BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17521_g3_i1 len=271 path=[2411:0-270]

Length=271
                                                                      Score     E

gb|EYU23068.1|  hypothetical protein MIMGU_mgv1a009201mg              96.7    8e-22   
ref|XP_004241449.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  90.9    1e-19   
ref|XP_006347480.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  90.5    1e-19   
gb|EPS70609.1|  steroleosin                                           86.7    2e-19   
ref|XP_004235330.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  87.4    1e-18   
gb|KHG19414.1|  Dehydrogenase/reductase SDR family protein 7-like...  85.5    8e-18   
gb|KCW83129.1|  hypothetical protein EUGRSUZ_B00090                   83.2    8e-18   
gb|KDO64428.1|  hypothetical protein CISIN_1g044010mg                 83.6    2e-17   
ref|XP_010026329.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  83.6    4e-17   
ref|XP_008239511.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  82.8    8e-17   
ref|XP_006436878.1|  hypothetical protein CICLE_v10031969mg           82.8    9e-17   
ref|XP_007038038.1|  Hydroxysteroid dehydrogenase 1                   81.3    3e-16   
ref|XP_008439964.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  78.6    3e-15   
ref|XP_002511145.1|  Corticosteroid 11-beta-dehydrogenase, putative   78.2    5e-15   Ricinus communis
ref|XP_010663769.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...  77.0    1e-14   
ref|XP_004145220.1|  PREDICTED: dehydrogenase/reductase SDR famil...  76.6    1e-14   
ref|XP_004503736.1|  PREDICTED: dehydrogenase/reductase SDR famil...  76.3    2e-14   
ref|XP_010695678.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  75.9    3e-14   
ref|XP_008344913.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  75.5    4e-14   
ref|XP_010695677.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  75.1    6e-14   
ref|XP_009359396.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  74.7    8e-14   
ref|XP_009359395.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  74.7    8e-14   
gb|KGN64427.1|  hypothetical protein Csa_1G051650                     74.3    1e-13   
ref|XP_004162136.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  73.9    1e-13   
ref|XP_004145221.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  73.9    2e-13   
ref|NP_001242368.1|  uncharacterized protein LOC100787835             73.6    3e-13   
ref|XP_008446259.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  72.8    4e-13   
gb|KHN16857.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein   73.2    4e-13   
ref|XP_010249449.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  69.7    6e-12   
ref|XP_010250645.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  69.3    8e-12   
ref|XP_008239509.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  68.2    2e-11   
ref|XP_004297523.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  68.2    3e-11   
ref|XP_009629548.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  66.6    7e-11   
ref|XP_009760328.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  66.6    8e-11   
ref|XP_007211139.1|  hypothetical protein PRUPE_ppa026374mg           64.7    3e-10   
emb|CBI15698.3|  unnamed protein product                              62.4    2e-09   
ref|NP_001291322.1|  11-beta-hydroxysteroid dehydrogenase 1B-like     62.8    2e-09   
ref|XP_006347650.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  62.0    3e-09   
ref|XP_007038040.1|  Hydroxysteroid dehydrogenase 2, putative         62.4    3e-09   
ref|XP_010536612.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  60.8    9e-09   
ref|XP_010536601.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  60.1    2e-08   
ref|XP_006580902.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...  58.9    4e-08   
ref|XP_011033351.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  55.8    2e-07   
ref|XP_007211157.1|  hypothetical protein PRUPE_ppa027140mg           57.0    2e-07   
ref|NP_568742.1|  hydroxysteroid dehydrogenase 1                      57.0    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282100.1|  hypothetical protein CARUB_v10028347mg           57.0    2e-07   
ref|XP_004298550.1|  PREDICTED: uncharacterized oxidoreductase Yq...  55.5    2e-07   
ref|XP_006402075.1|  hypothetical protein EUTSA_v10015475mg           57.0    2e-07   
ref|XP_006402065.1|  hypothetical protein EUTSA_v10015936mg           56.6    2e-07   
gb|KFK22922.1|  hypothetical protein AALP_AAs48765U000100             56.2    3e-07   
ref|XP_008392822.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  56.2    4e-07   
ref|XP_010442253.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  55.8    5e-07   
ref|XP_002865819.1|  short-chain dehydrogenase/reductase family p...  55.8    5e-07   
ref|XP_002865822.1|  hypothetical protein ARALYDRAFT_918105           53.5    6e-07   
ref|XP_008446283.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  55.5    6e-07   
tpg|DAA63854.1|  TPA: hypothetical protein ZEAMMB73_332488            55.1    1e-06   
gb|ABO71657.1|  short-chain dehydrogenase reductase                   55.1    1e-06   Brassica napus [oilseed rape]
gb|KEH21006.1|  short-chain dehydrogenase/reductase                   55.1    1e-06   
emb|CDY16353.1|  BnaA02g11570D                                        55.1    1e-06   
ref|XP_009127346.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  55.1    1e-06   
gb|ACG69522.1|  steroleosin SLO1-1                                    54.7    1e-06   Brassica napus [oilseed rape]
ref|XP_010250644.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  54.7    1e-06   
ref|NP_001136546.1|  corticosteroid 11-beta-dehydrogenase isozyme...  54.7    1e-06   Zea mays [maize]
gb|ACG24673.1|  corticosteroid 11-beta-dehydrogenase isozyme 1        54.7    1e-06   Zea mays [maize]
ref|XP_010482377.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  53.9    2e-06   
gb|KDP22587.1|  hypothetical protein JCGZ_26418                       54.3    2e-06   
ref|XP_010442549.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  53.9    2e-06   
ref|NP_001066740.1|  Os12g0464400                                     54.3    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009134064.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  53.9    2e-06   
emb|CDY34029.1|  BnaC03g27860D                                        53.9    2e-06   
gb|ACG69524.1|  steroleosin SLO1-3                                    53.9    2e-06   Brassica napus [oilseed rape]
ref|XP_010482376.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  53.9    2e-06   
ref|XP_002322681.2|  hypothetical protein POPTR_0016s04940g           53.1    3e-06   Populus trichocarpa [western balsam poplar]
gb|ABA98146.2|  oxidoreductase, short chain dehydrogenase/reducta...  53.1    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006436879.1|  hypothetical protein CICLE_v10031927mg           53.1    4e-06   
ref|XP_010086989.1|  Dehydrogenase/reductase SDR family protein 7...  53.1    4e-06   
gb|EEE53178.1|  hypothetical protein OsJ_36031                        53.1    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004962634.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  53.1    5e-06   
gb|EEC69238.1|  hypothetical protein OsI_38254                        53.1    5e-06   Oryza sativa Indica Group [Indian rice]
gb|KDO64429.1|  hypothetical protein CISIN_1g042560mg                 52.8    5e-06   
ref|XP_002463266.1|  hypothetical protein SORBIDRAFT_02g040840        52.8    5e-06   Sorghum bicolor [broomcorn]
ref|XP_001767568.1|  predicted protein                                52.8    5e-06   
gb|KDP22589.1|  hypothetical protein JCGZ_26420                       51.2    6e-06   
ref|NP_199890.1|  hydroxysteroid dehydrogenase 6                      52.4    8e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006664013.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  52.0    1e-05   
ref|XP_003576230.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  52.0    1e-05   
ref|XP_010482368.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  52.0    1e-05   
gb|ACG69523.1|  steroleosin SLO1-2                                    52.0    1e-05   Brassica napus [oilseed rape]
gb|KFK26701.1|  hypothetical protein AALP_AA8G282300                  52.0    1e-05   
ref|XP_008811369.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  51.6    1e-05   
ref|XP_010442316.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  52.0    1e-05   
emb|CDX91557.1|  BnaC02g16030D                                        50.8    2e-05   
ref|XP_010086987.1|  Dehydrogenase/reductase SDR family protein 7...  50.8    3e-05   
ref|XP_009127342.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  50.8    3e-05   
gb|ABM90633.1|  short-chain dehydrogenase reductase                   50.8    3e-05   Brassica napus [oilseed rape]
emb|CDY16351.1|  BnaA02g11550D                                        50.4    3e-05   
ref|XP_009127343.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  50.4    3e-05   
ref|XP_009359394.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  50.4    3e-05   
ref|XP_006282170.1|  hypothetical protein CARUB_v10028440mg           50.8    3e-05   
ref|XP_004141553.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  50.4    3e-05   
ref|XP_004977951.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  50.4    4e-05   
ref|XP_010271122.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  50.1    5e-05   
ref|XP_010086988.1|  Dehydrogenase/reductase SDR family protein 7...  50.1    5e-05   
ref|XP_006844627.1|  hypothetical protein AMTR_s00016p00227990        50.1    5e-05   
emb|CDP14997.1|  unnamed protein product                              49.3    6e-05   
ref|XP_002511144.1|  Corticosteroid 11-beta-dehydrogenase, putative   49.7    6e-05   Ricinus communis
ref|XP_006436880.1|  hypothetical protein CICLE_v10031927mg           49.7    6e-05   
gb|EMT26675.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein   49.7    6e-05   
ref|XP_010695411.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  49.7    7e-05   
ref|XP_010277349.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  49.3    8e-05   
gb|KHN23681.1|  hypothetical protein glysoja_039132                   48.1    1e-04   
dbj|BAK03741.1|  predicted protein                                    48.9    1e-04   
ref|XP_002994525.1|  hypothetical protein SELMODRAFT_138761           48.9    1e-04   
ref|XP_007038041.1|  Glucose 1-dehydrogenase, putative                48.5    1e-04   
gb|EMS53803.1|  Dehydrogenase/reductase SDR family protein 7-like...  48.1    2e-04   
gb|EMT12098.1|  Pentatricopeptide repeat-containing protein           48.9    2e-04   
ref|XP_010525337.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  48.1    2e-04   
ref|XP_009602452.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  48.1    2e-04   
gb|EYU23067.1|  hypothetical protein MIMGU_mgv1a009247mg              48.1    2e-04   
ref|XP_008459623.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  48.1    2e-04   
ref|XP_010421918.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  48.1    2e-04   
ref|XP_006289482.1|  hypothetical protein CARUB_v10003016mg           48.1    2e-04   
ref|XP_004297522.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  48.1    2e-04   
ref|XP_010455398.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  48.1    2e-04   
gb|KHG01718.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein   48.1    2e-04   
ref|XP_002973836.1|  hypothetical protein SELMODRAFT_100351           48.1    2e-04   
ref|XP_002966954.1|  hypothetical protein SELMODRAFT_87233            48.1    3e-04   
ref|XP_010437678.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  48.1    3e-04   
ref|XP_002872483.1|  short-chain dehydrogenase/reductase family p...  48.1    3e-04   
ref|XP_006397111.1|  hypothetical protein EUTSA_v10029315mg           48.1    3e-04   
ref|XP_004242256.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  47.8    3e-04   
gb|ABI20736.1|  11-beta-hydroxysteroid dehydrogenase-like protein     47.8    3e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004981097.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  47.8    3e-04   
gb|ABS28874.1|  steroleosin-A                                         47.8    3e-04   Arachis hypogaea [goober]
tpg|DAA38129.1|  TPA: hypothetical protein ZEAMMB73_775961            45.4    4e-04   
ref|NP_001145589.1|  uncharacterized protein LOC100279063             47.8    4e-04   Zea mays [maize]
ref|XP_008668191.1|  PREDICTED: steroleosin isoform X2                47.4    4e-04   
ref|XP_008668190.1|  PREDICTED: steroleosin isoform X1                47.4    4e-04   
ref|XP_006356566.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  47.4    4e-04   
ref|NP_001152614.1|  steroleosin                                      47.4    4e-04   Zea mays [maize]
ref|XP_004975422.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  47.4    4e-04   
ref|XP_010243359.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  47.4    4e-04   
ref|XP_009765827.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  47.4    4e-04   
ref|XP_007038039.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...  47.4    5e-04   
ref|XP_003579631.2|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  47.0    6e-04   
ref|XP_009622010.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  47.0    7e-04   
emb|CAN76088.1|  hypothetical protein VITISV_028806                   47.0    7e-04   Vitis vinifera
gb|ACF75106.1|  Ste-b                                                 47.0    7e-04   Brassica napus [oilseed rape]
ref|NP_192740.1|  hydroxysteroid dehydrogenase 5                      46.6    8e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KGN64430.1|  hypothetical protein Csa_1G051680                     46.6    8e-04   
emb|CDX90742.1|  BnaA03g24220D                                        46.6    0.001   
ref|XP_009134177.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  46.6    0.001   
gb|ACG69526.1|  steroleosin SLO2-2                                    46.6    0.001   Brassica napus [oilseed rape]
ref|XP_008669501.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  46.2    0.001   
ref|XP_009617211.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  46.2    0.001   



