BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17521_g2_i1 len=1000 path=[978:0-999]

Length=1000
                                                                      Score     E

gb|EYU23068.1|  hypothetical protein MIMGU_mgv1a009201mg                313   8e-101   
ref|XP_006347650.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    308   4e-99    
ref|XP_009760328.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    306   2e-98    
ref|XP_004235330.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    303   4e-97    
ref|XP_006347480.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    303   5e-97    
ref|XP_004241449.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    302   9e-97    
gb|AAL09328.1|AF302806_1  steroleosin                                   302   1e-96    Sesamum indicum [beniseed]
ref|XP_011073095.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    302   1e-96    
ref|XP_010026329.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    296   1e-94    
ref|XP_009629548.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    295   4e-94    
ref|XP_010536612.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    292   1e-92    
ref|XP_008344913.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    291   2e-92    
ref|XP_009359396.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    289   2e-91    
ref|XP_009359395.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    283   3e-89    
ref|XP_008239511.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    281   2e-88    
ref|XP_004297523.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    283   3e-88    
ref|XP_007211139.1|  hypothetical protein PRUPE_ppa026374mg             279   5e-88    
gb|KHG19414.1|  Dehydrogenase/reductase SDR family protein 7-like...    278   3e-87    
gb|KFK22922.1|  hypothetical protein AALP_AAs48765U000100               277   4e-87    
ref|XP_007038038.1|  Hydroxysteroid dehydrogenase 1                     276   9e-87    
gb|ABM90633.1|  short-chain dehydrogenase reductase                     275   5e-86    Brassica napus [oilseed rape]
gb|ABM30178.1|  steroleosin                                             271   5e-86    Brassica napus [oilseed rape]
emb|CDY16353.1|  BnaA02g11570D                                          275   5e-86    
ref|NP_568742.1|  hydroxysteroid dehydrogenase 1                        274   9e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127346.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    273   2e-85    
ref|XP_010929562.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    273   2e-85    
ref|XP_010442549.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    272   4e-85    
ref|XP_002865819.1|  short-chain dehydrogenase/reductase family p...    272   4e-85    
gb|ACG69523.1|  steroleosin SLO1-2                                      272   5e-85    Brassica napus [oilseed rape]
ref|XP_010482368.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    272   7e-85    
emb|CBI15698.3|  unnamed protein product                                270   9e-85    
ref|XP_010663769.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    271   1e-84    
emb|CDX83157.1|  BnaA03g23490D                                          270   1e-84    
gb|ACG69524.1|  steroleosin SLO1-3                                      270   2e-84    Brassica napus [oilseed rape]
gb|ABO71657.1|  short-chain dehydrogenase reductase                     270   3e-84    Brassica napus [oilseed rape]
ref|XP_009784251.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    264   6e-84    
emb|CDY34029.1|  BnaC03g27860D                                          269   6e-84    
ref|XP_002511145.1|  Corticosteroid 11-beta-dehydrogenase, putative     269   7e-84    Ricinus communis
ref|XP_006402075.1|  hypothetical protein EUTSA_v10015475mg             269   9e-84    
ref|XP_010442253.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    269   1e-83    
ref|XP_009134064.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    268   1e-83    
gb|ACG69522.1|  steroleosin SLO1-1                                      268   1e-83    Brassica napus [oilseed rape]
ref|XP_010695411.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    267   4e-83    
ref|XP_010695678.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    267   5e-83    
ref|XP_008439964.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    266   6e-83    
ref|XP_006282100.1|  hypothetical protein CARUB_v10028347mg             266   7e-83    
ref|XP_004145220.1|  PREDICTED: dehydrogenase/reductase SDR famil...    266   1e-82    
ref|XP_010250644.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    265   3e-82    
ref|XP_010086987.1|  Dehydrogenase/reductase SDR family protein 7...    264   1e-81    
ref|XP_004162136.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    263   2e-81    
ref|XP_010249449.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    263   2e-81    
ref|XP_004145221.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    263   2e-81    
ref|XP_008446259.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    262   3e-81    
ref|XP_006436878.1|  hypothetical protein CICLE_v10031969mg             260   2e-80    
ref|XP_010695677.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    257   3e-79    
ref|XP_010929561.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    258   6e-79    
ref|XP_010929560.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    257   8e-79    
ref|XP_006436879.1|  hypothetical protein CICLE_v10031927mg             256   1e-78    
ref|XP_010039131.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    254   9e-78    
ref|XP_004503837.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    251   4e-77    
ref|XP_008239509.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    250   1e-76    
ref|XP_004503736.1|  PREDICTED: dehydrogenase/reductase SDR famil...    250   1e-76    
ref|XP_006844627.1|  hypothetical protein AMTR_s00016p00227990          250   2e-76    
ref|XP_008811369.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    249   2e-76    
ref|XP_008392822.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    249   3e-76    
gb|ABS28874.1|  steroleosin-A                                           246   8e-75    Arachis hypogaea [goober]
gb|EYU23067.1|  hypothetical protein MIMGU_mgv1a009247mg                245   2e-74    
ref|XP_004297522.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    244   2e-74    
ref|XP_004153125.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    244   3e-74    
gb|KDP22587.1|  hypothetical protein JCGZ_26418                         246   3e-74    
ref|XP_006366592.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    243   1e-73    
gb|KHN16857.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     243   2e-73    
ref|XP_011073098.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    242   2e-73    
ref|XP_004162134.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    243   5e-73    
ref|XP_009765827.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    239   3e-72    
ref|XP_008446273.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    239   4e-72    
ref|NP_001242368.1|  uncharacterized protein LOC100787835               239   9e-72    
ref|XP_009602452.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    236   3e-71    
ref|XP_010249088.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    233   9e-71    
ref|XP_010323832.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    234   2e-70    
gb|KEH21006.1|  short-chain dehydrogenase/reductase                     233   6e-70    
ref|XP_010249087.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    234   6e-70    
ref|XP_004173851.1|  PREDICTED: retinol dehydrogenase 2-like            226   6e-69    
ref|XP_008446283.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    229   2e-68    
ref|XP_007160005.1|  hypothetical protein PHAVU_002G285000g             228   7e-68    
ref|XP_004962634.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    227   1e-67    
gb|KGN64430.1|  hypothetical protein Csa_1G051680                       226   3e-67    
ref|XP_004153126.1|  PREDICTED: dehydrogenase/reductase SDR famil...    226   3e-67    
ref|XP_004145219.1|  PREDICTED: uncharacterized protein LOC101220214    230   8e-67    
ref|NP_001136546.1|  corticosteroid 11-beta-dehydrogenase isozyme...    224   1e-66    Zea mays [maize]
gb|KGN64427.1|  hypothetical protein Csa_1G051650                       223   3e-66    
gb|ACG24673.1|  corticosteroid 11-beta-dehydrogenase isozyme 1          223   4e-66    Zea mays [maize]
ref|XP_002463266.1|  hypothetical protein SORBIDRAFT_02g040840          223   4e-66    Sorghum bicolor [broomcorn]
ref|XP_006664013.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    223   5e-66    
ref|XP_002446311.1|  hypothetical protein SORBIDRAFT_06g013980          224   7e-66    Sorghum bicolor [broomcorn]
ref|XP_007211157.1|  hypothetical protein PRUPE_ppa027140mg             221   2e-65    
emb|CAN60641.1|  hypothetical protein VITISV_039526                     226   2e-65    Vitis vinifera
ref|XP_010442316.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    221   3e-65    
ref|XP_010913000.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    221   4e-65    
ref|XP_003581150.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    221   4e-65    
ref|XP_006282170.1|  hypothetical protein CARUB_v10028440mg             220   6e-65    
ref|XP_004975422.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    220   1e-64    
gb|KFK26701.1|  hypothetical protein AALP_AA8G282300                    219   2e-64    
ref|XP_003576230.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    219   2e-64    
ref|XP_010277349.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    217   5e-64    
ref|XP_010910414.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    217   7e-64    
ref|XP_002994525.1|  hypothetical protein SELMODRAFT_138761             217   1e-63    
gb|EEC69238.1|  hypothetical protein OsI_38254                          217   1e-63    Oryza sativa Indica Group [Indian rice]
ref|XP_010482376.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    216   2e-63    
ref|XP_002966954.1|  hypothetical protein SELMODRAFT_87233              216   2e-63    
ref|XP_010086991.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    216   2e-63    
ref|XP_008798974.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    215   4e-63    
gb|ABA98146.2|  oxidoreductase, short chain dehydrogenase/reducta...    215   5e-63    Oryza sativa Japonica Group [Japonica rice]
gb|EEE53178.1|  hypothetical protein OsJ_36031                          215   8e-63    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066740.1|  Os12g0464400                                       215   1e-62    Oryza sativa Japonica Group [Japonica rice]
ref|NP_199890.1|  hydroxysteroid dehydrogenase 6                        213   2e-62    Arabidopsis thaliana [mouse-ear cress]
gb|KDO64429.1|  hypothetical protein CISIN_1g042560mg                   211   2e-62    
dbj|BAF01972.1|  11-beta-hydroxysteroid dehydrogenase-like              207   3e-62    Arabidopsis thaliana [mouse-ear cress]
gb|ABI20736.1|  11-beta-hydroxysteroid dehydrogenase-like protein       213   5e-62    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ85563.1|  predicted protein                                      211   2e-61    
ref|XP_010241532.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    209   5e-61    
ref|XP_010271122.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    208   2e-60    
ref|XP_010271120.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    207   8e-60    
ref|XP_010271121.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    207   8e-60    
ref|XP_010243359.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    206   3e-59    
emb|CDY16351.1|  BnaA02g11550D                                          203   9e-59    
ref|XP_002321718.2|  hypothetical protein POPTR_0015s11200g             202   1e-58    Populus trichocarpa [western balsam poplar]
ref|XP_009405178.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    203   2e-58    
ref|XP_009127343.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    201   4e-58    
ref|XP_010536601.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    201   1e-57    
ref|XP_010086989.1|  Dehydrogenase/reductase SDR family protein 7...    200   1e-57    
gb|EAZ30541.1|  hypothetical protein OsJ_14589                          200   2e-57    Oryza sativa Japonica Group [Japonica rice]
emb|CAH66438.1|  OSIGBa0132D06.4                                        199   1e-56    Oryza sativa [red rice]
ref|NP_001052642.1|  Os04g0390700                                       199   1e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009127342.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    197   2e-56    
ref|XP_008239510.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    196   3e-56    
ref|XP_008798975.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    194   4e-56    
ref|XP_010270763.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    196   6e-56    
ref|XP_011044100.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    194   1e-55    
ref|XP_002321719.2|  short-chain dehydrogenase/reductase family p...    194   1e-55    Populus trichocarpa [western balsam poplar]
ref|XP_010086988.1|  Dehydrogenase/reductase SDR family protein 7...    194   2e-55    
ref|XP_010250645.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    195   2e-55    
ref|XP_002318146.2|  hypothetical protein POPTR_0012s10360g             192   1e-54    Populus trichocarpa [western balsam poplar]
ref|NP_001152614.1|  steroleosin                                        193   1e-54    Zea mays [maize]
ref|XP_006402065.1|  hypothetical protein EUTSA_v10015936mg             191   2e-54    
ref|XP_011023955.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    191   2e-54    
ref|XP_002446312.1|  hypothetical protein SORBIDRAFT_06g013990          192   3e-54    Sorghum bicolor [broomcorn]
dbj|BAK03741.1|  predicted protein                                      192   4e-54    
dbj|BAJ87073.1|  predicted protein                                      191   6e-54    
gb|ABA93830.1|  oxidoreductase, short chain dehydrogenase/reducta...    191   1e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007210136.1|  hypothetical protein PRUPE_ppa022641mg             189   1e-53    
ref|NP_001067940.1|  Os11g0499600                                       191   1e-53    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579631.2|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    190   2e-53    
ref|XP_009359394.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    189   2e-53    
ref|NP_001141666.2|  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase     190   3e-53    Zea mays [maize]
gb|KDP22590.1|  hypothetical protein JCGZ_26421                         183   4e-53    
ref|NP_001147696.1|  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase     189   4e-53    Zea mays [maize]
emb|CDP19889.1|  unnamed protein product                                189   4e-53    
ref|XP_010251331.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    189   4e-53    
ref|XP_010271842.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    187   4e-53    
ref|XP_010253812.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    188   5e-53    
ref|XP_004979317.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    189   6e-53    
ref|XP_004977951.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    188   1e-52    
dbj|BAD23082.1|  putative steroleosin                                   188   1e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010271841.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    187   1e-52    
ref|XP_001767568.1|  predicted protein                                  187   1e-52    
ref|XP_002466880.1|  hypothetical protein SORBIDRAFT_01g015790          187   2e-52    Sorghum bicolor [broomcorn]
ref|XP_006653338.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    186   2e-52    
ref|XP_006648666.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    187   3e-52    
ref|XP_002973836.1|  hypothetical protein SELMODRAFT_100351             187   4e-52    
tpg|DAA63854.1|  TPA: hypothetical protein ZEAMMB73_332488              186   4e-52    
ref|XP_003575023.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    186   6e-52    
ref|XP_002449530.1|  hypothetical protein SORBIDRAFT_05g017960          185   2e-51    Sorghum bicolor [broomcorn]
ref|XP_011023956.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    183   2e-51    
gb|AGT17053.1|  hypothetical protein SHCRBa_201_F17_F_10                185   2e-51    
ref|XP_008670737.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    184   4e-51    
ref|XP_003577550.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    184   6e-51    
ref|XP_002452151.1|  hypothetical protein SORBIDRAFT_04g020710          184   7e-51    Sorghum bicolor [broomcorn]
ref|XP_008666705.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    182   1e-50    
ref|XP_007038039.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    183   3e-50    
ref|XP_010270765.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    180   3e-50    
emb|CBI38150.3|  unnamed protein product                                179   3e-50    
emb|CDP19890.1|  unnamed protein product                                185   4e-50    
ref|XP_010270764.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    180   5e-50    
gb|EMT12098.1|  Pentatricopeptide repeat-containing protein             188   5e-50    
ref|XP_002266761.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    179   1e-49    Vitis vinifera
ref|XP_006662954.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    179   3e-49    
gb|EMS50702.1|  Dehydrogenase/reductase SDR family protein 7-like...    179   3e-49    
ref|XP_006653339.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    179   3e-49    
tpg|DAA38136.1|  TPA: hypothetical protein ZEAMMB73_559137              176   1e-48    
tpg|DAA38134.1|  TPA: hypothetical protein ZEAMMB73_559137              175   1e-48    
ref|NP_001046935.1|  Os02g0511400                                       179   1e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009597072.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    177   1e-48    
emb|CDX91557.1|  BnaC02g16030D                                          175   2e-48    
emb|CAH66439.1|  OSIGBa0132D06.5                                        176   6e-48    Oryza sativa [red rice]
gb|EAZ23188.1|  hypothetical protein OsJ_06873                          175   7e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010037388.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    174   7e-48    
gb|EEC77184.1|  hypothetical protein OsI_15677                          176   7e-48    Oryza sativa Indica Group [Indian rice]
ref|NP_001239786.1|  uncharacterized protein LOC100808990               175   7e-48    
ref|XP_008669501.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    175   1e-47    
gb|EAY86013.1|  hypothetical protein OsI_07374                          176   1e-47    Oryza sativa Indica Group [Indian rice]
ref|NP_001052643.2|  Os04g0390800                                       175   1e-47    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007038041.1|  Glucose 1-dehydrogenase, putative                  172   7e-47    
ref|XP_009778659.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    172   7e-47    
ref|XP_010656935.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    172   8e-47    
emb|CBI38151.3|  unnamed protein product                                172   2e-46    
ref|XP_010536605.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    171   2e-46    
ref|XP_010536604.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    171   2e-46    
gb|KDP22588.1|  hypothetical protein JCGZ_26419                         168   1e-45    
ref|XP_010536608.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    168   1e-45    
ref|XP_002983555.1|  hypothetical protein SELMODRAFT_234271             169   2e-45    
ref|XP_002511144.1|  Corticosteroid 11-beta-dehydrogenase, putative     168   2e-45    Ricinus communis
ref|XP_007160006.1|  hypothetical protein PHAVU_002G285100g             167   3e-45    
emb|CDX83014.1|  BnaA01g20140D                                          164   4e-45    
gb|KEH21004.1|  hydroxysteroid 11-beta-dehydrogenase-like protein       167   6e-45    
ref|XP_009150624.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    166   9e-45    
ref|XP_010536603.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    166   1e-44    
gb|KDO64428.1|  hypothetical protein CISIN_1g044010mg                   164   1e-44    
emb|CDX71662.1|  BnaC09g27030D                                          165   3e-44    
ref|XP_002322680.1|  hypothetical protein POPTR_0016s04930g             164   6e-44    Populus trichocarpa [western balsam poplar]
ref|XP_006360917.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    164   2e-43    
ref|XP_009124895.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    162   2e-43    
ref|XP_007038040.1|  Hydroxysteroid dehydrogenase 2, putative           165   2e-43    
ref|XP_006436880.1|  hypothetical protein CICLE_v10031927mg             162   3e-43    
ref|XP_010086990.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    166   7e-43    
ref|XP_010431074.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    159   8e-43    
ref|XP_011033248.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    161   8e-43    
ref|XP_006404393.1|  hypothetical protein EUTSA_v10010570mg             161   8e-43    
ref|XP_010555563.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    158   7e-42    
ref|XP_009333966.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    159   9e-42    
ref|XP_010536607.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    158   1e-41    
ref|XP_010525337.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    157   2e-41    
gb|EMT06462.1|  hypothetical protein F775_52091                         159   3e-41    
ref|XP_010426176.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    157   3e-41    
gb|EPS67142.1|  hypothetical protein M569_07637                         156   3e-41    
gb|KFK22923.1|  hypothetical protein AALP_AAs48765U000200               156   3e-41    
ref|XP_006402076.1|  hypothetical protein EUTSA_v10014225mg             155   9e-41    
ref|NP_199871.1|  hydroxysteroid dehydrogenase 4                        155   1e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007222177.1|  hypothetical protein PRUPE_ppa007781mg             156   1e-40    
ref|XP_006291536.1|  hypothetical protein CARUB_v10017691mg             155   1e-40    
ref|XP_009150234.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    155   1e-40    
emb|CDY21787.1|  BnaA06g20560D                                          155   2e-40    
ref|XP_008347866.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    154   2e-40    
dbj|BAA96982.1|  11-beta-hydroxysteroid dehydrogenase-like              155   2e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503335.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    154   2e-40    
ref|XP_010442243.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    154   3e-40    
ref|XP_010421918.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    156   3e-40    
ref|XP_010437678.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    155   3e-40    
ref|XP_009357192.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    155   3e-40    
ref|XP_006580902.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    154   3e-40    
ref|XP_006289482.1|  hypothetical protein CARUB_v10003016mg             155   4e-40    
ref|XP_010503336.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    154   5e-40    
ref|NP_190319.1|  hydroxysteroid dehydrogenase 2                        154   5e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008219091.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    154   6e-40    
ref|XP_008378718.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    154   7e-40    
ref|XP_010442546.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    153   7e-40    
ref|XP_010515042.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    153   7e-40    
ref|XP_008365259.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    154   8e-40    
gb|EMS47145.1|  Dehydrogenase/reductase SDR family protein 7-like...    154   8e-40    
ref|XP_008459623.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    154   1e-39    
gb|AFW71547.1|  hypothetical protein ZEAMMB73_313921                    150   1e-39    
ref|XP_006404394.1|  hypothetical protein EUTSA_v10011076mg             152   1e-39    
ref|XP_010455398.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    154   1e-39    
ref|XP_009134177.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    155   2e-39    
ref|NP_190320.1|  hydroxysteroid dehydrogenase 3                        152   2e-39    Arabidopsis thaliana [mouse-ear cress]
emb|CDX90742.1|  BnaA03g24220D                                          155   2e-39    
gb|KFK32035.1|  hypothetical protein AALP_AA6G191600                    154   2e-39    
ref|XP_010426175.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    152   2e-39    
gb|ACG69525.1|  steroleosin SLO2-1                                      155   2e-39    Brassica napus [oilseed rape]
emb|CDY05081.1|  BnaC03g28790D                                          155   2e-39    
ref|XP_010062387.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    153   2e-39    
ref|XP_002875833.1|  short-chain dehydrogenase/reductase family p...    152   3e-39    
ref|XP_004141553.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    153   3e-39    
ref|XP_002864070.1|  short-chain dehydrogenase/reductase family p...    150   5e-39    
ref|XP_002872483.1|  short-chain dehydrogenase/reductase family p...    152   5e-39    
ref|XP_006844630.1|  hypothetical protein AMTR_s00016p00228910          149   8e-39    
ref|XP_002322681.2|  hypothetical protein POPTR_0016s04940g             150   9e-39    Populus trichocarpa [western balsam poplar]
ref|NP_192740.1|  hydroxysteroid dehydrogenase 5                        152   1e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511142.1|  Glucose 1-dehydrogenase, putative                  150   1e-38    Ricinus communis
gb|ACG69526.1|  steroleosin SLO2-2                                      152   2e-38    
gb|KFK34034.1|  hypothetical protein AALP_AA5G093400                    153   3e-38    
ref|XP_010530110.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    150   3e-38    
ref|XP_006397111.1|  hypothetical protein EUTSA_v10029315mg             150   4e-38    
ref|XP_008668191.1|  PREDICTED: steroleosin isoform X2                  149   7e-38    
tpg|DAA52416.1|  TPA: hypothetical protein ZEAMMB73_783233              146   9e-38    
ref|XP_010482377.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    145   2e-37    
gb|KDP45630.1|  hypothetical protein JCGZ_17237                         146   2e-37    
ref|NP_001145589.1|  uncharacterized protein LOC100279063               147   3e-37    
ref|XP_002318707.2|  hypothetical protein POPTR_0012s10370g             146   4e-37    
ref|XP_008668190.1|  PREDICTED: steroleosin isoform X1                  147   4e-37    
ref|XP_009335461.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    147   4e-37    
ref|XP_011095759.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    147   6e-37    
ref|XP_010442547.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    145   8e-37    
ref|NP_001241259.1|  uncharacterized protein LOC100780731               146   8e-37    
gb|KHN25620.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     146   9e-37    
ref|XP_004511498.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    146   9e-37    
ref|XP_003538052.2|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    147   1e-36    
ref|XP_006441634.1|  hypothetical protein CICLE_v10020750mg             145   1e-36    
ref|XP_006650876.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    145   2e-36    
emb|CDY09733.1|  BnaC07g33280D                                          143   3e-36    
ref|XP_002528042.1|  Corticosteroid 11-beta-dehydrogenase, putative     144   3e-36    
gb|KHN35097.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     144   4e-36    
ref|XP_009597074.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    142   5e-36    
ref|XP_009387843.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    143   7e-36    
gb|KDO51722.1|  hypothetical protein CISIN_1g039397mg                   143   7e-36    
ref|XP_011036367.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    143   8e-36    
gb|EYU22738.1|  hypothetical protein MIMGU_mgv1a008685mg                143   9e-36    
ref|XP_010910399.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    143   1e-35    
ref|XP_008806995.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    142   1e-35    
ref|XP_006478271.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    143   1e-35    
gb|KHG01718.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     143   1e-35    
ref|XP_007160008.1|  hypothetical protein PHAVU_002G2852001g            137   1e-35    
ref|XP_002279316.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    142   2e-35    
ref|XP_010039129.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    139   2e-35    
ref|XP_010683155.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    142   2e-35    
gb|AAX49394.1|  STO-1                                                   142   2e-35    
gb|EAZ23191.1|  hypothetical protein OsJ_06876                          139   2e-35    
gb|ABS28873.1|  steroleosin-B                                           142   2e-35    
ref|XP_009799020.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    142   2e-35    
ref|XP_002325513.1|  short-chain dehydrogenase/reductase family p...    142   3e-35    
ref|XP_003610951.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    142   4e-35    
gb|ABM90634.1|  11-beta short-chain dehydrogenase reductase             138   5e-35    
gb|EMT26674.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     142   5e-35    
ref|XP_009617211.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    141   5e-35    
emb|CDX90560.1|  BnaA03g42210D                                          140   7e-35    
ref|XP_004299863.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    140   8e-35    
ref|XP_009136723.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    139   8e-35    
ref|XP_006376168.1|  short-chain dehydrogenase/reductase family p...    140   9e-35    
ref|XP_010645922.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    140   9e-35    
gb|EPS67484.1|  hypothetical protein M569_07290                         140   1e-34    
ref|XP_009622010.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    140   1e-34    
ref|XP_006356566.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    140   1e-34    
ref|XP_008788738.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    136   1e-34    
ref|XP_004242256.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    140   2e-34    
ref|XP_011006178.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    139   2e-34    
gb|EMS53803.1|  Dehydrogenase/reductase SDR family protein 7-like...    138   3e-34    
ref|XP_009778660.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    137   4e-34    
ref|XP_009408757.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    138   4e-34    
ref|XP_010100094.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    139   4e-34    
ref|XP_009797377.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    138   5e-34    
ref|XP_007019842.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    139   5e-34    
gb|ABX82800.1|  sterolesin-B                                            135   8e-34    
ref|XP_010927839.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    136   3e-33    
ref|XP_004981097.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    135   5e-33    
ref|NP_001051859.1|  Os03g0842900                                       134   1e-32    
ref|XP_002463543.1|  hypothetical protein SORBIDRAFT_01g001700          134   2e-32    
ref|XP_010536606.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    132   2e-32    
ref|XP_006579445.1|  PREDICTED: uncharacterized protein LOC100808...    132   2e-32    
tpg|DAA41997.1|  TPA: hypothetical protein ZEAMMB73_718382              134   3e-32    
ref|XP_010910406.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    132   3e-32    
ref|XP_011033350.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    135   4e-32    
dbj|BAK05747.1|  predicted protein                                      132   9e-32    
gb|ABI20735.1|  11-beta-hydroxysteroid dehydrogenase-like protein       130   2e-31    
ref|NP_001154667.1|  hydroxysteroid dehydrogenase 2                     130   4e-31    
ref|WP_006299197.1|  short-chain dehydrogenase                          128   5e-31    
ref|XP_003524470.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    129   7e-31    
ref|XP_002875832.1|  hypothetical protein ARALYDRAFT_905956             125   3e-30    
ref|XP_006291535.1|  hypothetical protein CARUB_v10017691mg             126   4e-30    
gb|EEE60277.1|  hypothetical protein OsJ_13325                          126   1e-29    
gb|EMT26675.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     124   2e-29    
ref|XP_001756706.1|  predicted protein                                  120   4e-28    
ref|WP_018200695.1|  hypothetical protein                               120   5e-28    
ref|WP_019560422.1|  hypothetical protein                               120   6e-28    
ref|WP_028767872.1|  short-chain dehydrogenase                          119   9e-28    
emb|CAN76088.1|  hypothetical protein VITISV_028806                     120   2e-27    
gb|EXU81407.1|  short-chain dehydrogenase                               118   2e-27    
ref|WP_011484077.1|  short-chain dehydrogenase                          117   4e-27    
ref|WP_028101485.1|  short-chain dehydrogenase                          117   5e-27    
ref|XP_002321720.1|  hypothetical protein POPTR_0015s11220g             114   2e-26    
ref|WP_008444711.1|  11-beta-hydroxysteroid dehydrogenase               115   3e-26    
ref|WP_015346442.1|  short chain dehydrogenase                          115   3e-26    
ref|XP_002979783.1|  hypothetical protein SELMODRAFT_153443             115   4e-26    
gb|AHG92246.1|  short-chain dehydrogenase/reductase SDR                 114   4e-26    
ref|WP_011758510.1|  short-chain dehydrogenase                          114   8e-26    
ref|WP_033539514.1|  short-chain dehydrogenase                          113   1e-25    
ref|WP_011867211.1|  short-chain dehydrogenase                          113   2e-25    
ref|WP_015895400.1|  short-chain dehydrogenase                          112   2e-25    
ref|WP_035040078.1|  short-chain dehydrogenase                          112   2e-25    
ref|XP_002985446.1|  hypothetical protein SELMODRAFT_424474             113   3e-25    
ref|WP_014611437.1|  short-chain dehydrogenase                          112   4e-25    
gb|ACF75106.1|  Ste-b                                                   114   5e-25    
ref|WP_011787922.1|  MULTISPECIES: short-chain dehydrogenase            111   6e-25    
ref|WP_027477137.1|  short-chain dehydrogenase                          111   6e-25    
ref|XP_011033351.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    110   7e-25    
ref|XP_008806996.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    112   7e-25    
ref|WP_019574304.1|  short-chain dehydrogenase                          111   7e-25    
ref|WP_012153695.1|  short-chain dehydrogenase                          111   1e-24    
ref|WP_006084347.1|  short-chain dehydrogenase                          110   1e-24    
ref|WP_012090367.1|  short-chain dehydrogenase                          110   1e-24    
ref|WP_015202720.1|  3-oxoacyl-(acyl-carrier-protein) reductase         110   1e-24    
ref|WP_002619156.1|  short-chain dehydrogenase                          110   2e-24    
ref|WP_012627354.1|  short-chain dehydrogenase                          110   2e-24    
ref|WP_011550940.1|  short-chain dehydrogenase                          110   2e-24    
ref|WP_017290334.1|  hypothetical protein                               110   2e-24    
ref|WP_020914692.1|  Oxidoreductase, short chain dehydrogenase/re...    110   2e-24    
ref|WP_028110082.1|  short-chain dehydrogenase                          109   2e-24    
ref|WP_039049894.1|  MULTISPECIES: short-chain dehydrogenase            110   2e-24    
ref|WP_034365254.1|  short-chain dehydrogenase                          110   3e-24    
emb|CBI26481.3|  unnamed protein product                                105   3e-24    
ref|WP_034392074.1|  short-chain dehydrogenase                          109   3e-24    
ref|WP_010995590.1|  short-chain dehydrogenase                          109   3e-24    
ref|WP_012837387.1|  short-chain dehydrogenase                          109   3e-24    
ref|WP_003064583.1|  short-chain dehydrogenase                          109   3e-24    
ref|WP_003076324.1|  short-chain dehydrogenase                          109   3e-24    
ref|WP_006079907.1|  short-chain dehydrogenase                          109   3e-24    
ref|WP_005667697.1|  hypothetical protein                               109   4e-24    
ref|WP_015182593.1|  short-chain dehydrogenase                          109   5e-24    
ref|WP_039713743.1|  short-chain dehydrogenase                          108   5e-24    
emb|CBA33247.1|  hypothetical protein Csp_B18100                        109   6e-24    
ref|WP_028117086.1|  short-chain dehydrogenase                          108   6e-24    
ref|WP_011070794.1|  short-chain dehydrogenase                          108   6e-24    
ref|WP_011320660.1|  short-chain dehydrogenase                          108   6e-24    
ref|WP_011715649.1|  short-chain dehydrogenase                          108   6e-24    
ref|WP_034359984.1|  short-chain dehydrogenase                          108   6e-24    
gb|KEK29981.1|  short chain dehydrogenase                               108   6e-24    
ref|WP_037413590.1|  MULTISPECIES: short-chain dehydrogenase            108   7e-24    
ref|WP_007867264.1|  short-chain dehydrogenase                          108   7e-24    
ref|WP_019043740.1|  short-chain dehydrogenase                          108   7e-24    
ref|WP_003057674.1|  short-chain dehydrogenase                          108   8e-24    
ref|WP_019504439.1|  hypothetical protein                               108   1e-23    
ref|WP_034408768.1|  short-chain dehydrogenase                          108   1e-23    
ref|WP_026848214.1|  short-chain dehydrogenase                          107   1e-23    
ref|WP_012792270.1|  short-chain dehydrogenase                          107   1e-23    
ref|WP_023268927.1|  short-chain dehydrogenase reductase sdr            107   2e-23    
ref|WP_011621243.1|  short-chain dehydrogenase                          107   3e-23    
ref|WP_013901898.1|  short-chain dehydrogenase                          106   3e-23    
ref|WP_013936035.1|  short-chain dehydrogenase                          106   4e-23    
ref|WP_011627377.1|  short-chain dehydrogenase                          106   4e-23    
ref|WP_016863819.1|  short-chain dehydrogenase                          106   4e-23    
ref|WP_027865286.1|  short-chain dehydrogenase                          106   5e-23    
gb|EMS48748.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     106   5e-23    
ref|WP_002638782.1|  short-chain dehydrogenase                          105   5e-23    
ref|WP_036217355.1|  short-chain dehydrogenase                          106   6e-23    
ref|WP_035608403.1|  short-chain dehydrogenase                          105   6e-23    
ref|WP_027102823.1|  short-chain dehydrogenase                          105   9e-23    
gb|EMS47146.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     105   9e-23    
ref|WP_014393553.1|  short-chain dehydrogenase                          105   1e-22    
gb|EAZ30542.1|  hypothetical protein OsJ_14590                          105   1e-22    
ref|WP_028764107.1|  short-chain dehydrogenase                          104   2e-22    
ref|XP_004032030.1|  short chain dehydrogenase, putative                107   2e-22    
ref|WP_006030560.1|  short-chain dehydrogenase                          104   2e-22    
ref|WP_028773340.1|  short-chain dehydrogenase                          104   2e-22    
ref|WP_017221315.1|  short-chain dehydrogenase                          103   3e-22    
ref|WP_007650722.1|  short-chain dehydrogenase                          103   3e-22    
ref|XP_004309297.1|  PREDICTED: uncharacterized protein LOC101306394    100   3e-22    
ref|XP_010656930.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    102   8e-22    
ref|WP_024897582.1|  short-chain dehydrogenase                          102   1e-21    
ref|WP_028111549.1|  short-chain dehydrogenase                          102   1e-21    
ref|XP_003562566.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    103   2e-21    
ref|WP_026039463.1|  short-chain dehydrogenase                          101   2e-21    
ref|XP_006836805.1|  hypothetical protein AMTR_s00099p00028560          100   3e-21    
ref|WP_015030997.1|  short-chain dehydrogenase                          101   3e-21    
ref|WP_013053166.1|  short-chain dehydrogenase                          101   3e-21    
gb|ETR74219.1|  Short chain dehydrogenase                               101   3e-21    
ref|WP_007877693.1|  short chain dehydrogenase                          100   5e-21    
ref|XP_001427169.1|  hypothetical protein                             99.8    9e-21    
ref|WP_036246069.1|  short-chain dehydrogenase                        99.8    9e-21    
ref|XP_004298550.1|  PREDICTED: uncharacterized oxidoreductase Yq...  98.2    1e-20    
ref|WP_007653791.1|  3-oxoacyl-ACP reductase                          98.2    1e-20    
ref|XP_001017504.1|  oxidoreductase, short chain dehydrogenase/re...  99.4    1e-20    
ref|WP_026236431.1|  short-chain dehydrogenase                        99.0    2e-20    
ref|XP_004335949.1|  oxidoreductase, short chain dehydrogenase/re...  99.4    2e-20    
ref|WP_014679581.1|  short-chain dehydrogenase                        99.0    2e-20    
ref|WP_036476988.1|  short-chain dehydrogenase                        98.6    2e-20    
ref|WP_026770433.1|  short-chain dehydrogenase                        98.6    2e-20    
ref|WP_026773737.1|  short-chain dehydrogenase                        98.6    2e-20    
ref|WP_039034840.1|  short-chain dehydrogenase                        98.2    3e-20    
gb|EKD89006.1|  hypothetical protein ACD_34C00237G0002                97.8    4e-20    
ref|WP_010660915.1|  short-chain dehydrogenase                        97.8    4e-20    
gb|EMT32988.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein   97.8    4e-20    
ref|WP_029465040.1|  short-chain dehydrogenase                        97.8    4e-20    
ref|WP_011982688.1|  short-chain dehydrogenase                        97.8    4e-20    
ref|WP_027001584.1|  short-chain dehydrogenase                        97.4    5e-20    
ref|WP_029928056.1|  short-chain dehydrogenase                        97.4    5e-20    
ref|WP_008242159.1|  short-chain dehydrogenase                        97.4    5e-20    
ref|WP_015332580.1|  short-chain dehydrogenase/reductase SDR          97.4    5e-20    
ref|WP_025009247.1|  MULTISPECIES: short-chain dehydrogenase          97.1    6e-20    
ref|WP_039451443.1|  short-chain dehydrogenase                        97.4    6e-20    
ref|WP_036579370.1|  short-chain dehydrogenase                        97.1    7e-20    
ref|WP_013632465.1|  short-chain dehydrogenase                        97.1    7e-20    
ref|WP_025604145.1|  short-chain dehydrogenase                        97.1    7e-20    
gb|KEH21005.1|  transmembrane protein, putative                       95.9    1e-19    
ref|WP_012322943.1|  short-chain dehydrogenase                        96.7    1e-19    
gb|KFE58907.1|  Short-chain dehydrogenase/reductase SDR               96.3    1e-19    
gb|KFA88847.1|  short-chain dehydrogenase                             96.3    1e-19    
ref|XP_001430409.1|  hypothetical protein                             96.7    1e-19    
ref|WP_006468435.1|  short-chain dehydrogenase                        96.3    2e-19    
ref|WP_006472471.1|  short chain dehydrogenase                        95.9    2e-19    
gb|AGY53466.1|  putative oxidoreductase yxnA                          95.9    2e-19    
ref|WP_008201864.1|  short-chain dehydrogenase                        95.5    2e-19    
ref|WP_011297583.1|  short-chain dehydrogenase                        95.5    2e-19    
ref|WP_028980058.1|  short-chain dehydrogenase                        95.5    2e-19    
gb|KFK39003.1|  hypothetical protein AALP_AA3G187700                  95.1    3e-19    
ref|XP_004357175.1|  11beta-hydroxysteroid dehydrogenase-like, pu...  95.5    4e-19    
ref|WP_027471744.1|  short-chain dehydrogenase                        94.7    4e-19    
ref|WP_021588207.1|  MULTISPECIES: short-chain dehydrogenase          94.7    4e-19    
ref|WP_026904729.1|  short-chain dehydrogenase                        94.7    5e-19    
ref|WP_010528274.1|  short-chain dehydrogenase                        94.4    6e-19    
ref|WP_006160665.1|  short-chain dehydrogenase                        94.4    6e-19    
dbj|GAL86506.1|  short-chain dehydrogenase/reductase SDR              94.4    7e-19    



