----SKLIYTPINSSYSSILQFSIQNLRFNTSSTPKP  69

Query  1559  LLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRG  1380
             L+I TP   SH+QAA++C+++ G+Q+R+RSGGHD+EGLSY S       FVVIDL  LR 
Sbjct  70    LVIVTPTNISHIQAAIICSQKHGMQIRIRSGGHDYEGLSYVSTFS----FVVIDLINLRT  125

Query  1379  IKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKY  1200
             I V+ E+ + WVQ+G T GEVYYR+AEKS+ L FPA  C ++G+GGH +GG YG ++RKY
Sbjct  126   INVNAENKTAWVQSGVTIGEVYYRIAEKSRTLAFPASVCPTVGVGGHFSGGGYGMLMRKY  185

Query  1199  GLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtv  1020
             GLAAD+ +DA++VD  GR+LDR +MGEDLFWAIRGGGG +FG+++AWKI LV  P TVTV
Sbjct  186   GLAADHIIDAQLVDVKGRILDRESMGEDLFWAIRGGGGNTFGVVIAWKISLVSAPPTVTV  245

Query  1019  ftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAV-KGKRTVQTAFDAVFLG  843
             F V RTLEQNA+KL+++WQ VADKL EDL +++++  VNST   K   T+Q +F+++FLG
Sbjct  246   FNVQRTLEQNASKLVHRWQFVADKLHEDLFIRIILNRVNSTEEGKSNTTIQASFNSLFLG  305

Query  842   KTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFK  663
               DRLL ++  SFPELGL  +DC+EMSWI+SV+Y   +P  +  + LL   P   +  FK
Sbjct  306   GIDRLLPLIQDSFPELGLVKEDCIEMSWIQSVLYFDGFPSNSSLDVLLDRTPSTRRN-FK  364

Query  662   AKSEFLRTPVPESGLRGLWKIFLKED--TPVMVWNPYGGMMAKIPESATPFPHRKGVICK  489
             AKS++++ P+PE GL G+W+ F  +D  TP+++++PYGG M++I ES+ PFPHR G I K
Sbjct  365   AKSDYVKEPIPELGLEGIWERFFDKDINTPILIFSPYGGKMSEISESSIPFPHRAGNIYK  424

Query  488   IVYLTSWKIEG--EKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSF  315
             I +L  W  EG    K+H+ WIRR+Y Y+  YVSK+PR AYVNYRDLD+G+N +  NTS+
Sbjct  425   IQHLIYWDEEGIVATKRHISWIRRLYSYLAPYVSKTPRAAYVNYRDLDIGINNHAGNTSY  484

Query  314   SEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
              +AS+WG KYFK NF+RLV VKT VDP NFF +EQSIP LS
Sbjct  485   RQASIWGLKYFKNNFDRLVRVKTAVDPANFFRNEQSIPPLS  525



>ref|XP_007023038.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY25660.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=529

 Score =   500 bits (1287),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 282/538 (52%), Positives = 383/538 (71%), Gaps = 20/538 (4%)
 Frame = -2

Query  1796  SWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnS  1617
             S+S P+ L +LF+F     WA S      F +C+SLHS  +     A    T N+SS+ S
Sbjct  5     SFSMPLFLLVLFSF----SWATSARTHDSFLQCLSLHSDIN-----ARLIYTQNSSSYES  55

Query  1616  VLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYT  1437
             VL+ +V+N  F  P+ P+PL+I TP   SH+QA + C++E  +Q+R+RSGGHD+EGLSY 
Sbjct  56    VLELSVRNARFSTPTTPRPLVIVTPSNVSHIQATINCSREHDMQIRIRSGGHDYEGLSYV  115

Query  1436  SDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVS  1257
             S +    PFV+IDL  +R I VD E+ + W+QAGAT GE+YYR+AEKS  L FPAG C +
Sbjct  116   SKV----PFVIIDLINMRSIDVDTEEKTAWIQAGATIGELYYRIAEKSATLAFPAGVCPT  171

Query  1256  LgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSF  1077
             +G+GGH +GG YG M RK+GLAAD  +DA IV   GR+LDR +MGEDLFWAIRGGGG SF
Sbjct  172   VGVGGHFSGGGYGMMTRKFGLAADQIIDAHIVTVDGRILDRNSMGEDLFWAIRGGGGASF  231

Query  1076  GILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNST  897
             G+++AWK+KLV VP+TVTVFTV RTLE+NATKL++KWQ VA+ +DEDL  ++ + AVNS+
Sbjct  232   GVIVAWKVKLVSVPSTVTVFTVNRTLEENATKLVHKWQSVAEAIDEDLYFRLFLRAVNSS  291

Query  896   AVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTT  717
               +GKRTVQ +F ++FLG+ D+L+ +M  SFPE GL  +DC+EMSWI+S++Y A  P++ 
Sbjct  292   Q-EGKRTVQASFTSLFLGRIDQLIALMQESFPEFGLVKEDCIEMSWIQSILYFAEIPQSE  350

Query  716   PPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPV--MVWNPYGGMMA  543
               + LL+        FFK KS+++  P+PE  L GLW+ F ++++    ++++PYGG+M 
Sbjct  351   SLDVLLNRT--VTAGFFKGKSDYVTEPIPEIALEGLWQWFYEDESETLGLIFSPYGGIMD  408

Query  542   KIPESATPFPHRKGVICKIVYLTSWKIE--GEKKKHLDWIRRMYDYMGTYVSKSPREAYV  369
             +I ES TPFPHR G +  I Y  SW+ E     +KH++++RR+Y YM  YVSKSPR AY+
Sbjct  409   EISESETPFPHRAGNLYNIHYGVSWEEEDASTSQKHINFMRRLYKYMEPYVSKSPRAAYM  468

Query  368   NYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             NYRDLDLG N  G+ TS+++AS W  KYFK NF +L+ VK  VDP NFF HEQS+P L
Sbjct  469   NYRDLDLGSNNKGKYTSYTQASRWALKYFKNNFNKLIHVKNMVDPQNFFRHEQSVPTL  526



>gb|KHN39149.1| Reticuline oxidase-like protein [Glycine soja]
Length=432

 Score =   496 bits (1277),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 283/432 (66%), Positives = 346/432 (80%), Gaps = 8/432 (2%)
 Frame = -2

Query  1484  LRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRV  1305
             +RVRSGGHD+EGLSY S +E P  F+++DLAKLR + VD+  N+ W+QAGAT GEVYYR+
Sbjct  1     MRVRSGGHDYEGLSYVSLIEKP--FMILDLAKLRAVNVDIARNTAWIQAGATIGEVYYRI  58

Query  1304  AEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAM  1125
             +EKS   GFPAG C +LGIGGHITGGAYG+M+RKYGL ADN LDARIVDA G+VLDR AM
Sbjct  59    SEKSAVHGFPAGLCTTLGIGGHITGGAYGSMMRKYGLGADNVLDARIVDANGKVLDRKAM  118

Query  1124  GEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkl  945
             GEDLFWAIRGGGGGSFG++L WKIKLVPVP TVTVFTV +TLEQ  +KLL++WQ+VA  +
Sbjct  119   GEDLFWAIRGGGGGSFGVILWWKIKLVPVPQTVTVFTVTKTLEQGGSKLLHRWQQVAPHI  178

Query  944   dedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEM  765
             DE+L ++V+I   N T V GKRTV T+++A+FLG  +RLL++M H FPELGLT KDC+E 
Sbjct  179   DENLFIRVIIQPGNGT-VPGKRTVTTSYNALFLGGANRLLQVMKHGFPELGLTRKDCVET  237

Query  764   SWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKED  585
             SWI+SV+Y A YP  T PE LL GK    K +FKAKS+F+R  + E  L  LWKIFL++D
Sbjct  238   SWIKSVLYIAGYPDGTAPEVLLQGKST-TKAYFKAKSDFVREVITEKSLNALWKIFLQDD  296

Query  584   TPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDY  411
              P+M+WNPYGG M++I ESATPFPHRKGV+ KI ++T W ++GEK   KH++W+R+ Y Y
Sbjct  297   GPLMIWNPYGGKMSRIAESATPFPHRKGVLYKIQHVTGW-LDGEKSMAKHMNWMRKFYFY  355

Query  410   MGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPD  231
             M  YVSK PRE YVNYRDLD+GMN+   NTS  +AS WGY+YFKGNF RLV VKT+VDP 
Sbjct  356   MAPYVSKYPRETYVNYRDLDIGMNQK-NNTSLLKASPWGYRYFKGNFNRLVKVKTKVDPS  414

Query  230   NFFWHEQSIPVL  195
             NFF HEQSIP+L
Sbjct  415   NFFRHEQSIPLL  426



>gb|KEH31322.1| reticuline oxidase-like protein [Medicago truncatula]
Length=542

 Score =   499 bits (1286),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 282/542 (52%), Positives = 387/542 (71%), Gaps = 15/542 (3%)
 Frame = -2

Query  1802  MASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassf  1623
             ++S+ S  +++ILF++   S    + + +  F +C+S +SH S   S +    T    S+
Sbjct  4     LSSYLSVALIAILFSYA--SSAIDTNTYEDNFLQCLSSYSHNS--TSISKVVYTKTNPSY  59

Query  1622  nSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLS  1443
             + VL+ T QNL F     PKPL+I TPL  SH+Q A++C++  G+Q+R RSGGHDFEGLS
Sbjct  60    SPVLKFTTQNLRFASYKTPKPLVIITPLEPSHIQTAIICSQNHGLQIRTRSGGHDFEGLS  119

Query  1442  YTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNC  1263
             Y S++    PFVVIDL   + I VDVE  + WVQ+GAT GE+YY +++KS+NL FPAG C
Sbjct  120   YVSEI----PFVVIDLINFKEIDVDVESRTAWVQSGATLGELYYTISQKSRNLAFPAGAC  175

Query  1262  VSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggG  1083
              ++G+GGH +GG YG +LRKYGLAADN +DA I+D  GR+LDR AMGED FWAIRGGGG 
Sbjct  176   PTIGVGGHFSGGGYGTLLRKYGLAADNVIDAHIIDVKGRLLDREAMGEDYFWAIRGGGGA  235

Query  1082  SFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVN  903
             SFG++++WKIKLV VPATVTVFTVPR LEQNATKL++KWQ +A K+DE++ + ++   +N
Sbjct  236   SFGVIISWKIKLVEVPATVTVFTVPRALEQNATKLVHKWQYLASKIDENIAINIVFQRIN  295

Query  902   STAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPR  723
             S+  KG+ T+   F A+FLG  D+L+ +M+  FPELG+  ++C+EMSWIESV+Y   +P+
Sbjct  296   SSK-KGETTILAIFQALFLGGVDKLIPLMDQKFPELGVVRENCIEMSWIESVLYLFQFPK  354

Query  722   TTPPEFLLHG--KPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDT--PVMVWNPYG  555
                PE LL+       P+  +KAKS+F++TP+PE+GL G+W +F +E     +M+W PYG
Sbjct  355   GALPEVLLNRTLAANSPRFIYKAKSDFVKTPIPENGLEGIWSLFHEEGAKGAMMIWFPYG  414

Query  554   GMMAKIPESATPFPHRKGVICKIVYLTSWKIEGE--KKKHLDWIRRMYDYMGTYVSKSPR  381
             G+M  I ES  PFPHRKG +  I Y   W+ EG+  +K H++WIR++Y+YM  +VSKSPR
Sbjct  415   GIMDTISESEIPFPHRKGNLYHIHYQVDWQQEGDEVEKLHINWIRKLYNYMEPFVSKSPR  474

Query  380   EAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
               Y+NYRDLD+G+N     TS+ +AS+WG KYFK NF RL  VKT+VDP NFF +EQSIP
Sbjct  475   AGYINYRDLDIGVNNIDGYTSYKQASIWGVKYFKNNFRRLANVKTKVDPLNFFRNEQSIP  534