>gb|EYU23068.1| hypothetical protein MIMGU_mgv1a009201mg [Erythranthe guttata]
Length=349

 Score = 96.7 bits (239),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IH FLNL APPFTFFSL+FL PPFQ++KFFLS+LG++F+EDVAGKV++ITGASS
Sbjct  1    MDLIHTFLNLAAPPFTFFSLMFLLPPFQIFKFFLSVLGTLFSEDVAGKVVVITGASS  57



>ref|XP_004241449.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
lycopersicum]
Length=349

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M++E+IHKFLNLVAPP +FFSLL   PPFQ +K  LSILG++F+EDVAGKV+IITGASS
Sbjct  1    MLVELIHKFLNLVAPPVSFFSLLLFLPPFQFFKCVLSILGTLFSEDVAGKVVIITGASS  59



>ref|XP_006347480.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
tuberosum]
Length=349

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M++E+IHKFLNLVAPP +FFSLL   PPFQ +K  LSILG++F+EDVAGKV+IITGASS
Sbjct  1    MLVELIHKFLNLVAPPVSFFSLLLFLPPFQFFKCVLSILGTLFSEDVAGKVVIITGASS  59



>gb|EPS70609.1| steroleosin, partial [Genlisea aurea]
Length=124

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  103  EVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++IH FLNL APPFTFF +LF +PP Q +K FLS+LG++F EDVAGKV++ITGASS
Sbjct  1    DIIHAFLNLAAPPFTFFCILFFYPPIQFFKLFLSLLGTLFPEDVAGKVVLITGASS  56



>ref|XP_004235330.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
lycopersicum]
Length=352

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++L++IHKFLNLVAPPFT F+LL   PP+Q  K+FLSILG  F+E+VAGKVI+ITGASS
Sbjct  2    VLLDLIHKFLNLVAPPFTLFTLLIFLPPYQFIKYFLSILGKFFSENVAGKVIVITGASS  60



>gb|KHG19414.1| Dehydrogenase/reductase SDR family protein 7-like protein [Gossypium 
arboreum]
Length=350

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IHKFLNLVAP FTFFS +FL PPF  + FFLSIL SVF+E+VAGKVI+ITGASS
Sbjct  1    MDLIHKFLNLVAPTFTFFSFVFLLPPFYFFNFFLSILRSVFSENVAGKVIVITGASS  57



>gb|KCW83129.1| hypothetical protein EUGRSUZ_B00090 [Eucalyptus grandis]
Length=150

 Score = 83.2 bits (204),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IHK LNLVAPPFTFFSL    PPF  +KFFLS L SVF+E V GKV++ITGASS
Sbjct  1    MDLIHKLLNLVAPPFTFFSLCLFLPPFYAFKFFLSTLSSVFSESVEGKVVLITGASS  57



>gb|KDO64428.1| hypothetical protein CISIN_1g044010mg [Citrus sinensis]
Length=248

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++I+KFLNLVAPPFT FSL    PPF  YKF LS+  S+F+EDV+GKV+IITGASS
Sbjct  1    MDLINKFLNLVAPPFTLFSLCLFLPPFLCYKFLLSVFNSIFSEDVSGKVVIITGASS  57



>ref|XP_010026329.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Eucalyptus 
grandis]
 gb|KCW83128.1| hypothetical protein EUGRSUZ_B00089 [Eucalyptus grandis]
Length=349

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IHKFLNLVAPPFTFFSL    PPF  +KFFLS L SVF+E V GKV++ITGASS
Sbjct  1    MDLIHKFLNLVAPPFTFFSLCLFLPPFYAFKFFLSTLSSVFSESVEGKVVLITGASS  57



>ref|XP_008239511.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Prunus 
mume]
Length=353

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            L +IHKFLNLVAPPFTFFSL    PPF ++K FLS+L S+F+E+V GKVI+ITGASS
Sbjct  4    LNLIHKFLNLVAPPFTFFSLCLFLPPFYLFKSFLSVLSSIFSENVNGKVILITGASS  60



>ref|XP_006436878.1| hypothetical protein CICLE_v10031969mg [Citrus clementina]
 ref|XP_006493234.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Citrus 
sinensis]
 gb|ESR50118.1| hypothetical protein CICLE_v10031969mg [Citrus clementina]
Length=349

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++I+KFLNLVAPPFT FSL    PPF  YKF LS+  S+F+EDV+GKV+IITGASS
Sbjct  1    MDLINKFLNLVAPPFTLFSLCLFLPPFLCYKFLLSVFNSIFSEDVSGKVVIITGASS  57



>ref|XP_007038038.1| Hydroxysteroid dehydrogenase 1 [Theobroma cacao]
 gb|EOY22539.1| Hydroxysteroid dehydrogenase 1 [Theobroma cacao]
Length=351

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IHKFLNLVAP FTFFSL    PPF ++KFFL+ LGS F+E+V+GKV+IITGASS
Sbjct  1    MDLIHKFLNLVAPWFTFFSLCLFLPPFYLFKFFLATLGSFFSENVSGKVVIITGASS  57



>ref|XP_008439964.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=349

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  106  VIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +IH FLNLV+PP TF SL FL PP+ V+K+FL ++  +F+EDVAGKV++ITGASS
Sbjct  3    LIHSFLNLVSPPITFVSLGFLLPPYVVFKYFLYLVRGIFSEDVAGKVVLITGASS  57



>ref|XP_002511145.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
 gb|EEF51747.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
Length=349

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++I+ FLNLVAPPFTFFSL FL PP+ +YK F S+   +F+EDV GKV++ITGASS
Sbjct  1    MDLINTFLNLVAPPFTFFSLCFLLPPYLIYKGFSSVFNFIFSEDVTGKVVLITGASS  57



>ref|XP_010663769.1| PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydroxysteroid dehydrogenase 
1B-like [Vitis vinifera]
Length=348