>gb|EYU23068.1| hypothetical protein MIMGU_mgv1a009201mg [Erythranthe guttata]
Length=349

 Score =   313 bits (801),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T+ ++ EEV+DVT  R++MD+NFWG VYMT  AAP+LR + GRIVVISSSA 
Sbjct  128  HLVNNAGITSVAMLEEVDDVTDFRAIMDVNFWGFVYMTRFAAPYLRNSRGRIVVISSSAS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL SPRMS YNASKAA++QFFETLR+E GPDI ITLVTPGFIESELTQGK LNK G+L V
Sbjct  188  WLPSPRMSFYNASKAAIAQFFETLRVEFGPDIGITLVTPGFIESELTQGKFLNKEGKLVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRDVQVN+ PV +V++CAK+I+ SA RGERYLTEPAW +VT  WK+F PE +E++  
Sbjct  248  DQEMRDVQVNMFPVQRVESCAKSIVRSAIRGERYLTEPAWVRVTHLWKLFMPEAMEWMYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L+Y+T PG   + A GKK+LDYTG + ++YPE++
Sbjct  308  LMYITGPGEESEAAFGKKVLDYTGAKHLLYPESV  341



>ref|XP_006347650.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
tuberosum]
Length=344

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  +LFEE+ED+T+ RS+MDINFWGS+YMT  A P+LRR+ GRI+V+SS+A 
Sbjct  131  HLVNNAGVTAVALFEEIEDITNFRSIMDINFWGSIYMTKFAIPYLRRSEGRIIVLSSAAS  190

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W+ +PRMS+Y  S   +  FFE LRIE G DIKITL+TPG++ESE+TQGK ++K G+++V
Sbjct  191  WIPAPRMSLYAVSPPTLILFFEALRIEFGRDIKITLITPGYVESEMTQGKFIDKTGKVDV  250

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               MRD QV+I+PV KV+ CAKAI+N +CRGERY+T PAWFKVT  WKVFFPEVVE+I  
Sbjct  251  DPQMRDAQVSIIPVVKVEECAKAIVNGSCRGERYVTVPAWFKVTYLWKVFFPEVVEWILR  310

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LL+++S G+ P+DAL KKILDYTG QK++YPE I
Sbjct  311  LLWLSSSGTSPEDALSKKILDYTGLQKVLYPENI  344



>ref|XP_009760328.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
sylvestris]
Length=352

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 183/224 (82%), Gaps = 2/224 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  SLF+E E++T+ RS+MDINFWGSVYMT  A P+LR + GR++V+SSSA 
Sbjct  131  HLVNNAGVTAVSLFDETEEITNFRSIMDINFWGSVYMTRFAIPYLRYSEGRVIVLSSSAS  190

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W+ +PR+S+Y ASKAAM+QFF+TLR+E G DIKITLVTPG++ESE+TQGK ++K G+++V
Sbjct  191  WVPAPRLSLYCASKAAMAQFFDTLRVEFGQDIKITLVTPGYVESEMTQGKFMDKTGKVDV  250

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            +  MR+VQV I+PV KV+ CAKAI+N ACRGERY+T P+WF+VT  WKVF PEVV++I  
Sbjct  251  NPQMRNVQVGIIPVVKVEECAKAIVNGACRGERYVTVPSWFRVTYLWKVFCPEVVDWILR  310

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
            LL +T  G+ P+DA  KKILDYTG QK++YPE I   +  PKT+
Sbjct  311  LLCLTGSGTSPEDAFSKKILDYTGVQKVLYPENIRELE--PKTN  352



>ref|XP_004235330.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
lycopersicum]
Length=352

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 181/224 (81%), Gaps = 2/224 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T+ SLFEE+ED+T++RS+MDINFWGSVYMT  A P+LR + GRIVV+SS+A 
Sbjct  131  HLVNNAGVTSVSLFEEIEDITNMRSIMDINFWGSVYMTRFAIPYLRYSEGRIVVLSSAAS  190

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W+ +PRMS+Y ASKAAM  FFE LRIE G DIKITLVTPGF+ESE+TQGK ++K G+++V
Sbjct  191  WMPAPRMSLYAASKAAMVLFFEALRIEFGRDIKITLVTPGFVESEITQGKFIDKTGKVDV  250

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            +  MRDV+V + PV KV+ CA+AI+N ACRGERY+T P+WF+VT  WKVF P+VVE+   
Sbjct  251  NPQMRDVEVGLTPVMKVEDCAEAIVNGACRGERYITVPSWFRVTYLWKVFCPDVVEWFLR  310

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
            L Y +  G+ P+DA  KKILDYTG +K++YPE I   + GPKT+
Sbjct  311  LSYFSGWGASPEDAPSKKILDYTGVRKVLYPENI--RELGPKTE  352



>ref|XP_006347480.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
tuberosum]
Length=349

 Score =   303 bits (775),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 173/214 (81%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   +LFE+ EDVT  +SVMDINFWGSVYMT  A P+LR + GRI+V+SSSA 
Sbjct  130  HLVNNAGVHAIALFEDTEDVTDFKSVMDINFWGSVYMTRFAIPYLRYSGGRIIVLSSSAS  189

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PR S YNASKAA+SQFFETLRIELG DIKITLVTPGF+ESELTQGK++ K G +EV
Sbjct  190  WLPVPRSSFYNASKAAVSQFFETLRIELGQDIKITLVTPGFVESELTQGKYIGKGGDVEV  249

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               MRDV +   PV KV++CAK I+NSACRGERY+T PAWF+V+  WKVF PEV+E++  
Sbjct  250  DQGMRDVFIGATPVAKVESCAKTIVNSACRGERYVTIPAWFRVSYLWKVFAPEVLEWMYR  309

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L+++T  G+ P+DAL KK++DYTG Q ++YPETI
Sbjct  310  LMHLT--GTSPEDALSKKVVDYTGAQNVLYPETI  341



>ref|XP_004241449.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
lycopersicum]
Length=349

 Score =   302 bits (774),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 173/214 (81%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   +LFE+ EDVT  +SVMDINFWGSVYMT  A P+LR + GRI+V+SSSA 
Sbjct  130  HLVNNAGVHAIALFEDTEDVTDFKSVMDINFWGSVYMTRFAIPYLRYSGGRIIVLSSSAS  189

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR S YNASKAA+SQFFETLRIELG DIKITLVTPGF+ESELTQGK++ K G +EV
Sbjct  190  WLPAPRSSFYNASKAAVSQFFETLRIELGQDIKITLVTPGFVESELTQGKYIGKGGDVEV  249

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               MRDV +   PV KV++CAK I+NSACRGERY+T P+WF+V+  WKVF PEV+E++  
Sbjct  250  DQGMRDVFIGATPVAKVESCAKTIVNSACRGERYVTIPSWFRVSYLWKVFAPEVLEWMYR  309

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L+++T  G+ P+DAL KK+ DYTG Q ++YPETI
Sbjct  310  LMHLT--GTSPEDALSKKVADYTGAQNVLYPETI  341



>gb|AAL09328.1|AF302806_1 steroleosin [Sesamum indicum]
 gb|AAL13315.1|AF421889_1 steroleosin [Sesamum indicum]
Length=348

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 176/224 (79%), Gaps = 3/224 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ + S+ EEVED+T  R  MDINFWG VYMT  AAP+LR + GRIVV+SSS+ 
Sbjct  128  HLVNNAGIMSVSMLEEVEDITGYRETMDINFWGYVYMTRFAAPYLRNSRGRIVVLSSSSS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W+ +PRMS YNASKAA+SQFFETLR+E GPDI ITLVTPGFIESELTQGK  N AG   +
Sbjct  188  WMPTPRMSFYNASKAAISQFFETLRVEFGPDIGITLVTPGFIESELTQGKFYN-AGERVI  246

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              DMRDVQV+  P+ +V++ A++I+ SA RGERY+TEPAWF+VT WWK+F PEV+E++  
Sbjct  247  DQDMRDVQVSTTPILRVESAARSIVRSAIRGERYVTEPAWFRVTYWWKLFCPEVMEWVFR  306

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
            L+Y+ SPG P ++  GKK+LDYTG + ++YPET+   +  PK D
Sbjct  307  LMYLASPGEPEKETFGKKVLDYTGVKSLLYPETVQVPE--PKND  348



>ref|XP_011073095.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Sesamum 
indicum]
Length=349

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 176/224 (79%), Gaps = 3/224 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ + S+ EEVED+T  R  MDINFWG VYMT  AAP+LR + GRIVV+SSS+ 
Sbjct  129  HLVNNAGIMSVSMLEEVEDITGYRETMDINFWGYVYMTRFAAPYLRNSRGRIVVLSSSSS  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W+ +PRMS YNASKAA+SQFFETLR+E GPDI ITLVTPGFIESELTQGK  N AG   +
Sbjct  189  WMPTPRMSFYNASKAAISQFFETLRVEFGPDIGITLVTPGFIESELTQGKFYN-AGERVI  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              DMRDVQV+  P+ +V++ A++I+ SA RGERY+TEPAWF+VT WWK+F PEV+E++  
Sbjct  248  DQDMRDVQVSTTPILRVESAARSIVRSAIRGERYVTEPAWFRVTYWWKLFCPEVMEWVFR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
            L+Y+ SPG P ++  GKK+LDYTG + ++YPET+   +  PK D
Sbjct  308  LMYLASPGEPEKETFGKKVLDYTGVKSLLYPETVQVPE--PKND  349



>ref|XP_010026329.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Eucalyptus 
grandis]
 gb|KCW83128.1| hypothetical protein EUGRSUZ_B00089 [Eucalyptus grandis]
Length=349

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 166/218 (76%), Gaps = 0/218 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ +   FE+  D+T  R+VMD N+WGSVY T  A P+LR + G+I+V+SS+A 
Sbjct  128  HLVNNAGINSVCKFEDAGDITHFRAVMDTNYWGSVYTTRFAVPYLRNSRGKIIVLSSAAS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PR S YNASKAA+   FETLR+ELGPDI IT+VTPGFIESELTQGKH  K G+LEV
Sbjct  188  WLPEPRTSFYNASKAALLSMFETLRVELGPDIGITIVTPGFIESELTQGKHFTKEGKLEV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RDVQV++ PVG V  CAKAI+NSACRG+RYLTEPAWFK+T +WK F PE+VE+   
Sbjct  248  DQDLRDVQVSVFPVGSVQGCAKAIVNSACRGDRYLTEPAWFKMTYFWKAFCPEIVEWSYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
            L+Y+  PG PP +A  KK++D  G +K++YP TI   Q
Sbjct  308  LMYLAGPGEPPTEAPSKKLVDLPGAKKLVYPSTIQTPQ  345



>ref|XP_009629548.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
tomentosiformis]
Length=348

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 178/224 (79%), Gaps = 6/224 (3%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  SLF+E E++T+ RSVMDINFWGSVYMT  A P+LR + GR++V+SSSA 
Sbjct  131  HLVNNAGVTAVSLFDETEEITNFRSVMDINFWGSVYMTRFAIPYLRYSEGRVIVLSSSAS  190

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W+ +PR+S+Y ASKAAM+QFF+TLR+E G DIKITLVTPG++ESE+TQGK +NK G+++V
Sbjct  191  WVPTPRLSLYCASKAAMAQFFDTLRVEFGQDIKITLVTPGYVESEMTQGKFINKTGKVDV  250

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               MRDVQV I+PV KV+ CAK I+N ACRGERY+T P+W +VT  WKVF PEVV++I  
Sbjct  251  KTQMRDVQVGIIPVVKVEECAKTIVNGACRGERYVTVPSWVRVTYLWKVFCPEVVDWILR  310

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
            LL +T  G+ P+    KKILDY+G QK++YPE I   +  PKT+
Sbjct  311  LLCLTGSGTSPR----KKILDYSGVQKVLYPENI--KELEPKTN  348



>ref|XP_010536612.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B [Tarenaya 
hassleriana]
Length=349

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 173/218 (79%), Gaps = 0/218 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ + ++FE V D+T+ R+VMDINFWG VYMT  A P+L++ NG+IVV+SS+A 
Sbjct  128  HLVNNAGIASMAMFENVTDITTTRTVMDINFWGPVYMTRAALPYLKQANGKIVVMSSAAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMSIYNASKAA+  FF+TLRIELG DI IT+VTPG+IESELTQGK+L++ G + V
Sbjct  188  WLTAPRMSIYNASKAALWNFFDTLRIELGRDIGITIVTPGYIESELTQGKYLSEEGEMIV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              DMRDVQ+ + PVG V  CA+AI+ + CRG++Y+TEP+WFKVT  WKVF PE++EY   
Sbjct  248  DQDMRDVQIGVCPVGSVTDCARAIVRAVCRGQKYVTEPSWFKVTYLWKVFCPEIIEYGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
            LL MT  G+  +DAL KKILD TG + I+YPE+I   Q
Sbjct  308  LLCMTGFGTSEKDALNKKILDMTGTRAILYPESIKTSQ  345



>ref|XP_008344913.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Malus 
domestica]
 ref|XP_008367477.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Malus 
domestica]
Length=350

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 172/224 (77%), Gaps = 2/224 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  S+ E+  D+T+ R++MD NFWGSVY TH A PHL+ + G+IVV+SSSA 
Sbjct  129  HLVNNAGITLLSILEDATDITNFRTIMDTNFWGSVYTTHFALPHLKSSKGKIVVLSSSAS  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PR SIYNASKAA+   +ETLRIE GPDI+IT+VTPGFIESELTQGK L   G++ V
Sbjct  189  WLPIPRQSIYNASKAALLSMYETLRIEFGPDIQITIVTPGFIESELTQGKFLMSEGKMTV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RD QV+  PV KV+ CAK+I+NSACRG+RYLTEPAWF+VT  WKVF PE++E+   
Sbjct  249  DQDLRDAQVSATPVAKVEGCAKSIVNSACRGDRYLTEPAWFRVTYLWKVFCPELLEWGYR  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
            L+YM   GS  +DA  +KILDYTG + ++YPE+ +H  E  KTD
Sbjct  309  LIYMNRAGSSARDAPSEKILDYTGAKNVLYPES-LHTPE-VKTD  350



>ref|XP_009359396.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Pyrus x bretschneideri]
Length=350

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 171/224 (76%), Gaps = 2/224 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  S+ E+  D+T+ R++MD NFWGSVY TH A PHL+ + G+IVV+SSSA 
Sbjct  129  HLVNNAGITLLSILEDATDITNFRTIMDTNFWGSVYTTHFALPHLKSSKGKIVVLSSSAS  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PR SIYNASKAA+   +ETLRIE GPDI+IT+VTPGFIESELTQGK L   G++ V
Sbjct  189  WLPIPRQSIYNASKAALLSMYETLRIEFGPDIQITIVTPGFIESELTQGKFLMSEGKMTV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RD QV+ +PV KV  CAK+I+NSACRG+RYLTEPAWF+VT  WKVF PE++E+   
Sbjct  249  DQDLRDAQVSAIPVAKVQGCAKSIVNSACRGDRYLTEPAWFRVTYLWKVFCPELLEWGYR  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
            L+ M   GS  +DA  KKILDYTG + ++YPE+ +H  E  KTD
Sbjct  309  LVCMNRAGSSARDAPSKKILDYTGAKNVLYPES-LHTPE-VKTD  350



>ref|XP_009359395.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Pyrus x bretschneideri]
Length=355

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 171/229 (75%), Gaps = 7/229 (3%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  S+ E+  D+T+ R++MD NFWGSVY TH A PHL+ + G+IVV+SSSA 
Sbjct  129  HLVNNAGITLLSILEDATDITNFRTIMDTNFWGSVYTTHFALPHLKSSKGKIVVLSSSAS  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PR SIYNASKAA+   +ETLRIE GPDI+IT+VTPGFIESELTQGK L   G++ V
Sbjct  189  WLPIPRQSIYNASKAALLSMYETLRIEFGPDIQITIVTPGFIESELTQGKFLMSEGKMTV  248

Query  363  SADMRDV-----QVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVV  527
              D+RD      QV+ +PV KV  CAK+I+NSACRG+RYLTEPAWF+VT  WKVF PE++
Sbjct  249  DQDLRDCNFVQAQVSAIPVAKVQGCAKSIVNSACRGDRYLTEPAWFRVTYLWKVFCPELL  308

Query  528  EYINLLLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
            E+   L+ M   GS  +DA  KKILDYTG + ++YPE+ +H  E  KTD
Sbjct  309  EWGYRLVCMNRAGSSARDAPSKKILDYTGAKNVLYPES-LHTPE-VKTD  355



>ref|XP_008239511.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Prunus 
mume]
Length=353

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 166/215 (77%), Gaps = 1/215 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T+  + EE  D+T+ R++MD NFWGSVY T  A PHLR + G+IVV+SS+A 
Sbjct  131  HLVNNAGITSLGMLEEATDITNFRAIMDTNFWGSVYTTRFAIPHLRSSKGKIVVLSSAAS  190

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHL-NKAGRLE  359
            WL  PR SIYNASKAA+   +ETLRIE GP+I+IT+VTPG+IESELTQGK L +  G++ 
Sbjct  191  WLPIPRQSIYNASKAALLSMYETLRIEFGPNIQITIVTPGYIESELTQGKFLMSDDGKMI  250

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V  D+RD QV+  PVG V+ CAKAI+NS CRG+RYLTEPAWF VT  WKVF PE++E+  
Sbjct  251  VDQDLRDAQVSATPVGSVEGCAKAIVNSVCRGDRYLTEPAWFGVTYIWKVFCPELLEWGY  310

Query  540  LLLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
             L+Y+T PGS  ++A  KKILDYTG + ++YPE +
Sbjct  311  RLMYVTRPGSSAKEAPSKKILDYTGAKNVLYPEIL  345



>ref|XP_004297523.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Fragaria vesca subsp. vesca]
Length=412

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 167/224 (75%), Gaps = 2/224 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  S+ EE  D+T+ RSVMD NFWGSVY TH AAPHLR N GRIV ISS   
Sbjct  191  HLVNNAGITACSMLEEATDITNFRSVMDTNFWGSVYTTHFAAPHLRNNKGRIVAISSVNS  250

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PRMSIYNASKAAMS  FETLR+ELGP++ IT+VTPG+IESE+ +GK+L+  GR+ V
Sbjct  251  WLPAPRMSIYNASKAAMSSMFETLRVELGPEVHITIVTPGYIESEMNKGKYLSTEGRMTV  310

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRDVQV+ MPV +V  CA AI+N  CRG+R LTEP W+ V   WKVF PE+ E+   
Sbjct  311  DQEMRDVQVSAMPVERVQDCAYAIVNGVCRGQRCLTEPRWWNVVYMWKVFCPELFEWGFK  370

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
              +M  PG+P ++A  KKILDYTG + ++YP++ +H  E  KTD
Sbjct  371  FSHMVRPGAPAKEAPSKKILDYTGVKNVLYPDS-LHSPE-IKTD  412



>ref|XP_007211139.1| hypothetical protein PRUPE_ppa026374mg [Prunus persica]
 gb|EMJ12338.1| hypothetical protein PRUPE_ppa026374mg [Prunus persica]
Length=337