Query  200   VL  195
              L
Sbjct  535   SL  536



>ref|XP_002270585.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=531

 Score =   499 bits (1284),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 277/517 (54%), Positives = 376/517 (73%), Gaps = 11/517 (2%)
 Frame = -2

Query  1739  WAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKP  1560
             WA S S+   F +C+S HS +S P S   ++   ++ S   VL+S ++NL F   + PKP
Sbjct  22    WAASDSVHGAFLQCLSTHSQSSHPISAVLYTPDNSSYSS--VLESYIRNLRFNTSTTPKP  79

Query  1559  LLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRG  1380
              LI T   ESH++AA++C+K+ G+Q+++RSGGHD+EG+SY SD+    PF ++D+  LR 
Sbjct  80    RLIITATHESHIKAALICSKKHGLQMKIRSGGHDYEGVSYVSDV----PFFILDMFNLRS  135

Query  1379  IKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKY  1200
             I VD+ED S WVQAGAT GE+YYR+AEKSK  GF AG C  +G GGH +GG YG M+RKY
Sbjct  136   ISVDIEDESAWVQAGATLGEIYYRIAEKSKIHGFSAGVCPRVGAGGHFSGGGYGNMMRKY  195

Query  1199  GLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtv  1020
             GL+ DN +DA +VD  GR+L+R +MGEDLFWAIRGGGG S+G+++++KIKLV VP TVTV
Sbjct  196   GLSVDNIVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPDTVTV  255

Query  1019  ftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGK  840
             F V RTLEQNAT ++Y+WQ+VADK+D DL +++ +  VN +   G++TV+  F ++FLG 
Sbjct  256   FRVARTLEQNATNIVYQWQQVADKVDGDLFIRLTMDVVNRSR-SGEKTVRATFRSLFLGS  314

Query  839   TDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKA  660
             ++RLL IMN S PELGL   DC EMSW+ESV++   +   TP E LL  KP    T  K 
Sbjct  315   SERLLSIMNTSLPELGLQSSDCTEMSWVESVLFWTNFATGTPVEALLDRKPQV-LTHLKR  373

Query  659   KSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVY  480
             KS++L+ P+P++GL G+WK  ++  TP + +NPYGG MA+I  SATPFPHR G +CKI Y
Sbjct  374   KSDYLKEPIPKAGLEGIWKKMIELQTPALAFNPYGGKMAEISPSATPFPHRAGNLCKIQY  433

Query  479   LTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
              T+W  EG +  +++++  R++Y YM  +VSKSPREA++NYRDLDLG+N NG+N S+ E 
Sbjct  434   ATNWDEEGSEAAERYINLTRQLYSYMTPFVSKSPREAFLNYRDLDLGINHNGKN-SYLEG  492

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              V+G KYFK NF RLV +KT+VDP NFF +EQSIP L
Sbjct  493   RVYGIKYFKKNFNRLVRIKTKVDPGNFFRNEQSIPTL  529



>ref|XP_007023052.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY25674.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=540

 Score =   498 bits (1282),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 281/527 (53%), Positives = 385/527 (73%), Gaps = 13/527 (2%)
 Frame = -2

Query  1757  FLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLV  1578
             F++ S  A S SIQ +F +C+   S +S P + A ++    + S   VL+S V+NL F+ 
Sbjct  23    FISLS-LASSQSIQDKFVQCLCKQSQSSNPIAGAIYTPNNASFSS--VLESYVRNLRFMT  79

Query  1577  PSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVID  1398
             P  PKPL+I T L ESHVQA VVC+K  G+Q+R+RSGGHD+EGLSY S +    PFV++D
Sbjct  80    PETPKPLVIVTALHESHVQATVVCSKSVGLQIRIRSGGHDYEGLSYVSSV----PFVILD  135

Query  1397  LAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggayg  1218
             +  LRGI ++V D S WVQAGA+ GEVYYR+AEKS   GFPAG C +LG+GGH TGG YG
Sbjct  136   MFNLRGIDINVRDESAWVQAGASLGEVYYRIAEKSPVHGFPAGVCPTLGVGGHFTGGGYG  195

Query  1217  AMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpv  1038
              M+RKYGL+ DN +DA++VDA+GR+LDRA+MGEDLFWAIRGGG  SF ++L+WKIKLVPV
Sbjct  196   NMMRKYGLSVDNIIDAKVVDASGRILDRASMGEDLFWAIRGGGAASFCVVLSWKIKLVPV  255

Query  1037  patvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFD  858
             P TVTVF V +TLE+ AT L+ KWQ+VAD+LD+DL ++++++     +  G+ T+Q +F 
Sbjct  256   PETVTVFRVDKTLEEGATDLVVKWQQVADRLDDDLFIRLMLSPEKIGSPPGQNTIQASFV  315

Query  857   AVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFP  678
             A+FLG+T+RLL++MN SFPELGL  KDC++M W+ESV++   YP  +  + LL   P   
Sbjct  316   AMFLGQTERLLQLMNESFPELGLQKKDCIKMRWVESVLFWINYPNVSSTDVLLQRIPK-S  374

Query  677   KTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGV  498
             ++F K KS++++ P+P++GL  +WK+ ++ +   M WNPYGG M++I  +ATPFPHR G 
Sbjct  375   ESFLKRKSDYVQQPIPKAGLEAIWKVMMEAENVGMNWNPYGGKMSEILPTATPFPHRAGN  434

Query  497   ICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRN  324
             I KI Y ++WK  G +     L+W R++Y+ M  YVSK+PRE+++NYRD+D+G+N NG  
Sbjct  435   IFKIQYGSNWKKPGNEVADNFLNWTRKLYEAMTPYVSKNPRESFLNYRDIDIGVNSNG--  492

Query  323   TSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS*LC  183
              +  E  V+G KYFK NF+RLV VKT+VDPDNFF +EQSIP  S  C
Sbjct  493   -TLEEGRVYGSKYFKENFDRLVDVKTQVDPDNFFSYEQSIPTRSSDC  538



>ref|XP_006377943.1| hypothetical protein POPTR_0011s16540g [Populus trichocarpa]
 gb|ERP55740.1| hypothetical protein POPTR_0011s16540g [Populus trichocarpa]
Length=536

 Score =   498 bits (1282),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 282/513 (55%), Positives = 375/513 (73%), Gaps = 11/513 (2%)
 Frame = -2

Query  1718  QHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPL  1539
                F +C+S H   S   + +    T  + S++SVLQ +VQN  F   S P+P++IFTP 
Sbjct  30    HEDFLQCLSFHFQDS--TAISKLIYTPRSPSYSSVLQFSVQNNRFNTTSDPEPVVIFTPT  87

Query  1538  TESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVED  1359
               SHVQAA+ C+++  + +R+RSGGHD+EGLSY S      PFV++DL  LR + VD   
Sbjct  88    NVSHVQAAIYCSRKQNLHIRIRSGGHDYEGLSYVS---YSLPFVIVDLINLRKVAVDARH  144

Query  1358  NSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNA  1179
              + WVQAGA+ GEVYYR+AEK++ L FPAG   ++G+GGHI+GG YG M+RKYGLAADN 
Sbjct  145   KTAWVQAGASLGEVYYRIAEKNRTLAFPAGIWPTIGVGGHISGGGYGMMMRKYGLAADNV  204

Query  1178  LDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTL  999
             +DA+++D  GR+LDRA+MGEDLFWAIRGGGG +FG+++AWK+KLVPVP TVTVFTVPRTL
Sbjct  205   IDAQLIDVKGRILDRASMGEDLFWAIRGGGGNTFGVVVAWKLKLVPVPPTVTVFTVPRTL  264

Query  998   EQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKI  819
             EQNATKL+++WQ VA KL +DL + +++  +NS+  +GK T+  AF ++FLG  DRLL +
Sbjct  265   EQNATKLVHRWQSVASKLHKDLTIALVLRRINSSE-EGKTTILAAFTSLFLGGVDRLLPL  323

Query  818   MNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRT  639
             M  SFPELGL  +DC+EMSWI+SV+Y   +P     + LL   PL  + F K KS++++ 
Sbjct  324   MQESFPELGLVKEDCIEMSWIKSVLYVVGFPSNASSDVLLARTPLTNRNF-KGKSDYVKE  382

Query  638   PVPESGLRGLWKIFLKED--TPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWK  465
             P+PE+ L G+W+ FL+ D  TP MVW PYGG M +I E++ PFPHR G + KI +L  W 
Sbjct  383   PMPETALEGIWERFLEADIDTPQMVWAPYGGKMDEISETSIPFPHRSGNLYKIQHLVFWD  442

Query  464   IEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGY  291
              EG +  K+H+ WIRR+YDY+  YVSK+PR AYVNYRDLD+G+N    NTS+ +AS+WG 
Sbjct  443   EEGNEASKRHISWIRRLYDYLTPYVSKNPRAAYVNYRDLDIGINNIQGNTSYRQASIWGI  502

Query  290   KYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             KYF  NF+RLV+VKTRVDP NFF +EQSIP LS
Sbjct  503   KYFDNNFDRLVSVKTRVDPANFFRNEQSIPPLS  535



>ref|XP_009101716.1| PREDICTED: tetrahydrocannabinolic acid synthase-like isoform 
X1 [Brassica rapa]
Length=557

 Score =   498 bits (1281),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 295/514 (57%), Positives = 374/514 (73%), Gaps = 14/514 (3%)
 Frame = -2

Query  1721  IQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTP  1542
             +Q  F KC+  ++H + P    FF+   NAS+F +VL++T QN  FL  + PKP  IF P
Sbjct  39    LQEDFVKCLHRNTHVNFPLEKTFFTPEKNASTFINVLEATAQNYRFLTKATPKPTFIFKP  98

Query  1541  LTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVE  1362
             + ESHVQA+V+C+K+ G+ LRVRSGGHDFE +SY S +E+P  FV++DL+KLR I VD+E
Sbjct  99    VHESHVQASVICSKKLGIHLRVRSGGHDFEAVSYVSQIETP--FVLLDLSKLRQINVDIE  156

Query  1361  DNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADN  1182
             +NS WVQAGAT GEVYYR+AEKSK  GFPAG C ++GIGGHITGG  G +LRKYGLAADN
Sbjct  157   ENSAWVQAGATLGEVYYRIAEKSKLHGFPAGLCSTVGIGGHITGGGDGTLLRKYGLAADN  216

Query  1181  ALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRT  1002
              LDA+IV+A G++L+RAAMGEDLFWAIRGGGGGSFG++LAWK+KLVPVP T+T+FTV +T
Sbjct  217   VLDAKIVNADGKLLNRAAMGEDLFWAIRGGGGGSFGVILAWKLKLVPVPETLTMFTVTKT  276

Query  1001  LEQN-ATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLL  825
             LEQ+  TK+L KWQ++ADKL +DL L+V+        V G +T+   +   FLG+   L+
Sbjct  277   LEQDPETKILSKWQRIADKLVDDLFLRVMFR------VAGDKTLTLEYKGQFLGEKGTLM  330

Query  824   KIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFP--KTFFKAKSE  651
             ++M   FPELGLT +DC+E++WIESV+ NA +P  +P E LL+ K L P  K +FK KS+
Sbjct  331   EVMKKYFPELGLTQEDCIEVTWIESVLANAGFPIDSPLEVLLNPK-LSPYVKVYFKGKSD  389

Query  650   FLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTS  471
             F   P+P  GL+G++K  ++E+T  M   PYGGMMAKIPES TPF HRKG I KI Y T+
Sbjct  390   FATEPIPPFGLKGMFKKLVEENTSSMFMIPYGGMMAKIPESETPFAHRKGTILKIHYATN  449