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IH FLNLVAPPFTF +L  L PPF  +KFFLS   S+ +E+V GKV+I+TGASS
Sbjct  1    MDIIHSFLNLVAPPFTFVALFLLLPPFHFFKFFLSTFWSILSENVTGKVVIVTGASS  57



>ref|XP_004145220.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
 ref|XP_004153124.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
 ref|XP_004162135.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
 gb|KGN64428.1| hypothetical protein Csa_1G051660 [Cucumis sativus]
Length=349

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            + +IH FLNLV+PPFTF SL  L PP+Q  K FLS+LG +F E+V GKV++ITGASS
Sbjct  1    MNLIHSFLNLVSPPFTFISLFLLLPPYQALKSFLSLLGVLFTENVHGKVVLITGASS  57



>ref|XP_004503736.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cicer arietinum]
Length=351

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IHKFLN+VAPPFTFFSL    PP+   KFFLS +  +F E+VAGKV+ ITGASS
Sbjct  1    MDLIHKFLNIVAPPFTFFSLALFLPPYWAIKFFLSTIYYIFTENVAGKVVHITGASS  57



>ref|XP_010695678.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Beta 
vulgaris subsp. vulgaris]
Length=349

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +EVI+K  NL APPFTFF L    PPF   KF LS+  S+F+EDVAGKV+IITGASS
Sbjct  1    MEVINKIFNLAAPPFTFFILCLFLPPFHFLKFCLSVFTSIFSEDVAGKVVIITGASS  57



>ref|XP_008344913.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Malus 
domestica]
 ref|XP_008367477.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Malus 
domestica]
Length=350

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ML +IH FLNLVAPPFTFFSL    PPF ++K F  +L S+F+E++ GKV++ITGASS
Sbjct  1    MLGLIHTFLNLVAPPFTFFSLCVFLPPFYLFKSFSYVLSSIFSENLKGKVVVITGASS  58



>ref|XP_010695677.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Beta 
vulgaris subsp. vulgaris]
Length=348

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++I+ FLNL APPFTF SL  L PPFQ+ KF LSI  S + EDV GKV++ITGASS
Sbjct  1    MDLINTFLNLTAPPFTFVSLCLLLPPFQILKFILSIFASFYPEDVFGKVVLITGASS  57



>ref|XP_009359396.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Pyrus x bretschneideri]
Length=350

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ML ++H FLNLVAPPFTFFSL    PPF ++K F  +L S+F+E++ GKV++ITGASS
Sbjct  1    MLGLVHTFLNLVAPPFTFFSLCVFLPPFYLFKSFSYVLSSIFSENLNGKVVVITGASS  58



>ref|XP_009359395.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Pyrus x bretschneideri]
Length=355

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ML ++H FLNLVAPPFTFFSL    PPF ++K F  +L S+F+E++ GKV++ITGASS
Sbjct  1    MLGLVHTFLNLVAPPFTFFSLCVFLPPFYLFKSFSYVLSSIFSENLNGKVVVITGASS  58



>gb|KGN64427.1| hypothetical protein Csa_1G051650 [Cucumis sativus]
Length=331

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I  FLNLV+PP TF SL F  PP+ V K+FL ++  +F EDVAGKV++ITGASS
Sbjct  1    MELIKSFLNLVSPPITFVSLGFFLPPYVVLKYFLYLVRGIFTEDVAGKVVLITGASS  57



>ref|XP_004162136.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
Length=349

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I  FLNLV+PP TF SL F  PP+ V K+FL ++  +F EDVAGKV++ITGASS
Sbjct  1    MELIKSFLNLVSPPITFVSLGFFLPPYVVLKYFLYLVRGIFTEDVAGKVVLITGASS  57



>ref|XP_004145221.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
 ref|XP_004153123.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
Length=349

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I  FLNLV+PP TF SL F  PP+ V K+FL ++  +F EDVAGKV++ITGASS
Sbjct  1    MELIKSFLNLVSPPITFVSLGFFLPPYVVLKYFLYLVRGIFTEDVAGKVVLITGASS  57



>ref|NP_001242368.1| uncharacterized protein LOC100787835 [Glycine max]
 gb|ACU17782.1| unknown [Glycine max]
Length=377

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IHKFLN+VAP  TFF L    PP+  +KFFLSI+ S+F+E+VAGKV+ ITGASS
Sbjct  1    MDLIHKFLNIVAPITTFFFLCLFLPPYWTFKFFLSIINSIFSENVAGKVVHITGASS  57



>ref|XP_008446259.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=349

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            + +IH FLNLV+PPFTF +L  L PP+Q  K FLS+   +F EDV GKV++ITGASS
Sbjct  1    MNLIHSFLNLVSPPFTFITLFLLLPPYQALKSFLSLFCVLFTEDVNGKVVLITGASS  57



>gb|KHN16857.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Glycine 
soja]
Length=377

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IHKFLN+VAP  TFF L    PP+  +KFFLSI+ S+F+E+VAGKV+ ITGASS
Sbjct  1    MDLIHKFLNIVAPITTFFFLCLFLPPYWTFKFFLSIINSIFSENVAGKVVHITGASS  57



>ref|XP_010249449.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=351

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M L +IHKF+N+VAPP T  +L+   PPF V+K F  I  ++F+E+VAGKV++ITGASS
Sbjct  1    MYLYLIHKFMNIVAPPTTLITLILFLPPFLVFKCFFYIFRAIFSENVAGKVVLITGASS  59



>ref|XP_010250645.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=353

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  103  EVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            + I KF+N+VAPP    +L+ L PPF V +FFLSIL S F+E+VAGKV++ITGASS
Sbjct  5    QQIRKFMNIVAPPVILLTLVLLSPPFLVLEFFLSILRSFFSENVAGKVVLITGASS  60



>ref|XP_008239509.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Prunus 
mume]
Length=343

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M ++I+K LN++ PP +    LFL PP+  YKF LS + SVF EDVAGKV++ITGASS
Sbjct  1    MDDIINKVLNIIIPPISLTFFLFLLPPYLFYKFLLSAVRSVFTEDVAGKVVLITGASS  58



>ref|XP_004297523.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Fragaria vesca subsp. vesca]
Length=412

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 59/81 (73%), Gaps = 6/81 (7%)
 Frame = +1

Query  46   LFLSFKVSRSV------EEIHTMMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSI  207
            LF +F++S SV        +   ML +IH FLNL APPFTFFSLL L PP  +Y+FF S+
Sbjct  40   LFSTFQLSSSVFIICSSSALSKTMLGLIHTFLNLSAPPFTFFSLLLLLPPLYLYRFFTSL  99

Query  208  LGSVFAEDVAGKVIIITGASS  270
            L ++F+E+V+GKV++ITGASS
Sbjct  100  LSTIFSENVSGKVVLITGASS  120



>ref|XP_009629548.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
tomentosiformis]
Length=348

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 44/59 (75%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++L++IHKFLNLVAPPFTFFSLLF  PP+Q +K+FLSILG+ F+EDV+GKV+IITGASS
Sbjct  2    VVLDLIHKFLNLVAPPFTFFSLLFFLPPYQFFKWFLSILGTFFSEDVSGKVVIITGASS  60



>ref|XP_009760328.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
sylvestris]
Length=352

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 44/59 (75%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++L +IHKFLNLVAPPFTFFSLLF  PP+Q +K+FLSILG+ F+EDV+GKV+IITGASS
Sbjct  2    VLLNLIHKFLNLVAPPFTFFSLLFFLPPYQFFKWFLSILGTFFSEDVSGKVVIITGASS  60



>ref|XP_007211139.1| hypothetical protein PRUPE_ppa026374mg [Prunus persica]
 gb|EMJ12338.1| hypothetical protein PRUPE_ppa026374mg [Prunus persica]
Length=337

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGK  243
            +E  H FLNLVAPPFTFFSL    PPF ++K FLS+L S+F+E+V GK
Sbjct  1    MEQCHCFLNLVAPPFTFFSLCLFLPPFYLFKSFLSVLSSIFSENVNGK  48



>emb|CBI15698.3| unnamed protein product [Vitis vinifera]
Length=322

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGK  243
            +++IH FLNLVAPPFTF +L  L PPF  +KFFLS   S+ +E+V GK
Sbjct  1    MDIIHSFLNLVAPPFTFVALFLLLPPFHFFKFFLSTFWSILSENVTGK  48



>ref|NP_001291322.1| 11-beta-hydroxysteroid dehydrogenase 1B-like [Sesamum indicum]
 gb|AAL09328.1|AF302806_1 steroleosin [Sesamum indicum]
 gb|AAL13315.1|AF421889_1 steroleosin [Sesamum indicum]
Length=348

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IH FLNL+APPFTFF LLF  PPFQ++KFFLSILG++F+EDVAGKV++ITGASS
Sbjct  1    MDLIHTFLNLIAPPFTFFFLLFFLPPFQIFKFFLSILGTLFSEDVAGKVVVITGASS  57



>ref|XP_006347650.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
tuberosum]
Length=344

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M+L++IHKFLNLVAPPFT F+LLFL PP+Q  KF LSIL +V++EDVAGKV++ITGASS
Sbjct  2    MLLDLIHKFLNLVAPPFTLFTLLFLLPPYQFIKFILSILSTVYSEDVAGKVVVITGASS  60