 Score =   279 bits (714),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 170/225 (76%), Gaps = 3/225 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T+  + EE  D+T+ R++MD NFWGSVY T  A PHLR + G+IVV+SS+A 
Sbjct  115  HLVNNAGITSLGMLEEATDITNFRAIMDTNFWGSVYTTRFAIPHLRSSKGKIVVLSSAAS  174

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHL-NKAGRLE  359
            WL  PR SIYNASKAA+   +ETLR+E GP+I+IT+VTPG+IESELTQGK L +  G + 
Sbjct  175  WLPIPRQSIYNASKAALLSMYETLRVEFGPNIQITIVTPGYIESELTQGKFLMSDDGEMI  234

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V  D+RD QV+  PVG V+ CAKAI+NS CRG+RYLTEP WF VT  WKVF PE++E+  
Sbjct  235  VDQDLRDAQVSATPVGSVEGCAKAIVNSVCRGDRYLTEPEWFGVTYIWKVFCPELLEWGY  294

Query  540  LLLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
             L+Y+T PGS  ++A  KKILDYTG + ++YPET +H  E  KTD
Sbjct  295  RLMYVTRPGSSAKEAPSKKILDYTGAKNVLYPET-LHSPE-VKTD  337



>gb|KHG19414.1| Dehydrogenase/reductase SDR family protein 7-like protein [Gossypium 
arboreum]
Length=350

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 168/215 (78%), Gaps = 1/215 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVE-DVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSA  179
            HLVNNAG+ T  +FE+   D++  R++MD NFWGSVY T  A PHL+ + G+IVV+SS+A
Sbjct  128  HLVNNAGINTVCMFEDAPPDMSLFRAIMDTNFWGSVYTTRFAVPHLKNSKGKIVVMSSAA  187

Query  180  GWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLE  359
             W++ PR S+YNASKAA++ FF+TLRIELG ++KIT+VTPGFIESE+TQGK L + G +E
Sbjct  188  SWMNDPRTSVYNASKAALTAFFDTLRIELGSEVKITIVTPGFIESEITQGKFLQRDGNME  247

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V  DMRDVQV+ +PV     CA+AI+NSA +G+RYLT+P+WF+VT  WK+FFPE+VE+  
Sbjct  248  VQQDMRDVQVSSIPVASASGCAQAIVNSASKGDRYLTQPSWFRVTYLWKMFFPELVEWGY  307

Query  540  LLLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            +L + + PG+P Q A  KKILD+TG + +IYP +I
Sbjct  308  ILSHFSRPGAPHQQAPSKKILDFTGLKNVIYPSSI  342



>gb|KFK22922.1| hypothetical protein AALP_AAs48765U000100 [Arabis alpina]
Length=349

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 166/214 (78%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAGMT  S+FE +E+++  ++VMD NFWGSVY+T  A P+LR++NG+IV +SSSA 
Sbjct  128  HLVNNAGMTQISMFENIEEISRTKAVMDTNFWGSVYVTRAALPYLRQSNGKIVAMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFET+RIEL  D+ IT+VTPG+IESELTQGK+ +  G L V
Sbjct  188  WLTAPRMSFYNASKAAVLNFFETMRIELAGDVHITIVTPGYIESELTQGKYFSGEGELIV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + D+RDVQ+   PV     CAKAI+N  CR +RY+TEP+WF+VT  WKVF P+++E++  
Sbjct  248  NQDIRDVQIGAFPVASASGCAKAIVNGVCRKQRYVTEPSWFRVTYLWKVFCPDLIEWLCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLYMT  G+  ++AL KKILD  G + ++YPE+I
Sbjct  308  LLYMTGTGTYEENALNKKILDIPGVRNVLYPESI  341



>ref|XP_007038038.1| Hydroxysteroid dehydrogenase 1 [Theobroma cacao]
 gb|EOY22539.1| Hydroxysteroid dehydrogenase 1 [Theobroma cacao]
Length=351

 Score =   276 bits (707),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 167/216 (77%), Gaps = 2/216 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVE-DVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSA  179
            HLVNNAG+T+  +FE    D+T+ R+VMD NFWGSVY T  A PHLR + G+IVV+SS+ 
Sbjct  128  HLVNNAGITSVCMFEGAPPDMTNFRAVMDTNFWGSVYTTRFAVPHLRNSKGKIVVLSSAN  187

Query  180  GWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLE  359
             WL  PR S+YNASKAA++ FF+TLRIELG D+ IT+VTPG IESE+T+ KHL+K G++E
Sbjct  188  SWLPEPRTSVYNASKAALAAFFDTLRIELGQDVTITIVTPGHIESEITRDKHLSKEGKME  247

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V  DMRDVQV+ +PV  V  CA+AI+NSACRG+R LT+P+W+  T  WK+FFPEV+E+  
Sbjct  248  VEQDMRDVQVSAIPVASVSECAQAIVNSACRGDRSLTQPSWYSATCLWKLFFPEVIEWGC  307

Query  540  LLLYMTSPGSPPQDALGKKILDYT-GCQKIIYPETI  644
             L Y+TSPG P Q+A  KKILD T G +K++YP TI
Sbjct  308  RLFYLTSPGVPHQEAPSKKILDLTAGEKKVLYPSTI  343



>gb|ABM90633.1| short-chain dehydrogenase reductase [Brassica napus]
 gb|ADW77633.1| steroleosin-A [Brassica napus]
 gb|ADW77634.1| steroleosin-A [Brassica napus]
Length=349

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 164/214 (77%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   S+FE +E++T  R+VMD NFWG+VY T  A P+LR++NG+IV +SSSA 
Sbjct  128  HLVNNAGIMQISMFENIEEITRTRAVMDTNFWGAVYTTRAALPYLRQSNGKIVAMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFETLRIELG D+ IT+VTPG+IESELTQGK+++  G L V
Sbjct  188  WLTAPRMSFYNASKAALLNFFETLRIELGSDVHITIVTPGYIESELTQGKYVSGEGELVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + D+RDVQ+   PV  V  CAK I+   CR ERY+TEP+WFKVT  WKVF PE++E+   
Sbjct  248  NQDIRDVQIGAFPVTSVSGCAKGIVKGVCRKERYVTEPSWFKVTYLWKVFCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L++++  G+P ++AL KKILD  G +  +YPE+I
Sbjct  308  LMFLSGHGTPEENALNKKILDIPGVRSALYPESI  341



>gb|ABM30178.1| steroleosin [Brassica napus]
Length=244

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   S+FE +E++T  R+VMD NFWGSVY T  A P+LR++NG+IV +SSSA 
Sbjct  23   HLVNNAGIMQISMFENIEEITRTRAVMDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAA  82

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFETLRIELG D+ IT+VTPG+IESELTQGK+ +  G L V
Sbjct  83   WLTAPRMSFYNASKAALLNFFETLRIELGSDVHITIVTPGYIESELTQGKYFSGEGELVV  142

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + D+RDVQ+   PV  V  CAK I+   CR +RY+TEP+WFKVT  WKVF PE++E+   
Sbjct  143  NQDIRDVQIGAFPVTSVSGCAKGIVKGVCRKQRYVTEPSWFKVTYLWKVFCPELIEWGCR  202

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LL+++  G+  ++AL KKILD  G +  +YPE+I
Sbjct  203  LLFLSGHGTSEKNALNKKILDIPGVRSALYPESI  236



>emb|CDY16353.1| BnaA02g11570D [Brassica napus]
Length=349

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 164/214 (77%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   S+FE +E++T  R+VMD NFWG+VY T  A P+LR++NG+IV +SSSA 
Sbjct  128  HLVNNAGIMQISMFENIEEITRTRAVMDTNFWGAVYTTRAALPYLRQSNGKIVAMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFETLRIELG D+ IT+VTPG+IESELTQGK+++  G L V
Sbjct  188  WLTAPRMSFYNASKAALLNFFETLRIELGSDVHITIVTPGYIESELTQGKYVSGEGELVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + D+RDVQ+   PV  V  CAK I+   CR ERY+TEP+WFKVT  WKVF PE++E+   
Sbjct  248  NQDIRDVQIGAFPVTSVSGCAKGIVKGVCRKERYVTEPSWFKVTYLWKVFCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L++++  G+P ++AL KKILD  G +  +YPE+I
Sbjct  308  LMFLSGHGTPEENALNKKILDIPGVRSALYPESI  341



>ref|NP_568742.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
 ref|NP_680418.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
 sp|P0DKC6.1|HSD1B_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase 1B; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase 1B; AltName: Full=Hydroxysteroid 
dehydrogenase 1; Short=AtHSD1 [Arabidopsis 
thaliana]
 sp|P0DKC5.1|HSD1A_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase 1A; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase 1A; AltName: Full=Hydroxysteroid 
dehydrogenase 1; Short=AtHSD1 [Arabidopsis 
thaliana]
 gb|AAL38621.1|AF446888_1 AT5g50700/MFB16_9 [Arabidopsis thaliana]
 dbj|BAA96983.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 dbj|BAB09145.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AAK96564.1| AT5g50700/MFB16_9 [Arabidopsis thaliana]
 gb|AAL32846.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AAM10215.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 dbj|BAD95411.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AED95967.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
 gb|AED95981.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
Length=349

 Score =   274 bits (700),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAGMT  S+FE +ED+T  ++V+D NFWGSVY T  A P+LR++NG+IV +SSSA 
Sbjct  128  HLVNNAGMTQISMFENIEDITRTKAVLDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFET+RIELG D+ IT+VTPG+IESELTQGK+ +  G L V
Sbjct  188  WLTAPRMSFYNASKAALLSFFETMRIELGGDVHITIVTPGYIESELTQGKYFSGEGELIV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + DMRDVQV   PV     CAK+I+N  CR +RY+TEP+WFKVT  WKV  PE++E+   
Sbjct  248  NQDMRDVQVGPFPVASASGCAKSIVNGVCRKQRYVTEPSWFKVTYLWKVLCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLYMT  G     AL K+I+D  G +  +YPE+I
Sbjct  308  LLYMTGTGMSEDTALNKRIMDIPGVRSTLYPESI  341



>ref|XP_009127346.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B [Brassica 
rapa]
Length=349

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   S+FE +E++T  R+VMD NFWG+VY T  A P+LR++NG+IV +SSSA 
Sbjct  128  HLVNNAGIMQISMFENIEEITRTRAVMDTNFWGAVYTTRAALPYLRQSNGKIVAMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFETLRIELG D+ IT+VTPG+IESELTQGK+++  G L V
Sbjct  188  WLTAPRMSFYNASKAALLNFFETLRIELGSDVHITIVTPGYIESELTQGKYVSGEGELVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + D+RDVQ+   PV  V  CAK I+   CR ERY+TEP+WFKVT  WKVF PE++E+   
Sbjct  248  NQDIRDVQIGAFPVTSVSGCAKGIVKGVCRKERYVTEPSWFKVTYLWKVFCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L++++  G+P ++AL KKILD  G +  +YPE I
Sbjct  308  LMFLSGHGTPEENALNKKILDIPGVRSALYPEPI  341



>ref|XP_010929562.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X3 [Elaeis guineensis]
Length=349

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FEE EDVT+   V+D+NFWGS+Y T+ A PHL++  GRIVV SSS+G
Sbjct  128  HLVNNAGIANLCMFEEAEDVTNFMPVLDVNFWGSIYPTYFALPHLKQTRGRIVVNSSSSG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS YNASKAA+  FFETLRIE G +I IT+ TPG+IESE+TQGK L+K GR+ V
Sbjct  188  WLPMPRMSFYNASKAALINFFETLRIEFGHEIGITIATPGWIESEMTQGKFLSKEGRMVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDV + ++PVG  + CAKAI+ SACRGE Y+TEP WFKV   W+VF PEV+++   
Sbjct  248  DQELRDVLIGLVPVGDSEGCAKAIVTSACRGEPYVTEPWWFKVLYLWRVFVPEVMDWFIH  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            +LY+T PG+P  DAL KKILD +  + +IYP +I
Sbjct  308  MLYVTRPGTPSCDALSKKILDLSRAKSVIYPSSI  341



>ref|XP_010442549.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B [Camelina 
sativa]
Length=350

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  S+FE+VED+T  ++V+D NFWGSVY T  A P+LR++NG+IV +SSSA 
Sbjct  128  HLVNNAGITQISMFEDVEDITRNKAVLDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFET+RIELG D+ IT+VTPG+IESELTQGK+ + AG L V
Sbjct  188  WLTAPRMSFYNASKAALLSFFETMRIELGGDVHITIVTPGYIESELTQGKYFSGAGELIV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + D+RDVQ+   PV     CAKAI+N  CR +RY+TEP+WFKVT  WKV  PE++E+   
Sbjct  248  NQDVRDVQIGPFPVASASGCAKAIVNGVCRKQRYVTEPSWFKVTYLWKVLCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLYMT      ++AL K+I+D  G +  +YPE+I
Sbjct  308  LLYMTGSSMSEENALNKRIMDIPGVRSALYPESI  341



>ref|XP_002865819.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42078.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=349

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAGMT  S+FE +ED+T  ++V+D NFWGSVY T  A P+LR++NG+IV +SSSA 
Sbjct  128  HLVNNAGMTQISMFENIEDITRTKAVLDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFET+RIELG D+ IT+VTPG+IESELTQGK+ +  G L V
Sbjct  188  WLTAPRMSFYNASKAALLSFFETMRIELGGDVHITIVTPGYIESELTQGKYFSGEGELIV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + DMRDVQ+   PV     CAKAI+N  CR +RY+T P+WFKVT  WKV  PE++E+   
Sbjct  248  NQDMRDVQIGPFPVSSASGCAKAIVNGVCRKQRYVTVPSWFKVTYLWKVLCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLYMT  G   + AL K+I+D  G +  +YPE+I
Sbjct  308  LLYMTGTGMSEESALNKRIMDIPGVRSALYPESI  341



>gb|ACG69523.1| steroleosin SLO1-2 [Brassica napus]
 emb|CDY68167.1| BnaCnng57830D [Brassica napus]
Length=349

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   S+FE +E++T  R+VMD NFWGSVY T  A P+LR++NG+IV +SSSA 
Sbjct  128  HLVNNAGIMQISMFENIEEITRTRAVMDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFETLRIELG D+ IT+VTPG+IESELTQGK+ +  G L V
Sbjct  188  WLTAPRMSFYNASKAALLNFFETLRIELGSDVHITIVTPGYIESELTQGKYFSGEGELVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + D+RDVQ+   PV  V  CAK I+   CR +RY+TEP+WFKVT  WKVF PE++E+   
Sbjct  248  NQDIRDVQIGAFPVTSVSGCAKGIVKGVCRKQRYVTEPSWFKVTYLWKVFCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LL+++  G+  ++AL KKILD  G +  +YPE+I
Sbjct  308  LLFLSGHGTSEENALNKKILDIPGVRSALYPESI  341



>ref|XP_010482368.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Camelina 
sativa]
Length=350

 Score =   272 bits (695),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  S+FE+VED+T  ++V+D NFWGSVY T  A P+LR++NG+IV +SSSA 
Sbjct  128  HLVNNAGITQISMFEDVEDITRNKAVLDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFET+RIELG D+ IT+VTPG+IESELTQGK+L+  G L V
Sbjct  188  WLTAPRMSFYNASKAALLSFFETMRIELGGDVHITIVTPGYIESELTQGKYLSGEGELIV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + D+RDVQ+   PV     CAKAI+N  CR +RY+TEP+WFKVT  WKV  PE++E+   
Sbjct  248  NQDVRDVQIGPFPVASASGCAKAIVNGVCRKQRYVTEPSWFKVTYLWKVLCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLYMT      ++AL K+I+D  G +  +YPE+I
Sbjct  308  LLYMTGSSMSEENALNKRIMDIPGVRSALYPESI  341



>emb|CBI15698.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   270 bits (691),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 162/215 (75%), Gaps = 3/215 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ + S  EE  D+T+ R VMD+NFWGSVY T  A PHLR ++G+I+ ++SSA 
Sbjct  102  HLVNNAGIQSASTLEEATDITNFRPVMDVNFWGSVYTTRFAIPHLRNSHGKIIGMASSAA  161

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIK-ITLVTPGFIESELTQGKHLNKAGRLE  359
            WL  PRMSIYNASKAA+  F++TLRIELG DI  IT+VTPGFIESE+TQG+ L    ++E
Sbjct  162  WLPMPRMSIYNASKAALISFYDTLRIELGSDIGGITVVTPGFIESEMTQGEFLKNEDQIE  221

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V  DMRD QV+I+PVG+ +ACAKAI+ SACRGE+YLTEP+WF+VT  WKV  PEV+E+  
Sbjct  222  VDQDMRDAQVSIIPVGRAEACAKAIVKSACRGEKYLTEPSWFRVTYLWKVLCPEVIEWCF  281

Query  540  LLLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
             L Y+  PG    + L KKILD +G +  +YP TI
Sbjct  282  RLFYLARPGE--SETLSKKILDISGARGFLYPTTI  314



>ref|XP_010663769.1| PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydroxysteroid dehydrogenase 
1B-like [Vitis vinifera]
Length=348

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 162/215 (75%), Gaps = 3/215 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ + S  EE  D+T+ R VMD+NFWGSVY T  A PHLR ++G+I+ ++SSA 
Sbjct  128  HLVNNAGIQSASTLEEATDITNFRPVMDVNFWGSVYTTRFAIPHLRNSHGKIIGMASSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIK-ITLVTPGFIESELTQGKHLNKAGRLE  359
            WL  PRMSIYNASKAA+  F++TLRIELG DI  IT+VTPGFIESE+TQG+ L    ++E
Sbjct  188  WLPMPRMSIYNASKAALISFYDTLRIELGSDIGGITVVTPGFIESEMTQGEFLKNEDQIE  247

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V  DMRD QV+I+PVG+ +ACAKAI+ SACRGE+YLTEP+WF+VT  WKV  PEV+E+  
Sbjct  248  VDQDMRDAQVSIIPVGRAEACAKAIVKSACRGEKYLTEPSWFRVTYLWKVLCPEVIEWCF  307

Query  540  LLLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
             L Y+  PG    + L KKILD +G +  +YP TI
Sbjct  308  RLFYLARPGE--SETLSKKILDISGARGFLYPTTI  340



>emb|CDX83157.1| BnaA03g23490D [Brassica napus]
Length=311

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 161/214 (75%), Gaps = 3/214 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  S+FE  E++T  RSVMD NFWGSVY T  A P+LR++NG+IVV+SSSA 
Sbjct  98   HLVNNAGITKISMFENFEEITRTRSVMDTNFWGSVYTTRAALPYLRQSNGKIVVMSSSAA  157

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFETLRIELG D+ IT+VTPG+ + EL QGK+ +  G L V
Sbjct  158  WLTAPRMSFYNASKAALLNFFETLRIELGGDVHITIVTPGYTQFELAQGKYFSAEGELVV  217

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RDVQV   PV  V ACAK I+N  CR +RY+TEP+WFKVT  WKVF PE++E+   
Sbjct  218  DQDVRDVQVGAFPVASVSACAKEIVNGVCRKQRYVTEPSWFKVTYLWKVFCPELIEWGCR  277

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LL+MT   +  ++AL KKILD TG + ++YPE I
Sbjct  278  LLFMT---TSEENALNKKILDNTGVRGVLYPEPI  308



>gb|ACG69524.1| steroleosin SLO1-3 [Brassica napus]
Length=341

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 161/214 (75%), Gaps = 3/214 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  S+FE  E++T  RSVMD NFWGSVY T  A P+LR++NG+IVV+SSSA 
Sbjct  128  HLVNNAGITKISMFENFEEITRTRSVMDTNFWGSVYTTRAALPYLRQSNGKIVVMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFETLRIELG D+ IT+VTPG+ + EL QGK+ +  G L V
Sbjct  188  WLTAPRMSFYNASKAALLNFFETLRIELGGDVHITIVTPGYTQFELAQGKYFSAEGELVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RDVQV   PV  V ACAK I+N  CR +RY+TEP+WFKVT  WKVF PE++E+   
Sbjct  248  DQDVRDVQVGAFPVASVSACAKEIVNGVCRKQRYVTEPSWFKVTYLWKVFCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LL+MT   +  ++AL KKILD TG + ++YPE I
Sbjct  308  LLFMT---TSEENALNKKILDNTGVRGVLYPEPI  338



>gb|ABO71657.1| short-chain dehydrogenase reductase [Brassica napus]
Length=349

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   S+FE +E++T  R+VMD NFWG+VY T  A P+LR++NG+IV +SSSA 
Sbjct  128  HLVNNAGIMQISMFENIEEITRTRAVMDTNFWGAVYTTRAALPYLRQSNGKIVAMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS+YNASKAA+  FFETLRIELG D+ IT+VTPG+IESELTQGK+++  G L V
Sbjct  188  WLTAPRMSLYNASKAALLNFFETLRIELGSDVHITIVTPGYIESELTQGKYVSGEGELVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + D+RDVQ+    V  V  CAK I+   CR ERY+TEP+WFKVT  WKVF PE++E+   
Sbjct  248  NQDIRDVQIGAFLVTSVSGCAKGIVKGVCRKERYVTEPSWFKVTYLWKVFCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L++++  G+P ++AL KKILD  G +  +YPE I
Sbjct  308  LMFLSGHGTPEENALNKKILDIPGVRSALYPEPI  341



>ref|XP_009784251.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like, partial 
[Nicotiana sylvestris]
Length=193

 Score =   264 bits (674),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   +LFE+ EDVT  RSVMDINFWGS YMT  A P+LR + GRI+V+SSSA 
Sbjct  7    HLVNNAGVHAITLFEDTEDVTDFRSVMDINFWGSFYMTRFAIPYLRYSGGRIIVLSSSAA  66

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR S YNASKAA+SQFFETLRIELG DIKITLVTPGF+ESELTQGK++ K+G +EV
Sbjct  67   WLPAPRSSFYNASKAAISQFFETLRIELGQDIKITLVTPGFVESELTQGKYIGKSGGVEV  126

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYI  536
               MRDV ++  PV KV++CAK I+NSACRGERY+T PAWF+V+  WKVF PEV+E++
Sbjct  127  DQGMRDVLISATPVAKVESCAKTIVNSACRGERYVTIPAWFRVSYLWKVFCPEVLEWM  184



>emb|CDY34029.1| BnaC03g27860D [Brassica napus]
Length=341

 Score =   269 bits (687),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 161/214 (75%), Gaps = 3/214 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  S+FE  E++T  RSVMD NFWGSVY T  A P+LR++NG+IVV+SSSA 
Sbjct  128  HLVNNAGITKISMFENFEEITRTRSVMDTNFWGSVYTTRAALPYLRQSNGKIVVMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFETLRIELG D+ IT+VTPG+ + EL QGK+ +  G L V
Sbjct  188  WLTAPRMSFYNASKAALLNFFETLRIELGGDVHITIVTPGYTQFELAQGKYFSAEGELVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RDVQV   PV  V  CAK I+N  CR +RY+TEP+WFKVT  WKVF PE++E+   
Sbjct  248  DQDVRDVQVGGFPVASVSGCAKEIVNGVCRKQRYVTEPSWFKVTYLWKVFCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LL+MT   +  ++AL KKILD TG + ++YPE+I
Sbjct  308  LLFMT---TSEENALNKKILDNTGVRGVLYPESI  338



>ref|XP_002511145.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
 gb|EEF51747.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
Length=349

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+++ ++ EE+ D+T+ R++MD NFWGS Y+TH A P+LR   G+I+VI+SSA 
Sbjct  128  HLVNNAGISSAAMLEEITDITTFRTIMDTNFWGSAYITHFAVPYLRGTRGKIIVIASSAS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL SPR SIYNASKAA+  FFETLR+ELG DI + +VTPGFIESELTQGK L   G++++
Sbjct  188  WLPSPRFSIYNASKAALVAFFETLRVELGSDIHVLIVTPGFIESELTQGKFLLAEGKVDL  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RDVQV+ +PV  V  CA++I+NSA RG++YLTEP WF++T  WKVF P+ +E+   
Sbjct  248  DQDARDVQVSAIPVQAVTECARSIVNSARRGDKYLTEPKWFRMTWIWKVFCPDAIEWNYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L Y+   G P  +A  KK+LD TG +KI+YPE+I
Sbjct  308  LSYLPGEGEPAAEAPSKKVLDMTGAKKILYPESI  341



>ref|XP_006402075.1| hypothetical protein EUTSA_v10015475mg [Eutrema salsugineum]
 gb|ESQ43528.1| hypothetical protein EUTSA_v10015475mg [Eutrema salsugineum]
Length=349

 Score =   269 bits (687),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 159/214 (74%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVN AG+T  S+FE+VED+T  +SVMD NFWGSVY T  A P+LR++NG+IV +SSSA 
Sbjct  128  HLVNIAGITQISMFEDVEDITRTKSVMDTNFWGSVYTTRAALPYLRQSNGKIVAMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMSIYNASKAA+  FFET+RIELG D+ IT+VTPGF+ESELTQGK+ +  G L  
Sbjct  188  WLTAPRMSIYNASKAAVLSFFETMRIELGGDVHITIVTPGFVESELTQGKYYSGEGELVF  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + DMRD Q+  +PV     CAK I+N  CR +RY+TEP+W KVT  WKVF PE++E    
Sbjct  248  NQDMRDAQIGPVPVASASGCAKGIVNGVCRKQRYVTEPSWVKVTYLWKVFCPELIERGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LL+M   G P + AL KK+LD  G +  +YP++I
Sbjct  308  LLFMAGRGMPEESALNKKLLDIPGVRSALYPDSI  341



>ref|XP_010442253.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Camelina 
sativa]
Length=350

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  S+FE+VED+T  ++V+D NFWGSVY T  A P+LR++NG+IV +SS+A 
Sbjct  128  HLVNNAGITQISMFEDVEDITRNKAVLDTNFWGSVYTTRAALPYLRQSNGKIVAMSSAAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFET+RIELG D+ IT+VTPG+IESELTQGK+ +  G L V
Sbjct  188  WLTAPRMSFYNASKAALLSFFETMRIELGGDVHITIVTPGYIESELTQGKYFSGEGELIV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + D+RDVQ+   PV     CAKAI+N  CR +RY+TEP+WFKVT  WKV  PE++E+   
Sbjct  248  NQDVRDVQIGPFPVASASGCAKAIVNGVCRKQRYVTEPSWFKVTYLWKVLCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L+YMT      ++AL K+I+D  G +  +YPE+I
Sbjct  308  LMYMTGSSMSEENALNKRIMDIPGVRSALYPESI  341



>ref|XP_009134064.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brassica 
rapa]
Length=341

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 161/214 (75%), Gaps = 3/214 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  S+FE  E++T  RSVMD NFWGSVY T  A P+LR++NG+IVV+SSSA 
Sbjct  128  HLVNNAGITKISMFENFEEITRTRSVMDTNFWGSVYTTRAALPYLRQSNGKIVVMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFETLRIELG D+ IT+VTPG+ + EL QGK+ +  G L V
Sbjct  188  WLTAPRMSFYNASKAALLNFFETLRIELGGDVHITIVTPGYTQFELAQGKYFSAEGELVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDVQV   PV  V ACAK I+N  CR +RY+TEP+WFKVT  WKVF PE++E+   
Sbjct  248  DQNVRDVQVGAFPVASVSACAKEIVNGVCRKQRYVTEPSWFKVTYLWKVFCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LL+MT   +  ++AL KKILD TG + ++YPE I
Sbjct  308  LLFMT---TSEENALNKKILDNTGVRGVLYPEPI  338



>gb|ACG69522.1| steroleosin SLO1-1 [Brassica napus]
Length=349

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   S+FE +E++T  R+VMD NFWG+VY T  A P+LR++NG+IV +SSSA 
Sbjct  128  HLVNNAGIMQISMFENIEEITRTRAVMDTNFWGAVYTTRAALPYLRQSNGKIVAMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFETLRIELG D+ IT+VTPG+IESELTQGK+++  G L V
Sbjct  188  WLTAPRMSFYNASKAALLNFFETLRIELGSDVHITIVTPGYIESELTQGKYVSGEGELVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + D+RDVQ+   PV  V   AK I+   CR ERY+TEP+WFKVT  WKVF PE++E+   
Sbjct  248  NQDIRDVQIGAFPVTSVSGRAKGIVKGVCRKERYVTEPSWFKVTYLWKVFCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L++++  G+P ++AL KKILD  G +  +YPE I
Sbjct  308  LMFLSGHGTPEENALNKKILDIPGVRSALYPEPI  341