Query  470   WKIEG--EKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVW  297
                E      K   WIR MY YM  YVS +PR AYVNYRDLDLG N      +F +A  W
Sbjct  450   STSEDGISLNKRTKWIREMYSYMTPYVSSNPRLAYVNYRDLDLGTNTKDSKANFIKAQTW  509

Query  296   GYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             G +YFK NF RLV +KT+VDP+NFF HEQSIP L
Sbjct  510   GAQYFKNNFNRLVKIKTKVDPENFFRHEQSIPSL  543



>ref|XP_007023037.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY25659.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=534

 Score =   496 bits (1278),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 285/541 (53%), Positives = 381/541 (70%), Gaps = 21/541 (4%)
 Frame = -2

Query  1796  SWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnS  1617
             S+S P+ L +LF+F     WA S      F +C+SLHS  +     A    T N+SS+ S
Sbjct  5     SFSVPLFLLVLFSF----SWATSARTHDSFLQCLSLHSGIN-----ARLIYTQNSSSYES  55

Query  1616  VLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYT  1437
             VL  + +N  F  P+ P+PL+I TP   SHVQA + C++E  +Q+R+RSGGHD+EGLSY 
Sbjct  56    VLDLSARNARFSTPTTPRPLVIVTPSNVSHVQATINCSREHDMQIRIRSGGHDYEGLSYV  115

Query  1436  SDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVS  1257
             S +    PFV+IDL  +R I VD E  + W+QAGAT GE+YYR+AEKS  L FPAG C +
Sbjct  116   SKV----PFVIIDLINMRSIDVDTEKKTAWIQAGATIGELYYRIAEKSTTLAFPAGVCPT  171

Query  1256  LgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSF  1077
             +G+GGH +GG YG M RK+GLAAD  +DA IV   GR+LDR +MGEDLFWAIRGGGG SF
Sbjct  172   VGVGGHFSGGGYGMMTRKFGLAADQIIDAHIVTVDGRILDRNSMGEDLFWAIRGGGGASF  231

Query  1076  GILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNST  897
             G+++AWK+KLV VP+TVTVFTV RTLE+NATKL++KWQ VA+ +DEDL  +V + AVNS+
Sbjct  232   GVIVAWKVKLVSVPSTVTVFTVNRTLEENATKLVHKWQSVAEAIDEDLYFRVFLRAVNSS  291

Query  896   AVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTT  717
               +GKRTVQ +F ++FLG+ D+L+ +M  SFPELGL  +DC+EMSWI+S++Y    P++ 
Sbjct  292   Q-EGKRTVQASFTSLFLGRIDQLIALMQESFPELGLVKEDCIEMSWIQSILYFPGIPQSE  350

Query  716   PPEFLLHGKPLFPKT---FFKAKSEFLRTPVPESGLRGLWKIFLKEDTPV--MVWNPYGG  552
               + LL+            FKAKS+++  P+PE  L GLW+ F ++++    ++++PYGG
Sbjct  351   SLDVLLNRTGTIRTVTAGIFKAKSDYVTEPIPEIALEGLWQWFYEDESGTLELIFSPYGG  410

Query  551   MMAKIPESATPFPHRKGVICKIVYLTSWKIE--GEKKKHLDWIRRMYDYMGTYVSKSPRE  378
             +M +I ES TPFPHR G + KI Y  SW+ E     +KH++++RR+Y YM  YVSKSPR 
Sbjct  411   IMDEISESETPFPHRAGNLYKIHYAVSWEEEDASTSQKHINFMRRLYKYMEPYVSKSPRA  470

Query  377   AYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             AY+NYRDLDLG N  G  TS+++AS W  KYFK NF RL+ VK+ VDP NFF HEQS+P 
Sbjct  471   AYMNYRDLDLGSNNEGNYTSYTQASRWALKYFKNNFNRLIHVKSMVDPQNFFRHEQSVPT  530

Query  197   L  195
             L
Sbjct  531   L  531



>ref|XP_002299045.1| hypothetical protein POPTR_0001s46910g [Populus trichocarpa]
 gb|EEE83850.1| hypothetical protein POPTR_0001s46910g [Populus trichocarpa]
Length=533

 Score =   496 bits (1277),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 280/536 (52%), Positives = 380/536 (71%), Gaps = 19/536 (4%)
 Frame = -2

Query  1784  PIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQS  1605
             P +L +L +F     W +S   +  F KC+SLH     P + +    T   SS++S+LQ 
Sbjct  10    PFLLCLLISF----SWVISAHPREDFLKCLSLHFED--PAAMSNAIHTPYNSSYSSILQF  63

Query  1604  TVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDME  1425
             +++NL F   S  KPL+I TP   SH+QAA++C++   +Q+R+RSGGHDFEGLSY + + 
Sbjct  64    SIRNLRF-NSSELKPLVIVTPTNASHIQAAILCSQRHNLQIRIRSGGHDFEGLSYMAAL-  121

Query  1424  SPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgig  1245
                PFV+IDL  LR + VD    + WVQAGAT GE+YY ++EKS+ L FPAG+C ++G+G
Sbjct  122   ---PFVIIDLISLRAVNVDATSRTAWVQAGATLGELYYSISEKSRTLAFPAGSCPTIGVG  178

Query  1244  ghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILL  1065
             GH +GG +G M+RK+GLA+DN +DA ++D+ GR+LDRA+MGEDLFWAIRGGGG SFG+++
Sbjct  179   GHFSGGGHGTMVRKFGLASDNVIDAHLIDSKGRILDRASMGEDLFWAIRGGGGQSFGVVV  238

Query  1064  AWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKG  885
             AWKI LV VP+TVT+F+V RTLEQNATKLL++WQ VA+ L EDL++ V +T VNS+  +G
Sbjct  239   AWKISLVEVPSTVTMFSVSRTLEQNATKLLHRWQYVANTLPEDLVIDVQVTRVNSSQ-EG  297

Query  884   KRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEF  705
               T+Q  F ++FLG+ D+LL +M  SFPELGL   DC EMSWIESV Y   +      + 
Sbjct  298   NTTIQATFFSLFLGEVDQLLPVMQESFPELGLVKDDCFEMSWIESVFYTGGFTSNASLDV  357

Query  704   LLHGKPL-FPKTFFKAKSEFLRTPVPESGLRGLWKIFLKED--TPVMVWNPYGGMMAKIP  534
             LL+  P   P+  FKAKS++++ P+PE    G+W+ F +ED   P ++  PYGG M +I 
Sbjct  358   LLNRTPRSIPR--FKAKSDYVKEPMPEIAFEGIWERFFEEDIEAPTLILIPYGGKMDEIS  415

Query  533   ESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYR  360
             ES+TPFPHR G +  +V   SW+ E ++  ++H+ WIRR+Y Y+  YVSK+PREAYVNYR
Sbjct  416   ESSTPFPHRAGNLYVLVSSVSWREESKEASRRHMAWIRRLYSYLTKYVSKNPREAYVNYR  475

Query  359   DLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             DLDLG+N     TS+ +AS+WG KYFK NF+RLV VKT VDP NFF +EQSIP LS
Sbjct  476   DLDLGINNLTGTTSYKQASIWGRKYFKNNFDRLVRVKTEVDPTNFFRNEQSIPSLS  531



>ref|XP_006356501.1| PREDICTED: cannabidiolic acid synthase-like [Solanum tuberosum]
Length=538

 Score =   496 bits (1276),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 283/542 (52%), Positives = 386/542 (71%), Gaps = 21/542 (4%)
 Frame = -2

Query  1796  SWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnS  1617
             SW S I + ++   L+ + W+       +F +C+S  + TS          T N SSF S
Sbjct  4     SWFSFIFVLVV---LSSASWSALADNHEEFIQCLSHSNQTS------SNIYTPNNSSFPS  54

Query  1616  VLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYT  1437
             +LQ ++QNL F     PKPL+I TP++ES VQ  ++C+K+ G+ +RVR  GHD+EGLSY 
Sbjct  55    ILQFSIQNLRFNTTETPKPLVIVTPVSESEVQRVILCSKKTGMHVRVRGAGHDYEGLSYV  114

Query  1436  SDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVS  1257
             S++    PFV++DL  LR I VDV D S WV+AG+T GE+YYR+AEKSK LGFPAG C +
Sbjct  115   SEV----PFVIVDLINLRTINVDVNDKSAWVEAGSTIGELYYRIAEKSKTLGFPAGVCPT  170

Query  1256  LgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSF  1077
             +G+GGH +GG YG MLRKYGLAADN +DAR++DA GR+LDR +MGEDLFWAIRGGGG +F
Sbjct  171   VGVGGHFSGGGYGVMLRKYGLAADNIVDARLIDANGRILDRVSMGEDLFWAIRGGGGNTF  230

Query  1076  GILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNST  897
             G++LAWKIKLV VP  VTVFT+ +TLEQNATKL+++WQ VA +  EDL +++L++ +NS+
Sbjct  231   GLVLAWKIKLVDVPEIVTVFTLDKTLEQNATKLVHRWQYVAPRFHEDLFIRILVSKLNSS  290

Query  896   AV---KGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYP  726
                    ++T+  +F+++FLG  DRLL IM  +FPELGL  +DC+EMSWIES++Y A +P
Sbjct  291   NQGDGNNQQTIVASFNSIFLGGIDRLLPIMKENFPELGLRREDCIEMSWIESIMYFAGFP  350

Query  725   RTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKED--TPVMVWNPYGG  552
                P + LL    L  + +FKAKS+++  P+PE GL G+W+ F +++  +  ++ +PYGG
Sbjct  351   TDGPLDVLLSRVQLSTR-YFKAKSDYVYQPIPEGGLEGIWRFFFEDEAQSSQVILSPYGG  409

Query  551   MMAKIPESATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPRE  378
              M +I  SA PFPHR G + KI +L  W  EGE+  ++H+ WIRR+Y YM  +VSK PR 
Sbjct  410   RMDEISPSAIPFPHRAGNLYKIQHLVYWDEEGEEVAERHISWIRRLYSYMAPFVSKLPRA  469

Query  377   AYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPV  198
             AY+NYRDLD+G+N     TS+ +A VWG KYFK NF+RLV VKT+VDP NFF +EQSIP 
Sbjct  470   AYINYRDLDIGVNNIKGYTSYVQAKVWGIKYFKNNFDRLVHVKTKVDPSNFFRNEQSIPS  529

Query  197   LS  192
             L+
Sbjct  530   LT  531



>ref|XP_010261632.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Nelumbo 
nucifera]
Length=529

 Score =   495 bits (1275),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 268/519 (52%), Positives = 371/519 (71%), Gaps = 13/519 (3%)
 Frame = -2

Query  1742  PWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPK  1563
             PW  S S++  F +C+SLHS  S P S   +S   ++     + +S++QNL FL    PK
Sbjct  20    PWVTSTSVEESFLQCLSLHSDPSSPISAVVYSPNNSSYLS--IYRSSIQNLRFLQSDTPK  77

Query  1562  PLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLR  1383
             PL I TPL ESHVQ AV+C KE G+++R R GGHD+EG SY +++    PFV++D++ L+
Sbjct  78    PLFIITPLNESHVQTAVICAKENGLEIRTRGGGHDYEGRSYVAEV----PFVIVDMSNLK  133

Query  1382  GIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRK  1203
              I VD+E+NS WVQAGAT GE+YYR+AEKS   GFP G C ++G+ G ++GG YG MLRK
Sbjct  134   TITVDIENNSAWVQAGATLGELYYRIAEKSNVHGFPGGVCHTVGVSGFLSGGGYGYMLRK  193

Query  1202  YGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvt  1023
             YGL AD+ +DA +V+A G++L+R  MGEDLFWAIRGGG  SFGI+L WK+ LVPVP  VT
Sbjct  194   YGLGADHVIDAHMVNANGKILNRETMGEDLFWAIRGGGAASFGIILWWKVNLVPVPPVVT  253