>ref|XP_007038040.1| Hydroxysteroid dehydrogenase 2, putative [Theobroma cacao]
 gb|EOY22541.1| Hydroxysteroid dehydrogenase 2, putative [Theobroma cacao]
Length=434

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  109  IHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            I+K LN+V PP    +L+F+ PPF V+K   SI   V+ E+VAGKV++ITGASS
Sbjct  3    INKLLNIVFPPLLIIALVFILPPFLVFKLLCSIQRFVYKENVAGKVVLITGASS  56



>ref|XP_010536612.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B [Tarenaya 
hassleriana]
Length=349

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++I+ FLNL AP  TFF+  F  PPF  +KF LSI  S+F+E++ GKV+IITGASS
Sbjct  1    MDIINGFLNLTAPFMTFFAFCFFLPPFYFFKFLLSIFSSIFSENLQGKVVIITGASS  57



>ref|XP_010536601.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 [Tarenaya 
hassleriana]
Length=348

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ I+K +NL+ PP   + L    P +Q  K F+S+  ++FAEDVAGKV++ITGA+S
Sbjct  1    MDSINKMMNLIFPPIALYGLFAFHPTYQRLKSFVSVFRNIFAEDVAGKVVLITGAAS  57



>ref|XP_006580902.1| PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydroxysteroid dehydrogenase 
1B-like [Glycine max]
Length=323

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IHKFLN+VA   TFF L    PP+  +KFFL I   +F+E+V GKV+ IT ASS
Sbjct  1    MDLIHKFLNIVASITTFFFLCLFLPPYWTFKFFLYITNYIFSENVXGKVVHITVASS  57



>ref|XP_011033351.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 [Populus 
euphratica]
Length=222

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M +  IHK LN+V P     S+L + PP+ V+K    I  S+F E+VAGKV++ITGASS
Sbjct  1    MAMTSIHKLLNIVFPLMIIISILVILPPYLVFKLLSYIKRSMFTENVAGKVVLITGASS  59



>ref|XP_007211157.1| hypothetical protein PRUPE_ppa027140mg [Prunus persica]
 gb|EMJ12356.1| hypothetical protein PRUPE_ppa027140mg [Prunus persica]
Length=326

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M ++I+K LN++ PP +    LFL P +  YKF LS + SVF+EDVAGKV++ITGASS
Sbjct  1    MDDIINKVLNIIIPPISLTFFLFLLPLYLFYKFLLSAVRSVFSEDVAGKVVLITGASS  58



>ref|NP_568742.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
 ref|NP_680418.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
 sp|P0DKC6.1|HSD1B_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase 1B; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase 1B; AltName: Full=Hydroxysteroid 
dehydrogenase 1; Short=AtHSD1 [Arabidopsis 
thaliana]
 sp|P0DKC5.1|HSD1A_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase 1A; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase 1A; AltName: Full=Hydroxysteroid 
dehydrogenase 1; Short=AtHSD1 [Arabidopsis 
thaliana]
 gb|AAL38621.1|AF446888_1 AT5g50700/MFB16_9 [Arabidopsis thaliana]
 dbj|BAA96983.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 dbj|BAB09145.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AAK96564.1| AT5g50700/MFB16_9 [Arabidopsis thaliana]
 gb|AAL32846.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AAM10215.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 dbj|BAD95411.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AED95967.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
 gb|AED95981.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
Length=349

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +KF  SI  ++F+E++ GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFYFFKFLQSIFSTIFSENLYGKVVLITGASS  57



>ref|XP_006282100.1| hypothetical protein CARUB_v10028347mg [Capsella rubella]
 gb|EOA14998.1| hypothetical protein CARUB_v10028347mg [Capsella rubella]
Length=349

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +KF  SI  ++F+E++ GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFYFFKFLQSIFSTIFSENLHGKVVLITGASS  57



>ref|XP_004298550.1| PREDICTED: uncharacterized oxidoreductase YqjQ-like [Fragaria 
vesca subsp. vesca]
Length=206

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M  + H  LN+V P  T   L+F  PPF +YKF   +  S   E+VAGKVI+ITGASS
Sbjct  1    MKNLNHNVLNVVVPLLTLTGLVFFLPPFLIYKFLCFVYRSKSIENVAGKVILITGASS  58



>ref|XP_006402075.1| hypothetical protein EUTSA_v10015475mg [Eutrema salsugineum]
 gb|ESQ43528.1| hypothetical protein EUTSA_v10015475mg [Eutrema salsugineum]
Length=349

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +KF  SI  ++F+E++ GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFYFFKFLQSIFSTIFSENLYGKVVLITGASS  57



>ref|XP_006402065.1| hypothetical protein EUTSA_v10015936mg [Eutrema salsugineum]
 gb|ESQ43518.1| hypothetical protein EUTSA_v10015936mg [Eutrema salsugineum]
Length=309

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ I+K +N V PP   + L   +P +Q  K+ +SI  ++F+E+VAGKV++ITGA+S
Sbjct  1    MDSINKIINFVFPPLALYGLFVFYPIYQRLKYIISIYQNLFSENVAGKVVVITGAAS  57



>gb|KFK22922.1| hypothetical protein AALP_AAs48765U000100 [Arabis alpina]
Length=349

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +KF  SI  ++F+E++ GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFYFFKFVQSIFSTIFSENLYGKVVLITGASS  57



>ref|XP_008392822.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Malus 
domestica]
Length=349

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++I+K LN+  PP +   LLF+ P +   K  LS    VF+EDV GKVI+ITGASS
Sbjct  1    MDIINKVLNVTIPPMSLAWLLFVLPTYLFCKLLLSAARHVFSEDVGGKVILITGASS  57



>ref|XP_010442253.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Camelina 
sativa]
Length=350

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +KF  SI  ++F+E++ GKV++ITGASS
Sbjct  1    MELINYFLNLTAPFFTFFGLCFFLPPFYFFKFVQSIFSTIFSENLHGKVVLITGASS  57



>ref|XP_002865819.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42078.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=349

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +KF  SI  ++F E++ GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFYFFKFLQSIFSTIFLENLYGKVVLITGASS  57



>ref|XP_002865822.1| hypothetical protein ARALYDRAFT_918105 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42081.1| hypothetical protein ARALYDRAFT_918105 [Arabidopsis lyrata subsp. 
lyrata]
Length=134

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ I+K +N V P  T ++LL  +P +Q  K   SI  ++F+E+VAGKV++ITGA+S
Sbjct  1    MDSINKIINFVFPLLTLYALLVFYPTYQRVKSAFSIYRNLFSENVAGKVVLITGAAS  57



>ref|XP_008446283.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=352

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ ++ FLNL+ PP +  S  F  P +  +K   SI+ S+F+EDVAGKV++ITGASS
Sbjct  1    MDPLNNFLNLILPPTSLVSFFFFLPIYLFFKSLSSIIRSIFSEDVAGKVVLITGASS  57



>tpg|DAA63854.1| TPA: hypothetical protein ZEAMMB73_332488 [Zea mays]
Length=330

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M  ++++  LN V  P    SLL  +PP+ ++K   S L  +F ED+AGKV++ITGASS
Sbjct  1    MAPDLVNGVLNWVGTPAMVASLLLFYPPYYLFKTCYSFLSWLFPEDLAGKVVLITGASS  59



>gb|ABO71657.1| short-chain dehydrogenase reductase [Brassica napus]
Length=349

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF   F  PPF  +KF  SI  ++F+E+V GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGPCFFLPPFYFFKFVQSIFSTIFSENVYGKVVLITGASS  57



>gb|KEH21006.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=351

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IH+FLN+VAPPFTFFSLL   PP+  +KFFLSI+ + F E+VAGKV+ ITGASS
Sbjct  1    MDLIHQFLNIVAPPFTFFSLLLFLPPYWTFKFFLSIIFAFFPENVAGKVVHITGASS  57



>emb|CDY16353.1| BnaA02g11570D [Brassica napus]
Length=349

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +KF  SI  ++F+E+V GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFYFFKFVQSIFSTIFSENVYGKVVLITGASS  57



>ref|XP_009127346.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B [Brassica 
rapa]
Length=349

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +KF  SI  ++F+E+V GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFYFFKFVQSIFSTIFSENVYGKVVLITGASS  57



>gb|ACG69522.1| steroleosin SLO1-1 [Brassica napus]
Length=349

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +KF  SI  ++F+E+V GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFYFFKFVQSIFSTIFSENVYGKVVLITGASS  57



>ref|XP_010250644.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=349

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ IHK LN VAPP    +L    P   + K    IL S+  ED+ GKV+IITGASS
Sbjct  1    MDTIHKLLNFVAPPLALVALCLTLPLLYICKIISYILRSISTEDLTGKVVIITGASS  57



>ref|NP_001136546.1| corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 1 [Zea 
mays]
 ref|XP_008650969.1| PREDICTED: corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 
1 isoform X1 [Zea mays]
 gb|ACF80369.1| unknown [Zea mays]
 gb|ACF82139.1| unknown [Zea mays]
 gb|ACG48671.1| corticosteroid 11-beta-dehydrogenase isozyme 1 [Zea mays]
 tpg|DAA63855.1| TPA: corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 1 
[Zea mays]
 tpg|DAA63856.1| TPA: corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 2 
[Zea mays]
Length=349