>ref|XP_010695411.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Beta 
vulgaris subsp. vulgaris]
Length=342

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ T S+FEE   VT+   VM+ NFWGSVY TH A PHLR + G+I+VI+SS  
Sbjct  128  HLVNNAGIATMSMFEEFTCVTNAAPVMETNFWGSVYSTHFAIPHLRTSKGKIIVIASSGA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR+++Y+ASKAA+  FFETLR+ELG DI IT+VTPG IESELT+GK L+  G++ V
Sbjct  188  WLPAPRLALYSASKAALVIFFETLRVELGGDIGITIVTPGLIESELTKGKFLSPEGKMVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRDVQV+ +PV  V+ C+KAI++S CRG+RYLT P+W +VT  WK+F PE++++ N 
Sbjct  248  DQEMRDVQVSAVPVEPVERCSKAIVDSVCRGDRYLTVPSWMRVTVLWKMFLPEILDWCNR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            +L +T P +PP  A  KKILDYTG +  +YP +I
Sbjct  308  MLLVTKPETPPTAAPSKKILDYTGVKSAMYPPSI  341



>ref|XP_010695678.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Beta 
vulgaris subsp. vulgaris]
Length=349

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 169/224 (75%), Gaps = 2/224 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T+ S+  + ED+T  RS+MDINFWGSVY+T  A PHL+R  G+I+V+SSSA 
Sbjct  128  HLVNNAGITSISMLADYEDITIPRSIMDINFWGSVYITQFAIPHLKRTGGKIIVMSSSAS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PRMSIYNASKAAM   +ETLR+ELG DI+IT+ TPGF+ESE+T+GKHL   G + V
Sbjct  188  WLPTPRMSIYNASKAAMVALYETLRVELGSDIQITIATPGFVESEMTKGKHLAPEGLMNV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRDVQV++ PV   + CAKAI+ SACRGERY+TEP W++V+ WWK F+PE+V+++  
Sbjct  248  DVNMRDVQVSVFPVASGERCAKAIITSACRGERYVTEPTWYRVSSWWKAFWPELVDWLFR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
            + Y+T  G  P D L KK+LD  G + ++YP ++     G KT+
Sbjct  308  MFYLTKFGDSPTDLLSKKLLDLPGLRAMVYPSSVY--SHGVKTE  349



>ref|XP_008439964.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=349

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 159/214 (74%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   +LFEE+ED+TSL  +MD N+WGSVY T  A P+LR N G+IVV+SS+A 
Sbjct  128  HLVNNAGVANMTLFEEIEDITSLNQIMDTNYWGSVYTTQFAIPYLRNNRGKIVVLSSTAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PRM+IYNA+KAA+   FETLR+EL PDI IT+VTPGF+ESELT+GK L   G +EV
Sbjct  188  WLPAPRMNIYNATKAALRSMFETLRVELAPDIGITIVTPGFVESELTKGKALYSHGTIEV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RD  +  +PV  V+ACAKAI+ S CRG+RYLTEP+W+    + KVF PEV+E+   
Sbjct  248  HQDVRDALIGAIPVETVEACAKAIVRSVCRGDRYLTEPSWYNSVYYMKVFCPEVLEWFYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            +   T PG+   +AL KK+LD TG + ++YP +I
Sbjct  308  IFVYTRPGTSVAEALNKKMLDATGAKNVMYPPSI  341



>ref|XP_006282100.1| hypothetical protein CARUB_v10028347mg [Capsella rubella]
 gb|EOA14998.1| hypothetical protein CARUB_v10028347mg [Capsella rubella]
Length=349

 Score =   266 bits (681),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 159/214 (74%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T  S+FE VED+T  ++V+D NFWGSVY T  A P+LR+ NG+IV +SSSA 
Sbjct  128  HLVNNAGITQISMFENVEDITRTKAVLDTNFWGSVYTTRAALPYLRQTNGKIVAMSSSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFET+RIELG D+ IT+VTPG+IESELTQGK+ +  G L V
Sbjct  188  WLTAPRMSFYNASKAALLSFFETMRIELGGDVHITIVTPGYIESELTQGKYFSGEGELIV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + D+RDVQ+   PV     CAK+I+N  CR +RY+TEP+WFKVT  WKV  PE++E+   
Sbjct  248  NQDVRDVQIGPFPVASAAGCAKSIVNGVCRKQRYVTEPSWFKVTYIWKVLCPELIEWGCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLYMT       +AL K+I+D  G +  +YPE+I
Sbjct  308  LLYMTGSEMSEANALNKRIMDIPGVRSALYPESI  341



>ref|XP_004145220.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
 ref|XP_004153124.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
 ref|XP_004162135.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
 gb|KGN64428.1| hypothetical protein Csa_1G051660 [Cucumis sativus]
Length=349

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 158/214 (74%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA +T   LFE++ D+ + + VMDIN+WG+VYMTHLA P+LR + G+IV +S+   
Sbjct  128  HLVNNAAITHLVLFEDIADIAAFKQVMDINYWGAVYMTHLAIPYLRYSRGKIVALSAPPA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL SPRMSIYN+SKAA+   FETLR+EL P+I +T+VTPGF+ESELTQGK LN  G++E+
Sbjct  188  WLPSPRMSIYNSSKAAIKSMFETLRVELAPEIGVTIVTPGFVESELTQGKALNAFGKVEL  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              DMRD  + I+PV   D CAK ++   CRG RY+TEP+W+KV  +WK F PE++E+   
Sbjct  248  RQDMRDALIGIVPVETADECAKGVVRGVCRGYRYVTEPSWYKVLFYWKAFCPELIEWCYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            ++ M +PG    DAL K+ LDYTG + ++YP +I
Sbjct  308  IMSMPAPGGSESDALSKQALDYTGGKYMLYPSSI  341



>ref|XP_010250644.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=349

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 162/218 (74%), Gaps = 0/218 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HL+ NAG+T   +FE+  DVT+ R+VMDINFWGS+Y T+ A PHLR++ G+I+VISSSAG
Sbjct  128  HLICNAGITCACIFEDALDVTNFRTVMDINFWGSIYSTYFAIPHLRKSKGKIIVISSSAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
               SP MS+Y ASKAAM  F+ETLR+ELG ++K+TLVTPGF+ESE+TQGKHL+K G LEV
Sbjct  188  SFVSPMMSLYGASKAAMINFYETLRVELGQEVKVTLVTPGFVESEMTQGKHLSKGGSLEV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
             A++RDV +  +PV  V  C K+I+N ACRG+RY+TEP+WF +   ++   PE+VE+   
Sbjct  248  DAELRDVAIGAVPVLSVSECTKSIVNGACRGDRYVTEPSWFGLLFVFQFCCPELVEWFCR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
            +LY T PG+  ++ L +K+LD  G +K  YP +I   Q
Sbjct  308  MLYGTKPGASNRETLSRKLLDVVGAKKFFYPSSIHSSQ  345



>ref|XP_010086987.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
 gb|EXB25266.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
Length=373

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 165/228 (72%), Gaps = 4/228 (2%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+++ S+FEE+ ++T+ R++MD NFWGSVY T  A P LR + G+IVV+SSSA 
Sbjct  129  HLVNNAGISSVSMFEEITNITAFRALMDTNFWGSVYTTRFAIPRLRNSRGKIVVLSSSAS  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PRMSIYNASKAA+   FETLR+ELG  + IT+VTPGFIESELTQGK L++ G++ +
Sbjct  189  WLPTPRMSIYNASKAALLTMFETLRVELGSVVNITIVTPGFIESELTQGKFLDQEGKMII  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RD Q++ +P+  V ACAK+I+ S  RG+RYLTEP WFKV+  WKVF PEV+E+   
Sbjct  249  DPDVRDAQISAVPIRTVRACAKSIVKSTLRGQRYLTEPPWFKVSYIWKVFCPEVLEWGFR  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETII----HDQEGPKTD  674
              Y+  PG    +A  KKI+D+TG + + YP T+     HD+     D
Sbjct  309  FFYLGRPGKSATEAPAKKIVDFTGAKNVPYPSTLQAPEDHDETAEDHD  356



>ref|XP_004162136.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
Length=349

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 159/219 (73%), Gaps = 1/219 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   +LFEE++D+TS   +MD N+WGSVY T  A P+LR N G+I+V+SS+A 
Sbjct  128  HLVNNAGVANMTLFEEMKDITSFNQIMDTNYWGSVYTTQFAIPYLRNNRGKIIVLSSTAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PRMSIYNA+KAA+   FETLR+EL PDI IT+VTPGF+ESELT+GK L   G +EV
Sbjct  188  WLPAPRMSIYNATKAALKSMFETLRVELAPDIGITIVTPGFVESELTKGKALYSHGAMEV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RD  +  +PV  V+ACAKAI+ S CRG+RYLTEP+W+    + KVF PEV+E+   
Sbjct  248  HQDVRDALIGAIPVETVEACAKAIVRSVCRGDRYLTEPSWYNSVYYLKVFCPEVLEWCYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQE  659
            +   T PGS   +A  KK+LD TG + ++YP + IH  E
Sbjct  308  MFMYTRPGSSVAEAPSKKLLDATGAKNVMYPPS-IHSAE  345



>ref|XP_010249449.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=351

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV+NAG+ +  +FE+  D+T    +MD NFWGSVY  + A PHLR++ G+I+V +SSAG
Sbjct  130  HLVSNAGIASVCMFEDSSDITKFAPIMDTNFWGSVYTAYFAVPHLRKSKGKIIVNASSAG  189

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS+YNASKAA+  F+ETLR+ELG DI IT+VTPGF ESE+ QGK L K G ++V
Sbjct  190  WLPLPRMSVYNASKAAVINFYETLRVELGRDIGITIVTPGFTESEMMQGKFLTKEGEMQV  249

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRDV+V   PV K + CAKAI+ SACRG+RYLT+P WF+V   WKV  P V+E+   
Sbjct  250  DQEMRDVEVGTFPVEKAEGCAKAIVKSACRGDRYLTQPLWFRVMFVWKVVCPHVLEWFYR  309

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLY+T PG+  +DA  KKIL +T    ++YP +I
Sbjct  310  LLYVTPPGTSQRDAPSKKILHHTAANNLLYPSSI  343



>ref|XP_004145221.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
 ref|XP_004153123.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
Length=349

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 159/219 (73%), Gaps = 1/219 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   +LFEE++D+TS   +MD N+WGSVY T  A P+LR N G+I+V+SS+A 
Sbjct  128  HLVNNAGVANMTLFEEMKDITSFNQIMDTNYWGSVYTTQFAIPYLRNNRGKIIVLSSTAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PRMSIYNA+KAA+   FETLR+EL PDI IT+VTPGF+ESELT+GK L   G +EV
Sbjct  188  WLPAPRMSIYNATKAALKSMFETLRVELAPDIGITIVTPGFVESELTKGKALYSHGAMEV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RD  +  +PV  V+ACAKAI+ S CRG+RYLTEP+W+    + KVF PEV+E+   
Sbjct  248  HQDVRDALIGAIPVETVEACAKAIVRSVCRGDRYLTEPSWYNSVYYLKVFCPEVLEWCYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQE  659
            +   T PGS   +A  KK+LD TG + ++YP + IH  E
Sbjct  308  IFMYTRPGSSVAEAPSKKLLDATGAKNVMYPPS-IHSAE  345



>ref|XP_008446259.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=349

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 158/214 (74%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA +T   LFE++ D+T+ + VMDIN+WG++Y+THLA P+LR + G+IV +S+   
Sbjct  128  HLVNNAAITHLVLFEDIADITAFKQVMDINYWGAIYLTHLAIPYLRISRGQIVALSAPPA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PRMSIYN+SKAA+   FETLR+EL PDI +T+VTPGF+ESELTQGK LN  G++E+
Sbjct  188  WLPAPRMSIYNSSKAAIKSMFETLRVELAPDIGVTIVTPGFVESELTQGKALNAFGKVEL  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              DMRD  + I+PV   + CAK ++   CRG RY+TEP+W+KV  +WK F PE+VE+   
Sbjct  248  RQDMRDALIGIVPVETAEECAKGVVRGVCRGYRYVTEPSWYKVLYYWKAFCPELVEWCYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            ++ M + G    DAL K+ LDYTG + ++YP +I
Sbjct  308  IMTMPAAGGSESDALSKQTLDYTGGKYLLYPSSI  341



>ref|XP_006436878.1| hypothetical protein CICLE_v10031969mg [Citrus clementina]
 ref|XP_006493234.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Citrus 
sinensis]
 gb|ESR50118.1| hypothetical protein CICLE_v10031969mg [Citrus clementina]
Length=349

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 155/213 (73%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+++ + FE+  ++T  + +MDINFWGSVY T  A PHLR   G+I V+SSSA 
Sbjct  128  HLVNNAGISSVAPFEDTVNITDFKQIMDINFWGSVYTTRFAVPHLRYTKGKIAVLSSSAS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PRMS YNASKAA+  FFETLR+ELG D+ +T+VTPGFIESELTQGK L   GR+++
Sbjct  188  WLTAPRMSFYNASKAALVLFFETLRVELGSDVGVTIVTPGFIESELTQGKFLTGEGRIQI  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RD QV+ +PV    +CAKAI+NS CRG+ YL  P+WF+ T W KV  PE++E+   
Sbjct  248  DENLRDAQVSTIPVQSAWSCAKAIVNSVCRGDTYLVVPSWFRTTYWMKVLCPELLEFWYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPET  641
            + YM  P  P  +A  +K+ DYTG Q ++YP +
Sbjct  308  VFYMGRPEEPSYEAPSQKVSDYTGAQNVLYPSS  340



>ref|XP_010695677.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Beta 
vulgaris subsp. vulgaris]
Length=348

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 159/214 (74%), Gaps = 1/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   + F+E+EDVT +R VMDINFWGSVY+T  A PHLR   G+IVV+SSSA 
Sbjct  128  HLVNNAGVVGVNQFDELEDVTRMRPVMDINFWGSVYITRFAIPHLRYTGGKIVVMSSSAS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W+  PR S YNASKAAM  FFETLR+ELG D+KIT+VTPG IESE T+GK   + G ++V
Sbjct  188  WMPVPRESFYNASKAAMLAFFETLRVELGSDVKITIVTPGVIESEFTKGKVWTEGG-MKV  246

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDVQVN++PVG V+  AK+I+ S CRG+RY+T PAWFKVT + K+  PEV+E+   
Sbjct  247  DQELRDVQVNVIPVGTVEGTAKSIIRSVCRGDRYVTTPAWFKVTYFLKMLCPEVLEWAYR  306

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
             L++TS    P  A+GK ++D+ G + ++YP  I
Sbjct  307  FLFLTSTDDSPTGAMGKHMVDFPGAKAMLYPPGI  340



>ref|XP_010929561.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Elaeis guineensis]
Length=389

 Score =   258 bits (658),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 163/224 (73%), Gaps = 1/224 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FEE EDVT+   V+D+NFWGS+Y T+ A PHL++  GRIVV SSS+G
Sbjct  128  HLVNNAGIANLCMFEEAEDVTNFMPVLDVNFWGSIYPTYFALPHLKQTRGRIVVNSSSSG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS YNASKAA+  FFETLRIE G +I IT+ TPG+IESE+TQGK L+K GR+ V
Sbjct  188  WLPMPRMSFYNASKAALINFFETLRIEFGHEIGITIATPGWIESEMTQGKFLSKEGRMVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDVQV + PV   + CAKAI+NSACRG+RY+ EP+WFK    W+VF PEV++++  
Sbjct  248  DQELRDVQVGLFPVSYSEDCAKAIVNSACRGDRYVIEPSWFKGLYLWRVFAPEVLDWLYH  307

Query  543  LLYMTSPGSPPQDALGKKILD-YTGCQKIIYPETIIHDQEGPKT  671
             +Y+T PG+P  +   K +L+  +G ++++ P +I+     P T
Sbjct  308  FVYVTKPGTPTSEMPSKIMLEAISGAKEVLVPSSILTGSNWPGT  351



>ref|XP_010929560.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Elaeis guineensis]
Length=390

 Score =   257 bits (657),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 163/224 (73%), Gaps = 1/224 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FEE EDVT+   V+D+NFWGS+Y T+ A PHL++  GRIVV SSS+G
Sbjct  128  HLVNNAGIANLCMFEEAEDVTNFMPVLDVNFWGSIYPTYFALPHLKQTRGRIVVNSSSSG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS YNASKAA+  FFETLRIE G +I IT+ TPG+IESE+TQGK L+K GR+ V
Sbjct  188  WLPMPRMSFYNASKAALINFFETLRIEFGHEIGITIATPGWIESEMTQGKFLSKEGRMVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDVQV + PV   + CAKAI+NSACRG+RY+ EP+WFK    W+VF PEV++++  
Sbjct  248  DQELRDVQVGLFPVSYSEDCAKAIVNSACRGDRYVIEPSWFKGLYLWRVFAPEVLDWLYH  307

Query  543  LLYMTSPGSPPQDALGKKILD-YTGCQKIIYPETIIHDQEGPKT  671
             +Y+T PG+P  +   K +L+  +G ++++ P +I+     P T
Sbjct  308  FVYVTKPGTPTSEMPSKIMLEAISGAKEVLVPSSILTGSNWPGT  351



>ref|XP_006436879.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
 ref|XP_006493235.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Citrus 
sinensis]
 gb|ESR50119.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
Length=359

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 159/219 (73%), Gaps = 1/219 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE+  D+T     MDINFWGS Y T+ A P+L++  G+I+V++S+AG
Sbjct  128  HLVTNAGVVPMCLFEDYTDITKPAPAMDINFWGSAYGTYFAIPYLKQTKGKIIVVASAAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS YNASKAA    +ETLRIE G DI IT+VTPG IESE+T GK LNK G+LEV
Sbjct  188  WLPPPRMSFYNASKAAKIALYETLRIEFGGDIGITIVTPGLIESEITGGKFLNKNGKLEV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDVQ++++PV   + CAKAI+NSACRG+RYLT+P+W  VT +WK+ +PE++E+ N 
Sbjct  248  DQEIRDVQISLLPVQPTEECAKAIVNSACRGDRYLTQPSWVGVTYYWKMLWPEIIEWCNR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTG-CQKIIYPETIIHDQ  656
            +L MT PG+  +D L KKILD     ++ + P T+  D+
Sbjct  308  VLLMTGPGTSQRDTLSKKILDAANEIKEFLTPGTVPFDE  346



>ref|XP_010039131.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Eucalyptus 
grandis]
 gb|KCW49098.1| hypothetical protein EUGRSUZ_K02704 [Eucalyptus grandis]
Length=369

 Score =   254 bits (648),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 158/214 (74%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG++   +FE+  D+T L  VMDINFWGSVY ++ A P+L+R+ G+IVVI+S+AG
Sbjct  146  HLVTNAGVSPMCMFEDCPDITKLAPVMDINFWGSVYSSYFALPYLKRSRGKIVVIASAAG  205

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PRMS YNASKAA+  F+ETLR ELG +I IT+VTPG IESE+TQGK L+K GR+ +
Sbjct  206  WLPAPRMSFYNASKAALISFYETLRTELGSEITITIVTPGLIESEMTQGKFLSKEGRMVL  265

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               +RDVQ+ +MP+  V A A+ I+  ACRG+ YLTEPAW K T +WKVF PEV+E+ N 
Sbjct  266  DPQLRDVQIGVMPIRSVGAAAEEIVKGACRGDNYLTEPAWVKSTFYWKVFCPEVLEWCNW  325

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LL +       ++ALG KIL+ TG +  +YP ++
Sbjct  326  LLLVAGTEISERNALGFKILELTGLKPFLYPPSV  359



>ref|XP_004503837.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cicer arietinum]
Length=347

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 162/221 (73%), Gaps = 2/221 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    LFE+  D+T+    MDINFWGS Y T+ + PHL++  G+IV I+SSAG
Sbjct  128  HLVNNAGIVPLCLFEDTTDITNFVPAMDINFWGSAYGTYFSIPHLKKFKGKIVAIASSAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PRM  YNASKAAM   +E+LR ELG DI IT+VTPG IESE+TQGK L+K GR+ +
Sbjct  188  WLPAPRMMFYNASKAAMITLYESLRTELGRDIGITIVTPGLIESEMTQGKFLSKEGRMVL  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRDVQ++++P+  V   AKAI+NSACRG+ YLTEPAW + T +WK+F PEV+E +N 
Sbjct  248  DQEMRDVQISMVPIRSVTEAAKAIVNSACRGDLYLTEPAWIRTTFYWKMFCPEVLEILNR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGP  665
             L ++  GS  ++ + KK+++ +G +K +YPE+I + +  P
Sbjct  308  WLLLS--GSSERETISKKLINLSGLKKYLYPESIRNPKLKP  346



>ref|XP_008239509.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Prunus 
mume]
Length=343

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T   LFEE  DVT +   MD NFWGSVY T+ A PHL+R+ G+IV I+SSAG
Sbjct  129  HLVNNAGITPVCLFEEATDVTKIAPAMDTNFWGSVYGTYFAIPHLKRSRGKIVGIASSAG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PR+S+Y A+K+A+  F+ETLR+E+G ++ IT+VTPG +ESE+T+GK L+K G+L +
Sbjct  189  WLRVPRLSLYGATKSAVISFYETLRVEIGREVGITIVTPGLVESEMTKGKFLSKEGQLVL  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDV+V+IMP+  V   AK+I++SACRGE YLT PAW   + +WKVFFPE++E+ N 
Sbjct  249  DQELRDVEVSIMPILPVKEAAKSIVDSACRGENYLTVPAWVWHSFYWKVFFPELLEWSNH  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            +L M+      +D + KK+LD TG ++ +YPE++
Sbjct  309  MLLMSKGSGGERDTISKKLLDLTGLKECLYPESV  342



>ref|XP_004503736.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cicer arietinum]
Length=351

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 160/220 (73%), Gaps = 2/220 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA ++  +LFEEV D+T LR VMD NFWGSVY T  A PHLR + G+IVV+SS+  
Sbjct  128  HLVNNAAISAATLFEEVTDITDLRPVMDTNFWGSVYTTRFALPHLRNSRGKIVVLSSADS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKH-LNKAGRLE  359
            W+ +PR SIYNASKAA+   +ETLR+E+G DI IT+VTPG+IESELT+GK  L    ++ 
Sbjct  188  WMPAPRRSIYNASKAALVSLYETLRVEVGSDIGITIVTPGYIESELTKGKFLLPPQAKMG  247

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V  DMRDV+V+ MPVG V  CAK+I+NS  RG+RYLT PAWF++T   KV  PE+VE+  
Sbjct  248  VDQDMRDVEVSAMPVGSVSGCAKSIVNSTLRGDRYLTVPAWFRMTYVVKVLCPELVEWSF  307

Query  540  LLLYMT-SPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
             +LY+T S  +P ++A  KKILD TG + + YP +I   Q
Sbjct  308  RMLYLTKSNTTPVREAPSKKILDATGIKNLFYPSSIHSPQ  347



>ref|XP_006844627.1| hypothetical protein AMTR_s00016p00227990 [Amborella trichopoda]
 gb|ERN06302.1| hypothetical protein AMTR_s00016p00227990 [Amborella trichopoda]
Length=348

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 164/227 (72%), Gaps = 9/227 (4%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ +  +FEEV D+T L  VMD+NFWGSVY T+ A PHLR+  G+IV  +S+AG
Sbjct  128  HLVNNAGIVSLCMFEEVTDITKLEPVMDVNFWGSVYPTYYAIPHLRKVRGKIVANASAAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL + RMSIYNASKAAM  FF+TLR+E+GP+I IT+ TPG+IESE+T+GK LNK G + V
Sbjct  188  WLPTARMSIYNASKAAMINFFDTLRMEVGPEIGITIATPGWIESEMTRGKFLNKEGEMVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + + R+VQV  MP+G    CA+AI+  AC G+R +TEP WF+V  W+++  PEV+E+   
Sbjct  248  NEETREVQVGPMPIGYTQGCAEAIVKGACIGDRNVTEPFWFRVMFWYRLLVPEVMEWCYR  307

Query  543  LLYMTSP-GS--PPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
            LLY+T P GS  PP     KKIL  TG +K++YP +I    E  K+D
Sbjct  308  LLYVTKPWGSRYPPS----KKILYATGAEKVLYPTSI--QSEETKSD  348



>ref|XP_008811369.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Phoenix 
dactylifera]
Length=330

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 145/190 (76%), Gaps = 0/190 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FEE EDVT+   VMD+NFWGS+Y T+ A PHL++  GRIVV SSSAG
Sbjct  128  HLVNNAGIANLCMFEEAEDVTNFTPVMDVNFWGSIYPTYFALPHLKQTRGRIVVNSSSAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS YNASKAA+  FFETLRIE G +I IT+ TP +IESE+TQGK L+K G++ V
Sbjct  188  WLPMPRMSFYNASKAALINFFETLRIEFGHEIGITIATPWWIESEMTQGKFLSKEGKMVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RD+QV +  VG  D C KAI+N ACRG+RY+TEP+WFK+   W+VF PEV++++  
Sbjct  248  DQELRDIQVGLFLVGYSDGCTKAIVNGACRGDRYVTEPSWFKMLYLWRVFAPEVLDWLYH  307

Query  543  LLYMTSPGSP  572
             LY+T PG+P
Sbjct  308  FLYVTKPGTP  317



>ref|XP_008392822.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Malus 
domestica]
Length=349

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    LFEE  DVT+L   MDINFWGSVY T+ A PHL+R+ GRIV I+SSAG
Sbjct  128  HLVNNAGIVPVCLFEETTDVTNLAPAMDINFWGSVYGTYFAIPHLKRSGGRIVAITSSAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR+S+Y A+KAA   F+ETL++E+G ++ IT+VTPG IESE++QGK L+K G++ +
Sbjct  188  WLRAPRLSMYGATKAAAIAFYETLKVEIGREVGITIVTPGMIESEISQGKFLSKEGQVVL  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RD++V+I+P+  V   AK+I++SACRGE YLT PAW   + +WKVFFPE++E+ N 
Sbjct  248  DQELRDLEVSIIPILPVKEAAKSIVDSACRGENYLTVPAWIWQSFYWKVFFPEILEWCNR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
             L ++  G+  +D L KK+L  +G ++ +YPET+
Sbjct  308  TLLISKAGNDERDTLSKKLLYLSGLKQHLYPETV  341



>gb|ABS28874.1| steroleosin-A [Arachis hypogaea]
 gb|ABX38844.1| steroleosin A [Arachis hypogaea]
Length=349

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 159/214 (74%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA ++  +LFEE  D+++LR +M+ NFWGSVY T  A  HLR++ G+IVV+SS   
Sbjct  128  HLVNNAAISIATLFEETPDISNLRPIMETNFWGSVYTTRYALQHLRKSRGKIVVMSSVDS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR  IY+ASKAA+   +ETLR+E+G +I IT+VTPG+IESE+T+GK L+  G ++V
Sbjct  188  WLPAPRRHIYSASKAALVSLYETLRVEVGSEIGITIVTPGYIESEITKGKFLSAQGEVDV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RDV+V+ +PVG V  CA++I+ S  RG+R LT P+WF++T   K+  PE++E+   
Sbjct  248  DQDLRDVEVSAVPVGSVSGCAESIIKSTLRGDRCLTVPSWFRMTYLIKLLCPELLEWTFR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLY+T+PG+P  DAL KKILD TG + + YP +I
Sbjct  308  LLYLTAPGTPTSDALSKKILDATGAKNLFYPPSI  341



>gb|EYU23067.1| hypothetical protein MIMGU_mgv1a009247mg [Erythranthe guttata]
Length=348

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 156/214 (73%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV +AG+T  SLFEE   VT+    MDINFWG  Y T+ AAP+LR   G+IVVI+SSA 
Sbjct  128  HLVMSAGVTPVSLFEETFKVTNFAPAMDINFWGLAYTTYFAAPYLRMTKGKIVVIASSAS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PR+S YNASKAA+  FFETLR+E G  I ITLVTPG IESE+T+GK LNK G++ V
Sbjct  188  WLNAPRLSFYNASKAAVVSFFETLRVEFGSGIGITLVTPGLIESEMTKGKFLNKEGKMVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              DMRDV ++ +P+ +V   AK+ +N+ACRG++YLT P WFK T + K+FFPE V++ N 
Sbjct  248  DQDMRDVVMSAVPIERVARLAKSTVNAACRGDKYLTVPPWFKTTLFIKMFFPEGVDWFNR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
               +T PG P  +A+ KK++D  G + +++P+++
Sbjct  308  WFSITEPGIPQTEAISKKVVDLPGLKDLLWPDSV  341



>ref|XP_004297522.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Fragaria vesca subsp. vesca]
Length=348