Query  1022  vftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLG  843
             VF   +T+E+  TKL+++WQ + DK+DEDL ++  +   N+++  G +T++ +F +++LG
Sbjct  254   VFNPSKTIEEGGTKLVHRWQYIVDKVDEDLFMRANLELTNTSS--GGKTIKVSFSSLYLG  311

Query  842   KTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFK  663
               D+LL +MN SFPELGL  +DC EMSWI+++     +P  T    +L  + L  K  +K
Sbjct  312   TIDKLLPLMNKSFPELGLQREDCTEMSWIDAIKNIGGFPNNTID--VLLNRTLQDKRTYK  369

Query  662   AKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIV  483
              KS++++ P+PE    G+WK FL+ + PVM   PYGG M++I ESA PFPHRKG I KI 
Sbjct  370   VKSDYVKEPIPEFVFEGIWKRFLQIEIPVMRLTPYGGRMSEISESAIPFPHRKGNIFKIQ  429

Query  482   YLTSWKIEG--EKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSE  309
             Y+ +W+  G  E K+H++WIR+++ YM  YVSKSPREAY+NYRDLD+G N  G NTS+S+
Sbjct  430   YIVNWRQNGTQEIKRHINWIRKLHKYMTPYVSKSPREAYLNYRDLDIGTNNKG-NTSYSQ  488

Query  308   ASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             AS+WG KYFK NF+RLV VK++VDP NFF +EQSIP ++
Sbjct  489   ASIWGRKYFKNNFDRLVYVKSKVDPGNFFRNEQSIPAVT  527



>ref|XP_008445632.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Cucumis 
melo]
Length=556

 Score =   496 bits (1277),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 278/513 (54%), Positives = 364/513 (71%), Gaps = 7/513 (1%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S S+Q  F +C +  S++      +    T  ++SF+S+ + +++NL FL  + PKPL +
Sbjct  26    SDSLQDNFLECFNSTSYSKHSIPVSEVVFTNESASFSSLFRLSIRNLRFLTTTLPKPLFL  85

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
              TP  ESHVQAA+VC +E G+Q+RVRSGGHD+EGLSY S   S APF+VIDL  LR I +
Sbjct  86    VTPFHESHVQAAIVCAREKGLQVRVRSGGHDYEGLSYVS---SQAPFIVIDLINLRSITI  142

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D+ED +  V  GA  GE+YYR+A+KS   GFPAG+C ++G+GGHI+GG +G + RKYGLA
Sbjct  143   DIEDETASVGTGAALGELYYRIAKKSSIHGFPAGSCPTVGVGGHISGGGFGTLFRKYGLA  202

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DA+I+D  GR++DR++MGEDLFWAIRGGGG SFG++L+WK+KLV VP+ VTVF V
Sbjct  203   ADNVIDAKIIDFNGRIMDRSSMGEDLFWAIRGGGGASFGVILSWKLKLVSVPSIVTVFNV  262

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              RTLEQ AT L  KWQ ++ KLD+D+ L V    V  T    K+T++ +F ++FLG  +R
Sbjct  263   QRTLEQGATHLFQKWQNISHKLDQDIFLHVTTKVV--TDFPSKKTIRLSFTSLFLGPIER  320

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLH-GKPLFPKTFFKAKS  654
             L+ IM   F ELGL   DC+EMSWI+SV++ A +   TP E L+    P     FF AKS
Sbjct  321   LIPIMKTRFSELGLKRSDCIEMSWIQSVLFFADFSIDTPLEVLMERSSPQISDAFFTAKS  380

Query  653   EFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLT  474
             +++ +P+ + GL GLWK  L+E+   ++  PYGG M++I ES TPFPHR+G I  I YL 
Sbjct  381   DYVISPISQKGLEGLWKKLLEEEKSELILTPYGGKMSQISESQTPFPHREGRIFGIQYLA  440

Query  473   SWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWG  294
             +W    E +KHL WIR +Y YM  YVSKSPR AY+NYRDLDLG N  GRNTS+ EA VWG
Sbjct  441   TWDNANETEKHLSWIREVYAYMKPYVSKSPRAAYLNYRDLDLGRNY-GRNTSYEEAKVWG  499

Query  293   YKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              KYF  NFERLV VKT+VDP NFFW+EQSIP+L
Sbjct  500   LKYFSDNFERLVRVKTKVDPSNFFWNEQSIPLL  532



>ref|XP_006377944.1| hypothetical protein POPTR_0011s16550g [Populus trichocarpa]
 gb|ERP55741.1| hypothetical protein POPTR_0011s16550g [Populus trichocarpa]
Length=524

 Score =   494 bits (1273),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 287/535 (54%), Positives = 380/535 (71%), Gaps = 19/535 (4%)
 Frame = -2

Query  1784  PIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQS  1605
             P++  +LF+F     W  S      F +C SL+   S     +    T N SS+ SVL  
Sbjct  3     PLLFVLLFSF----SWVTSAHTHEDFIECFSLYVEDS--TDISKVIYTQNDSSYPSVLHF  56

Query  1604  TVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDME  1425
              ++NL F   +  KPL+I TP   SH+QAA+ C+++  +Q+R+RSGGHDFEGLSY S + 
Sbjct  57    AIRNLRF-NSTTLKPLVIVTPTNVSHIQAAIRCSQKNNLQIRIRSGGHDFEGLSYMSVL-  114

Query  1424  SPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgig  1245
                PFV++DL   R + +DV + + WVQAGAT GE+YY +A+K + L FPAG C ++G+G
Sbjct  115   ---PFVILDLINFRSVTIDVTNKTAWVQAGATVGELYYHIAKKGRTLAFPAGICPTMGVG  171

Query  1244  ghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILL  1065
             GH++GG YGA+LRKYGLAADN +DA ++DA GRVLDR +MGEDLFWA+RGGGG SFG+++
Sbjct  172   GHLSGGGYGALLRKYGLAADNVIDAELIDANGRVLDRISMGEDLFWALRGGGGNSFGVVI  231

Query  1064  AWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKG  885
             AWKIKLV VP T+TVF V RTLEQNAT+L+++WQ +A+KL EDL++   I  VNS+  +G
Sbjct  232   AWKIKLVEVPPTLTVFNVLRTLEQNATQLIHRWQYIANKLHEDLMITTYIRRVNSS--QG  289

Query  884   KRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEF  705
               T+Q  F   FLG  D+LL++MN SFPELGL   DCLE SWIE++I N  +P  T  E 
Sbjct  290   NPTIQATFAGFFLGGVDKLLQLMNESFPELGLAKDDCLETSWIEAIILNR-FPGNTSLEL  348

Query  704   LLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKED--TPVMVWNPYGGMMAKIPE  531
             LL   P F  T +KAKS++++ P+PE  L G+++ FL+ED  TP ++  PYGG M +I E
Sbjct  349   LLDRTPRF-VTNYKAKSDYVKEPMPEIALEGIFERFLEEDIETPRLLLVPYGGKMDQISE  407

Query  530   SATPFPHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRD  357
             S++PFPHR G I KI +  SW  EG++  K+H+DWIRR+Y YM  YVSK+PREAY+NYRD
Sbjct  408   SSSPFPHRAGNIYKIEHQVSWSEEGKEASKRHVDWIRRLYSYMTPYVSKNPREAYINYRD  467

Query  356   LDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             LD+GMN    NTS+ +AS+WG KYFK NF++LV VKT VDP NFF +EQSIP LS
Sbjct  468   LDIGMNSLAGNTSYEQASIWGRKYFKNNFDKLVRVKTAVDPANFFRNEQSIPPLS  522



>ref|XP_007010661.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY19471.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=576

 Score =   496 bits (1277),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 293/552 (53%), Positives = 392/552 (71%), Gaps = 23/552 (4%)
 Frame = -2

Query  1835  LKKMQSSLHIAMASWSSPIILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfsta  1656
             L KM+S+ +   A      + +ILF+F     W  S     +F  C+SL S+ S   S +
Sbjct  42    LHKMKSAHYSTFA-----FLFAILFSF----SWETSAQSPEKFLHCLSLRSNDS--SSIS  90

Query  1655  ffstttnassfnSVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRV  1476
                 + N  S++S+L+S++QNL F     PKPL+I TPL  SH+QA + C+KE G+Q+R 
Sbjct  91    KVIYSQNNYSYSSILESSIQNLRFSTIDIPKPLVIVTPLHASHIQATIQCSKELGLQIRS  150

Query  1475  RSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEK  1296
             RSGGHDFEGLSY S++    PFV+IDL  LR I V+VE+   WV+AGAT GE+Y+R+AEK
Sbjct  151   RSGGHDFEGLSYVSEV----PFVLIDLVNLRSIDVNVENGVAWVEAGATIGELYFRIAEK  206

Query  1295  SKNLGFPAGNCVSLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGED  1116
             S+ L FPAG C ++G+GGH +GG YG + RKYGLAADN +DA+++DA GR+LDR +MGED
Sbjct  207   SRTLAFPAGICHTVGVGGHFSGGGYGGLFRKYGLAADNIIDAQLIDANGRILDRQSMGED  266

Query  1115  LFWAIRggggGSFGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadklded  936
             LFWAIRGGGGGS+GI+LAWK+KLVPVPATVTVF++ +TLEQNAT+L+++WQ VA KL +D
Sbjct  267   LFWAIRGGGGGSYGIVLAWKLKLVPVPATVTVFSITKTLEQNATELIHRWQDVAHKLPDD  326

Query  935   lllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWI  756
             + L V IT VNS   +GK T+Q AF A+FLG  D L+ +M   FPELG+  +DC+EMSWI
Sbjct  327   IFLIVTITRVNS-GQEGKDTIQAAFTALFLGGVDNLISLMEIRFPELGVVKQDCIEMSWI  385

Query  755   ESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTP-  579
             +S++Y   +P    PE LL  +    KT FK KS++++ P+P+    G+W+ F +E+   
Sbjct  386   QSLLYLDQFP-IERPEILL-DRTAVNKTLFKVKSDYVKEPIPKIVFEGMWQKFYEEEGKY  443

Query  578   -VMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLTSWKIEG--EKKKHLDWIRRMYDYM  408
              ++   PYGG M +IPE+ TPFPHR G + KI+Y      E   E +K+++WIRR+Y +M
Sbjct  444   GIIFLIPYGGRMDEIPETETPFPHRAGNMYKIIYYVGRAQEENLEFQKYINWIRRIYRHM  503

Query  407   GTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDN  228
               YVSKSPREAY NYRDLD+G+N  G NTS+++AS WG+KYFK NF +LV VKT VDP N
Sbjct  504   TPYVSKSPREAYANYRDLDIGVNNKG-NTSYAQASTWGFKYFKNNFNKLVRVKTLVDPKN  562

Query  227   FFWHEQSIPVLS  192
             FF HEQSIP +S
Sbjct  563   FFRHEQSIPPVS  574



>ref|XP_004135724.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
 ref|XP_004158099.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus]
Length=555

 Score =   495 bits (1274),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 275/513 (54%), Positives = 368/513 (72%), Gaps = 7/513 (1%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S S+Q  F +C +  S++      +    T  ++SF+S+L+ +++NL FL  + PKPLL+
Sbjct  25    SDSLQDNFLECFNSTSYSKHSIPISEVVFTNESASFSSLLRLSIRNLRFLTTTLPKPLLL  84

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
              TP  ESHVQAA++C +E G+Q+RVRSGGHD+EGLSY S   S APF+VIDL  LR IK+
Sbjct  85    VTPFHESHVQAAILCAREKGLQVRVRSGGHDYEGLSYIS---SQAPFIVIDLINLRSIKI  141

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             D++  +  V+ GA+ GE+YYR+A+KS   GFPAG+C ++G+GGHI+GG +G + RKYGLA
Sbjct  142   DIKTETASVETGASLGELYYRIAKKSSIHGFPAGSCPTVGVGGHISGGGFGTLFRKYGLA  201