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M  ++++  LN V  P    SLL  +PP+ ++K   S L  +F ED+AGKV++ITGASS
Sbjct  1    MAPDLVNGVLNWVGTPAMVASLLLFYPPYYLFKTCYSFLSWLFPEDLAGKVVLITGASS  59



>gb|ACG24673.1| corticosteroid 11-beta-dehydrogenase isozyme 1 [Zea mays]
Length=349

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M  ++++  LN V  P    SLL  +PP+ ++K   S L  +F ED+AGKV++ITGASS
Sbjct  1    MAPDLVNGVLNWVGTPAMVASLLLFYPPYYLFKTCYSFLSWLFPEDLAGKVVLITGASS  59



>ref|XP_010482377.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 isoform 
X2 [Camelina sativa]
Length=272

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M++ ++K +NL+ P  T ++LL  +P +Q  K  +SI  ++F+E+V+G+V++ITGA+S
Sbjct  1    MMDPVNKIINLLFPLLTLYALLVFYPTYQRLKSAVSICRNLFSENVSGRVVVITGAAS  58



>gb|KDP22587.1| hypothetical protein JCGZ_26418 [Jatropha curcas]
Length=396

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +1

Query  91   TMMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            T  +++I+K +N+V  P    +L    P +  +K+ LS    +F+EDV+GKV++ITGASS
Sbjct  34   TEAMDLINKLMNIVFAPLAVLALYHFLPTYHFFKYLLSTYNKIFSEDVSGKVVLITGASS  93



>ref|XP_010442549.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B [Camelina 
sativa]
Length=350

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +KF  SI  ++F+E++ GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFYFFKFVQSIFSTIFSENLHGKVVLITGASS  57



>ref|NP_001066740.1| Os12g0464400 [Oryza sativa Japonica Group]
 dbj|BAF29759.1| Os12g0464400, partial [Oryza sativa Japonica Group]
Length=393

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M+++++  LN VA P    SLL  +PP+ ++K   S L  +F +D+A KV++ITGASS
Sbjct  45   MVDLVNGVLNWVATPAMVASLLLFYPPYYLFKTVHSFLSYLFPDDLARKVVLITGASS  102



>ref|XP_009134064.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brassica 
rapa]
Length=341

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +KF  SI  ++F E++ GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFIFFKFLQSIFSTIFCENLNGKVVLITGASS  57



>emb|CDY34029.1| BnaC03g27860D [Brassica napus]
Length=341

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +KF  SI  ++F E++ GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFIFFKFLQSIFSTIFCENLNGKVVLITGASS  57



>gb|ACG69524.1| steroleosin SLO1-3 [Brassica napus]
Length=341

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +KF  SI  ++F E++ GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFIFFKFLQSIFSTIFCENLNGKVVLITGASS  57



>ref|XP_010482376.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 isoform 
X1 [Camelina sativa]
Length=343

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M++ ++K +NL+ P  T ++LL  +P +Q  K  +SI  ++F+E+V+G+V++ITGA+S
Sbjct  1    MMDPVNKIINLLFPLLTLYALLVFYPTYQRLKSAVSICRNLFSENVSGRVVVITGAAS  58



>ref|XP_002322681.2| hypothetical protein POPTR_0016s04940g [Populus trichocarpa]
 gb|EEF04442.2| hypothetical protein POPTR_0016s04940g [Populus trichocarpa]
Length=326

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M    IH+ LN+V P     S+L + PP+ V+K    I  S+F E+VAGKV++ITGASS
Sbjct  1    MATTSIHRLLNIVFPLTIIISILVILPPYLVFKLLSYIKRSMFTENVAGKVVLITGASS  59



>gb|ABA98146.2| oxidoreductase, short chain dehydrogenase/reductase family protein, 
expressed [Oryza sativa Japonica Group]
Length=349

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M+++++  LN VA P    SLL  +PP+ ++K   S L  +F +D+A KV++ITGASS
Sbjct  1    MVDLVNGVLNWVATPAMVASLLLFYPPYYLFKTVHSFLSYLFPDDLARKVVLITGASS  58



>ref|XP_006436879.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
 ref|XP_006493235.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Citrus 
sinensis]
 gb|ESR50119.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
Length=359

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++++++FLN+VAP  T   L    P + ++KF   ++ ++ AEDVAGKV++ITGASS
Sbjct  1    MDLVNEFLNIVAPVLTIAILPSFLPLYLLFKFLHFVIRTINAEDVAGKVVLITGASS  57



>ref|XP_010086989.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
 gb|EXB25268.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
Length=311

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVF--AEDVAGKVIIITGASS  270
            +++IHKFLNLV PP    ++L   PPF +YK F     ++F   E++AGKV++ITG SS
Sbjct  1    MDLIHKFLNLVLPPAALIAILVFLPPFLIYKLFKHFT-NLFKPTENLAGKVVLITGGSS  58



>gb|EEE53178.1| hypothetical protein OsJ_36031 [Oryza sativa Japonica Group]
Length=357

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M+++++  LN VA P    SLL  +PP+ ++K   S L  +F +D+A KV++ITGASS
Sbjct  1    MVDLVNGVLNWVATPAMVASLLLFYPPYYLFKTVHSFLSYLFPDDLARKVVLITGASS  58



>ref|XP_004962634.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Setaria 
italica]
Length=348

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++++  LN V  P     LL  +PP+ ++K   S L  +F EDVAGKV+++TGASS
Sbjct  1    MDLVNGVLNWVVTPAMVAGLLLFYPPYYLFKSCYSFLSWLFPEDVAGKVVLVTGASS  57



>gb|EEC69238.1| hypothetical protein OsI_38254 [Oryza sativa Indica Group]
Length=357

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M+++++  LN VA P    SLL  +PP+ ++K   S L  +F +D+A KV++ITGASS
Sbjct  1    MVDLVNGVLNWVATPAMVASLLLFYPPYYLFKTVHSFLSYLFPDDLARKVVLITGASS  58



>gb|KDO64429.1| hypothetical protein CISIN_1g042560mg, partial [Citrus sinensis]
Length=287

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++++++FLN+VAP  T   L    P + ++KF   ++ ++ AEDVAGKV++ITGASS
Sbjct  1    MDLVNEFLNIVAPVLTIAILPSFLPLYLLFKFLHFVIRTINAEDVAGKVVLITGASS  57



>ref|XP_002463266.1| hypothetical protein SORBIDRAFT_02g040840 [Sorghum bicolor]
 gb|EER99787.1| hypothetical protein SORBIDRAFT_02g040840 [Sorghum bicolor]
Length=348

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++++  LN V  P     LL  +PP+ ++K   S L  +F ED+AGKV++ITGASS
Sbjct  1    MDLVNGVLNWVGTPAMVACLLLFYPPYYLFKTCYSFLSWLFPEDLAGKVVLITGASS  57



>ref|XP_001767568.1| predicted protein [Physcomitrella patens]
 gb|EDQ67703.1| predicted protein [Physcomitrella patens]
Length=341

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  118  FLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            FLNLV PP    +LL +WP   +YK  +  L  V  ED+ GKV++ITGASS
Sbjct  7    FLNLVVPPSAAVTLLLVWPVLALYKTMMWWLSWVLYEDMRGKVVLITGASS  57



>gb|KDP22589.1| hypothetical protein JCGZ_26420 [Jatropha curcas]
Length=197

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IHKF N+V PP     L+   P + V++F   +   +F E+VAGKV+++TGA+S
Sbjct  1    MDLIHKFFNIVLPPLNIILLVCFLPLYLVFRFAYCLKRHIFIENVAGKVVLVTGAAS  57



>ref|NP_199890.1| hydroxysteroid dehydrogenase 6 [Arabidopsis thaliana]
 sp|Q9LUE4.1|HSD6_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase-like 6; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase-like 6; AltName: 
Full=Hydroxysteroid dehydrogenase 6; Short=AtHSD6 [Arabidopsis 
thaliana]
 dbj|BAA96990.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAW49294.1| At5g50770 [Arabidopsis thaliana]
 gb|AED95990.1| hydroxysteroid dehydrogenase 6 [Arabidopsis thaliana]
Length=342

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ I+K +N + P  T ++LL  +P +Q  K  +SI  ++F+E+VAGKV++ITGA+S
Sbjct  1    MDSINKIINFLFPLLTLYALLVFYPTYQRLKSAVSICRNLFSENVAGKVVVITGAAS  57



>ref|XP_006664013.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Oryza 
brachyantha]
Length=349

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M++V++   N VA P    SLL  +PP+ +++   S L  +F ED+  KV++ITGASS
Sbjct  1    MVDVVNGVFNWVATPAMVGSLLLFYPPYYLFRTVYSFLSYLFPEDLTRKVVLITGASS  58



>ref|XP_003576230.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brachypodium 
distachyon]
Length=349

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M+++++  LN VA P    S L  +PP+ ++K   S L  +F ED++ KV++ITGASS
Sbjct  1    MMDLVNGVLNWVAAPSMVASFLLFYPPYYLFKTCYSFLSYLFPEDLSRKVVLITGASS  58



>ref|XP_010482368.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Camelina 
sativa]
Length=350

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF  +K   SI  ++F+E++ GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFYFFKLVQSIFSTIFSENLHGKVVLITGASS  57