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 158/218 (72%), Gaps = 1/218 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FEE  DVT L   MD+NFWGSVY ++ A PHL+++ GRI+ ISS+AG
Sbjct  128  HLVNNAGIAPICMFEETPDVTKLAPAMDVNFWGSVYSSYFAIPHLKQSQGRIIGISSAAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR+S+Y+ASK A+  F+ETLR+E G ++ ITLVTPG +ESE+TQGK LNK GRL +
Sbjct  188  WLRTPRLSMYSASKTAVISFYETLRVETGDEVGITLVTPGLVESEMTQGKFLNKEGRLVL  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RD ++++MPV  V   A+AI++ AC G +YLT PAW + + +WKVF PE +E+ N 
Sbjct  248  DQELRDAEMSLMPVLPVKEAAEAIVDGACEGVKYLTVPAWVRQSIYWKVFSPETLEWCNR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
            +L M+  G    + L KKILD +G + ++YP+TI   Q
Sbjct  308  ILLMSRSGD-ETNTLSKKILDISGLKDLVYPDTIQSPQ  344



>ref|XP_004153125.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
 gb|KGN64429.1| hypothetical protein Csa_1G051670 [Cucumis sativus]
Length=347

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 163/218 (75%), Gaps = 2/218 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T+ +LFEE +D  ++ SVMD +FWG+VY T+ A P+L++  G+I+ I+SSA 
Sbjct  128  HLVNNAGITSINLFEEYDDPRNVASVMDTDFWGTVYCTYYAIPYLKQTRGKIIGIASSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR+S Y+ASKAA+  F+ETLR+E+G DI IT+VTPG  ESE+TQGK + + G++ +
Sbjct  188  WLPTPRLSFYSASKAAVISFYETLRVEIGRDIGITIVTPGLTESEMTQGKFMFEDGKMYL  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RD  +++MP+  V + AKAI+N  CRG+ Y+TEP W ++T +WK+F PE+VE++N 
Sbjct  248  DQELRDAVMSVMPIEAVGSAAKAIVNGGCRGDEYVTEPPWIRMTFYWKMFLPEMVEWLNY  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
            L  MT  GS P ++ GK++L++TG +  IYP ++   Q
Sbjct  308  LFIMT--GSSPTESFGKRVLEFTGLKPFIYPPSVRCSQ  343



>gb|KDP22587.1| hypothetical protein JCGZ_26418 [Jatropha curcas]
Length=396

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 146/209 (70%), Gaps = 8/209 (4%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+T  S+FE+V D+T+    MDINFWGSVY +H A PHL+R  G+I+VI+S A 
Sbjct  162  HLVANAGVTPVSMFEDVPDITNFTPTMDINFWGSVYSSHFAIPHLKRTKGKIIVIASCAS  221

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PRMS YNASKAA+   +ETLRIEL P+I IT+VTPG IESE+T GK LN+ G+LE 
Sbjct  222  WLPTPRMSFYNASKAALVSMYETLRIELAPEIGITIVTPGLIESEMTGGKFLNQQGQLEA  281

Query  363  SADMRDVQVN--------IMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFP  518
              +MRDV +         +MPV     CAKAI+ SACRGE+YLTEP W++   +WKVF P
Sbjct  282  DQEMRDVGLYEHYHVILVVMPVESTPECAKAIVKSACRGEKYLTEPDWYRAIFFWKVFCP  341

Query  519  EVVEYINLLLYMTSPGSPPQDALGKKILD  605
            +V+E+ N    M  PG   +D + K I+D
Sbjct  342  DVIEWSNRFFLMPGPGRSERDTISKNIVD  370



>ref|XP_006366592.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
tuberosum]
Length=353

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 154/215 (72%), Gaps = 0/215 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV+NA +T   +FE++ +VT+    MDINFWG+VY TH A P+L+   G+IV I+SSAG
Sbjct  132  HLVSNAAVTPLYMFEDLVEVTNAAPAMDINFWGAVYTTHFAIPYLKETKGKIVAITSSAG  191

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            +L + R+S YNASKAA+  FFETLR+ELG  I IT+VTPG IESE+T+GK L   G+LEV
Sbjct  192  YLPAARISFYNASKAALISFFETLRVELGTQIGITIVTPGLIESEMTKGKFLTTEGKLEV  251

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               MRDV++++ P+  V+ CA++I+ SACRG++YLTEP WFK    + +FFPEVV++   
Sbjct  252  DQVMRDVEMSVTPILPVEKCARSIVKSACRGDKYLTEPLWFKTFFIYVLFFPEVVDWFQH  311

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETII  647
               +  PG P  +   K +LD TG QK +YPE+++
Sbjct  312  WFLIPGPGKPTTETPSKILLDLTGLQKYVYPESLL  346



>gb|KHN16857.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Glycine 
soja]
Length=377

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 154/214 (72%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG++   LFE   D+ +    MDINFWGS Y T+ A PHLR++ G+I+ I+S  G
Sbjct  158  HLVNNAGVSAPGLFESTTDIRNFAPAMDINFWGSAYGTYFAIPHLRKSKGKIIAIASCTG  217

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMSIYNASKAA+   +ETLRIELG DI IT+VTPG IESE++QGK L K G++  
Sbjct  218  WLPVPRMSIYNASKAAVISLYETLRIELGRDIGITIVTPGLIESEMSQGKVLFKEGKMVS  277

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               +RDVQ +++P+  V   AK+I+NSACRG+ YLTEPAWF  T +WK+FFP+V+E+ N 
Sbjct  278  DQLIRDVQASLIPIRSVTEAAKSIVNSACRGDSYLTEPAWFTTTFYWKIFFPDVLEFCNR  337

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
               ++  GS  +D + KK+LD +G +K + P+++
Sbjct  338  RTLIS--GSSERDTVSKKLLDLSGLKKYLCPKSV  369



>ref|XP_011073098.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 [Sesamum 
indicum]
Length=349

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 153/214 (71%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV  AG+T  S+FE+   VT+    MDINFWG  Y T+ AAP+LR   GRIVVI+SSA 
Sbjct  128  HLVMAAGVTPVSMFEDTFQVTNFAPAMDINFWGLAYATYFAAPYLRMTKGRIVVIASSAS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL++PR+S YNASKAA+  FFETLR E G DI+ITLVTPG +ESE+T+GK L+K G++ V
Sbjct  188  WLNAPRLSFYNASKAAVVSFFETLRTEFGSDIRITLVTPGLVESEMTKGKFLDKEGKMVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              DMRDV ++ +P+  V  CAKAI++ ACRG++YLT P WF+ T + K+  PE  ++ N 
Sbjct  248  DQDMRDVVMSAIPIELVGRCAKAIVDGACRGDKYLTVPPWFRTTFFIKMMLPEATDWFNR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
               +T PG P  +A+ KK++D  G + I++P+++
Sbjct  308  WFSITEPGIPATEAISKKVVDLPGVKDILWPDSV  341



>ref|XP_004162134.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like, 
partial [Cucumis sativus]
Length=429

 Score =   243 bits (621),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 160/211 (76%), Gaps = 2/211 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T+ +LFEE +D  ++ SVMD +FWG+VY T+ A P+L++  G+I+ I+SSA 
Sbjct  128  HLVNNAGITSINLFEEYDDPRNVASVMDTDFWGTVYCTYYAIPYLKQTRGKIIGIASSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR+S Y+ASKAA+  F+ETLR+E+G DI IT+VTPG  ESE+TQGK + + G++ +
Sbjct  188  WLPTPRLSFYSASKAAVISFYETLRVEIGRDIGITIVTPGLTESEMTQGKFMFEDGKMYL  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RD  +++MP+  V + AKAI+N  CRG+ Y+TEP W ++T +WK+F PE+VE++N 
Sbjct  248  DQELRDAVMSVMPIEAVGSAAKAIVNGGCRGDEYVTEPPWIRMTFYWKMFLPEMVEWLNY  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYP  635
            L  MT  GS P ++ GK++L++TG +  IYP
Sbjct  308  LFIMT--GSSPTESFGKRVLEFTGLKPFIYP  336



>ref|XP_009765827.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
sylvestris]
Length=353

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 149/215 (69%), Gaps = 0/215 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NA +T   LFE + +VT     MDINFWG+VY TH A P+L+   G+IV I+SSAG
Sbjct  132  HLVTNAAVTPLYLFENLIEVTKAAPAMDINFWGAVYTTHFAIPYLKETKGKIVAITSSAG  191

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             L++ R+S YNASKAAM  F+ETLR+ELG  I IT+VTPG +ESELT+GK L   G+LEV
Sbjct  192  VLNAARISFYNASKAAMISFYETLRVELGTQIGITIVTPGLVESELTKGKFLTTEGKLEV  251

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               MRDV++++ P+  V  CA+AI+ SACRG+ YLTEP WFK    +++FFPE +E+   
Sbjct  252  DQVMRDVEMSVTPILPVQKCARAIVKSACRGDNYLTEPPWFKTLFVYRIFFPEFLEWFQR  311

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETII  647
                  PG PP +A  K ILD TG ++  YP++++
Sbjct  312  WFLFPGPGQPPTEAPSKIILDVTGFKEYGYPKSVL  346



>ref|XP_008446273.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=351

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 165/226 (73%), Gaps = 2/226 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T+ +LFEE +D  ++ SVMD +FWG+VY T+ A P+L++  G+I+ I+SSA 
Sbjct  128  HLVNNAGITSINLFEEYDDPRNVASVMDTDFWGTVYCTYYAIPYLKQTRGKIIGIASSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR+S Y ASKAA+  F+ETLR+E+G D+ IT+VTPG  ESE+TQGK + + G++ +
Sbjct  188  WLPTPRLSFYTASKAAVISFYETLRVEIGRDVGITIVTPGLTESEMTQGKFMFEDGKMYL  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RD  +++MP+  V + A+AI+   CRG+ Y+TEP W ++T +W++F PE+VE++N 
Sbjct  248  DQELRDAVMSVMPIEAVGSAAEAIVKGGCRGDEYVTEPPWMRMTFYWRMFLPEMVEWLNH  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD*Y  680
            L  MT  GS P ++ GK++L++TG +  IYP ++   + G + + Y
Sbjct  308  LFIMT--GSSPTESFGKRVLEFTGLKPFIYPASVRCSELGYEKEYY  351



>ref|NP_001242368.1| uncharacterized protein LOC100787835 [Glycine max]
 gb|ACU17782.1| unknown [Glycine max]
Length=377

 Score =   239 bits (609),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 152/214 (71%), Gaps = 2/214 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG++   LFE   D+ +    MDINFWGS Y T+ A PHLR++ G+I+ I+S  G
Sbjct  158  HLVNNAGVSAPGLFESTTDIRNFAPAMDINFWGSAYGTYFAIPHLRKSKGKIIAIASCTG  217

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMSIYNASKAA+   +ETLRIELG DI +T+VTPG IESE++QGK L K G++  
Sbjct  218  WLPVPRMSIYNASKAAVISLYETLRIELGRDIGMTIVTPGLIESEMSQGKVLFKEGKMVS  277

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               +RD Q +++P+  V    K+I+NSACRG+ YLTEPAWF  T +WK+FFP+V+E+ N 
Sbjct  278  DQLIRDAQASLIPIRSVTEAVKSIVNSACRGDSYLTEPAWFTTTFYWKIFFPDVLEFCNR  337

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
               ++  GS  +D + KK+LD +G +K + P+++
Sbjct  338  RTLIS--GSSERDTVSKKLLDLSGLKKYLCPKSV  369



>ref|XP_009602452.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
tomentosiformis]
Length=353

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 152/215 (71%), Gaps = 0/215 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NA +T   +FE++ +VT+    MDINFWG+VY TH A PHL+   G+IV I+SSAG
Sbjct  132  HLVINAAVTPLYMFEDLIEVTNAAPAMDINFWGAVYTTHFAIPHLKETKGKIVAITSSAG  191

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             L++ R+S YNASKAAM  F+ETLR+ELG  I IT+VTPG +ESELT+GK L   G+LEV
Sbjct  192  VLNAARISFYNASKAAMISFYETLRVELGTQIGITIVTPGLVESELTKGKFLTTEGKLEV  251

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            +  MRDV++++ P+  V  CA+AI+ SACRG+ YLTEP WF+    +++FFPE++E+   
Sbjct  252  NQVMRDVEMSVTPILPVQKCARAIVKSACRGDNYLTEPPWFRTLFVYRIFFPELLEWFQR  311

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETII  647
                   G PP +A  K ILD TG ++  YP++++
Sbjct  312  WFLFPGRGQPPTEAPSKIILDVTGFKEYGYPKSVL  346



>ref|XP_010249088.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Nelumbo nucifera]
Length=293

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 151/218 (69%), Gaps = 0/218 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +F  FE++  + +   +MDINFWGS+Y T  A PHL++  G+I+  +SS+G
Sbjct  72   HLVCNAGIISFCAFEDITGIGNFTPLMDINFWGSIYTTSFAIPHLKKTKGKIIANASSSG  131

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL SP +S+Y ASKAA+  F+E LR EL PD+K+T+   GFIESE++QGKHL+  G ++V
Sbjct  132  WLISPTLSLYGASKAAVINFYERLRKELEPDVKVTIAALGFIESEMSQGKHLDNEGVVKV  191

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + +MRDV + I+P+  V  CA++I+N ACRGERY+ EP WFKV    +   P ++E+   
Sbjct  192  NQEMRDVSIGILPILSVGKCAESIVNKACRGERYVIEPPWFKVLILIQFLCPTLLEWAVH  251

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
             LY+T  G+P  +A  KKILD  G +K +YP +I+  Q
Sbjct  252  FLYVTKSGTPVTNARNKKILDAIGGKKFLYPSSILSSQ  289



>ref|XP_010323832.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
lycopersicum]
Length=353

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 151/215 (70%), Gaps = 0/215 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV+NA +T   +FE++ DVT+    MDINFWG+VY  H A P+L+   G+IV I+SSAG
Sbjct  132  HLVSNAAVTPLYMFEDLVDVTNAAPAMDINFWGAVYTMHFAIPYLKETKGKIVAITSSAG  191

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            +L + R+S YNASKAA+  FFETLR+ELG  I IT+V PG  ESE+T+GK L   G+LEV
Sbjct  192  YLPAARISFYNASKAALISFFETLRVELGARIGITIVNPGLTESEMTKGKFLTTEGKLEV  251

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               MRDV++++ P+  V+  A++I+NSACRG++YL EP WFK    + +FFPEVV++   
Sbjct  252  DQVMRDVEMSVTPILPVEKSARSIVNSACRGDKYLMEPPWFKAFFVYVLFFPEVVDWFQH  311

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETII  647
               +  PG P  ++  K +LD TG QK +YPE+++
Sbjct  312  WFLIPGPGKPATESPSKILLDVTGLQKYVYPESLL  346



>gb|KEH21006.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=351

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 154/216 (71%), Gaps = 2/216 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA ++   +FE V D+T+ R +MD NFWGSVY T  A  HLR + G+IVV+SS   
Sbjct  128  HLVNNAAISAAMMFEGVTDITNWRPLMDTNFWGSVYTTRFALTHLRNSRGKIVVLSSIDS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGK-HLNKAGRLE  359
            W+ +PR SIYNASKAA+   +ETLR+E+G D+ +T+VTPG+IESELT+GK  L   G++ 
Sbjct  188  WMPAPRRSIYNASKAALVSLYETLRVEVGADVGVTIVTPGYIESELTKGKVLLPPEGKMG  247

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V  DMRDV+V+  PVG V  CAK+I+N   RG+RYLT PAWF++T   KV  PE++E+  
Sbjct  248  VDQDMRDVEVSATPVGSVSECAKSIVNGTLRGDRYLTAPAWFRMTYVVKVLCPELLEWGF  307

Query  540  LLLYMT-SPGSPPQDALGKKILDYTGCQKIIYPETI  644
             +LY+T S  +P ++A  KKILD TG + + YP +I
Sbjct  308  RILYLTRSSNTPAREAPSKKILDATGIKNVFYPSSI  343



>ref|XP_010249087.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Nelumbo nucifera]
Length=379

 Score =   234 bits (597),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 151/218 (69%), Gaps = 0/218 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +F  FE++  + +   +MDINFWGS+Y T  A PHL++  G+I+  +SS+G
Sbjct  158  HLVCNAGIISFCAFEDITGIGNFTPLMDINFWGSIYTTSFAIPHLKKTKGKIIANASSSG  217

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL SP +S+Y ASKAA+  F+E LR EL PD+K+T+   GFIESE++QGKHL+  G ++V
Sbjct  218  WLISPTLSLYGASKAAVINFYERLRKELEPDVKVTIAALGFIESEMSQGKHLDNEGVVKV  277

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + +MRDV + I+P+  V  CA++I+N ACRGERY+ EP WFKV    +   P ++E+   
Sbjct  278  NQEMRDVSIGILPILSVGKCAESIVNKACRGERYVIEPPWFKVLILIQFLCPTLLEWAVH  337

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
             LY+T  G+P  +A  KKILD  G +K +YP +I+  Q
Sbjct  338  FLYVTKSGTPVTNARNKKILDAIGGKKFLYPSSILSSQ  375



>ref|XP_004173851.1| PREDICTED: retinol dehydrogenase 2-like, partial [Cucumis sativus]
Length=226

 Score =   226 bits (577),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+++ +LFEE +++ +   VMD+NFWG VY ++   PHL+++ G+I+ I+SSA 
Sbjct  7    HLVNNAGVSSVNLFEEYDNLQNAVPVMDVNFWGMVYCSYYGIPHLKQSRGKIIGIASSAA  66

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR+S Y +SKAA+  F+ETLR+E+G DI IT+VTPG +ESE+TQGK ++K G L +
Sbjct  67   WLPAPRLSFYTSSKAAVISFYETLRVEVGRDIGITIVTPGLVESEMTQGKFMSKDGHLYL  126

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               +RD  V+ MP+  +D   K IL S C+G+RY TEP W K+  ++K  +PE+VE+ N 
Sbjct  127  DQQLRDATVSAMPIMPIDDAVKGILRSVCKGDRYATEPRWMKMAFYYKTLWPELVEWFNY  186

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L+ M    + P D  GK+++  +G +   YP+++
Sbjct  187  LINMRGSSNSPTDTFGKRLVQLSGLKNWFYPDSV  220



>ref|XP_008446283.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=352

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+++ +LFEE +++ +   VMD+NFWG VY ++   PHL+++ G+I+ I+SSA 
Sbjct  128  HLVNNAGVSSVNLFEEYDNLQNAVPVMDVNFWGMVYCSYYGIPHLKQSRGKIIGIASSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR+S Y +SKAA+  F+ETLR+E+G DI IT+VTPG +ESE+TQGK ++K GRL +
Sbjct  188  WLPAPRLSFYTSSKAAVISFYETLRVEVGRDIGITIVTPGLVESEMTQGKFISKDGRLYL  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               +RD  V+ MP+  +D   K IL S CRG+RY TEP W ++  ++K  +PE+VE+ N 
Sbjct  248  DQQLRDATVSAMPIMPIDDAVKGILRSVCRGDRYATEPRWMRMAFYYKTLWPELVEWFNY  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L+ M      P D  GK+++  +G +   YP+++
Sbjct  308  LINMRGSSDSPTDTFGKRLIQLSGLKSWFYPDSV  341



>ref|XP_007160005.1| hypothetical protein PHAVU_002G285000g [Phaseolus vulgaris]
 gb|ESW31999.1| hypothetical protein PHAVU_002G285000g [Phaseolus vulgaris]
Length=347

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 149/216 (69%), Gaps = 6/216 (3%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   SLFE+  D+T     MDINFWGS Y T+ + PHLR++ G+IV ++S  G
Sbjct  128  HLVNNAGIVALSLFEDTTDITKFAPAMDINFWGSAYGTYFSIPHLRQSKGKIVAVASCNG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMSIYNASKAA+   +ETLR ELG DI IT+VTPG I+SE++QGK L+K GR+  
Sbjct  188  WLPVPRMSIYNASKAAVISLYETLRTELGRDIGITIVTPGLIDSEMSQGKILSKDGRMVF  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               +RD++ + MP+  V   AKAI+NS CRG+ YLTEPAWF  T +W++F PEV+E++N 
Sbjct  248  DQQIRDMEGSGMPIKSVTEAAKAIVNSVCRGDSYLTEPAWFTTTFYWQIFCPEVLEFLNR  307

Query  543  --LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
              L   +S   P      KK+LD    +K ++P+++
Sbjct  308  WSLTSESSEEEPAS----KKVLDLAFLKKYMHPKSV  339



>ref|XP_004962634.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Setaria 
italica]
Length=348

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 148/217 (68%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+E+ DVT+  S +D+NFWGSV  T  A P+L+R+ GRIVV +S+  
Sbjct  128  HLVCNAGIASVGAFQEIPDVTNYSSQLDVNFWGSVQTTFAALPYLKRSRGRIVVTASATA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRMS YNA+ AA+  FFETLR ELG +I IT+VTPG+IESE+++GK+L + G +EV
Sbjct  188  WNPVPRMSFYNAANAALVNFFETLRTELGSEIGITIVTPGWIESEMSKGKYLKEHGEMEV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRD Q+ + PV     CA+A++ +AC+GERYLT PAWF+    W+VF PEVVE    
Sbjct  248  DQEMRDAQIGLFPVEYAKNCARAMVQAACQGERYLTVPAWFRAMYLWRVFAPEVVEVCYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHD  653
            LLYM   G+   DA  K +    G ++++YP ++  D
Sbjct  308  LLYMHGHGASQTDAPSKTMAQ-AGGKQLLYPTSLRSD  343



>gb|KGN64430.1| hypothetical protein Csa_1G051680 [Cucumis sativus]
Length=351

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+++ +LFEE +++ +   VMD+NFWG VY ++   PHL+++ G+I+ I+SSA 
Sbjct  128  HLVNNAGVSSVNLFEEYDNLQNAVPVMDVNFWGMVYCSYYGIPHLKQSRGKIIGIASSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR+S Y +SKAA+  F+ETLR+E+G DI IT+VTPG +ESE+TQGK ++K G L +
Sbjct  188  WLPAPRLSFYTSSKAAVISFYETLRVEVGRDIGITIVTPGLVESEMTQGKFMSKDGHLYL  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               +RD  V+ MP+  +D   K IL S C+G+RY TEP W K+  ++K  +PE+VE+ N 
Sbjct  248  DQQLRDATVSAMPIMPIDDAVKGILRSVCKGDRYATEPRWMKMAFYYKTLWPELVEWFNY  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L+ M    + P D  GK+++  +G +   YP+++
Sbjct  308  LINMRGSSNSPTDTFGKRLVQLSGLKNWFYPDSV  341



>ref|XP_004153126.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
Length=344

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+++ +LFEE +++ +   VMD+NFWG VY ++   PHL+++ G+I+ I+SSA 
Sbjct  121  HLVNNAGVSSVNLFEEYDNLQNAVPVMDVNFWGMVYCSYYGIPHLKQSRGKIIGIASSAA  180

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR+S Y +SKAA+  F+ETLR+E+G DI IT+VTPG +ESE+TQGK ++K G L +
Sbjct  181  WLPAPRLSFYTSSKAAVISFYETLRVEVGRDIGITIVTPGLVESEMTQGKFMSKDGHLYL  240

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               +RD  V+ MP+  +D   K IL S C+G+RY TEP W K+  ++K  +PE+VE+ N 
Sbjct  241  DQQLRDATVSAMPIMPIDDAVKGILRSVCKGDRYATEPRWMKMAFYYKTLWPELVEWFNY  300

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L+ M    + P D  GK+++  +G +   YP+++
Sbjct  301  LINMRGSSNSPTDTFGKRLVQLSGLKNWFYPDSV  334



>ref|XP_004145219.1| PREDICTED: uncharacterized protein LOC101220214 [Cucumis sativus]
Length=520

 Score =   230 bits (586),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 154/204 (75%), Gaps = 2/204 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T+ +LFEE +D  ++ SVMD +FWG+VY T+ A P+L++  G+I+ I+SSA 
Sbjct  128  HLVNNAGITSINLFEEYDDPRNVASVMDTDFWGTVYCTYYAIPYLKQTRGKIIGIASSAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL +PR+S Y+ASKAA+  F+ETLR+E+G DI IT+VTPG  ESE+TQGK + + G++ +
Sbjct  188  WLPTPRLSFYSASKAAVISFYETLRVEIGRDIGITIVTPGLTESEMTQGKFMFEDGKMYL  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RD  +++MP+  V + AKAI+N  CRG+ Y+TEP W ++T +WK+F PE+VE++N 
Sbjct  248  DQELRDAVMSVMPIEAVGSAAKAIVNGGCRGDEYVTEPPWIRMTFYWKMFLPEMVEWLNY  307

Query  543  LLYMTSPGSPPQDALGKKILDYTG  614
            L  MT  GS P ++ GK+ +++ G
Sbjct  308  LFIMT--GSSPTESFGKRDVNFWG  329


 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 129/187 (69%), Gaps = 0/187 (0%)
 Frame = +3

Query  84   DINFWGSVYMTHLAAPHLRRNNGRIVVISSSAGWLSSPRMSIYNASKAAMSQFFETLRIE  263
            D+NFWG VY ++   PHL+++ G+I+ I+SSA WL +PR+S Y +SKAA+  F+ETLR+E
Sbjct  324  DVNFWGMVYCSYYGIPHLKQSRGKIIGIASSAAWLPAPRLSFYTSSKAAVISFYETLRVE  383

Query  264  LGPDIKITLVTPGFIESELTQGKHLNKAGRLEVSADMRDVQVNIMPVGKVDACAKAILNS  443
            +G DI IT+VTPG +ESE+TQGK ++K G L +   +RD  V+ MP+  +D   K IL S
Sbjct  384  VGRDIGITIVTPGLVESEMTQGKFMSKDGHLYLDQQLRDATVSAMPIMPIDDAVKGILRS  443

Query  444  ACRGERYLTEPAWFKVTRWWKVFFPEVVEYINLLLYMTSPGSPPQDALGKKILDYTGCQK  623
             C+G+RY TEP W K+  ++K  +PE+VE+ N L+ M    + P D  GK+++  +G + 
Sbjct  444  VCKGDRYATEPRWMKMAFYYKTLWPELVEWFNYLINMRGSSNSPTDTFGKRLVQLSGLKN  503

Query  624  IIYPETI  644
              YP+++
Sbjct  504  WFYPDSV  510



>ref|NP_001136546.1| corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 1 [Zea 
mays]
 ref|XP_008650969.1| PREDICTED: corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 
1 isoform X1 [Zea mays]
 gb|ACF80369.1| unknown [Zea mays]
 gb|ACF82139.1| unknown [Zea mays]
 gb|ACG48671.1| corticosteroid 11-beta-dehydrogenase isozyme 1 [Zea mays]
 tpg|DAA63855.1| TPA: corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 1 
[Zea mays]
 tpg|DAA63856.1| TPA: corticosteroid 11-beta-dehydrogenase isozyme 1 isoform 2 
[Zea mays]
Length=349

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/218 (50%), Positives = 149/218 (68%), Gaps = 1/218 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ DVTS  S +D+NFWGSV  T  A PHL+R+ GRIVV +S+ G
Sbjct  130  HLVCNAGVASVGAFEEIPDVTSYSSQLDVNFWGSVQTTFAALPHLKRSRGRIVVTASATG  189

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRMSIYNA+ AA+  FFETLR ELG  + IT+VTPG++ESE+++GK L + G++EV
Sbjct  190  WNPVPRMSIYNAANAALINFFETLRTELGNQVGITVVTPGWVESEMSRGKFLKEHGQVEV  249

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRD Q+ + PV     CAKA++ +A +GERYLT PAWF     W++F PEVVE    
Sbjct  250  DQEMRDAQIGLFPVEYAKNCAKAMVQAARQGERYLTVPAWFGAMYLWRLFAPEVVEACYR  309

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
            LLYM   G+   DA  + + +  G ++++YP ++  D+
Sbjct  310  LLYMHGHGARQADAPSRTMAE-AGGKQLLYPTSLRSDE  346



>gb|KGN64427.1| hypothetical protein Csa_1G051650 [Cucumis sativus]
Length=331

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 143/219 (65%), Gaps = 19/219 (9%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   +LFEE++D+TS   +MD N+WGSVY T  A P+LR N G+I+       
Sbjct  128  HLVNNAGVANMTLFEEMKDITSFNQIMDTNYWGSVYTTQFAIPYLRNNRGKII-------  180

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
                       A+KAA+   FETLR+EL PDI IT+VTPGF+ESELT+GK L   G +EV
Sbjct  181  -----------ATKAALKSMFETLRVELAPDIGITIVTPGFVESELTKGKALYSHGAMEV  229