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DA+I+D  GR++DR++MGEDLFWAIRGGGG SFG++L+WK+KLV VP+ VTVF V
Sbjct  202   ADNVIDAKIIDFNGRIMDRSSMGEDLFWAIRGGGGASFGVILSWKLKLVSVPSIVTVFNV  261

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              RTLE+ AT L  KWQ ++ KLD+D+ L V    V  T    K+T++ +F ++FLG  +R
Sbjct  262   QRTLEEGATHLFQKWQNISHKLDQDIFLHVTTKVV--TNFPSKKTIRLSFTSLFLGPIER  319

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLL-HGKPLFPKTFFKAKS  654
             L+ IM   F ELGL   DC+EMSWI+SV++ A +    P E L+    P     FF AKS
Sbjct  320   LIPIMKTRFSELGLKRNDCIEMSWIQSVLFFADFSIDAPLEVLMDRSSPQISDAFFTAKS  379

Query  653   EFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYLT  474
             +++ +P+ E+GL GLW   L+ED   +++ PYGG M++I ES  PFPHR+G I  I YL 
Sbjct  380   DYVTSPISENGLEGLWSKLLEEDKSELIFTPYGGKMSQISESQIPFPHREGRIFGIQYLA  439

Query  473   SWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEASVWG  294
             +W    E +KHL WIR +Y YM +YVSKSPR AY+NYRDLDLG N  GRNTS+ EA VWG
Sbjct  440   TWDNANENEKHLSWIREVYAYMESYVSKSPRAAYLNYRDLDLGTNY-GRNTSYEEAKVWG  498

Query  293   YKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              KYF  NF+RLV VKT+VDP NFFW+EQSIP+L
Sbjct  499   LKYFSDNFKRLVRVKTKVDPSNFFWNEQSIPLL  531



>ref|XP_011037721.1| PREDICTED: cannabidiolic acid synthase-like 1 [Populus euphratica]
Length=536

 Score =   494 bits (1272),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 284/517 (55%), Positives = 375/517 (73%), Gaps = 12/517 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S      F +C+SL+S  S   S +    T N SS+  VLQ ++QN  F   + PKPL+I
Sbjct  26    SAHTHEDFLQCLSLYSEDS--NSFSKLVHTPNNSSYLHVLQGSIQNSRFNTTATPKPLVI  83

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
              TP+  SH+QA + C+++ G+ +R+RSGGHD+EGLSY S +    PFV+IDL  LR I V
Sbjct  84    VTPMNVSHIQATIFCSQKHGMNVRIRSGGHDYEGLSYVSVL----PFVIIDLINLRAINV  139

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             DVE+++ WVQAGAT GE+YY +AEKS  L FPAG C ++G GGH++GG YG ++RKYGLA
Sbjct  140   DVENSTAWVQAGATLGELYYSIAEKSGTLAFPAGACPTIGAGGHLSGGGYGGLMRKYGLA  199

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DA+++DA GR+LDRA+MGEDLFWAIRGGGG +FG+++AWK+KLVPVP TVT F+V
Sbjct  200   ADNIIDAQLIDAKGRILDRASMGEDLFWAIRGGGGNTFGVVVAWKLKLVPVPHTVTNFSV  259

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              R+LE+NATKL+++WQ VA+KL EDL +   IT +NS+  +G  T+Q  F ++FLG  DR
Sbjct  260   LRSLEENATKLIHRWQYVANKLPEDLFITAYITKINSSE-EGISTIQAEFPSLFLGGADR  318

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL +M  +FPELGL   DC EMSW+E V+YN+ Y   +  + LL+  P +  T FKAKS+
Sbjct  319   LLPLMQENFPELGLVKDDCTEMSWVEFVLYNSGYSSNSSLDVLLNRTPQY-ITNFKAKSD  377

Query  650   FLRTPVPESGLRGLWKIFLKE--DTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYL  477
             +++ P+PE    G+WK FLKE  +TP +V  PYGG M +I ES+ PF HR G + KI YL
Sbjct  378   YVKKPIPEIAFDGIWKRFLKEGIETPRLVLVPYGGKMDQISESSIPFAHRAGNLYKIQYL  437

Query  476   TSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEAS  303
               W  +G++   +H+ WIRR+Y Y   YVSK+PREAY+NYRDLD+GMN    NTSF +AS
Sbjct  438   VLWNEQGKEASMRHIAWIRRLYSYTTPYVSKNPREAYINYRDLDIGMNNLAGNTSFKQAS  497

Query  302   VWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             +WG KYFK NF+RL+ VKT VDPDNFF +EQSIP LS
Sbjct  498   IWGRKYFKNNFDRLIQVKTAVDPDNFFRNEQSIPPLS  534



>ref|XP_011037734.1| PREDICTED: cannabidiolic acid synthase-like 1 [Populus euphratica]
Length=536

 Score =   494 bits (1272),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 284/517 (55%), Positives = 375/517 (73%), Gaps = 12/517 (2%)
 Frame = -2

Query  1730  SLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKPLLI  1551
             S      F +C+SL+S  S   S +    T N SS+  VLQ ++QN  F   + PKPL+I
Sbjct  26    SAHTHEDFLQCLSLYSEDS--NSFSKLVHTPNNSSYLHVLQGSIQNSRFNTTATPKPLVI  83

Query  1550  FTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRGIKV  1371
              TP+  SH+QA + C+++ G+ +R+RSGGHD+EGLSY S +    PFV+IDL  LR I V
Sbjct  84    VTPMNVSHIQATIFCSQKHGMNVRIRSGGHDYEGLSYVSVL----PFVIIDLINLRAINV  139

Query  1370  DVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKYGLA  1191
             DVE+++ WVQAGAT GE+YY +AEKS  L FPAG C ++G GGH++GG YG ++RKYGLA
Sbjct  140   DVENSTAWVQAGATLGELYYSIAEKSGTLAFPAGACPTIGAGGHLSGGGYGGLMRKYGLA  199

Query  1190  ADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtvftv  1011
             ADN +DA+++DA GR+LDRA+MGEDLFWAIRGGGG +FG+++AWK+KLVPVP TVT F+V
Sbjct  200   ADNIIDAQLIDAKGRILDRASMGEDLFWAIRGGGGNTFGVVVAWKLKLVPVPHTVTNFSV  259

Query  1010  PRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGKTDR  831
              R+LE+NATKL+++WQ VA+KL EDL +   IT +NS+  +G  T+Q  F ++FLG  DR
Sbjct  260   LRSLEENATKLIHRWQYVANKLPEDLFITAYITKINSSE-EGISTIQAEFPSLFLGGADR  318

Query  830   LLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKAKSE  651
             LL +M  +FPELGL   DC EMSW+E V+YN+ Y   +  + LL+  P +  T FKAKS+
Sbjct  319   LLPLMQENFPELGLVKDDCTEMSWVEFVLYNSGYSSNSSLDVLLNRTPQY-ITNFKAKSD  377

Query  650   FLRTPVPESGLRGLWKIFLKE--DTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVYL  477
             +++ P+PE    G+WK FLKE  +TP +V  PYGG M +I ES+ PF HR G + KI YL
Sbjct  378   YVKKPIPEIAFDGIWKRFLKEGIETPRLVLVPYGGKMDQISESSIPFAHRAGNLYKIQYL  437

Query  476   TSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEAS  303
               W  +G++   +H+ WIRR+Y Y   YVSK+PREAY+NYRDLD+GMN    NTSF +AS
Sbjct  438   VLWNEQGKEASMRHIAWIRRLYSYTTPYVSKNPREAYINYRDLDIGMNNLAGNTSFKQAS  497

Query  302   VWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             +WG KYFK NF+RL+ VKT VDPDNFF +EQSIP LS
Sbjct  498   IWGRKYFKNNFDRLIQVKTAVDPDNFFRNEQSIPPLS  534



>ref|XP_007045724.1| FAD-binding Berberine family protein [Theobroma cacao]
 gb|EOY01556.1| FAD-binding Berberine family protein [Theobroma cacao]
Length=542

 Score =   494 bits (1272),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 288/539 (53%), Positives = 382/539 (71%), Gaps = 17/539 (3%)
 Frame = -2

Query  1796  SWSSPIILSILFTFLTFSPWAVSLSIQHQ-FYKCVSLHSHTSIPfstaffstttnassfn  1620
             S+S  +++S+L +F     W  +L   H+ F +C+ LHS  ++    +    T N SSF 
Sbjct  13    SFSMSLLVSVLLSF-----WWATLGQTHEGFLQCLLLHSDDNV-APISNAIYTQNNSSFA  66

Query  1619  SVLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSY  1440
             SVL     NL F  P+ PKPL+I  P   SH+QA V C+++ G+Q+RVRSGGHD EGLSY
Sbjct  67    SVLDFPYGNLRFSTPTTPKPLVIVKPTHVSHIQATVNCSRKHGLQVRVRSGGHDHEGLSY  126

Query  1439  TSDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCV  1260
              +       FVVIDL  LR I VDV   + W+QAGAT GE+YYR+AE S  L FPAG C 
Sbjct  127   VAQ----DSFVVIDLIDLRSINVDVGSKTAWIQAGATIGELYYRIAEISTTLAFPAGVCP  182

Query  1259  SLgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGS  1080
             ++G+GGH +GG YG ++RK+G+AAD+ +DA +VD  GR+LDR +MGEDLFWAIRGGGG S
Sbjct  183   TVGVGGHFSGGGYGMLMRKFGIAADHIIDAHLVDVDGRILDRKSMGEDLFWAIRGGGGAS  242

Query  1079  FGILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNS  900
             FG+++AWK++LV VP  VTVFT+ + LE+NATKL+++WQ  A K  EDL L++  T VNS
Sbjct  243   FGVVVAWKVELVSVPPVVTVFTINKVLEENATKLVHRWQYAAPKSPEDLFLRIFFTDVNS  302

Query  899   TAVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRT  720
             T  +GKRT+Q +F ++FLG+TD+L+K+M  +FPEL L  +DC EM+WIES+IY A  P +
Sbjct  303   TQ-EGKRTIQASFVSMFLGRTDQLVKLMQENFPELRLVKEDCHEMNWIESIIYFAEIPNS  361

Query  719   TPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKED--TPVMVWNPYGGMM  546
             +P + LL  + L+P+TFFKAKS++++ P+PE+ L GLW+ F +E   T  ++++PY G M
Sbjct  362   SPLDALL-DRNLYPETFFKAKSDYVKEPIPETALEGLWQRFYEEKPGTVELIFSPYEGKM  420

Query  545   AKIPESATPFPHRKGVICKIVYLTSWKIEGE--KKKHLDWIRRMYDYMGTYVSKSPREAY  372
              +IPES TPFPHR G + KI Y   W+ +     +KHLDW+RR+Y YM  YVSKSPREAY
Sbjct  421   DEIPESETPFPHRAGNLYKIYYEVLWEEKDNLAPQKHLDWMRRLYSYMAPYVSKSPREAY  480

Query  371   VNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             VNYRDLDLG N  G  TS+ +AS WG +YFK NF RLV VKT VDP NFF +EQSIP L
Sbjct  481   VNYRDLDLGTNNKGNYTSYRQASKWGVRYFKDNFNRLVRVKTMVDPHNFFRNEQSIPPL  539



>ref|XP_010494453.1| PREDICTED: cannabidiolic acid synthase-like 2 [Camelina sativa]
Length=546

 Score =   494 bits (1271),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 302/524 (58%), Positives = 382/524 (73%), Gaps = 12/524 (2%)
 Frame = -2

Query  1757  FLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLV  1578
             + T +P + S S+Q  F +C+  +++   P    FF++  NAS F  V +S  QN  FL 
Sbjct  24    YATITPTS-SASVQDGFIECLQRNTNVGFPIERTFFTSERNASIFIEVFESRAQNQRFLT  82