>gb|ACG69523.1| steroleosin SLO1-2 [Brassica napus]
 emb|CDY68167.1| BnaCnng57830D [Brassica napus]
Length=349

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ F NL AP FTFF L F  PPF  +KF  SI  ++F+E++ GKV++ITGASS
Sbjct  1    MELINDFFNLTAPFFTFFGLCFFLPPFYFFKFVQSIFSTIFSENLYGKVVLITGASS  57



>gb|KFK26701.1| hypothetical protein AALP_AA8G282300 [Arabis alpina]
Length=343

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVF-AEDVAGKVIIITGASS  270
            +++I+K +N V PP   + L   +P +Q  K  +SI  ++F +E+VAGKV+IITGA+S
Sbjct  1    MDLINKIINFVFPPLALYGLFVFYPTYQRLKSLVSICRNLFFSENVAGKVVIITGAAS  58



>ref|XP_008811369.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Phoenix 
dactylifera]
Length=330

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++I KF+NL APP    +L FL PP   +K FLS + S+F ED+  KV++ITGASS
Sbjct  1    MDLITKFMNLFAPPTLLTALFFLLPPLYFFKLFLSFISSLFPEDMLHKVVLITGASS  57



>ref|XP_010442316.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 [Camelina 
sativa]
Length=342

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ I+K +N + P  T ++LL  +P +Q  K  +SI  ++F E+VAGKV++ITGA+S
Sbjct  1    MDPINKIINFLFPLLTLYALLVFYPTYQRLKSVVSICRNLFPENVAGKVVVITGAAS  57



>emb|CDX91557.1| BnaC02g16030D [Brassica napus]
Length=286

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ I++ +N V PP   + L   +P +Q  K  +SI  +V  E+VAGKV++ITGA+S
Sbjct  1    MDSINRIINFVFPPLALYGLFVFYPIYQRLKSAVSIWRNVLRENVAGKVVLITGAAS  57



>ref|XP_010086987.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
 gb|EXB25266.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
Length=373

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M+E+IHKFLNL AP FTFFSL   +PPF  +KF   +L  VF+E++AGKV++ITGASS
Sbjct  1    MVELIHKFLNLTAPTFTFFSLFLFYPPFLFFKFCQFLLSYVFSENIAGKVVLITGASS  58



>ref|XP_009127342.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 isoform 
X1 [Brassica rapa]
Length=313

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ +++ +N V PP   + L   +P +Q  K  +SI  +V +E+VAGKV++ITGA+S
Sbjct  1    MDSVNRIINFVFPPLALYGLFVFYPIYQRLKSAVSIWRNVLSENVAGKVVLITGAAS  57



>gb|ABM90633.1| short-chain dehydrogenase reductase [Brassica napus]
 gb|ADW77633.1| steroleosin-A [Brassica napus]
 gb|ADW77634.1| steroleosin-A [Brassica napus]
Length=349

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLNL AP FTFF L F  PPF   KF  SI  ++ +E+V GKV++ITGASS
Sbjct  1    MELINDFLNLTAPFFTFFGLCFFLPPFYFSKFVQSIFSTISSENVYGKVVLITGASS  57



>emb|CDY16351.1| BnaA02g11550D [Brassica napus]
Length=311

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ +++ +N V PP   + L   +P +Q  K  +SI  +V +E+VAGKV++ITGA+S
Sbjct  1    MDSVNRIINFVFPPLALYGLFVFYPIYQRLKSAVSIWRNVLSENVAGKVVLITGAAS  57



>ref|XP_009127343.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 isoform 
X2 [Brassica rapa]
Length=312

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ +++ +N V PP   + L   +P +Q  K  +SI  +V +E+VAGKV++ITGA+S
Sbjct  1    MDSVNRIINFVFPPLALYGLFVFYPIYQRLKSAVSIWRNVLSENVAGKVVLITGAAS  57



>ref|XP_009359394.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Pyrus 
x bretschneideri]
Length=312

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ IHK LN+V P   F   LF  P F VYK    I  S   E++AGKVI+ITGASS
Sbjct  1    MDSIHKVLNVVVPLLIFIGSLFFLPYFLVYKLISFIYRSKSTENIAGKVILITGASS  57



>ref|XP_006282170.1| hypothetical protein CARUB_v10028440mg [Capsella rubella]
 gb|EOA15068.1| hypothetical protein CARUB_v10028440mg [Capsella rubella]
Length=342

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ I+K +N + P  T ++L+  +P +Q  K   SI  ++F+E+VAGKV++ITGA+S
Sbjct  1    MDSINKIINFLFPLLTLYALVVFYPTYQRLKSAFSICRNLFSENVAGKVVVITGAAS  57



>ref|XP_004141553.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
 ref|XP_004162860.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
 gb|KGN52682.1| hypothetical protein Csa_5G650470 [Cucumis sativus]
Length=360

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E+I+ FLN+V PP + F L F WP          I  S   ED+  KV+IITGASS
Sbjct  1    MELINSFLNVVVPPASLFMLAFSWPALSFISACEWIYNSFNTEDMEDKVVIITGASS  57



>ref|XP_004977951.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Setaria 
italica]
Length=350

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  157  LLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            L  L PP+ V+K    +LG+VF EDVAGKV++ITGASS
Sbjct  20   LAVLLPPYYVWKLTTYLLGAVFPEDVAGKVVLITGASS  57



>ref|XP_010271122.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X3 [Nelumbo nucifera]
Length=335

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 8/61 (13%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFF----SLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGAS  267
            + +IHKFLNLV PP        S LFL     +++ F  I  S+F+E++AGKV++ITG S
Sbjct  1    MNLIHKFLNLVLPPIALIILCVSTLFLL----IFRLFSCISRSIFSENMAGKVVVITGGS  56

Query  268  S  270
            S
Sbjct  57   S  57



>ref|XP_010086988.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
 gb|EXB25267.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
Length=310

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +1

Query  109  IHKFLNLVAPPFTFFSLLFLWPPFQVYKFF-LSILGSVFAEDVAGKVIIITGASS  270
            IHKFLN+V P  T  ++L   PPF +YK F  +I      E +AGKV++ITGASS
Sbjct  4    IHKFLNVVLPLLTLVTILLFLPPFFIYKLFNYTIKAFRQTEKLAGKVVLITGASS  58



>ref|XP_006844627.1| hypothetical protein AMTR_s00016p00227990 [Amborella trichopoda]
 gb|ERN06302.1| hypothetical protein AMTR_s00016p00227990 [Amborella trichopoda]
Length=348

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  106  VIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            VI+  L+LV PP     L   +P +   K FL ++  + A+D+ GKV++ITGASS
Sbjct  3    VINNLLSLVLPPTAIVFLSLCYPTYATLKLFLYLISPILADDMRGKVVLITGASS  57



>emb|CDP14997.1| unnamed protein product [Coffea canephora]
Length=230

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ ++H+FLN     F+  +     PP+ V+K+   I  S+F+ED+ GKV++ITGASS
Sbjct  25   VITLVHRFLNTFVARFSVNAPFSFLPPYLVFKYLDYIRRSIFSEDLTGKVVLITGASS  82



>ref|XP_002511144.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
 gb|EEF51746.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
Length=317

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/56 (38%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGAS  267
            ++++H+  N+V PP     +L   PP+ V+K    I   +  E+VAGKV++ITGA+
Sbjct  1    MDLMHELFNIVLPPINIILILCFLPPYLVFKILYYIKRHISIENVAGKVVLITGAA  56



>ref|XP_006436880.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
 gb|ESR50120.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
Length=282

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++++++FLN+VAP  T   L    P + ++KF   ++ ++ AEDVAGKV++ITGASS
Sbjct  1    MDLVNEFLNIVAPVLTIAILPSFLPLYLLFKFLHFVIRTINAEDVAGKVVLITGASS  57



>gb|EMT26675.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Aegilops 
tauschii]
Length=307

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  172  PPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            PP+ VY+F  S LGSVF ++V+GKV++ITGASS
Sbjct  26   PPYYVYRFTASFLGSVFPDNVSGKVVLITGASS  58



>ref|XP_010695411.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Beta 
vulgaris subsp. vulgaris]
Length=342

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            + ++H+ LN+     TF ++L   PP    +F +S L  +F+E+VAGKV++ITGASS
Sbjct  1    MNLVHQILNVAISLITFMTILISLPPLLFLRFVISNLRYIFSENVAGKVVLITGASS  57



>ref|XP_010277349.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=317

 Score = 49.3 bits (116),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++ IH FLNLV+PP  F  L   +P   +++F   IL  ++ E++AGKV++ITGASS
Sbjct  1    MDNIHSFLNLVSPPIAFLLLCLTFPLLIIFRFIRFILAYIYMENMAGKVVLITGASS  57



>gb|KHN23681.1| hypothetical protein glysoja_039132 [Glycine soja]
Length=204

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVA  237
            +++IHKFLN+VA   TFF L    PP+  +KFFL I   +F+E+VA
Sbjct  1    MDLIHKFLNIVASITTFFFLCLFLPPYWTFKFFLYITNYIFSENVA  46



>dbj|BAK03741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  172  PPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            PP+ VYK   S LGSVF ++V+GKV++ITGASS
Sbjct  42   PPYYVYKLTASFLGSVFPDNVSGKVVLITGASS  74