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RD  +  +PV  V+ACAKAI+ S CRG+RYLTEP+W+    + KVF PEV+E+   
Sbjct  230  HQDVRDALIGAIPVETVEACAKAIVRSVCRGDRYLTEPSWYNSVYYLKVFCPEVLEWCYR  289

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQE  659
            +   T PGS   +A  KK+LD TG + ++YP + IH  E
Sbjct  290  IFMYTRPGSSVAEAPSKKLLDATGAKNVMYPPS-IHSAE  327



>gb|ACG24673.1| corticosteroid 11-beta-dehydrogenase isozyme 1 [Zea mays]
Length=349

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 149/218 (68%), Gaps = 1/218 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ DVTS  S +D+NFWGSV  T  A PHL+R+ GRIVV +S+ G
Sbjct  130  HLVCNAGVASVGAFEEIPDVTSYSSQLDVNFWGSVQTTFAALPHLKRSRGRIVVTASATG  189

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRMSIYNA+ AA+  FFETLR ELG  + IT+VTPG++ESE+++GK L + G++EV
Sbjct  190  WNPVPRMSIYNAANAALINFFETLRTELGNQVGITVVTPGWVESEMSRGKFLKEHGQVEV  249

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRD Q+ + PV     CAKA++ +A +GERYLT PAWF     W++F PEVVE    
Sbjct  250  DQEMRDAQIGLFPVEYAKNCAKAMVQAARQGERYLTVPAWFGAMYLWRLFAPEVVEACYR  309

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
            LLYM   G+   DA  + + +  G ++++YP ++  ++
Sbjct  310  LLYMHGHGARQADAPSRTMAE-AGGKQLLYPTSLRSEE  346



>ref|XP_002463266.1| hypothetical protein SORBIDRAFT_02g040840 [Sorghum bicolor]
 gb|EER99787.1| hypothetical protein SORBIDRAFT_02g040840 [Sorghum bicolor]
Length=348

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 146/214 (68%), Gaps = 1/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+E+ DVT   S +D+NFWGSV  T  A PHL+R+ GRIVV +S+ G
Sbjct  128  HLVCNAGIASVGAFQEIPDVTKYSSQLDVNFWGSVQTTFAALPHLKRSRGRIVVTASATG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRMS YNA+ AA+  FFETLR ELG  + IT+VTPG+IESE+++GK+L + G +EV
Sbjct  188  WNPVPRMSFYNAANAALINFFETLRTELGNQVGITVVTPGWIESEMSKGKYLKEHGEVEV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRD Q+ + PV     CAKA++ +A +GERYLT PAWF+    W+VF PEVVE    
Sbjct  248  DQEMRDAQIGLFPVEYAKNCAKAMVQAAQQGERYLTVPAWFRPMYLWRVFAPEVVEACYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLYM   G+   D   + + D +G ++++YP ++
Sbjct  308  LLYMHGHGARQADTASRTMAD-SGGKQLLYPTSL  340



>ref|XP_006664013.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Oryza 
brachyantha]
Length=349

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 145/214 (68%), Gaps = 1/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+E+ DVT+ RS +D+NFWGSV  T  A PHL+R+ GRIVV +S+ G
Sbjct  129  HLVCNAGIASVGAFQEIPDVTNYRSQLDVNFWGSVQSTFAALPHLKRSRGRIVVTASATG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRM  YNA+ AA+  F+ETLR ELG  + IT+VTPG+IESE+++GK L   G +EV
Sbjct  189  WNPVPRMIFYNAANAALINFYETLRTELGSQVGITIVTPGWIESEMSKGKFLKDHGEMEV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRD Q+ + PV     CAKA++ +A +GERYLT P+WF     W+VF PE+VE+   
Sbjct  249  DQEMRDAQIGLFPVEYAKNCAKAMVQAARQGERYLTLPSWFSTMYLWRVFAPEIVEFCYR  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLYM   G    DA  KK+ +  G ++++YP ++
Sbjct  309  LLYMHRHGGNQADAPSKKMAE-AGAKQLLYPTSL  341



>ref|XP_002446311.1| hypothetical protein SORBIDRAFT_06g013980 [Sorghum bicolor]
 gb|EES10639.1| hypothetical protein SORBIDRAFT_06g013980 [Sorghum bicolor]
Length=406

 Score =   224 bits (572),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 143/214 (67%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     FEEV DV  L+ V+ +NFWG+VY TH A PHL+++ G+I   SS+A 
Sbjct  185  HLVNNAGVAYVCWFEEVPDVADLKQVLAVNFWGAVYPTHCALPHLKKSGGKIFANSSAAA  244

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             L+ PRMS YNASKAA+  FFETLRIEL  ++ IT+ TPG+IESE+T+GKHL+K G +EV
Sbjct  245  MLAMPRMSFYNASKAAVLNFFETLRIELHDEVGITIATPGWIESEMTKGKHLSKEGTVEV  304

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RD QV + PV     CA+AI+++ CRG R+LT P W++    W+   PEV +    
Sbjct  305  DQDTRDAQVGLFPVLHAARCAEAIVDAICRGRRHLTVPLWYRALFLWRTLTPEVTDLSQR  364

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L Y  + G     A  K++L++TG + ++ P ++
Sbjct  365  LFYGRTAGGHSNQAKAKRLLEFTGAKGVLQPASL  398



>ref|XP_007211157.1| hypothetical protein PRUPE_ppa027140mg [Prunus persica]
 gb|EMJ12356.1| hypothetical protein PRUPE_ppa027140mg [Prunus persica]
Length=326

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 151/214 (71%), Gaps = 17/214 (8%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T                  D NFWGSVY T+ A PHL+R+ G+IV I+SSAG
Sbjct  129  HLVNNAGITP-----------------DTNFWGSVYGTYFAIPHLKRSRGKIVGIASSAG  171

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PR+S+Y A+K+A+  F+ETLR+E+G ++ IT+VTPG +ESE+T+GK L+K G+L +
Sbjct  172  WLRVPRLSLYGATKSAVISFYETLRVEIGREVGITIVTPGLVESEMTKGKFLSKEGQLVL  231

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               +RDV+V+IMP+  V   AK+I++SACRGE YLT PAW   + +WKVFFPE++++ N 
Sbjct  232  DQQLRDVEVSIMPILPVKEAAKSIVDSACRGENYLTVPAWVWHSFYWKVFFPELLDWSNR  291

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            +L M++     +D + KK+LD TG ++ +YP ++
Sbjct  292  MLLMSNGSGGERDTISKKLLDLTGLKECLYPVSV  325



>emb|CAN60641.1| hypothetical protein VITISV_039526 [Vitis vinifera]
Length=501

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 147/215 (68%), Gaps = 10/215 (5%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ + S  EE  D+T+ R VM   F   V   H +         R + ++SSA 
Sbjct  177  HLVNNAGIQSASTLEEATDITNFRPVM---FTPPVLQFHTS----ETATARSLDMASSAA  229

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIK-ITLVTPGFIESELTQGKHLNKAGRLE  359
            WL  PRMSIYNASKAA+  F++TLRIELG DI  IT+VTPGFIESE+TQG+ L    ++E
Sbjct  230  WLPMPRMSIYNASKAALISFYDTLRIELGSDIGGITVVTPGFIESEMTQGEFLKNEDQIE  289

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V  DMRD QV+I+PVG+ +ACAKAI+ SACRGE+YLTEP+WF+VT  WKV  PEV+E+  
Sbjct  290  VDQDMRDAQVSIIPVGRAEACAKAIVKSACRGEKYLTEPSWFRVTYLWKVLCPEVIEWCF  349

Query  540  LLLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
             L Y+  PG    + L KKILD +G +  +YP TI
Sbjct  350  RLFYLARPGE--SETLSKKILDISGARGFLYPTTI  382



>ref|XP_010442316.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 [Camelina 
sativa]
Length=342

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 138/201 (69%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE+++D++     MDINFWGSVY T  A+P+L+++ GRIV I+S  G
Sbjct  128  HLVTNAGVAPLYLFEDIDDLSKASPAMDINFWGSVYCTFYASPYLKKSRGRIVAIASGCG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            +++SPR+S Y ASKAA+  F+ETLR E G +I IT+V PG ++SEL++GK + K G L V
Sbjct  188  YIASPRLSFYCASKAALIAFYETLRTEFGSEIGITIVAPGVVDSELSRGKFMTKDGNLVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDVQV+++PV   + CAKAI+ S CRG+RYL EP+W      WKVF  EV E I  
Sbjct  248  DKELRDVQVSVLPVESAERCAKAIMKSVCRGDRYLLEPSWIGCVILWKVFCSEVTESIAR  307

Query  543  LLYMTSPGSPPQDALGKKILD  605
             L M  P  P  +A  KKILD
Sbjct  308  WLLMAGPTLPVTEAPTKKILD  328



>ref|XP_010913000.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Elaeis 
guineensis]
Length=349

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 150/214 (70%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +  LFE++ ++++   VMD+NFWGSVY T+ A PHL+ ++G I+V +S AG
Sbjct  129  HLVVNAGIWSSCLFEDITNISAFTQVMDVNFWGSVYPTYYAIPHLKTSHGNIIVTASMAG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + + RMS YNASKAA+ +F+ETLR ELG +I+IT++TPG++ESE+TQGK L K G + +
Sbjct  189  HVPTARMSFYNASKAALIRFYETLRSELGSEIRITIITPGYVESEITQGKVLKKEGEVGI  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RDVQ+  +PVG    CA+ I++ AC+G+ Y+T P+WFK       F PEV+ + + 
Sbjct  249  DEDARDVQLGPLPVGSTKKCAEIIVDGACKGDEYVTWPSWFKPFYMVMCFAPEVMNWFSH  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
              Y+  PG+   + L K+IL+ +G +K+ YP +I
Sbjct  309  SFYVAKPGTTSTETLSKRILEASGAKKLFYPASI  342



>ref|XP_003581150.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brachypodium 
distachyon]
Length=368

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 147/219 (67%), Gaps = 1/219 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     F++V DV   + V+D+NFWG+V+ TH A PHL+R+ G+I V SS+A 
Sbjct  147  HLVNNAGLANVCWFQDVPDVADFKQVLDVNFWGTVHPTHCALPHLKRSRGKIFVNSSAAA  206

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             L+ PRMS YNASKAA+  F ETLR+ELG ++ +T+ TPG+IESE+T+GKHL+K G +EV
Sbjct  207  MLAMPRMSFYNASKAAVLNFAETLRMELGNEVGVTVATPGWIESEMTKGKHLSKDGTVEV  266

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RD QV + PV + + CA+AI+++ CRG R +T PAW++    W+ F PEV +    
Sbjct  267  DQDTRDTQVGLFPVVRAERCAEAIVDAVCRGRRSVTVPAWYRALFLWRAFAPEVGDLFQR  326

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQE  659
            + Y  S G        +++L+ TG + ++ P + +H  E
Sbjct  327  VFYRRSSGDEGSQMRTRRVLELTGAKALLQPPS-LHTSE  364



>ref|XP_006282170.1| hypothetical protein CARUB_v10028440mg [Capsella rubella]
 gb|EOA15068.1| hypothetical protein CARUB_v10028440mg [Capsella rubella]
Length=342

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 138/201 (69%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE+++D++     MDINFWGSVY T  A+P+LR + GRIV ++S  G
Sbjct  128  HLVTNAGVAPLYLFEDIDDLSKATPAMDINFWGSVYCTFFASPYLRESRGRIVAVASGCG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            +++SPR+S Y ASKAA+  F+ETLR E G +I +T+V PG ++SEL++GK + K G++ V
Sbjct  188  YIASPRLSFYCASKAALIAFYETLRTEFGSEISVTIVAPGVVDSELSRGKFMTKDGKIVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + ++RDVQV+++PV   + CAKAI+ S CRG+RYL EP W      WKVF  EV E I  
Sbjct  248  NKELRDVQVSVLPVETAERCAKAIIKSVCRGDRYLLEPGWIGSVILWKVFCSEVTESIAR  307

Query  543  LLYMTSPGSPPQDALGKKILD  605
               +  P  P +DA  KKILD
Sbjct  308  WFLIAGPTLPMRDAPSKKILD  328



>ref|XP_004975422.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Setaria 
italica]
Length=370

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 147/216 (68%), Gaps = 2/216 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ +   FEEV DV   + V+ +NFWG+V+ TH A PHL+++ G+I   SS+A 
Sbjct  147  HLVNNAGVASVCWFEEVPDVADFKQVLAVNFWGTVHPTHCALPHLKKSGGKIFANSSAAA  206

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             L+ PRMS YNASKAA+  FFETLR+EL  ++ IT+ TPG+IESE+T+GKHL+K G +EV
Sbjct  207  VLAMPRMSFYNASKAAVLNFFETLRMELRDEVGITIATPGWIESEMTKGKHLSKEGTVEV  266

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              DMRD QV + PV + + CA+AI+++ CRG R+LT P W++    W++  PEV ++   
Sbjct  267  DQDMRDAQVGLFPVVRAERCAEAIVDAVCRGRRHLTVPLWYRAMFLWRMLAPEVADFSQR  326

Query  543  LLYMTSPGSPPQD--ALGKKILDYTGCQKIIYPETI  644
            + Y  + G    D  A  ++ L+ TG + ++ P ++
Sbjct  327  VFYRRTAGGGHGDRQAKARRFLEATGAKGVLQPASL  362



>gb|KFK26701.1| hypothetical protein AALP_AA8G282300 [Arabis alpina]
Length=343

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 142/210 (68%), Gaps = 0/210 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE+++D++     +DINFWGSVY T  A P+L+++ GRIVVI+S  G
Sbjct  129  HLVTNAGVAPLYLFEDMDDLSMAAPALDINFWGSVYCTFFAFPYLKKSRGRIVVIASGCG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            ++++PR+S Y ASKAA+  F+ETLRIE G +I +T+V PG I+SEL++GK + K G L V
Sbjct  189  YIAAPRLSFYCASKAAVIAFYETLRIEFGSEIGVTIVAPGVIDSELSRGKFMTKEGELRV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDVQ++++PV   D CAK I+ S CRG+RYL EPAW      WKVF  EV++ +  
Sbjct  249  DQELRDVQISVLPVESADRCAKEIMRSVCRGDRYLLEPAWIGCLILWKVFCSEVLDSVGR  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIY  632
             L M  P  P  +A  KKIL+     + ++
Sbjct  309  WLVMAGPALPRTEAPSKKILNVANALRALF  338



>ref|XP_003576230.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brachypodium 
distachyon]
Length=349

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 145/214 (68%), Gaps = 1/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+E+ DVT+  S +D+NFWG+V  T  A PHL+R+ GRIVV +S+ G
Sbjct  129  HLVCNAGIASVGAFQEIPDVTNYSSQLDVNFWGAVQSTFAALPHLKRSRGRIVVTASATG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRM  YNA+ AA+  FFETLR ELG ++ IT+VTPG+IESE+++GK L + G +EV
Sbjct  189  WNPVPRMIFYNAANAALINFFETLRTELGSEVGITIVTPGWIESEMSKGKFLKEHGGVEV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD Q+ + PV     CAKA++ +A +GERYLT PAWF     W+V  PEVVE+   
Sbjct  249  DQEFRDAQIGMFPVEYAKNCAKAMVQAARQGERYLTVPAWFSTMYLWRVLAPEVVEFCYR  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLYM   G+   DA  KK+ +  G ++++YP ++
Sbjct  309  LLYMHGHGADQTDAPSKKMAE-GGAKQLLYPSSL  341



>ref|XP_010277349.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=317

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +F LF+E  +V +  SVMDINFWGS+Y T  A PHL+R+ G+IVV +S+ G
Sbjct  128  HLVCNAGIDSFCLFKEAVNVANFTSVMDINFWGSIYPTRFAIPHLKRSRGKIVVNASATG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL SP  S+Y ASKAA+  F+ETLR+EL P+IKIT V PGFIESE+ QGKHL   G ++V
Sbjct  188  WLVSPWSSVYGASKAALLNFYETLRVELAPEIKITTVAPGFIESEMIQGKHLTNEGEVKV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               M+++  +I PV     CAKAI++  CRG+RY+ EP+WF+V   ++   P +VE++  
Sbjct  248  DQKMKEIVASIFPVQSTGKCAKAIVDGTCRGDRYVIEPSWFRVLVLFQFVCPGLVEWLTR  307

Query  543  LLYMTSPG  566
             LY+ +PG
Sbjct  308  FLYIPNPG  315



>ref|XP_010910414.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Elaeis 
guineensis]
Length=349

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 148/214 (69%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +  LFE++ ++++   VMD+NFWGSVY T+ A PHL+ ++G I+V +S AG
Sbjct  129  HLVVNAGIWSSCLFEDIANISAFTQVMDVNFWGSVYPTYYAIPHLKTSHGNIIVTASMAG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            ++ + RMS YNASKAAM +F+ETLR ELG +I+IT++TPG++ESE+TQGK L K G + +
Sbjct  189  YVPTARMSFYNASKAAMIRFYETLRSELGSEIRITIITPGYVESEITQGKVLKKDGEVGI  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RDVQ+   PVG    CA+ I++SAC+G+ Y+T P+WFK         PEVV   + 
Sbjct  249  DEEARDVQLGPFPVGSTKKCAEIIVDSACKGDEYVTWPSWFKPFFMVMCLAPEVVNRFSH  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
              ++  PG+   + L K+IL+ +G +K  YP +I
Sbjct  309  SFHVAKPGTTSTETLSKRILEASGAKKFFYPASI  342



>ref|XP_002994525.1| hypothetical protein SELMODRAFT_138761 [Selaginella moellendorffii]
 gb|EFJ04409.1| hypothetical protein SELMODRAFT_138761 [Selaginella moellendorffii]
Length=347

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 150/219 (68%), Gaps = 1/219 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    LFEE  DV+S +S+MD+ FWGSVY T+ A PHL+R+ G++VV SS + 
Sbjct  128  HLVNNAGIMHSYLFEEAVDVSSFQSIMDVTFWGSVYPTYYALPHLKRSGGKVVVNSSVSA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PR++IYNA++AA+   F+TLR+E+G  + IT+ TPG++ESE+T+GK ++  G    
Sbjct  188  WLPMPRLAIYNAAEAALLNLFDTLRVEVGNSVGITIATPGWVESEITRGKFISAEGEHVT  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RDV V  +PV   + CAKAI +   RG RY+  P+W+ VT  +++F PE++E+   
Sbjct  248  MPDLRDVTVGPVPVTYAEECAKAIFSGTVRGARYVRVPSWYGVTLLYRIFAPELIEWTYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQE  659
            LL++ SP    Q    K I+D  G ++I+YP +I+H Q+
Sbjct  308  LLFV-SPAPGTQVPAAKLIMDVPGAKEILYPSSIVHPQK  345



>gb|EEC69238.1| hypothetical protein OsI_38254 [Oryza sativa Indica Group]
Length=357

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 142/214 (66%), Gaps = 1/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+E+ DVT+  S  D+NFWGSV  T  A PHL+R+ GRIVV +S+ G
Sbjct  137  HLVCNAGIASVGAFQEIPDVTNYSSQFDVNFWGSVQSTFEALPHLKRSRGRIVVTASATG  196

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRM+ YNA+ AA+  F+ETLR ELG  + IT+VTPG+IESE+++GK L   G +EV
Sbjct  197  WNPVPRMTFYNAANAALINFYETLRTELGSQVGITIVTPGWIESEMSKGKFLKDHGEMEV  256

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRD Q+ + PV     CAKA++ +  +GER LT P WF     W+VF PEVVE+   
Sbjct  257  DQEMRDAQIGLFPVEYAKNCAKAMVQAVRQGERCLTVPPWFSTMYLWRVFAPEVVEFCYR  316

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLYM   G    DA  KK+ + +G +K++YP ++
Sbjct  317  LLYMQRHGGSQADAPSKKMAEASG-KKLLYPTSL  349



>ref|XP_010482376.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 isoform 
X1 [Camelina sativa]
Length=343

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 136/201 (68%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE+++D++     MDINFWGSVY T  A+P+L+++ GRIV ++S  G
Sbjct  129  HLVTNAGVAPLYLFEDIDDLSKASPAMDINFWGSVYCTFYASPYLKKSRGRIVAVASGCG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            +++SPR+S Y ASKAA+  F+ETLR E G +I +T+V PG ++SEL++GK + K G L V
Sbjct  189  YIASPRLSFYCASKAALIAFYETLRTEFGSEIGVTIVAPGVVDSELSRGKFMTKDGELVV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDVQV+++PV   + CAKAI+ S CRG+RYL EP W      WKVF  EV E I  
Sbjct  249  DKELRDVQVSVLPVESAERCAKAIMRSVCRGDRYLLEPGWIGCVILWKVFCSEVTESIAR  308

Query  543  LLYMTSPGSPPQDALGKKILD  605
             L M     P  +A  KKILD
Sbjct  309  WLLMAGSTLPVTEAPTKKILD  329



>ref|XP_002966954.1| hypothetical protein SELMODRAFT_87233 [Selaginella moellendorffii]
 gb|EFJ31553.1| hypothetical protein SELMODRAFT_87233 [Selaginella moellendorffii]
Length=347

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 150/219 (68%), Gaps = 1/219 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    LFEE  DV+S +S+MD+ FWGSVY T+ A PHL+R+ G++VV SS + 
Sbjct  128  HLVNNAGIMHSYLFEEAVDVSSFQSIMDVTFWGSVYPTYYALPHLKRSGGKVVVNSSVSA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PR++IYNA++AA+   F+TLR+E+G  + IT+ TPG++ESE+T+GK ++  G    
Sbjct  188  WLPMPRLAIYNAAEAALLNLFDTLRVEVGNSVGITIATPGWVESEITRGKFVSAEGEHVT  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D+RDV V  +PV   + CAKAI +   RG RY+  P+W+ VT  +++F PE++E+   
Sbjct  248  MPDLRDVTVGPVPVTYAEECAKAIFSGTVRGARYVRVPSWYGVTLLYRIFAPELIEWTYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQE  659
            LL++ SP    Q    K I+D  G ++I+YP +I+H Q+
Sbjct  308  LLFV-SPAPGTQVPAAKLIMDVPGAKEILYPSSIVHPQK  345



>ref|XP_010086991.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Morus notabilis]
 gb|EXB25270.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Morus notabilis]
Length=365

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 139/215 (65%), Gaps = 14/215 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FEE  D+      MDINFWGSVY T+ A P+L+R  GRIVVISS+A 
Sbjct  128  HLVNNAGVAPVCMFEESPDIKKFTQAMDINFWGSVYATYFAIPYLKRTRGRIVVISSAAS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PR+ IY ASKAA++ F+ETLR+E+G D++IT+VTPG  ESE+T GK L   G LE+
Sbjct  188  WLPVPRLGIYGASKAAVTSFYETLRVEIGRDVRITIVTPGLTESEMTLGKFLTGRGTLEL  247

Query  363  SADMRD--------------VQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRW  500
              ++RD              V +++ PV  V   AKAI+  AC+G  YLT PAW K T  
Sbjct  248  GQELRDFELGSPNAYLIDGQVVMSMTPVMSVKETAKAIVEGACQGAYYLTVPAWIKPTFL  307

Query  501  WKVFFPEVVEYINLLLYMTSPGSPPQDALGKKILD  605
            W VFFPEV+E+ N LL M   GS  ++   KKI++
Sbjct  308  WHVFFPEVLEWCNRLLLMPGMGSTDRETASKKIVE  342



>ref|XP_008798974.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Phoenix dactylifera]
Length=349

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 149/214 (70%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +  L E++ ++++   VMD+NFWGSVY T+ A PHL+ ++G I+V +S AG
Sbjct  129  HLVVNAGIWSSCLVEDITNISAFTQVMDVNFWGSVYPTYYAIPHLKTSHGNIIVTASVAG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + + RM IYNASKAA+ +F+ETLR ELG +I+IT++TPG++ESELT+GK + K G + V
Sbjct  189  HVPTARMGIYNASKAAVIRFYETLRSELGSEIRITIITPGYVESELTKGKIVKKDGEVGV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD+Q+  +PVG+ + CA+ I++SAC G+ Y+T P+WFK       F PEVV + + 
Sbjct  249  DEEARDIQLGPLPVGRTERCAEIIVDSACNGDEYVTWPSWFKPFYAVMSFAPEVVNWFSR  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
              Y+  PG+   + L K+IL+ +G  K  YP +I
Sbjct  309  TFYVAKPGATSTETLSKRILEASGAHKFFYPASI  342



>gb|ABA98146.2| oxidoreductase, short chain dehydrogenase/reductase family protein, 
expressed [Oryza sativa Japonica Group]
Length=349

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 142/217 (65%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+E+ DVT+  S  D+NFWGSV  T  A PHL+R+ GRIVV +S+ G
Sbjct  129  HLVCNAGIASVGAFQEIPDVTNYSSQFDVNFWGSVQSTFEALPHLKRSRGRIVVTASATG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRM+ YNA+ AA+  F+ETLR ELG  + IT+VTPG+IESE+++GK L   G +EV
Sbjct  189  WNPVPRMTFYNAANAALINFYETLRTELGSQVGITIVTPGWIESEMSKGKFLKDHGEMEV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRD Q+ + PV     CAKA++ +  +G+R LT P WF     W+VF PEVVE+   
Sbjct  249  DQEMRDAQIGLFPVEYAKNCAKAMVQAVRQGKRCLTVPPWFSTMYLWRVFAPEVVEFCYR  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHD  653
            LLYM   G    DA  KK+ +  G +K++YP ++  D
Sbjct  309  LLYMHRHGGSQADAPSKKMAE-AGGKKLLYPTSLRSD  344



>gb|EEE53178.1| hypothetical protein OsJ_36031 [Oryza sativa Japonica Group]
Length=357

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 142/217 (65%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+E+ DVT+  S  D+NFWGSV  T  A PHL+R+ GRIVV +S+ G
Sbjct  137  HLVCNAGIASVGAFQEIPDVTNYSSQFDVNFWGSVQSTFEALPHLKRSRGRIVVTASATG  196

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRM+ YNA+ AA+  F+ETLR ELG  + IT+VTPG+IESE+++GK L   G +EV
Sbjct  197  WNPVPRMTFYNAANAALINFYETLRTELGSQVGITIVTPGWIESEMSKGKFLKDHGEMEV  256

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRD Q+ + PV     CAKA++ +  +G+R LT P WF     W+VF PEVVE+   
Sbjct  257  DQEMRDAQIGLFPVEYAKNCAKAMVQAVRQGKRCLTVPPWFSTMYLWRVFAPEVVEFCYR  316

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHD  653
            LLYM   G    DA  KK+ +  G +K++YP ++  D
Sbjct  317  LLYMHRHGGSQADAPSKKMAE-AGGKKLLYPTSLRSD  352



>ref|NP_001066740.1| Os12g0464400 [Oryza sativa Japonica Group]
 dbj|BAF29759.1| Os12g0464400, partial [Oryza sativa Japonica Group]
Length=393

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 142/217 (65%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+E+ DVT+  S  D+NFWGSV  T  A PHL+R+ GRIVV +S+ G
Sbjct  173  HLVCNAGIASVGAFQEIPDVTNYSSQFDVNFWGSVQSTFEALPHLKRSRGRIVVTASATG  232

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRM+ YNA+ AA+  F+ETLR ELG  + IT+VTPG+IESE+++GK L   G +EV
Sbjct  233  WNPVPRMTFYNAANAALINFYETLRTELGSQVGITIVTPGWIESEMSKGKFLKDHGEMEV  292

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRD Q+ + PV     CAKA++ +  +G+R LT P WF     W+VF PEVVE+   
Sbjct  293  DQEMRDAQIGLFPVEYAKNCAKAMVQAVRQGKRCLTVPPWFSTMYLWRVFAPEVVEFCYR  352

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHD  653
            LLYM   G    DA  KK+ +  G +K++YP ++  D
Sbjct  353  LLYMHRHGGSQADAPSKKMAE-AGGKKLLYPTSLRSD  388



>ref|NP_199890.1| hydroxysteroid dehydrogenase 6 [Arabidopsis thaliana]
 sp|Q9LUE4.1|HSD6_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase-like 6; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase-like 6; AltName: 
Full=Hydroxysteroid dehydrogenase 6; Short=AtHSD6 [Arabidopsis 
thaliana]
 dbj|BAA96990.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAW49294.1| At5g50770 [Arabidopsis thaliana]
 gb|AED95990.1| hydroxysteroid dehydrogenase 6 [Arabidopsis thaliana]
Length=342