Query  1577  PSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVID  1398
              S PKP  IF P+ ESHVQA+++ +K+ G+   VRSGGHD+EG+SY S +E+P  F++ID
Sbjct  83    NSMPKPGFIFKPVHESHVQASIIYSKKLGIHFLVRSGGHDYEGVSYVSQIETP--FILID  140

Query  1397  LAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggayg  1218
             L+KLR I VD+E+NS WVQ+GAT GE+YYR+AEKSK  GFPAG   SLGIGGHITGGAYG
Sbjct  141   LSKLRQINVDIENNSAWVQSGATIGELYYRIAEKSKIHGFPAGVFPSLGIGGHITGGAYG  200

Query  1217  AMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpv  1038
             +++RKYGLAADN LDA+IVD  G++LDRAAMGEDLFW+IRGG GGSFGI+L+WKIKLVPV
Sbjct  201   SLMRKYGLAADNVLDAKIVDVNGKLLDRAAMGEDLFWSIRGGSGGSFGIILSWKIKLVPV  260

Query  1037  patvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAF  861
             P T+TVFTV +TLEQ+A+ K+L KWQ+VADKL E+L L+V  + V +    G +TV  A+
Sbjct  261   PKTLTVFTVTKTLEQDASFKILSKWQRVADKLVEELFLRVFFSVVGNN---GNKTVTMAY  317

Query  860   DAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP--EFLLHGKP  687
                FLGK   LL++M   FPELGLT  DC+EMSWI+S+IYN+ +P + PP  E LL  K 
Sbjct  318   IGQFLGKKGTLLEVMKKGFPELGLTQMDCIEMSWIKSIIYNSGFPTSPPPPVEILLQAKS  377

Query  686   LFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHR  507
                K +FKAKS+F + P+P  GL+G+ K  L+ED  +++W PYGGMM KIPES  PFPHR
Sbjct  378   PIGKVYFKAKSDFAKEPIPIVGLKGMMKKLLEEDAALVIWTPYGGMMDKIPESEIPFPHR  437

Query  506   KGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKN  333
             KG I  I Y  SW  + EK+  + + WIR MY YM  YVS +PR+AYVNYRDLDLG NKN
Sbjct  438   KGTIFMIQYYRSWS-DSEKRPNRRIKWIREMYSYMTPYVSSNPRQAYVNYRDLDLGQNKN  496

Query  332   GRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
                 +F EA  WG  YFK NF RLV +KT+VDP+NFF HEQSIP
Sbjct  497   NSKVNFIEAKPWGANYFKDNFNRLVRIKTKVDPENFFRHEQSIP  540



>ref|XP_010053026.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Eucalyptus 
grandis]
Length=528

 Score =   493 bits (1268),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 279/526 (53%), Positives = 376/526 (71%), Gaps = 9/526 (2%)
 Frame = -2

Query  1769  ILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNL  1590
             I   FL+F   A S   Q  F +C SLH   S   ST+   TT    ++ S+LQS++QNL
Sbjct  8     ISIIFLSFCYVASSFD-QVSFLQCFSLHPLQS--NSTSKSITTRKDPTYISLLQSSIQNL  64

Query  1589  VFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPF  1410
              FL  S+P P LI TP+  S +QAA+VC+++ GV +RVRSGGHD+EGLSY S M    PF
Sbjct  65    RFLNTSSPSPQLIVTPVNPSQIQAAIVCSQKLGVHVRVRSGGHDYEGLSYVSQM----PF  120

Query  1409  VVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitg  1230
             ++IDL  +R ++VDVE  S WV+ GAT GE+YY +++KSK LGFPAG+C ++G+GG ++G
Sbjct  121   IIIDLRNMRSVEVDVEKESAWVETGATLGELYYAISQKSKVLGFPAGSCPTVGVGGQVSG  180

Query  1229  gaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIK  1050
             G +G + RKYGLAADN +DA+IVD  G+VLDR AMGEDLFWAIRGGGG SFG++ AWK  
Sbjct  181   GGFGTIFRKYGLAADNVIDAKIVDVNGKVLDRKAMGEDLFWAIRGGGGASFGVIFAWKFV  240

Query  1049  LvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQ  870
             LVPVP TVTVF V +T+E+NAT LLYKWQ VA KL EDL L  +   V S++    +T+ 
Sbjct  241   LVPVPPTVTVFEVGKTIEENATMLLYKWQNVAYKLHEDLFLHAVTGVVTSSSSLANKTIS  300

Query  869   TAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGK  690
              +F  ++LGK ++LL  +  SFPELGLT + C EMSWI+SV+Y A + +   P+ LL+ +
Sbjct  301   ISFGGLYLGKIEKLLPSIQESFPELGLTRESCTEMSWIQSVLYFAGFSQDGSPKVLLN-R  359

Query  689   PLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPH  510
                 ++FFKAKS+++  P+ +S L+GLW   ++++T  ++  PYGG+M++I +SATPFPH
Sbjct  360   TQSSRSFFKAKSDYVMEPISQSALQGLWNKLIEDETSYLILTPYGGVMSQISDSATPFPH  419

Query  509   RKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNG  330
             R G + +I Y+ +W  E E  + ++W+R +YDYM  YVS+ PR AY+NYRDLDLG N   
Sbjct  420   RGGNMYQIQYMVTWDSEEENNQKINWMRELYDYMAPYVSRFPRAAYMNYRDLDLGRNYV-  478

Query  329   RNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
              NT++++ASVWG KYFK NF+RLV VKT  DP NFFW+EQS PVLS
Sbjct  479   INTTYAQASVWGLKYFKSNFKRLVKVKTASDPANFFWNEQSFPVLS  524



>ref|XP_002269462.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera]
Length=531

 Score =   493 bits (1268),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 275/517 (53%), Positives = 376/517 (73%), Gaps = 11/517 (2%)
 Frame = -2

Query  1739  WAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNLVFLVPSAPKP  1560
             WA S S+   F +C+S  S +S P S   ++   ++ S   VL+S ++NL F   +  KP
Sbjct  22    WAASDSVHGAFLQCLSTRSQSSHPISAVLYTPDNSSYSS--VLESYIRNLRFNTSATLKP  79

Query  1559  LLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPFVVIDLAKLRG  1380
              LI T   ESH++AA++C+K+ G+Q+++RSGGHD+EG+SY SD+    PF ++D+  LR 
Sbjct  80    RLIITATHESHIKAAIICSKKHGLQMKIRSGGHDYEGVSYVSDV----PFFILDMFNLRS  135

Query  1379  IKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitggaygAMLRKY  1200
             I VD+ED S WVQAGAT GE+YYR+AEKSK  GFPAG C ++G GGH +GG YG M+RKY
Sbjct  136   ISVDIEDESAWVQAGATLGEIYYRIAEKSKTHGFPAGVCPTVGAGGHFSGGGYGNMMRKY  195

Query  1199  GLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIKLvpvpatvtv  1020
             GL+ DN +DA +VD  GR+L+R +MGEDLFWAIRGGGG S+G+++++KIKLV VPATVTV
Sbjct  196   GLSVDNIVDAELVDVNGRLLNRKSMGEDLFWAIRGGGGASYGVIVSYKIKLVQVPATVTV  255

Query  1019  ftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQTAFDAVFLGK  840
             F V RTLEQN T ++Y+WQ+VADK+D+DL +++ +  VNS+   G++TV+  F ++FLG 
Sbjct  256   FRVARTLEQNTTNIVYQWQQVADKVDDDLFIRLTMDVVNSSR-SGEKTVRATFLSLFLGS  314

Query  839   TDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGKPLFPKTFFKA  660
             ++RLL IMN S PELGL   DC EMSW+ESV++   +   TP E LL   P    T  K 
Sbjct  315   SERLLSIMNTSLPELGLQSSDCTEMSWVESVLFWTNFAIGTPVEALLDRNPQV-LTHLKR  373

Query  659   KSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPHRKGVICKIVY  480
             KS++L+ P+P++GL G+WK  ++  TP + +NPYGG MA+I  SATPFPHR G +CKI Y
Sbjct  374   KSDYLKEPIPKAGLEGIWKKMIELQTPALTFNPYGGKMAEISPSATPFPHRAGNLCKIQY  433

Query  479   LTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNGRNTSFSEA  306
              T+W  EG +  +++++  R++Y YM  +VSK PREA++NYRDLDLG+N NG+N S+ E 
Sbjct  434   ATNWDEEGSEAAERYINLTRQLYSYMTPFVSKFPREAFLNYRDLDLGINHNGKN-SYLEG  492

Query  305   SVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
              V+G KYFK NF RLV +KT+VDP NFF +EQSIP L
Sbjct  493   RVYGIKYFKKNFNRLVRIKTKVDPGNFFRNEQSIPTL  529



>ref|XP_002317088.2| hypothetical protein POPTR_0011s16190g [Populus trichocarpa]
 gb|EEE97700.2| hypothetical protein POPTR_0011s16190g [Populus trichocarpa]
Length=538

 Score =   493 bits (1268),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 276/526 (52%), Positives = 368/526 (70%), Gaps = 10/526 (2%)
 Frame = -2

Query  1769  ILFTFLTFSPW-AVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQN  1593
             +L  FL  S W A S S Q +F +C S     S P S    +  ++  S   VL+S+++N
Sbjct  11    LLLIFLAPSVWPASSSSAQEKFLQCFSSRIQPSNPVSEVILTKNSSDYSS--VLRSSIRN  68

Query  1592  LVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAP  1413
               FL  +  KP  I TP  ESH+QAA+VC +E G+Q+RVRSGGHD+EGLS+ S  E    
Sbjct  69    YRFLNTTIVKPQFIITPFDESHIQAAIVCAREYGMQIRVRSGGHDYEGLSFESYQE----  124

Query  1412  FVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghit  1233
             FV++DLAKL  I VD+E+ + W+ AGA+ GE+YY++A+KSK  GFPAG+C ++G+GGH +
Sbjct  125   FVLVDLAKLSSIIVDIENETAWIGAGASIGELYYKIADKSKVHGFPAGSCPTVGVGGHFS  184

Query  1232  ggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKI  1053
             GG +G + RKYGLAADN +DA+IVDA GR+LDR +MGEDLFWAIRGGG  SFG++ +WK+
Sbjct  185   GGGFGTIFRKYGLAADNVIDAQIVDANGRILDRESMGEDLFWAIRGGGAASFGVIFSWKL  244

Query  1052  KLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTV  873
             +LV VP TVTVF + RTLEQ A+ LL KWQ + DK  EDL L   I    S+   G +T+
Sbjct  245   RLVSVPPTVTVFNIKRTLEQGASNLLQKWQSIGDKFHEDLFLHAAIEVATSSP-NGNKTI  303

Query  872   QTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHG  693
             + +F ++FLG+ + LL +M  SFPELGL  ++C EMSWI+S++Y   +      + LL  
Sbjct  304   RVSFVSLFLGRAEELLPVMQDSFPELGLMRENCSEMSWIQSILYFGGFSPRDSLDVLLSR  363

Query  692   KPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFP  513
                F K FFK KS++++ P+ E+GL GL++  L+E+  +++  PYGG M++I +S  PFP
Sbjct  364   TAQF-KGFFKGKSDYVKEPISETGLEGLYRRLLEEEASMLILTPYGGRMSEISDSEIPFP  422

Query  512   HRKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKN  333
             HR G I KI YL +W +E E ++HL W+RR+Y YM  YVS SPR AY+NYRDLDLG N N
Sbjct  423   HRSGNIFKIQYLITWDVEEETERHLKWMRRLYAYMAPYVSNSPRAAYLNYRDLDLGRNNN  482

Query  332   GRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             G NTSF++ASVWG KYFK NF+RLV VKT  DP NFF +EQSIPVL
Sbjct  483   G-NTSFAKASVWGLKYFKNNFKRLVQVKTATDPSNFFRNEQSIPVL  527