>ref|XP_002994525.1| hypothetical protein SELMODRAFT_138761 [Selaginella moellendorffii]
 gb|EFJ04409.1| hypothetical protein SELMODRAFT_138761 [Selaginella moellendorffii]
Length=347

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 6/60 (10%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPF---QVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++++  FLNLV PP   F L   WPP        +FLS    VF E+V GKV+++TGA+S
Sbjct  1    MDLVQFFLNLVVPPMGLFFLALAWPPLTFMNACHWFLSF---VFRENVRGKVVVVTGATS  57



>ref|XP_007038041.1| Glucose 1-dehydrogenase, putative [Theobroma cacao]
 gb|EOY22542.1| Glucose 1-dehydrogenase, putative [Theobroma cacao]
Length=319

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++I+KF+N +    +  +L FL   ++ +K  LS + ++F E+V GKVI+ITGASS
Sbjct  1    MDLINKFMNAIVATISLIALFFLLHHYRFFKSLLSTVRTIFKENVTGKVILITGASS  57



>gb|EMS53803.1| Dehydrogenase/reductase SDR family protein 7-like protein [Triticum 
urartu]
Length=305

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++++  LN  A P    +LL  +PP+ ++K   S L  +F +D+  KV++ITGASS
Sbjct  1    MDLVNGVLNWAAMPAMVTTLLLFYPPYYLFKLCYSFLSYLFPDDLKRKVVLITGASS  57



>gb|EMT12098.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=882

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/76 (36%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = +1

Query  55   SFKVSR----SVEEIHTMMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVF  222
            SF VS      +E      +++++  LN  A P    SLL  +PP+ ++K   S L  +F
Sbjct  565  SFHVSAPGACELESKRPETMDLVNGALNWAAMPAMVASLLLFYPPYYLFKLCYSFLSYLF  624

Query  223  AEDVAGKVIIITGASS  270
             +D+  KV++ITGASS
Sbjct  625  PDDLKRKVVLITGASS  640



>ref|XP_010525337.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Tarenaya 
hassleriana]
Length=307

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  106  VIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            + +K LN V PPF F  LL   P   ++K F  +     AE+VAGKV++ITGASS
Sbjct  3    LTNKTLNNVLPPFAFLFLLVSSPLLFLFKLFRYVQRCRTAENVAGKVVVITGASS  57



>ref|XP_009602452.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
tomentosiformis]
Length=353

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++L++IHK LN   P  +  +L+   P +   KF   I  S+F+E+VAGKV++ITGASS
Sbjct  3    LVLDLIHKILNTYLPHISTTALIHFMPLYLFLKFLHFIFRSIFSENVAGKVVLITGASS  61



>gb|EYU23067.1| hypothetical protein MIMGU_mgv1a009247mg [Erythranthe guttata]
Length=348

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++++ FLN+ AP FT  +  F +P + ++K    +  SVF E+VAGKV++I GASS
Sbjct  1    MDLVNGFLNIFAPIFTVGAFTFFFPGYLLFKSLRYLWRSVFIENVAGKVVVIAGASS  57



>ref|XP_008459623.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Cucumis 
melo]
Length=360

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 31/57 (54%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +E I+ FLNLV PP +   L F WP          I  S   ED+  KV+IITGASS
Sbjct  1    MEFINSFLNLVVPPASLVMLAFSWPALSFISACEWIYNSFNTEDMEDKVVIITGASS  57



>ref|XP_010421918.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Camelina 
sativa]
Length=377

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFA-EDVAGKVIIITGASS  270
            M+++++  +NLVAPP T   + F WP      F   +  S FA E++  KV++ITGASS
Sbjct  1    MVDLLNSVMNLVAPPATMVVMAFAWPLLSFISFSERVYNSYFATENMEDKVVVITGASS  59



>ref|XP_006289482.1| hypothetical protein CARUB_v10003016mg [Capsella rubella]
 gb|EOA22380.1| hypothetical protein CARUB_v10003016mg [Capsella rubella]
Length=389

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFA-EDVAGKVIIITGASS  270
            M+++++  +NLVAPP T   + F WP      F   +  S FA E++  KV++ITGASS
Sbjct  1    MVDLLNSVMNLVAPPATMVVMAFAWPLLSFISFSERVYNSYFATENMEDKVVVITGASS  59



>ref|XP_004297522.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Fragaria vesca subsp. vesca]
Length=348

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++I+  LN+V PP     LLF  PP+   KF LSI+  +F E+VAGKVI+ITGASS
Sbjct  1    MDIINTLLNIVLPPIGLTLLLFFLPPYLFLKFLLSIIRPLFCENVAGKVILITGASS  57



>ref|XP_010455398.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Camelina 
sativa]
Length=382

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFA-EDVAGKVIIITGASS  270
            M+++++  +NLVAPP T   + F WP      F   +  S FA E++  KV++ITGASS
Sbjct  1    MVDLLNSVMNLVAPPATMVVMAFAWPLLSFISFSERVYNSYFATENMEDKVVVITGASS  59



>gb|KHG01718.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Gossypium 
arboreum]
 gb|KHG29574.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Gossypium 
arboreum]
Length=355

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFA-EDVAGKVIIITGASS  270
            M++++  FLNLV PP T   L F WP          +  +++  ED+ GKV+IITGASS
Sbjct  1    MMDLMTSFLNLVVPPATMMMLAFSWPALCFINACEWVYNTLYTIEDMDGKVVIITGASS  59



>ref|XP_002973836.1| hypothetical protein SELMODRAFT_100351 [Selaginella moellendorffii]
 gb|EFJ24791.1| hypothetical protein SELMODRAFT_100351 [Selaginella moellendorffii]
Length=346

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 31/57 (54%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++I   LNLV PP     LL  WP      F+  I     AE+V GKV +ITGASS
Sbjct  1    MDLIQMLLNLVVPPLGLVFLLLTWPAVAFLSFWRWIFSYALAENVRGKVAVITGASS  57



>ref|XP_002966954.1| hypothetical protein SELMODRAFT_87233 [Selaginella moellendorffii]
 gb|EFJ31553.1| hypothetical protein SELMODRAFT_87233 [Selaginella moellendorffii]
Length=347

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 6/60 (10%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPF---QVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++++  FLNLV PP   F L   WPP        +FLS    VF E+V GKV+++TGA+S
Sbjct  1    MDLVQFFLNLVVPPTGLFFLALAWPPLTFMNACHWFLSF---VFRENVRGKVVVVTGATS  57



>ref|XP_010437678.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Camelina 
sativa]
Length=382

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFA-EDVAGKVIIITGASS  270
            M+++++  +NLVAPP T   + F WP      F   +  S FA E++  KV++ITGASS
Sbjct  1    MVDLLNSVMNLVAPPATMVVMAFAWPLLSFISFSERVYNSYFATENMEDKVVVITGASS  59



>ref|XP_002872483.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH48742.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=382

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFA-EDVAGKVIIITGASS  270
            M+++++  +NLVAPP T   + F WP      F   +  S FA E++  KV++ITGASS
Sbjct  1    MVDLLNSVMNLVAPPATMVVMAFAWPLLSFISFSERVYNSYFATENMEDKVVVITGASS  59



>ref|XP_006397111.1| hypothetical protein EUTSA_v10029315mg [Eutrema salsugineum]
 gb|ESQ38564.1| hypothetical protein EUTSA_v10029315mg [Eutrema salsugineum]
Length=401

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFA-EDVAGKVIIITGASS  270
            M+++++  +NLVAPP T   + F WP      F   +  S FA ED+  KV++ITGASS
Sbjct  1    MVDLLNSVMNLVAPPATMVVMAFSWPLLCFISFSERLYNSYFATEDMEDKVVVITGASS  59



>ref|XP_004242256.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Solanum 
lycopersicum]
Length=384

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M+++++  LN V PP +   L F WP          +  S F ED+  K++IITGASS
Sbjct  1    MMDLVNSVLNFVVPPASLVMLAFSWPALYFINTCERMYNSFFGEDMEDKIVIITGASS  58



>gb|ABI20736.1| 11-beta-hydroxysteroid dehydrogenase-like protein [Triticum aestivum]
Length=349

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++++  LN  A P    +LL  +PP+ ++K   S L  +F +D+  KV++ITGASS
Sbjct  1    MDLVNGALNWAAMPAMVAALLLFYPPYYLFKLCYSFLSYLFPDDLKRKVVLITGASS  57



>ref|XP_004981097.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5-like [Setaria 
italica]
Length=354

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M +V++  ++LV PP +   L F WP     +    +L ++  ED+ GKV++ITGASS
Sbjct  1    MDQVVNAVMDLVVPPASMVMLAFAWPTLSFLRGVEWVLKTLTKEDMLGKVVVITGASS  58



>gb|ABS28874.1| steroleosin-A [Arachis hypogaea]
 gb|ABX38844.1| steroleosin A [Arachis hypogaea]
Length=349

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++IH FLNLVAPPFTFF L    PP+   KF +SIL  + +E+VAGKV+ ITGASS
Sbjct  1    MDLIHTFLNLVAPPFTFFFLCLFLPPYWGLKFMVSILSWLLSENVAGKVVHITGASS  57



>tpg|DAA38129.1| TPA: hypothetical protein ZEAMMB73_775961 [Zea mays]
Length=148

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  172  PPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            P + VYK    +LG+VF EDVAGKV++ITGASS
Sbjct  27   PAYYVYKLTTYLLGAVFPEDVAGKVVLITGASS  59