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 135/201 (67%), Gaps = 0/201 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+     F ++EDV+     MDINFWGSVY T  A+P+L++  GRIVVI+S  G
Sbjct  128  HLVTNAGVAPLYFFADIEDVSKASPAMDINFWGSVYCTFFASPYLKKFRGRIVVIASGCG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            +++SPR+S Y ASKAA+  F+ETLR E G DI +T+V PG ++SE+++GK + K G+L V
Sbjct  188  YIASPRLSFYCASKAAVIAFYETLRTEFGSDIGVTIVAPGIVDSEMSRGKFMTKDGKLVV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDVQ++++PV   + CAKAI+ S CRG+RYL EP W       KVF  E  E++  
Sbjct  248  DKELRDVQMSVLPVESAERCAKAIMRSVCRGDRYLLEPDWIGCVILLKVFCSEATEWVAR  307

Query  543  LLYMTSPGSPPQDALGKKILD  605
             L +  P  P  +AL  KILD
Sbjct  308  WLLIARPKFPMMEALSNKILD  328



>gb|KDO64429.1| hypothetical protein CISIN_1g042560mg, partial [Citrus sinensis]
Length=287

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE+  D+T     MDINFWGS Y T+ A P+L++  G+I+V++S+AG
Sbjct  128  HLVTNAGVVPMCLFEDYTDITKPAPAMDINFWGSAYGTYFAIPYLKQTKGKIIVVASAAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS YNASKAA    +ETLR+E G DI IT+VTPG IESE+T GK LNK G+LEV
Sbjct  188  WLPPPRMSFYNASKAAKIALYETLRVEFGGDIGITIVTPGLIESEITGGKFLNKNGKLEV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAW  482
              ++RDVQ++++PV   + CAKAI+NSACRG+RYLT+P+W
Sbjct  248  DQEIRDVQISLLPVQPTEECAKAIVNSACRGDRYLTQPSW  287



>dbj|BAF01972.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
Length=176

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  141  RNNGRIVVISSSAGWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESEL  320
            + NG+IV +SSSA WL++PRMS YNASKAA+  FFET+RIELG D+ IT+VTPG+IESEL
Sbjct  1    QGNGKIVAMSSSAAWLTAPRMSFYNASKAALLSFFETMRIELGGDVHITIVTPGYIESEL  60

Query  321  TQGKHLNKAGRLEVSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRW  500
            TQGK+ +  G L V+ DMRDVQV   PV     CAK+I+N  CR +RY+TEP+WFKVT  
Sbjct  61   TQGKYFSGEGELIVNQDMRDVQVGPFPVASASGCAKSIVNGVCRKQRYVTEPSWFKVTYL  120

Query  501  WKVFFPEVVEYINLLLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            WKV  PE++E+   LLYMT  G     AL K+I+D  G +  +YPE+I
Sbjct  121  WKVLCPELIEWGCRLLYMTGTGMSEDTALNKRIMDIPGVRSTLYPESI  168



>gb|ABI20736.1| 11-beta-hydroxysteroid dehydrogenase-like protein [Triticum aestivum]
Length=349

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 141/214 (66%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+E+ DVT+  S +D+NFWG+V  T  A PHL+R  GRIVV +S+ G
Sbjct  128  HLVCNAGIASVGAFQEIPDVTNYSSQLDVNFWGAVQSTSAALPHLKRTRGRIVVTASATG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRM  YNA+ AA+  FFETLR ELG ++ IT+VTPG+IESE+++GK L + G +EV
Sbjct  188  WNPVPRMIFYNAANAALINFFETLRSELGSEVGITIVTPGWIESEMSKGKFLKEHGGVEV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD Q+ + PV     CA+A++ +A +G+RYLT P+WF     W+VF PEVVE+   
Sbjct  248  DQEYRDAQIGLFPVEYAKNCARAMVQAARQGDRYLTVPSWFGTMYLWRVFAPEVVEFCYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLYM   G   Q     K +   G ++++YP ++
Sbjct  308  LLYMHRHGGGDQTDAPSKTMAQGGGKQMLYPSSL  341



>dbj|BAJ85563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=349

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 140/214 (65%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+E+ DVT+  S +D+NFWG+V  T  A PHL+R  GRIVV +S+  
Sbjct  128  HLVCNAGIASVGAFQEIPDVTNYSSQLDVNFWGAVQSTFAALPHLKRTRGRIVVTASATR  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRM  YNA+ AA+  FFETLR ELG ++ IT+VTPG+IESE+++GK L + G +EV
Sbjct  188  WNPVPRMIFYNAANAALINFFETLRAELGSEVGITIVTPGWIESEMSKGKFLKEHGGVEV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD QV + PV     CA+A++ +A +G+RYLT P+WF     W+VF PEVVE+   
Sbjct  248  DQEFRDAQVGLFPVEYAKNCARAMVQAARQGDRYLTVPSWFGTMYLWRVFAPEVVEFCYR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLYM   G   Q     K +   G ++++YP ++
Sbjct  308  LLYMHGHGGGDQTDAPSKTMAQGGGKQMLYPSSL  341



>ref|XP_010241532.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=316

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HL+ NAG+T+   FEE  D+T+ R VMD+NFWGS+Y T+ A PHLRR+ G+IVV SS AG
Sbjct  128  HLICNAGVTSGCKFEETNDITNFRPVMDVNFWGSIYPTYFAIPHLRRSKGKIVVNSSLAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
               +P +S+Y ASKAAM  F+ETLR+EL  ++K+T VTPGFI++E+TQGKHL+K G ++V
Sbjct  188  SFPTPMLSLYGASKAAMENFYETLRVELAGEVKVTTVTPGFIDTEMTQGKHLSKEGSVKV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
              + ++  +  MPV    ACAKAI+N ACRG+RYLT P+W++V   ++ F  E+V +
Sbjct  248  EQEWKNTIIGAMPVMSAGACAKAIVNGACRGDRYLTVPSWYRVAFPFQFFCAELVAF  304



>ref|XP_010271122.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X3 [Nelumbo nucifera]
Length=335

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 133/200 (67%), Gaps = 2/200 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+  +   E+  +V  LR VMDINFWG VY TH A PHLR++ GRI+V +S  G
Sbjct  134  HLVCNAGVVVYCPVEDTTNVEKLRPVMDINFWGPVYATHFALPHLRKSKGRIIVNASMKG  193

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL SP   +Y ASKAA+  F ETLR+EL  D+K+T+V PGF+ SE+TQGKH++K G +EV
Sbjct  194  WLVSPWSILYGASKAAIVSFCETLRVELAQDVKVTIVAPGFVNSEITQGKHISKEGEVEV  253

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +M  V     PV   + CA+AI++  CRG+RY+ EP+W+++   ++   PE+VE+   
Sbjct  254  DQEMSKVMSGKFPVESTEDCARAIVDGVCRGDRYIIEPSWYRILLQFQFLCPELVEWFAR  313

Query  543  LLYMTSP--GSPPQDALGKK  596
             LY T P   +  +DA+G K
Sbjct  314  SLYKTKPQDAATKRDAMGLK  333



>ref|XP_010271120.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X1 [Nelumbo nucifera]
Length=370

 Score =   207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 133/200 (67%), Gaps = 2/200 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+  +   E+  +V  LR VMDINFWG VY TH A PHLR++ GRI+V +S  G
Sbjct  169  HLVCNAGVVVYCPVEDTTNVEKLRPVMDINFWGPVYATHFALPHLRKSKGRIIVNASMKG  228

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL SP   +Y ASKAA+  F ETLR+EL  D+K+T+V PGF+ SE+TQGKH++K G +EV
Sbjct  229  WLVSPWSILYGASKAAIVSFCETLRVELAQDVKVTIVAPGFVNSEITQGKHISKEGEVEV  288

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +M  V     PV   + CA+AI++  CRG+RY+ EP+W+++   ++   PE+VE+   
Sbjct  289  DQEMSKVMSGKFPVESTEDCARAIVDGVCRGDRYIIEPSWYRILLQFQFLCPELVEWFAR  348

Query  543  LLYMTSP--GSPPQDALGKK  596
             LY T P   +  +DA+G K
Sbjct  349  SLYKTKPQDAATKRDAMGLK  368



>ref|XP_010271121.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X2 [Nelumbo nucifera]
Length=364

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 133/200 (67%), Gaps = 2/200 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+  +   E+  +V  LR VMDINFWG VY TH A PHLR++ GRI+V +S  G
Sbjct  163  HLVCNAGVVVYCPVEDTTNVEKLRPVMDINFWGPVYATHFALPHLRKSKGRIIVNASMKG  222

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL SP   +Y ASKAA+  F ETLR+EL  D+K+T+V PGF+ SE+TQGKH++K G +EV
Sbjct  223  WLVSPWSILYGASKAAIVSFCETLRVELAQDVKVTIVAPGFVNSEITQGKHISKEGEVEV  282

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +M  V     PV   + CA+AI++  CRG+RY+ EP+W+++   ++   PE+VE+   
Sbjct  283  DQEMSKVMSGKFPVESTEDCARAIVDGVCRGDRYIIEPSWYRILLQFQFLCPELVEWFAR  342

Query  543  LLYMTSP--GSPPQDALGKK  596
             LY T P   +  +DA+G K
Sbjct  343  SLYKTKPQDAATKRDAMGLK  362



>ref|XP_010243359.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=364

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 128/190 (67%), Gaps = 2/190 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+  +   E+  DV  LR VMDINFWGS+Y TH A PHL+R+ G I+V +S  G
Sbjct  154  HLVCNAGVVLYCPVEDTTDVEKLRPVMDINFWGSIYATHFALPHLKRSKGNIIVNASMKG  213

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPD--IKITLVTPGFIESELTQGKHLNKAGRL  356
            WL SP   +Y ASKAA+  FFETLR+EL  D  +KIT+V PGFI+SE+TQGKHL+K G +
Sbjct  214  WLVSPWSILYGASKAALINFFETLRVELPQDENVKITIVAPGFIKSEITQGKHLSKEGEV  273

Query  357  EVSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYI  536
             +  +M  +     PV   + CA+AI+   CRGERY+ EP+W++V   ++   PE+VE+ 
Sbjct  274  VIDPEMSKMMSGKFPVESTEECARAIVKGVCRGERYIVEPSWYRVLPLFQFMCPELVEWC  333

Query  537  NLLLYMTSPG  566
            +  LY T PG
Sbjct  334  SRCLYKTKPG  343



>emb|CDY16351.1| BnaA02g11550D [Brassica napus]
Length=311

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 128/184 (70%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE+++D++     MDINFWGSVY T  A+ +L+++ G+IVVI+S  G
Sbjct  127  HLVTNAGVAPLYLFEDIDDLSKAMPAMDINFWGSVYCTFFASSYLKKSRGKIVVIASGCG  186

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            +++SPR+S Y ASKAA+  F+ETLR E G  + +T+V PG ++SE+TQGK + K G+  V
Sbjct  187  YIASPRLSFYCASKAAVIAFYETLRSEFGSKVGVTIVAPGVVDSEMTQGKFMTKNGQFIV  246

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDVQ++++PV   + CAKAIL S CRG+RYL EPAW      WKVF  EV + +  
Sbjct  247  DKELRDVQISLLPVESAERCAKAILRSVCRGDRYLLEPAWISCVILWKVFCSEVTDSLGR  306

Query  543  LLYM  554
             L M
Sbjct  307  WLVM  310



>ref|XP_002321718.2| hypothetical protein POPTR_0015s11200g [Populus trichocarpa]
 gb|EEF05845.2| hypothetical protein POPTR_0015s11200g [Populus trichocarpa]
Length=307

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 125/178 (70%), Gaps = 12/178 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FE+ + ++   ++ D NFWGSVY TH A PHLR++ GRIV ISS AG
Sbjct  128  HLVNNAGVVQIDMFEDCKQISDFATLTDTNFWGSVYTTHFAIPHLRKSKGRIVGISSIAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W + PRMS Y ASKAA++ F+ETLR E G DI IT+VTPG +ESE++QG  L+KA     
Sbjct  188  WFTVPRMSFYCASKAAITSFYETLRAEFGSDIGITIVTPGVVESEMSQGDFLSKA-----  242

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYI  536
                   Q++ +P    + CAKAI++SACRG+RYLTEP+W ++T   KV  PEV+E++
Sbjct  243  -------QIDFVPAESTERCAKAIVDSACRGDRYLTEPSWARMTFLLKVLCPEVLEWL  293



>ref|XP_009405178.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Musa 
acuminata subsp. malaccensis]
Length=354

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 143/215 (67%), Gaps = 0/215 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+     FEE+  +T+   +MD+NFWGSVY T+ A P L+   G+IVV +S AG
Sbjct  129  HLVCNAGLWCSCFFEEITSITAFTQLMDVNFWGSVYPTYYALPFLKNTRGKIVVNASMAG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + +PRMS+YNASKAAM +F+ETLR ELG D++IT+V  G++ SELT+GK + K G + +
Sbjct  189  RVPTPRMSLYNASKAAMIRFYETLRSELGSDVRITIVNLGYVASELTKGKAVQKNGEVAI  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + + RD+ V  +P+G    CA+ I+  ACRG+ Y++ P+W+K         PE+V + + 
Sbjct  249  NQEARDILVGPLPIGSTKKCAQLIVGGACRGDEYISWPSWYKPFHVVMSLAPEIVIWFSR  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETII  647
              Y+ +PG+   + L K++L+  G ++ +YP +++
Sbjct  309  CFYLGNPGNASSEPLSKRMLNVKGLKRFLYPASVL  343



>ref|XP_009127343.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 isoform 
X2 [Brassica rapa]
Length=312

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 127/184 (69%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE+++D++     MDINFWGSVY T  A+ +L+++ G+IVVI+S  G
Sbjct  128  HLVTNAGVAPLYLFEDIDDLSKAMPAMDINFWGSVYCTFFASSYLKKSRGKIVVIASGCG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            +++SPR+S Y ASKAA+  F+ETLR E G  + +T+  PG ++SE+TQGK + K G+  V
Sbjct  188  YIASPRLSFYCASKAAVIAFYETLRSEFGSKVGVTIAAPGVVDSEMTQGKFMTKNGQFIV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDVQ++++PV   + CAKAIL S CRG+RYL EPAW      WKVF  EV + +  
Sbjct  248  DKELRDVQISLLPVESAERCAKAILRSVCRGDRYLLEPAWISCVILWKVFCSEVTDSLGR  307

Query  543  LLYM  554
             L M
Sbjct  308  WLVM  311



>ref|XP_010536601.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 [Tarenaya 
hassleriana]
Length=348

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 135/213 (63%), Gaps = 0/213 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE+++D++     MD+NFWGS Y T  A P+L+++ G+IV I+S   
Sbjct  129  HLVTNAGIAPLYLFEDIDDLSKAAPSMDVNFWGSAYCTFFARPYLKKSRGKIVAIASGCA  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            ++ SP++S Y ASKAAM  F+ETLR E G ++ IT+V PG I+SEL++GK + K G L+V
Sbjct  189  YIPSPKLSFYCASKAAMISFYETLRAEFGSEVGITIVVPGIIDSELSRGKFMTKDGELKV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              ++RDV VN++PV   + C KAI+ S CRG++YL EP+W      W+VF PEV E+++ 
Sbjct  249  DKELRDVHVNVLPVESAEKCGKAIVRSVCRGDKYLVEPSWIDSVMLWRVFAPEVTEWLSR  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPET  641
                 +   PP  +    +    G   I+ P +
Sbjct  309  WWADLAKAKPPPRSKVLNLRRSAGRYDIVRPRS  341



>ref|XP_010086989.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
 gb|EXB25268.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
Length=311

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 129/190 (68%), Gaps = 12/190 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   SLFE+   ++++RS+MDINFWGSVY T  A PHLR+  G+IVV SSS  
Sbjct  129  HLVNNAGVLQVSLFEDSTQLSAIRSIMDINFWGSVYCTQFAVPHLRKAKGKIVVTSSSGA  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W S PR+S+YNASKAA   FFETL+ E G D+ IT+VTPG +ESE+T  +  +K+G    
Sbjct  189  WYSPPRLSVYNASKAAQISFFETLKSEYGSDVGITIVTPGLVESEMTGDQFWSKSG----  244

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
                    +  +PV   + CAKAI++SACRG+ YLTEP+W KV  W+KV +P++V+    
Sbjct  245  --------IKGIPVESAEGCAKAIVDSACRGDMYLTEPSWCKVGFWFKVIWPQLVQKCFH  296

Query  543  LLYMTSPGSP  572
            L  +  P +P
Sbjct  297  LTLVHRPWTP  306



>gb|EAZ30541.1| hypothetical protein OsJ_14589 [Oryza sativa Japonica Group]
Length=326

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 137/214 (64%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     FEEV DV + + V+D+NFWG+V+ TH A PHL+ + G+I V SS++ 
Sbjct  105  HLVNNAGLANVCWFEEVPDVANFKQVLDVNFWGTVHPTHAALPHLKASRGKIFVNSSASA  164

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             L+ PRMS YNASKAA+  F ETLR+EL  ++ +T+ TPG+++SE+T+GKHL+  G +EV
Sbjct  165  VLAMPRMSFYNASKAAVHNFAETLRMELHGEVGVTVATPGWVDSEMTKGKHLSSHGAMEV  224

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RD QV + PV + + CA+AI+++  RG R +T PAW+     W+   PEV +    
Sbjct  225  DQDTRDAQVGVFPVERGERCAEAIVDAVARGRRRVTSPAWYGALFLWRTMAPEVADACQR  284

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            + Y     +       +  L+ TG + ++ P ++
Sbjct  285  VFYHRRSSAAGGGGRARAALEATGAKAVLQPPSL  318



>emb|CAH66438.1| OSIGBa0132D06.4 [Oryza sativa Indica Group]
 gb|EAY93903.1| hypothetical protein OsI_15676 [Oryza sativa Indica Group]
Length=368

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 137/214 (64%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     FEEV DV + + V+D+NFWG+V+ TH A PHL+ + G+I V SS++ 
Sbjct  147  HLVNNAGLANVCWFEEVPDVANFKQVLDVNFWGTVHPTHAALPHLKASRGKIFVNSSASA  206

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             L+ PRMS YNASKAA+  F ETLR+EL  ++ +T+ TPG+++SE+T+GKHL+  G +EV
Sbjct  207  VLAMPRMSFYNASKAAVHNFAETLRMELHGEVGVTVATPGWVDSEMTKGKHLSSHGAMEV  266

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RD QV + PV + + CA+AI+++  RG R +T PAW+     W+   PEV +    
Sbjct  267  DQDTRDAQVGVFPVERGERCAEAIVDAVARGRRRVTSPAWYGALFLWRTMAPEVADACQR  326

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            + Y     +       +  L+ TG + ++ P ++
Sbjct  327  VFYHRRSSAGGGGGRARAALEATGAKAVLQPPSL  360



>ref|NP_001052642.1| Os04g0390700 [Oryza sativa Japonica Group]
 emb|CAD40535.1| OSJNBa0055C08.3 [Oryza sativa Japonica Group]
 dbj|BAF14556.1| Os04g0390700 [Oryza sativa Japonica Group]
 dbj|BAG98013.1| unnamed protein product [Oryza sativa Japonica Group]
Length=368

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 137/214 (64%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     FEEV DV + + V+D+NFWG+V+ TH A PHL+ + G+I V SS++ 
Sbjct  147  HLVNNAGLANVCWFEEVPDVANFKQVLDVNFWGTVHPTHAALPHLKASRGKIFVNSSASA  206

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             L+ PRMS YNASKAA+  F ETLR+EL  ++ +T+ TPG+++SE+T+GKHL+  G +EV
Sbjct  207  VLAMPRMSFYNASKAAVHNFAETLRMELHGEVGVTVATPGWVDSEMTKGKHLSSHGAMEV  266

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RD QV + PV + + CA+AI+++  RG R +T PAW+     W+   PEV +    
Sbjct  267  DQDTRDAQVGVFPVERGERCAEAIVDAVARGRRRVTSPAWYGALFLWRTMAPEVADACQR  326

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            + Y     +       +  L+ TG + ++ P ++
Sbjct  327  VFYHRRSSAAGGGGRARAALEATGAKAVLQPPSL  360



>ref|XP_009127342.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 isoform 
X1 [Brassica rapa]
Length=313

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 127/185 (69%), Gaps = 1/185 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE+++D++     MDINFWGSVY T  A+ +L+++ G+IVVI+S  G
Sbjct  128  HLVTNAGVAPLYLFEDIDDLSKAMPAMDINFWGSVYCTFFASSYLKKSRGKIVVIASGCG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            +++SPR+S Y ASKAA+  F+ETLR E G  + +T+  PG ++SE+TQGK + K G+  V
Sbjct  188  YIASPRLSFYCASKAAVIAFYETLRSEFGSKVGVTIAAPGVVDSEMTQGKFMTKNGQFIV  247

Query  363  SADMRD-VQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
              ++RD VQ++++PV   + CAKAIL S CRG+RYL EPAW      WKVF  EV + + 
Sbjct  248  DKELRDQVQISLLPVESAERCAKAILRSVCRGDRYLLEPAWISCVILWKVFCSEVTDSLG  307

Query  540  LLLYM  554
              L M
Sbjct  308  RWLVM  312



>ref|XP_008239510.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Prunus 
mume]
Length=314

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 127/192 (66%), Gaps = 15/192 (8%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEE--VEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSS  176
            HLVNNAG+     FE+     V+ L S+MDINFWGSVY TH + PHLR++ G+IVVISSS
Sbjct  128  HLVNNAGILQAGSFEDWTQGQVSKLVSIMDINFWGSVYCTHFSLPHLRKSKGKIVVISSS  187

Query  177  AGWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRL  356
            + W S+P+   YNASKAA++ FFETLR ELG DI IT+V+PG IESE+T           
Sbjct  188  STWFSTPKFGFYNASKAALTCFFETLRAELGSDIGITIVSPGLIESEMTGSSQF------  241

Query  357  EVSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYI  536
                 +  V+ N+MP+   + C KAI++SACRG+ YLTEPAW K   W +VF PE++E  
Sbjct  242  -----LSQVRPNLMPIKSAEGCTKAIVDSACRGDMYLTEPAWVKFGFWLRVFCPELLE--  294

Query  537  NLLLYMTSPGSP  572
             LL  M +  +P
Sbjct  295  KLLQLMATKTNP  306



>ref|XP_008798975.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Phoenix dactylifera]
Length=256

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 131/187 (70%), Gaps = 0/187 (0%)
 Frame = +3

Query  84   DINFWGSVYMTHLAAPHLRRNNGRIVVISSSAGWLSSPRMSIYNASKAAMSQFFETLRIE  263
            D+NFWGSVY T+ A PHL+ ++G I+V +S AG + + RM IYNASKAA+ +F+ETLR E
Sbjct  63   DVNFWGSVYPTYYAIPHLKTSHGNIIVTASVAGHVPTARMGIYNASKAAVIRFYETLRSE  122

Query  264  LGPDIKITLVTPGFIESELTQGKHLNKAGRLEVSADMRDVQVNIMPVGKVDACAKAILNS  443
            LG +I+IT++TPG++ESELT+GK + K G + V  + RD+Q+  +PVG+ + CA+ I++S
Sbjct  123  LGSEIRITIITPGYVESELTKGKIVKKDGEVGVDEEARDIQLGPLPVGRTERCAEIIVDS  182

Query  444  ACRGERYLTEPAWFKVTRWWKVFFPEVVEYINLLLYMTSPGSPPQDALGKKILDYTGCQK  623
            AC G+ Y+T P+WFK       F PEVV + +   Y+  PG+   + L K+IL+ +G  K
Sbjct  183  ACNGDEYVTWPSWFKPFYAVMSFAPEVVNWFSRTFYVAKPGATSTETLSKRILEASGAHK  242

Query  624  IIYPETI  644
              YP +I
Sbjct  243  FFYPASI  249



>ref|XP_010270763.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=318

 Score =   196 bits (497),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 129/190 (68%), Gaps = 1/190 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +F  FE V   ++L+SVMDINFWGS+Y T+ A PHLR++ G+IVV +S   
Sbjct  128  HLVCNAGIVSFGKFENVLGFSNLKSVMDINFWGSIYPTYFAIPHLRKSKGKIVVNASGTS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESEL-TQGKHLNKAGRLE  359
            WL SP  S Y ASKAA+  F+ET+RIEL P+IKIT+  P + ESE+ + GK L K G +E
Sbjct  188  WLISPFFSFYGASKAAIVNFYETMRIELAPEIKITIAAPWYTESEMVSHGKSLTKDGVVE  247

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
             S +MR+V +  +PV +V  CAK I+N AC GERY+ EP  +K+    + F+P +VE+  
Sbjct  248  NSREMREVLIGKLPVMRVGVCAKDIVNGACSGERYVIEPFCYKILFLLQFFYPGIVEWAA  307

Query  540  LLLYMTSPGS  569
              LYM   G+
Sbjct  308  RRLYMGKSGT  317



>ref|XP_011044100.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
Length=307

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 123/177 (69%), Gaps = 12/177 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FE  + ++    +M+INFWGSVY+T  A PHLR++ GRIV ISS AG
Sbjct  128  HLVNNAGIIQIDMFEHCKQISDCAILMNINFWGSVYVTRFAIPHLRKSKGRIVGISSIAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W S P+MS Y ASKAA++ F+ETL  E GPDI IT+VTPG +ESE+TQG  ++KA     
Sbjct  188  WCSVPKMSFYCASKAAITSFYETLAAEFGPDIGITIVTPGVVESEMTQGDFISKA-----  242

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
                   Q++ +P    + CA+AI+NSACRG+RYL EP+W +++   KV  PEV+E+
Sbjct  243  -------QMDFVPAESTERCAEAIVNSACRGDRYLVEPSWTRMSFLLKVLCPEVMEW  292



>ref|XP_002321719.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEF05846.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=298

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 121/177 (68%), Gaps = 21/177 (12%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FE+ + ++   ++M+ NFWGSVY +H A PHLR++ GRIV ISS AG
Sbjct  128  HLVNNAGVAQIDMFEDCKQISDFATIMNTNFWGSVYASHFAIPHLRKSKGRIVGISSIAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W S PRMS Y+ASKAA++ F+ETLR E G DI+IT+VTPG +ESE+TQG  L+K+     
Sbjct  188  WCSVPRMSFYSASKAAITSFYETLRAEFGSDIRITIVTPGLVESEMTQGDFLSKS-----  242

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
                             + CAKAI++SACRG+RYL EP+W ++T   KV  PEV+E+
Sbjct  243  ----------------TERCAKAIVDSACRGDRYLVEPSWARITFLMKVLCPEVLEW  283



>ref|XP_010086988.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
 gb|EXB25267.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
Length=310

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 127/194 (65%), Gaps = 12/194 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            +L+NNAG     L E+  + + +RS+MDINFWGSVY T  A PHLR+ NG+IVVISS   
Sbjct  129  YLINNAGALQAILIEDFTEFSKIRSIMDINFWGSVYCTQFAIPHLRKGNGKIVVISSIGA  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WLS PR+ IY+ASKAA   FFE L+ ELG DI IT+V+PG IESE+T+ +  ++      
Sbjct  189  WLSPPRLGIYSASKAAQLCFFEALKAELGSDIGITIVSPGLIESEMTKDEFFSQT-----  243

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
                   +V   PV   + CAKAI+ SACRGE YLTEP W++VT W+KV  P++V+Y   
Sbjct  244  -------RVKGFPVESGEMCAKAIVESACRGEMYLTEPYWWRVTFWFKVILPQLVQYYFH  296

Query  543  LLYMTSPGSPPQDA  584
            L  +  P +  +DA
Sbjct  297  LTLIRMPWASNKDA  310



>ref|XP_010250645.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=353

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 124/184 (67%), Gaps = 1/184 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +  +FE+  ++     VM INFWGS+Y TH AAPHLR + G+++VI+S AG
Sbjct  131  HLVTNAGIGSVCMFEDSTEINKFTPVMGINFWGSIYATHFAAPHLRNSKGKMIVIASLAG  190

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRL-E  359
            WL  PRMS Y ASKAA+ +F ET RIE G DI+  +V PG IESE+T+G+ L+  G L E
Sbjct  191  WLPVPRMSFYCASKAALIKFHETYRIEYGADIRSVIVVPGLIESEMTKGRFLSNEGVLME  250

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V  + R+V+V + P    + CAK I++ ACRGE Y+ EP W+K   + +   PEV+E+  
Sbjct  251  VDEESREVEVGVFPYASTEGCAKHIVDGACRGEPYVIEPRWYKAAIFCRSLCPEVLEWFY  310