>ref|XP_003638113.1| Reticuline oxidase [Medicago truncatula]
 gb|KEH31321.1| reticuline oxidase-like protein [Medicago truncatula]
Length=543

 Score =   492 bits (1267),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 287/537 (53%), Positives = 385/537 (72%), Gaps = 22/537 (4%)
 Frame = -2

Query  1781  IILSILFTFLTFSPWAVSLS-IQHQFYKCVSLHSH--TSIPfstaffstttnassfnSVL  1611
             ++++I F+F +F   A+  S  +  F +C+  +SH  TSI    +    T   SS++S+L
Sbjct  11    VLIAIAFSFTSF---AIDTSPHEDNFLQCLYSYSHNITSI----SKVVYTKTNSSYSSIL  63

Query  1610  QSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSD  1431
             + ++QNL F     PKPL+I TP   SH+Q A++C++  G+Q+R+RSGGHDFEGLS+ S+
Sbjct  64    KFSIQNLRFATNETPKPLVIITPTQISHIQTAIICSQHHGMQIRIRSGGHDFEGLSFVSN  123

Query  1430  MESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLg  1251
             +    PFV+IDL   RGI VDVE+ + WVQ+GAT GE+YY++A+KSK LGFP G C ++G
Sbjct  124   V----PFVIIDLTNFRGIDVDVENRTAWVQSGATLGELYYKIAQKSKTLGFPGGVCPTVG  179

Query  1250  igghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGI  1071
             +GGH +GG YG +LRKYGLAADN +DA I+D  GR LDR AMGEDLFWAIRGGGG SFG+
Sbjct  180   VGGHFSGGGYGTLLRKYGLAADNVIDAHIIDVKGRFLDREAMGEDLFWAIRGGGGASFGV  239

Query  1070  LLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAV  891
             +++WKIKLV VP+TVTVFTVPRTLEQNATKL++KWQ VA KL+E+L + +++  ++  + 
Sbjct  240   IVSWKIKLVQVPSTVTVFTVPRTLEQNATKLVHKWQFVAHKLEENLAINIILQRLDLNSS  299

Query  890   KG---KRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRT  720
             K    K TV   F ++FLG  D LL +M   FPELGL  +DC+EMSWIESV+Y   +P  
Sbjct  300   KQGEPKSTVLALFQSLFLGSVDNLLPLMEEKFPELGLVREDCVEMSWIESVLYLFRFPEG  359

Query  719   TPPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKE--DTPVMVWNPYGGMM  546
              P E LL+ + L  K   KAKS+F++ P+PE+GL GLW +F ++  +  +MV  PYGG+M
Sbjct  360   EPLETLLN-RTLAAKDNSKAKSDFVKIPIPETGLEGLWPLFDEDGAEDVLMVLFPYGGIM  418

Query  545   AKIPESATPFPHRKGVICKIVYLTSWKIEGE--KKKHLDWIRRMYDYMGTYVSKSPREAY  372
              KI ES  PFPHR G + KI Y   W  EG+  +K H++WIR++Y YM  +VSKSPR AY
Sbjct  419   DKISESEIPFPHRYGTLYKIQYAVHWHQEGDEVEKLHINWIRKLYSYMEPFVSKSPRAAY  478

Query  371   VNYRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIP  201
             +NYRDLD+G+N     TS+ +AS+WG KYFK NF+RL  VKT+VDP NFF +EQSIP
Sbjct  479   INYRDLDIGVNNINGYTSYKQASIWGVKYFKNNFKRLAKVKTKVDPLNFFRNEQSIP  535



>gb|AAL24314.1| berberine bridge enzyme-like protein [Arabidopsis thaliana]
 gb|AAN15688.1| berberine bridge enzyme-like protein [Arabidopsis thaliana]
Length=542

 Score =   492 bits (1266),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 296/533 (56%), Positives = 379/533 (71%), Gaps = 12/533 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             + ++ F+F T +    S S+Q  F KC+  +++        FF+   NAS F  VL+ST 
Sbjct  15    VFALYFSFYTIT-LTSSTSLQDDFIKCLYRNTNVRFTLDKTFFTPERNASIFTEVLESTA  73

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QN  +L  + PKP  IF P+ ESHVQA+V+C+K+  +  RVRSGGHD+EG+SY S +E P
Sbjct  74    QNQRYLTKTMPKPGFIFKPVHESHVQASVICSKKLEIHFRVRSGGHDYEGVSYVSQIEKP  133

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               FV+IDL+KLR I VD++D S WV+AGAT GE+YYR+AEKSK  GFPAG   SLGIGGH
Sbjct  134   --FVLIDLSKLRQINVDIKDTSAWVEAGATVGELYYRIAEKSKFHGFPAGVYPSLGIGGH  191

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+++RKYGLAADN LDA+IVDA G++LDRA+MGEDLFWAIRGG GGSFGI+L+W
Sbjct  192   ITGGAYGSLMRKYGLAADNVLDAKIVDANGKLLDRASMGEDLFWAIRGGSGGSFGIILSW  251

Query  1058  KIKLvpvpatvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             KIKLVPVP T+TVFTV +T EQ+ + K+L KWQ++AD L ++L L+V  T    +  K  
Sbjct  252   KIKLVPVPETLTVFTVTKTFEQDRSFKILSKWQEIADNLVDELFLRVFFTV---SGNKAN  308

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP--E  708
             +TV  A+   FLG+   L+++M   FPELGLT KDC+EMSWI+S+IYN+ +P   PP  E
Sbjct  309   KTVTMAYIGQFLGEKGTLIEVMKKDFPELGLTQKDCIEMSWIDSIIYNSGFPTNPPPPIE  368

Query  707   FLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPES  528
              LL  K    K +FK KS+F + P+P  GL G++K  L+ED  +++W PYGG M KIPES
Sbjct  369   ILLQAKSPIGKVYFKGKSDFAKKPIPVLGLEGMFKKLLEEDAALVIWTPYGGKMDKIPES  428

Query  527   ATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDL  354
               PFPHR G    I Y  SW  + EK+  +   WIR +Y YM  YVS +PR+AYVNYRDL
Sbjct  429   EIPFPHRNGTNFMIQYYRSWS-DSEKRPNRRTKWIRELYGYMTPYVSSNPRQAYVNYRDL  487

Query  353   DLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             DLG NK+   ++F EA VWG  YFK NF RLV +K++VDPDNFF HEQSIP L
Sbjct  488   DLGQNKDNSKSNFIEAKVWGANYFKDNFNRLVRIKSKVDPDNFFRHEQSIPTL  540



>gb|KCW77268.1| hypothetical protein EUGRSUZ_D01625 [Eucalyptus grandis]
Length=528

 Score =   491 bits (1263),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 278/526 (53%), Positives = 375/526 (71%), Gaps = 9/526 (2%)
 Frame = -2

Query  1769  ILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNL  1590
             I   FL+F   A S   Q  F +C SLHS  S   ST+   TT    ++ S+LQS++QNL
Sbjct  8     ISIIFLSFCYVASSFD-QVSFLQCFSLHSFQS--NSTSKTITTRKDPTYISLLQSSIQNL  64

Query  1589  VFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPF  1410
              FL  S+P P LI TP+  S +QAA+VC+++ GV +RVRSGGHD+EGLSY S M    PF
Sbjct  65    RFLNTSSPSPQLIVTPVNPSQIQAAIVCSQKLGVHVRVRSGGHDYEGLSYVSQM----PF  120

Query  1409  VVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitg  1230
             ++IDL  +R ++VDVE  S WV+ GAT GE+YY +++KSK LGFPAG+C ++G+GG ++G
Sbjct  121   IIIDLRNMRLVEVDVEKESAWVETGATVGELYYAISQKSKVLGFPAGSCPTVGVGGQVSG  180

Query  1229  gaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIK  1050
             G  G + RKYGLAADN +DA+IVD  G+VLDR AMGEDLFWAIRGGGG SFG++ AWK  
Sbjct  181   GGVGTIFRKYGLAADNVIDAKIVDVNGKVLDRKAMGEDLFWAIRGGGGASFGVIFAWKFV  240

Query  1049  LvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQ  870
             LVPVP TVTVF V +T+E++AT LLYKWQ VA KL EDL L  +   V  ++    +T+ 
Sbjct  241   LVPVPPTVTVFEVGKTIEEDATMLLYKWQNVAHKLHEDLFLHAVTGVVTPSSSLANKTIS  300

Query  869   TAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGK  690
              +F  ++LGK ++LL  +  SFPELGLT + C EMSWI+SV+Y A + +   PE LL+ +
Sbjct  301   ISFGGLYLGKIEKLLPSIQESFPELGLTRESCTEMSWIQSVLYFAGFSQDGSPEVLLN-R  359

Query  689   PLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPESATPFPH  510
                 ++FFKAKS+F+  P+ ++ L+GLW   ++++T  ++  PYGG+M++I +SATPFPH
Sbjct  360   TQSSRSFFKAKSDFVMEPISQTALQGLWNKLIEDETSYLILTPYGGVMSQISDSATPFPH  419

Query  509   RKGVICKIVYLTSWKIEGEKKKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGMNKNG  330
             R G + +I+Y+ +W  E E  + ++W+R +YDYM  YVS+ PR AY+NYRDLDLG N   
Sbjct  420   RGGNMYQIMYMVTWDSEEENNQKINWMRELYDYMAPYVSRFPRAAYMNYRDLDLGRNYV-  478

Query  329   RNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
              NT++++ASVWG KYFK NF+RLV VKT  DP NFFW+EQS PV S
Sbjct  479   INTTYAQASVWGLKYFKSNFKRLVKVKTASDPANFFWNEQSFPVSS  524



>ref|NP_199252.1| FAD-binding Berberine family protein [Arabidopsis thaliana]
 dbj|BAB10124.1| berberine bridge enzyme-like protein [Arabidopsis thaliana]
 gb|AED95104.1| FAD-binding Berberine family protein [Arabidopsis thaliana]
Length=542

 Score =   491 bits (1264),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 295/533 (55%), Positives = 379/533 (71%), Gaps = 12/533 (2%)
 Frame = -2

Query  1778  ILSILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             + ++ F+F T +    S S+Q  F KC+  +++        FF+   NAS F  VL+ST 
Sbjct  15    VFALYFSFYTIT-LTSSTSLQDDFIKCLYRNTNVRFTLDKTFFTPERNASIFTEVLESTA  73

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QN  +L  + PKP  IF P+ ESHVQA+V+C+K+  +  RVRSGGHD+EG+SY S +E P
Sbjct  74    QNQRYLTKTMPKPGFIFKPVHESHVQASVICSKKLEIHFRVRSGGHDYEGVSYVSQIEKP  133

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               FV+IDL+KLR I VD++D S WV+AGAT GE+YYR+AEKSK  GFPAG   SLGIGGH
Sbjct  134   --FVLIDLSKLRQINVDIKDTSAWVEAGATVGELYYRIAEKSKFHGFPAGVYPSLGIGGH  191

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+++RKYGLAADN LDA+IVDA G++LDRA+MGEDLFWAIRGG GGSFGI+L+W
Sbjct  192   ITGGAYGSLMRKYGLAADNVLDAKIVDANGKLLDRASMGEDLFWAIRGGSGGSFGIILSW  251

Query  1058  KIKLvpvpatvtvftvPRTLEQNAT-KLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             KIKLVPVP T+TVFTV +T EQ+ + K+L KWQ++AD L ++L L+V  T    +  K  
Sbjct  252   KIKLVPVPETLTVFTVTKTFEQDRSFKILSKWQEIADNLVDELFLRVFFTV---SGNKAN  308

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPP--E  708
             +TV  A+   FLG+   L+++M   FPELGLT KDC+EMSWI+S+IYN+ +P   PP  E
Sbjct  309   KTVTMAYIGQFLGEKGTLMEVMKKDFPELGLTQKDCIEMSWIDSIIYNSGFPTNPPPPIE  368