>ref|NP_001145589.1| uncharacterized protein LOC100279063 [Zea mays]
 gb|ACG48762.1| hypothetical protein [Zea mays]
Length=377

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M +V++  ++LV PP +   L F WP     +     L ++  ED+ GKV++ITGASS
Sbjct  1    MEQVVNTVMDLVVPPASMVMLAFAWPTLSFLRGVEWTLKTLTKEDMLGKVVVITGASS  58



>ref|XP_008668191.1| PREDICTED: steroleosin isoform X2 [Zea mays]
Length=368

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  157  LLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            L  + P + VYK    +LG+VF EDVAGKV++ITGASS
Sbjct  22   LPLVLPAYYVYKLTTYLLGAVFPEDVAGKVVLITGASS  59



>ref|XP_008668190.1| PREDICTED: steroleosin isoform X1 [Zea mays]
Length=373

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  157  LLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            L  + P + VYK    +LG+VF EDVAGKV++ITGASS
Sbjct  22   LPLVLPAYYVYKLTTYLLGAVFPEDVAGKVVLITGASS  59



>ref|XP_006356566.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5-like [Solanum 
tuberosum]
Length=384

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/58 (38%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            M+++++  LN V PP +   L F WP          +  S F ED+  K++IITGASS
Sbjct  1    MMDLVNSVLNFVVPPASLVMLAFSWPALYFINTCERMYNSFFGEDMEDKIVIITGASS  58



>ref|NP_001152614.1| steroleosin [Zea mays]
 gb|ACG48577.1| steroleosin [Zea mays]
 tpg|DAA38130.1| TPA: steroleosin [Zea mays]
Length=350

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  157  LLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            L  + P + VYK    +LG+VF EDVAGKV++ITGASS
Sbjct  22   LPLVLPAYYVYKLTTYLLGAVFPEDVAGKVVLITGASS  59



>ref|XP_004975422.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Setaria 
italica]
Length=370

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/71 (37%), Positives = 39/71 (55%), Gaps = 1/71 (1%)
 Frame = +1

Query  58   FKVSRSVEEIHTMMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVA  237
             KV  ++    T   ++++ F++  A        +FL PP+ VYK   S    V  EDVA
Sbjct  7    LKVGYTILRSETPATDLVNTFMDWAARRSLLLLAIFL-PPYYVYKLATSAFAVVAPEDVA  65

Query  238  GKVIIITGASS  270
            GKV+++TGASS
Sbjct  66   GKVVLVTGASS  76



>ref|XP_010243359.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=364

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 40/63 (63%), Gaps = 1/63 (2%)
 Frame = +1

Query  85   IHTMMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVF-AEDVAGKVIIITG  261
            I   ++++IH+ LNLV PP +   L    P   +++    I+ S+F +E++ GKV++ITG
Sbjct  21   IKVQVMDLIHQLLNLVLPPISLIILCVSIPLLLIFRLVRCIIQSIFISENLTGKVVLITG  80

Query  262  ASS  270
            ASS
Sbjct  81   ASS  83



>ref|XP_009765827.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
sylvestris]
Length=353

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   MMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            ++L++IHK LN   P     +L+   P +   KF   I  S+F+E+VAGKV++ITGASS
Sbjct  3    LVLDLIHKILNAYLPHMATTALIHFMPLYLFLKFLHFIFRSIFSENVAGKVVLITGASS  61



>ref|XP_007038039.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein, putative 
[Theobroma cacao]
 gb|EOY22540.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein, putative 
[Theobroma cacao]
Length=407

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 4/87 (5%)
 Frame = +1

Query  10   LSLSTCIYIIALLFLSFKVSRSVEEIHTMMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVY  189
            +  ST + I+ L   SF    S++      ++ IHK +N++ PP     LLF  PP+ ++
Sbjct  72   IDYSTSVIILVLQGASF----SIQLQTAKAMDFIHKLINILFPPIAILLLLFFLPPYLIF  127

Query  190  KFFLSILGSVFAEDVAGKVIIITGASS  270
            K+F  I+ S  +E+VAGKV++ITGASS
Sbjct  128  KYFSYIIRSFCSENVAGKVVLITGASS  154



>ref|XP_003579631.2| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brachypodium 
distachyon]
Length=352

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  157  LLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            L+   P + VYK   S+L S+F EDVAGKV++ITGASS
Sbjct  23   LVLFLPAYYVYKLTTSLLRSLFPEDVAGKVVLITGASS  60



>ref|XP_009622010.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Nicotiana 
tomentosiformis]
Length=367

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 31/57 (54%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++++  LN V PP +   L F WP          +  S F ED+  KV+IITGASS
Sbjct  1    MDLVNSVLNFVVPPASLVMLAFAWPALTFINTCEWLYNSFFGEDMEDKVVIITGASS  57



>emb|CAN76088.1| hypothetical protein VITISV_028806 [Vitis vinifera]
Length=392

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++I+  LNLV PP +   L F WP          +  ++++E++  KV+IITGASS
Sbjct  1    MDLINSLLNLVVPPASLVMLAFAWPALSFINACEWVYNTLYSENMEDKVVIITGASS  57



>gb|ACF75106.1| Ste-b [Brassica napus]
Length=461

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVF-AEDVAGKVIIITGASS  270
            M+++++  +NLVAPP T   + F WP      F   +  S F  ED+  KV++ITGASS
Sbjct  1    MVDLLNSVMNLVAPPATMVVMAFSWPLLCFITFSERLYNSYFVTEDMEDKVVVITGASS  59



>ref|NP_192740.1| hydroxysteroid dehydrogenase 5 [Arabidopsis thaliana]
 sp|Q9T0G0.1|HSD5_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase-like 5; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase-like 5; AltName: 
Full=Hydroxysteroid dehydrogenase 5; Short=AtHSD5 [Arabidopsis 
thaliana]
 emb|CAB39626.1| putative oxidoreductase [Arabidopsis thaliana]
 emb|CAB78125.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AEE82830.1| hydroxysteroid dehydrogenase 5 [Arabidopsis thaliana]
Length=389

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFA-EDVAGKVIIITGASS  270
            M+++++  +NLVAPP T   + F WP      F      S FA E++  KV++ITGASS
Sbjct  1    MVDLLNSVMNLVAPPATMVVMAFAWPLLSFISFSERAYNSYFATENMEDKVVVITGASS  59



>gb|KGN64430.1| hypothetical protein Csa_1G051680 [Cucumis sativus]
Length=351

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  136  PPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            PP +  S  F  P +  +K   SI+ SVF+EDVAGKV++ITGASS
Sbjct  13   PPTSLISFFFFLPIYLFFKSLSSIIRSVFSEDVAGKVVLITGASS  57



>emb|CDX90742.1| BnaA03g24220D [Brassica napus]
Length=451

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVF-AEDVAGKVIIITGASS  270
            M+++++  +NLVAPP T   + F WP      F   +  S F  ED+  KV++ITGASS
Sbjct  1    MVDLLNSVMNLVAPPATMVVMAFSWPLLCFISFSERLYNSYFVTEDMEDKVVVITGASS  59



>ref|XP_009134177.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Brassica 
rapa]
Length=447

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVF-AEDVAGKVIIITGASS  270
            M+++++  +NLVAPP T   + F WP      F   +  S F  ED+  KV++ITGASS
Sbjct  1    MVDLLNSVMNLVAPPATMVVMAFSWPLLCFISFSERLYNSYFVTEDMEDKVVVITGASS  59



>gb|ACG69526.1| steroleosin SLO2-2 [Brassica napus]
Length=461

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 1/59 (2%)
 Frame = +1

Query  97   MLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVF-AEDVAGKVIIITGASS  270
            M+++++  +NLVAPP T   + F WP      F   +  S F  ED+  KV++ITGASS
Sbjct  1    MVDLLNSVMNLVAPPATMVVMAFSWPLLCFISFSERLYNSYFVTEDMEDKVVVITGASS  59



>ref|XP_008669501.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Zea 
mays]
Length=350

 Score = 46.2 bits (108),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/71 (34%), Positives = 39/71 (55%), Gaps = 1/71 (1%)
 Frame = +1

Query  58   FKVSRSVEEIHTMMLEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVA  237
             KV  ++    T   ++++ F++  A        +FL PP+ +YK   S   +   EDVA
Sbjct  7    LKVGYTILRSETPATDLVNTFMDWAARRSLMLLAIFL-PPYYIYKLTTSAFAAAVPEDVA  65

Query  238  GKVIIITGASS  270
            GKV++ITGA+S
Sbjct  66   GKVVLITGAAS  76



>ref|XP_009617211.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Nicotiana 
tomentosiformis]
Length=349

 Score = 46.2 bits (108),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 31/57 (54%), Gaps = 0/57 (0%)
 Frame = +1

Query  100  LEVIHKFLNLVAPPFTFFSLLFLWPPFQVYKFFLSILGSVFAEDVAGKVIIITGASS  270
            +++++  LN V PP +   L   WP F        +  + F ED+  KV+IITGASS
Sbjct  1    MDLVNSVLNFVVPPASLVMLACAWPAFTFINICERLYNTFFGEDMEDKVVIITGASS  57



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 530965476660