Query  707   FLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPES  528
              LL  K    K +FK KS+F + P+P  GL G++K  L+ED  +++W PYGG M KIPES
Sbjct  369   ILLQAKSPIGKVYFKGKSDFAKKPIPVLGLEGMFKKLLEEDAALVIWTPYGGKMDKIPES  428

Query  527   ATPFPHRKGVICKIVYLTSWKIEGEKK--KHLDWIRRMYDYMGTYVSKSPREAYVNYRDL  354
               PFPHR G    I Y  SW  + EK+  +   WIR +Y YM  YVS +PR+AYVNYRDL
Sbjct  429   EIPFPHRNGTNFMIQYYRSWS-DSEKRPNRRTKWIRELYGYMTPYVSSNPRQAYVNYRDL  487

Query  353   DLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             DLG NK+   ++F EA +WG  YFK NF RLV +K++VDPDNFF HEQSIP L
Sbjct  488   DLGQNKDNSKSNFIEAKIWGANYFKDNFNRLVRIKSKVDPDNFFRHEQSIPTL  540



>ref|XP_011037730.1| PREDICTED: cannabidiolic acid synthase-like [Populus euphratica]
Length=534

 Score =   491 bits (1263),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 282/530 (53%), Positives = 379/530 (72%), Gaps = 19/530 (4%)
 Frame = -2

Query  1769  ILFTFLTFSPWAVSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTVQNL  1590
             +LF+F     W  S      F +C SL+   S     +    T N SS++SVL   ++NL
Sbjct  18    LLFSF----SWVTSAHTHEDFIECFSLYVEDS--TDISKVIYTQNDSSYSSVLHFAIRNL  71

Query  1589  VFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESPAPF  1410
              F   +  KPL+I TP   SH+QAA+ C+++  +Q+R+RSGGHDFEGLSY S +    PF
Sbjct  72    RF-NSTTLKPLVIVTPTNVSHIQAAIRCSQKNNLQIRIRSGGHDFEGLSYMSVL----PF  126

Query  1409  VVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgigghitg  1230
             V++DL   R + +DV + + WVQAGAT GE+YY +A+K + L FPAG C ++G+GGH++G
Sbjct  127   VILDLINFRSVTIDVTNKTAWVQAGATVGELYYHIAKKGRTLAFPAGICPTMGVGGHLSG  186

Query  1229  gaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAWKIK  1050
             G YGA+LRKYGLAADN +DA ++DA GRVLDR +MGEDLFWA+RGGGG SFG+++AWKIK
Sbjct  187   GGYGALLRKYGLAADNVIDAELIDANGRVLDRKSMGEDLFWALRGGGGNSFGVVIAWKIK  246

Query  1049  LvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNSTAVKGKRTVQ  870
             LV VP T+TVF V RTL+QNAT+L+++WQ +A+KL EDL++   I  VNS+  +G  T+Q
Sbjct  247   LVEVPPTLTVFNVLRTLDQNATQLIHRWQYIANKLHEDLMITTYIRRVNSS--QGNPTIQ  304

Query  869   TAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTTPPEFLLHGK  690
               F   FLG  D+LL+++N SFPELGL   DCLE SWIE++I N  +P  T  E LL   
Sbjct  305   ATFAGFFLGGVDKLLQLINESFPELGLAKDDCLETSWIEAIILNR-FPGNTSLELLLDRT  363

Query  689   PLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKED--TPVMVWNPYGGMMAKIPESATPF  516
             P F    +KAKS++++ P+PE+ L G++++FL+ED  TP ++  PYGG M +I ES++PF
Sbjct  364   PRFVSN-YKAKSDYVKEPMPENALEGIFEMFLEEDIETPRLLLVPYGGKMDQISESSSPF  422

Query  515   PHRKGVICKIVYLTSWKIEGEK--KKHLDWIRRMYDYMGTYVSKSPREAYVNYRDLDLGM  342
             PHR G I KI +  SW  EG++  ++H+DWIRR+Y YM  YVSK+PREAY+NYRDLD+GM
Sbjct  423   PHRAGNIYKIEHQVSWSEEGKEASQRHIDWIRRLYSYMTPYVSKNPREAYINYRDLDIGM  482

Query  341   NKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVLS  192
             N    NTS+ +AS+WG KYFK NF++LV VKT VDP NFF +EQSIP LS
Sbjct  483   NNLAGNTSYKQASIWGRKYFKNNFDKLVRVKTAVDPANFFRNEQSIPPLS  532



>ref|XP_006398047.1| hypothetical protein EUTSA_v10001137mg [Eutrema salsugineum]
 gb|ESQ39500.1| hypothetical protein EUTSA_v10001137mg [Eutrema salsugineum]
Length=525

 Score =   490 bits (1262),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 295/535 (55%), Positives = 373/535 (70%), Gaps = 34/535 (6%)
 Frame = -2

Query  1775  LSILFTFLTFSPWA-VSLSIQHQFYKCVSLHSHTSIPfstaffstttnassfnSVLQSTV  1599
             L++ F+  T +P +  SL +Q  F KC+  +++ + P    FFS   NAS F  VL+ST 
Sbjct  16    LALYFSLYTITPISSTSLQLQDDFIKCLHENTNVNFPLEKTFFSPERNASIFIEVLESTA  75

Query  1598  QNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYTSDMESP  1419
             QN  +L  S PKP  IF P+ ESHVQA+V+C+K+ G+ LRVRSGGHD+EG+SY S +E+ 
Sbjct  76    QNQRYLTKSMPKPGFIFKPVHESHVQASVICSKKLGIHLRVRSGGHDYEGVSYVSQIETS  135

Query  1418  APFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVSLgiggh  1239
               F++IDL++LR I VD+E NS WVQAGAT GE+YYR+AEKSK  G PAG   SLGIGGH
Sbjct  136   --FIIIDLSRLRQINVDIEGNSAWVQAGATIGELYYRIAEKSKIHGCPAGVYPSLGIGGH  193

Query  1238  itggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSFGILLAW  1059
             ITGGAYG+++RKYGLAADN +DA+IVDA G++LDR AMGEDLFWAIRGG GGSFGI+L+W
Sbjct  194   ITGGAYGSLMRKYGLAADNVVDAKIVDANGKLLDRTAMGEDLFWAIRGGSGGSFGIILSW  253

Query  1058  KIKLvpvpatvtvftvPRTLEQN-ATKLLYKWQkvadkldedlllkvLITAVNSTAVKGK  882
             KIKLVPVP T+TVFTV +TLEQ+   ++L KWQ+                      V  K
Sbjct  254   KIKLVPVPVTLTVFTVTKTLEQDVGLEILSKWQR----------------------VADK  291

Query  881   RTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTT---PP  711
              TV  ++   FLG+   L+++MN  FPELGLT +DC+EMSWIES++YN+ + RT    PP
Sbjct  292   LTVSMSYIGQFLGEKGNLIEVMNKGFPELGLTLEDCVEMSWIESIVYNSGF-RTNPLPPP  350

Query  710   EFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKIPE  531
             E LL  K    + +FKAKS+F + P+P  GL+G+ K FL+ED  +++W PYGGMM KIPE
Sbjct  351   EVLLQAKSPLGEVYFKAKSDFAKEPIPALGLKGMIKKFLEEDAALVIWTPYGGMMEKIPE  410

Query  530   SATPFPHRKGVICKIVYLTSWKIEGEKKKHL--DWIRRMYDYMGTYVSKSPREAYVNYRD  357
             S  PFPHR G I  I Y  SW  E EK+  L   WIR +Y YM  YVS +PR+AYVNYRD
Sbjct  411   SEIPFPHRSGTIFMIQYYRSWS-ETEKRPDLRIKWIRELYSYMTPYVSSNPRQAYVNYRD  469

Query  356   LDLGMNK-NGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             LDLG N  N    +F  A +WG KYFK NF RLV +K++VDP+N F HEQSIP L
Sbjct  470   LDLGQNNHNNSKENFLNAQIWGAKYFKDNFNRLVKIKSKVDPENLFRHEQSIPPL  524



>ref|XP_011005994.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Populus 
euphratica]
Length=534

 Score =   490 bits (1262),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 272/477 (57%), Positives = 356/477 (75%), Gaps = 11/477 (2%)
 Frame = -2

Query  1616  VLQSTVQNLVFLVPSAPKPLLIFTPLTESHVQAAVVCTKEAGVQLRVRSGGHDFEGLSYT  1437
             +LQS+ QNL +L  S  KP LI TP  ES +QA ++C+K+ G+Q+RVRSGGHD+EGLS+ 
Sbjct  64    ILQSSKQNLRWL-NSTSKPQLIITPFHESEIQAVILCSKKQGLQVRVRSGGHDYEGLSFL  122

Query  1436  SDMESPAPFVVIDLAKLRGIKVDVEDNSVWVQAGATNGEVYYRVAEKSKNLGFPAGNCVS  1257
                    PF++IDL  LRGI++D+ED + WVQ GAT GE+YY +A+KS+  GFPAG C +
Sbjct  123   CK----TPFIIIDLVNLRGIEMDIEDETAWVQTGATLGELYYAIAKKSRVHGFPAGLCPT  178

Query  1256  LgigghitggaygAMLRKYGLAADNALDARIVDATGRVLDRAAMGEDLFWAIRggggGSF  1077
             +G+GGH+TGG +G +LRKYGLAADN +DA ++D  GR+LDR  MGEDLFWAIRGGGG SF
Sbjct  179   VGVGGHVTGGGFGILLRKYGLAADNVIDAYLIDVNGRILDRQGMGEDLFWAIRGGGGASF  238

Query  1076  GILLAWKIKLvpvpatvtvftvPRTLEQNATKLLYKWQkvadkldedlllkvLITAVNST  897
             GI+L+WKIKL+ VP TVTVFTVP+T+EQ ATKL+++WQ +A KL EDL ++++I  V   
Sbjct  239   GIILSWKIKLIRVPPTVTVFTVPKTIEQGATKLVHRWQYIAGKLHEDLFIRIVIQNVGGE  298

Query  896   AVKGKRTVQTAFDAVFLGKTDRLLKIMNHSFPELGLTPKDCLEMSWIESVIYNALYPRTT  717
             +   K+TV+ +F+++FLG  DRL+ +MN SFPELGL P++C EMSWIES +Y A + + +
Sbjct  299   STSNKKTVEASFNSLFLGSIDRLITLMNESFPELGLVPENCTEMSWIESTVYFAGFQKGS  358

Query  716   PPEFLLHGKPLFPKTFFKAKSEFLRTPVPESGLRGLWKIFLKEDTPVMVWNPYGGMMAKI  537
             P E LL    L+ K  FKAKS+F+  P+PE GL G+W+ FL+E    M+ +P+GG M +I
Sbjct  359   PLEVLLDKTQLY-KAKFKAKSDFVTEPIPEFGLEGIWERFLEEGLVFMIMDPFGGRMNEI  417

Query  536   PESATPFPHRKGVICKIVYLTSWKIEGEKK---KHLDWIRRMYDYMGTYVSKSPREAYVN  366
             PES  PFPHR+G +  I YL  W  E E +   KH+ WI+ +Y YM  YVSKSPR AY+N
Sbjct  418   PESHIPFPHREGNLYNIQYLVKWD-EDEARATHKHVSWIQMLYRYMKPYVSKSPRAAYLN  476

Query  365   YRDLDLGMNKNGRNTSFSEASVWGYKYFKGNFERLVAVKTRVDPDNFFWHEQSIPVL  195
             YRDLDLG NK+  NTS+SEA  WG KYFKGNF+RLV VK++VD DNFF  EQSIP +
Sbjct  477   YRDLDLGTNKHA-NTSYSEAKAWGMKYFKGNFKRLVQVKSKVDSDNFFRSEQSIPSI  532



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5927913304104