Query  540  LLLY  551
             L+Y
Sbjct  311  RLVY  314



>ref|XP_002318146.2| hypothetical protein POPTR_0012s10360g, partial [Populus trichocarpa]
 gb|EEE96366.2| hypothetical protein POPTR_0012s10360g, partial [Populus trichocarpa]
Length=338

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 123/177 (69%), Gaps = 12/177 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FE+ ++++    +M+ NFWGSVY+T  A PHLR++ GRIV ISS AG
Sbjct  161  HLVNNAGIIQIDMFEQCKEISDCAILMNTNFWGSVYVTRFAIPHLRKSKGRIVGISSIAG  220

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W S PRMS Y ASKAA++ F+ETL  E GPDI IT+VTPG +ESE+TQG  ++KA     
Sbjct  221  WCSVPRMSFYCASKAAVTSFYETLAAEFGPDIGITIVTPGVVESEMTQGDFVSKA-----  275

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
                   Q++ +P    + CA+AI+NSACRG+RYL EP+W ++    KV  PEV+E+
Sbjct  276  -------QMDSVPAESTERCAEAIVNSACRGDRYLVEPSWTRMLFLLKVLCPEVMEW  325



>ref|NP_001152614.1| steroleosin [Zea mays]
 gb|ACG48577.1| steroleosin [Zea mays]
 tpg|DAA38130.1| TPA: steroleosin [Zea mays]
Length=350

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 137/214 (64%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA +     FEE++DV  LR++MDINFWG VY T LA PHLRR+ GRIV ++S++ 
Sbjct  130  HLVNNASIWQVCKFEEIQDVRHLRALMDINFWGHVYPTRLAIPHLRRSRGRIVGVTSNSS  189

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            ++   R + YNASKAA   F++TLR+ELG DI+IT V PG +ESE+T+GK L K G ++V
Sbjct  190  YIFIGRNTFYNASKAAALSFYDTLRMELGSDIRITEVVPGVVESEITKGKMLTKGGEMKV  249

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RD  +   P   V   A+ ++   CRG RY+ EP W+      +   PEV+ + + 
Sbjct  250  DQDERDAILGPTPAEPVGDFARTVVRDVCRGARYVFEPRWYMGVYLLRACLPEVLAWNSR  309

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LL + + G+   D LGK +++  G ++++ P ++
Sbjct  310  LLTVDTVGASTTDTLGKWLVELPGVRRVVQPPSL  343



>ref|XP_006402065.1| hypothetical protein EUTSA_v10015936mg [Eutrema salsugineum]
 gb|ESQ43518.1| hypothetical protein EUTSA_v10015936mg [Eutrema salsugineum]
Length=309

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 120/176 (68%), Gaps = 5/176 (3%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE+++D++     MDINFWGSVY T L      +  GRIVVI+S  G
Sbjct  128  HLVTNAGVAPLYLFEDIDDLSKASPAMDINFWGSVYCTFL-----EKTRGRIVVIASGCG  182

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            ++SSPR+S Y ASKAA+  F+E++R E G +I +T+V PG I++E+T+GK + K G L V
Sbjct  183  YISSPRLSFYCASKAAVIAFYESIRTEFGSEIGVTIVAPGVIDTEMTRGKFMTKNGELVV  242

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVE  530
              ++RDVQ+N++PV   + CAKAI+ S CRG+RYL EP W      WKVF  EV +
Sbjct  243  DKELRDVQINVLPVESAERCAKAIMRSVCRGDRYLLEPEWIGSVILWKVFCSEVTD  298



>ref|XP_011023955.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
Length=298

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 121/177 (68%), Gaps = 21/177 (12%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FE+ ++++   ++M+ NFWGSVY +H A PHLR++ GRIV ISS AG
Sbjct  128  HLVNNAGVAQIDMFEDCKEISDFATIMNTNFWGSVYASHFAIPHLRKSKGRIVGISSIAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W S PRMS Y ASKAA++ F+ETLR E G DI+IT+VTPG +ESE+T+G  L+K+     
Sbjct  188  WCSVPRMSFYCASKAAITSFYETLRAECGSDIRITIVTPGVVESEMTRGDFLSKS-----  242

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
                             + CAKAI++SACRG+RYL EP+W ++T   KV  PEV+E+
Sbjct  243  ----------------TERCAKAIVDSACRGDRYLVEPSWARITFLMKVLCPEVLEW  283



>ref|XP_002446312.1| hypothetical protein SORBIDRAFT_06g013990 [Sorghum bicolor]
 gb|EES10640.1| hypothetical protein SORBIDRAFT_06g013990 [Sorghum bicolor]
Length=348

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 136/214 (64%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA +     FEE+EDV+  R++MDINFWG VY T LA PHL+R++GRIV ++S++ 
Sbjct  127  HLVNNASVWKVCKFEEIEDVSHFRALMDINFWGHVYPTRLAIPHLKRSHGRIVGVTSNSS  186

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            ++   R + YNASKAA   F++TLR+ELG DI+IT V PG +ESE+T+GK L K G ++V
Sbjct  187  YIFIGRNTFYNASKAAALNFYDTLRMELGGDIRITEVVPGVVESEITKGKMLTKEGEMKV  246

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RD  +   P   V   A+ ++   CRG RY+ EP W+      +   PEV+ + + 
Sbjct  247  DQDERDAILGPTPAEPVGDFARTVVRDVCRGARYVFEPRWYMGVYLLRACIPEVLAWNSR  306

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LL +   G+   D LGK +LD  G +++  P ++
Sbjct  307  LLTVDRVGASTTDTLGKWLLDLPGVRRVAQPPSL  340



>dbj|BAK03741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 133/207 (64%), Gaps = 1/207 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA +     FEEVEDV   R+VMDINFWG VY T  A PHL++ +GRIV ++S++ 
Sbjct  145  HLVNNASIWQVCKFEEVEDVHYFRTVMDINFWGHVYPTRYAIPHLKKTHGRIVGVTSNSS  204

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            ++   R + YNASKAA   F++TLR+ELG D+ IT + PG +ESE+T+GK L K G ++V
Sbjct  205  YIFIGRNTFYNASKAAALNFYDTLRMELGGDVHITEIVPGVVESEITKGKMLTKEGEMKV  264

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RD      P   V A AK ++   CRGERY+ EP W+     ++V FPE++ + + 
Sbjct  265  DQDERDAIHGPTPAEPVAAFAKTVVRDVCRGERYVFEPRWYMAVYLFRVCFPEILSWSSR  324

Query  543  LLYMTSPGSPP-QDALGKKILDYTGCQ  620
            LL + + G P   D +G++ILD  G +
Sbjct  325  LLTVKTLGRPATTDTVGRQILDMPGVR  351



>dbj|BAJ87073.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92171.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=352

 Score =   191 bits (486),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 138/218 (63%), Gaps = 0/218 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ ++++ ++VMD+NFWG+VY T+ A P+L+ + G IVV +S AG
Sbjct  133  HLVANAGVWSSCFFEEITNISAFQNVMDLNFWGAVYPTYFALPYLKASRGNIVVTASVAG  192

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +   RMS YNASK A+ +FFETLR ELGP +++T++ PG++ S LT GK + K G +  
Sbjct  193  RVPVARMSFYNASKGAVIRFFETLRAELGPHVRVTILVPGYVVSNLTMGKGVQKDGNVGF  252

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RD+ V  +PVGK +  A+ ++ S  RG+RY+T P W+          PE+V++ + 
Sbjct  253  DEDARDINVGPLPVGKTETLAEVVVASVRRGDRYVTWPGWYWPFHMVMCAAPELVDWFSR  312

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
              Y++       DAL KKIL   G +K +YP+ I   Q
Sbjct  313  AFYVSKSSDKDGDALSKKILMAVGGKKFLYPKNIRSHQ  350



>gb|ABA93830.1| oxidoreductase, short chain dehydrogenase/reductase family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAG97628.1| unnamed protein product [Oryza sativa Japonica Group]
Length=340

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 139/214 (65%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ ++T+  +V+D+NFWG+VY T+ A P+L+ + G IVV SS AG
Sbjct  119  HLVANAGIWSSCFFEEITNITAFHNVIDLNFWGAVYPTYFALPYLKASRGNIVVTSSVAG  178

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + + RMS YNASK A+ +F+ETLR ELG  +++T++TPG++ S LT GK + K G + +
Sbjct  179  RVPTARMSFYNASKGAVIRFYETLRAELGSHVRVTILTPGYVVSNLTMGKGIQKDGHVGI  238

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD+ V  +PVGK +  AK ++ +  RG+ Y+T P W+          PE+V++ + 
Sbjct  239  DEEARDINVGPLPVGKTETLAKVVVAAVRRGDYYVTWPGWYWPFHMVMCTAPELVDWFSR  298

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
              Y++       DAL KKIL+  G +K +YP+TI
Sbjct  299  TFYVSKSSDHDGDALSKKILEAVGGKKFLYPKTI  332



>ref|XP_007210136.1| hypothetical protein PRUPE_ppa022641mg [Prunus persica]
 gb|EMJ11335.1| hypothetical protein PRUPE_ppa022641mg [Prunus persica]
Length=310

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 122/192 (64%), Gaps = 15/192 (8%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEE--VEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSS  176
            HLVNNAG+     FE+      + L S+MDINFWGSVY TH + PHLR++ G+IVVISS 
Sbjct  128  HLVNNAGVLQAGSFEDWTQGQFSKLVSIMDINFWGSVYCTHFSLPHLRKSKGKIVVISSC  187

Query  177  AGWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRL  356
            A W S+P+   YNASKAA++ FFETLR ELG DI IT+V+PG IESE+            
Sbjct  188  ASWFSAPKFGFYNASKAALTCFFETLRAELGSDIGITIVSPGVIESEMIGSSQF------  241

Query  357  EVSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYI  536
                 +  V+ N+MP    + C KAI++SACRG+ YLTEPAW K   W +VF PE++E  
Sbjct  242  -----LSQVRSNLMPSKSTEGCTKAIVDSACRGDMYLTEPAWVKFGLWLRVFCPELLE--  294

Query  537  NLLLYMTSPGSP  572
             L   M +  +P
Sbjct  295  KLFQLMATKKNP  306



>ref|NP_001067940.1| Os11g0499600 [Oryza sativa Japonica Group]
 gb|ABA93829.1| oxidoreductase, short chain dehydrogenase/reductase family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF28303.1| Os11g0499600 [Oryza sativa Japonica Group]
 gb|EAY81017.1| hypothetical protein OsI_36200 [Oryza sativa Indica Group]
 gb|EAZ18442.1| hypothetical protein OsJ_33972 [Oryza sativa Japonica Group]
Length=354

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 139/214 (65%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ ++T+  +V+D+NFWG+VY T+ A P+L+ + G IVV SS AG
Sbjct  133  HLVANAGIWSSCFFEEITNITAFHNVIDLNFWGAVYPTYFALPYLKASRGNIVVTSSVAG  192

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + + RMS YNASK A+ +F+ETLR ELG  +++T++TPG++ S LT GK + K G + +
Sbjct  193  RVPTARMSFYNASKGAVIRFYETLRAELGSHVRVTILTPGYVVSNLTMGKGIQKDGHVGI  252

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD+ V  +PVGK +  AK ++ +  RG+ Y+T P W+          PE+V++ + 
Sbjct  253  DEEARDINVGPLPVGKTETLAKVVVAAVRRGDYYVTWPGWYWPFHMVMCTAPELVDWFSR  312

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
              Y++       DAL KKIL+  G +K +YP+TI
Sbjct  313  TFYVSKSSDHDGDALSKKILEAVGGKKFLYPKTI  346



>ref|XP_003579631.2| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brachypodium 
distachyon]
Length=352

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 134/214 (63%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA +     FEEVEDV   R +MDINFWG VY T  A PHL+R +GRIV ++S++ 
Sbjct  131  HLVNNASIWQVCKFEEVEDVNYFRELMDINFWGHVYPTRHAIPHLKRTHGRIVGVTSNSS  190

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            ++   R + YNASKAA   F++TLR+EL  +I+IT V PG IESE+T+GK L K G ++V
Sbjct  191  YIFIGRNTFYNASKAAALNFYDTLRMELAGEIRITEVVPGVIESEITKGKMLTKEGEMKV  250

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + D RD  +   P   V   AK ++   CRG RY+ EP W+     +++ FPE++ + + 
Sbjct  251  NQDERDAILGPTPAESVGNFAKTVVRDVCRGARYVFEPRWYMAVYMFRLCFPEILAWNSR  310

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LL + + G    D LGK+ILD  G +    P ++
Sbjct  311  LLAVKTLGPATTDTLGKQILDVPGVRWFTQPGSL  344



>ref|XP_009359394.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Pyrus 
x bretschneideri]
Length=312

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 128/195 (66%), Gaps = 13/195 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   SLFE+    +++ S+MDINFWGSVY TH + PHLR++ G+IVVISSSA 
Sbjct  128  HLVNNAGVLQVSLFEDYNQFSTMVSIMDINFWGSVYCTHFSVPHLRKSKGKIVVISSSAP  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W S+P+ S YNASKAA + FFE+LR ELG +I IT+V+PG IESE+T  +          
Sbjct  188  WFSAPKSSFYNASKAAQTCFFESLRSELGSEIGITIVSPGLIESEMTGSRQF--------  239

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               +  ++   MP    + C KAIL+S CRG+ +LTEP+W     W +V +PE++E +  
Sbjct  240  ---VSQLRPKWMPSESPEKCTKAILDSVCRGDMHLTEPSWVGFGFWLRVLYPELLEKLFH  296

Query  543  LLYMTS--PGSPPQD  581
            L+  T   P +P +D
Sbjct  297  LIVETKKMPATPNKD  311



>ref|NP_001141666.2| cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [Zea mays]
 gb|ACF86821.2| unknown [Zea mays]
 gb|AFW60730.1| cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [Zea mays]
Length=357

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 143/219 (65%), Gaps = 1/219 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ ++T+  +VMD+NFWG+VY T+ A P+L+ + G IVV +S AG
Sbjct  133  HLVANAGIWSSCFFEEITNITAFHNVMDLNFWGAVYPTYFALPYLKASRGNIVVTASVAG  192

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + + RMS YNASK A+ +F+ETLR ELG  +++T++ PG++ S LT+G+ L K GR+ V
Sbjct  193  RVPTARMSFYNASKGAVIRFYETLRAELGSHVRVTILMPGYVVSNLTKGRGLQKDGRVGV  252

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD+ V  MPVGK ++ A+ ++ S  RG+ Y+T P W+          PE++++ + 
Sbjct  253  DEEARDINVGPMPVGKTESLAEVVVASVRRGDYYVTWPGWYWPFHMVMCAAPELLDWFSR  312

Query  543  LLYMT-SPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
              Y++ S G     AL KKIL+  G +K +YP+TI   Q
Sbjct  313  AFYVSKSGGQDGGAALSKKILEAVGGKKFLYPQTIRCQQ  351



>gb|KDP22590.1| hypothetical protein JCGZ_26421 [Jatropha curcas]
Length=156

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = +3

Query  201  MSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEVSADMRD  380
            MSIYNASKAA+  FFETLR+ELG D+ + +VTPG  ESELTQGK +   G+++V  D+RD
Sbjct  1    MSIYNASKAALVTFFETLRVELGSDVSVLIVTPGHTESELTQGKFMLAEGKVDVDQDLRD  60

Query  381  VQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINLLLYMTS  560
            VQV  +PV  V  CAK I+NSACRG++YLTEPAW +VT  WKVF P+++E+    L++  
Sbjct  61   VQVGPIPVETVSGCAKGIVNSACRGDKYLTEPAWLRVTWLWKVFCPDMLEWNYRFLFLNR  120

Query  561  PGSPPQDALGKKILDYTGCQKIIYPETI  644
            P  P  +A  KKILD TG +KI+YPETI
Sbjct  121  PEEPATEAPTKKILDMTGAKKILYPETI  148



>ref|NP_001147696.1| cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [Zea mays]
 gb|ACG28403.1| cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [Zea mays]
Length=359

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 145/222 (65%), Gaps = 5/222 (2%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ ++T+  +VMD+NFWG+VY T+ A P+L+ + G IVV +S AG
Sbjct  133  HLVANAGIWSSCFFEEITNITAFHNVMDLNFWGAVYPTYFALPYLKASRGNIVVTASVAG  192

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + + RMS YNASK A+ +F+ETLR ELG  +++T++ PG++ S LT+G+ L K GR+ V
Sbjct  193  RVPTARMSFYNASKGAVIRFYETLRAELGSHVRVTILMPGYVVSNLTKGRGLQKDGRVGV  252

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD+ V  MPVGK ++ A+ ++ S  RG+ Y+T P W+          PE++++ + 
Sbjct  253  DEEARDINVGPMPVGKTESLAEVVVASVRRGDYYVTWPGWYWPFHMVMCAAPELLDWFSR  312

Query  543  LLYMTSPGSPPQD----ALGKKILDYTGCQKIIYPETIIHDQ  656
              Y++S  S  QD    AL KKIL+  G +K +YP+TI   Q
Sbjct  313  AFYVSSK-SGGQDGGGAALSKKILEAVGGKKFLYPQTIRCQQ  353



>emb|CDP19889.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 124/184 (67%), Gaps = 0/184 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+++  L E+  D+T  + VMD+NFWGS+Y T+ A P+L+R  G I V +S++ 
Sbjct  125  HLVNNAGISSMCLIEDATDITRFQPVMDVNFWGSIYPTYFAMPYLKRTKGSISVNASASA  184

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            ++     SIY ASKAA+  F+ET+R E+ P+I IT+ T G +ESE+T+GKHLN+ G  EV
Sbjct  185  YMHPSGFSIYTASKAALLSFYETMRSEMPPEISITIATLGLVESEMTKGKHLNREGTTEV  244

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            S ++ D  +N +P     ACAK+I+ + CR ERY+TEP W  V    K   P ++E++N 
Sbjct  245  SPELADTLINQLPAMSTSACAKSIVEAVCRKERYVTEPKWCAVLFLLKAPCPGIIEFVNR  304

Query  543  LLYM  554
             L++
Sbjct  305  RLHL  308



>ref|XP_010251331.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=330

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 119/171 (70%), Gaps = 3/171 (2%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +F  F++V  + S  S+MDINFWGS Y T+ A PHL+R+ G+I+V +SS+G
Sbjct  159  HLVCNAGIISFCAFKDVTSIASCTSLMDINFWGSFYPTYFAVPHLKRSKGKIIVNASSSG  218

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGP---DIKITLVTPGFIESELTQGKHLNKAGR  353
            W+ SP M+ Y A+KAA+   +E LR EL P   D+ +T+  PGFIESE++QGKHL+  G 
Sbjct  219  WMGSPAMTFYGATKAALINHYEKLRTELAPDALDVTVTITAPGFIESEMSQGKHLSGKGV  278

Query  354  LEVSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWK  506
            + V  DMRDV + ++PV  V  CA+AI+  ACRG+ Y+ EP WF + +  +
Sbjct  279  VMVDQDMRDVAIGVLPVLSVGKCAEAIVKKACRGDGYVIEPWWFNMLQLCR  329



>ref|XP_010271842.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Nelumbo nucifera]
Length=287

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 123/200 (62%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV N G  +F LFE+  DV     VMD+NFWGSV     A PHLR++ GRIVV +S  G
Sbjct  88   HLVCNTGTESFGLFEDAADVAKFAPVMDVNFWGSVAPACFAIPHLRKSRGRIVVNASVLG  147

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W  SP  S+Y A+KAA+  F+ET RI+L  ++KIT V P FIE+E+ Q KH +  G +  
Sbjct  148  WTVSPWASVYGATKAALVNFYETFRIDLKQEVKITTVAPAFIEAEMLQEKHSSNTGDIVA  207

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               MR + V++  V   + CAKAI+N ACRG+RY+ EP W+KV   ++   P +V++   
Sbjct  208  DEKMRKIMVSLFAVRSSEECAKAIVNGACRGDRYVIEPPWYKVFILFQFVCPGLVQWCAH  267

Query  543  LLYMTSPGSPPQDALGKKIL  602
             L+ TS   PP+    K++ 
Sbjct  268  WLFTTSDQVPPRGCCKKRMF  287



>ref|XP_010253812.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=326

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 124/187 (66%), Gaps = 0/187 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE   +    + VMDINFWGS+Y T+ A PHL+++ G+I+V +S AG
Sbjct  128  HLVCNAGVYNSHLFECGINAEISKPVMDINFWGSIYPTYFAIPHLKKSKGKIIVNASVAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W  SP  S+Y ASKAA+  FFETLR+EL  ++ IT+V P FI+SE+TQGKHLNK G LEV
Sbjct  188  WAISPWASVYGASKAALINFFETLRLELAQEVTITIVAPAFIQSEITQGKHLNKEGILEV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               +R +  +   V     CAKAI+N ACRGERY+ EP+++++   +    PE+VE+   
Sbjct  248  DPKLRKIINSRFQVKSAGECAKAIVNGACRGERYVVEPSYYRLLFLFHFMCPEIVEWFVR  307

Query  543  LLYMTSP  563
            L+    P
Sbjct  308  LICRIKP  314



>ref|XP_004979317.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Setaria 
italica]
Length=357

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 143/217 (66%), Gaps = 4/217 (2%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ ++T+  +++D+NFWG+VY T+ A P+L+ + G IVV SS AG
Sbjct  133  HLVANAGIWSSCFFEEITNITAFHNIIDLNFWGAVYPTYFALPYLKASRGNIVVTSSVAG  192

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + + RMS YNASK A+ +F+ETLR ELG  +++T++ PG++ S LT+GK L K G + +
Sbjct  193  RVPTARMSFYNASKGAVIRFYETLRAELGSHVRVTILMPGYVVSNLTKGKGLQKDGHVGI  252

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD+ V  +PVGK ++ A  ++ S  RG+ Y+T P W+          PE++++ + 
Sbjct  253  DEEARDINVGPLPVGKTESLAAVVVASVQRGDYYVTWPGWYWPFHMVMCAAPELLDWFSR  312

Query  543  LLYMTSPGSPPQD---ALGKKILDYTGCQKIIYPETI  644
              Y++S G  PQD   AL KKIL+  G +K +YP+TI
Sbjct  313  TFYVSSSGE-PQDGGAALSKKILEAVGGKKFLYPKTI  348



>ref|XP_004977951.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Setaria 
italica]
Length=350

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 137/215 (64%), Gaps = 1/215 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA +    +FEEVEDV   R++MDINFWG VY T LA PHL++ +GRIV ++S++ 
Sbjct  128  HLVNNASIWQVCMFEEVEDVNHFRTLMDINFWGHVYPTRLAIPHLKKTHGRIVGVTSNSS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            ++   R + YNASKAA   F++TLR+ELG DI+IT V PG +ESE+T+GK L K G ++V
Sbjct  188  YIFIGRNTFYNASKAAALNFYDTLRMELGGDIRITEVVPGVVESEITKGKILTKEGEMKV  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RD  +   P   V   A+A++   CRG RY+ EP W+      +V  PEV+ + + 
Sbjct  248  DQDERDAILGPTPAEPVGDFARAVVRDVCRGARYVFEPRWYMGVYLLRVCLPEVLAWNSR  307

Query  543  LLYMTSPG-SPPQDALGKKILDYTGCQKIIYPETI  644
            LL +   G +   D LGK +++  G ++ + P ++
Sbjct  308  LLTVGRAGATSTTDTLGKWLVELPGVRRAVQPPSL  342



>dbj|BAD23082.1| putative steroleosin [Oryza sativa Japonica Group]
Length=357

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/224 (41%), Positives = 147/224 (66%), Gaps = 3/224 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+E+ ++T+  ++MD+NFWG+VY T+ A PHL+ + G++VV SS+AG
Sbjct  124  HLVANAGIWSTCPFDEITNITAFTTIMDVNFWGAVYPTYYALPHLKASRGKLVVCSSAAG  183

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +++ RMS YNASKAA+ +F+ETLR ELG ++ +T++T G++ESE+T GK + K G L V
Sbjct  184  TVATSRMSFYNASKAAVLRFYETLRAELGSEVGVTILTHGYVESEMTMGKAVQKDGVLVV  243

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RDVQ+ + PVG V A  +  ++   RG+RY+T P+ ++  +      PE+V +++ 
Sbjct  244  DQEARDVQIGVFPVGGVGAMCRVAMDGIRRGDRYVTWPSVYRPLQLVACLAPEIVSWLSY  303

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
             +Y T  G      L K+ LD TG ++  +PE +  +    KTD
Sbjct  304  AMYNTKAGGGAP--LSKRALDATGARR-FFPEGLRRNPVVIKTD  344



>ref|XP_010271841.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X1 [Nelumbo nucifera]
Length=328

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 123/200 (62%), Gaps = 0/200 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV N G  +F LFE+  DV     VMD+NFWGSV     A PHLR++ GRIVV +S  G
Sbjct  129  HLVCNTGTESFGLFEDAADVAKFAPVMDVNFWGSVAPACFAIPHLRKSRGRIVVNASVLG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W  SP  S+Y A+KAA+  F+ET RI+L  ++KIT V P FIE+E+ Q KH +  G +  
Sbjct  189  WTVSPWASVYGATKAALVNFYETFRIDLKQEVKITTVAPAFIEAEMLQEKHSSNTGDIVA  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
               MR + V++  V   + CAKAI+N ACRG+RY+ EP W+KV   ++   P +V++   
Sbjct  249  DEKMRKIMVSLFAVRSSEECAKAIVNGACRGDRYVIEPPWYKVFILFQFVCPGLVQWCAH  308

Query  543  LLYMTSPGSPPQDALGKKIL  602
             L+ TS   PP+    K++ 
Sbjct  309  WLFTTSDQVPPRGCCKKRMF  328



>ref|XP_001767568.1| predicted protein [Physcomitrella patens]
 gb|EDQ67703.1| predicted protein [Physcomitrella patens]
Length=341

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 137/214 (64%), Gaps = 4/214 (2%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     F E +D+ +L S +D  FWG VYMT+ A PHLRR +G+++V++S+A 
Sbjct  128  HLVNNAGVAHSFFFSETKDLKALTSTLDTTFWGQVYMTYFAIPHLRRTHGKVLVMASTAS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PR ++YNA KA +  FF+TLR+E+G  I IT+V PG+IESE+T+GK +++ G +  
Sbjct  188  WLPYPRQTLYNAGKAGVLAFFDTLRVEVGDVIGITIVMPGWIESEITKGKFIHEDGDIWT  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
                RD+ +  +PV  V  CA A +    RG  Y+T P ++     +++F PEV+++I  
Sbjct  248  DQMERDMHIGPVPVTSVTECANAAVKGVIRGSHYVTVPFYYSAFLLYRMFAPEVLDWIFR  307

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            L+++  P  P    L K++L  +   +++YP +I
Sbjct  308  LIFVKHPQKP----LSKQVLKASEVHRVLYPTSI  337



>ref|XP_002466880.1| hypothetical protein SORBIDRAFT_01g015790 [Sorghum bicolor]
 gb|EER93878.1| hypothetical protein SORBIDRAFT_01g015790 [Sorghum bicolor]
Length=349

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 152/224 (68%), Gaps = 3/224 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F++V ++T+   +MD+NFWGSVY T+ A PHL+ + G+++V SS+AG
Sbjct  129  HLVANAGIWSSCSFDQVTNITAFTKLMDVNFWGSVYPTYYALPHLKASKGKLIVCSSAAG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +++ RM+ YNASKAA  +F+ETLR E+G ++ IT++TPG++ESE+T+GK + K G + V
Sbjct  189  TVATSRMAFYNASKAAQLRFYETLRTEVGSEVGITILTPGYVESEITKGKGIQKTGEVAV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RD Q+ + PVG+V+A  +  L+    G+ Y+T P+ ++  +      PEV+++++ 
Sbjct  249  DEDARDAQIGVFPVGRVEALCEVALDGIRNGDWYVTWPSMYRPLQLIACLAPEVLDWMSN  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
             +Y  +  +  +  LG++IL+ TG ++ +YP +++  Q   KTD
Sbjct  309  AMYKEAATAQGRRPLGQRILEATGGKR-LYPPSLL--QPRIKTD  349



>ref|XP_006653338.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Oryza 
brachyantha]
Length=313

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     FE+V DV + + V+D+NFWG+V+ TH A PHLR + G+I V SS+A 
Sbjct  147  HLVNNAGLANVCWFEDVPDVANFKQVLDVNFWGTVHPTHAALPHLRESGGKIFVNSSAAA  206

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             L+ PRMS YNASKAA+  F ETLR+EL  ++ +T+ TPG++ESE+T+GKHL+  G +EV
Sbjct  207  ELAMPRMSFYNASKAAVLSFAETLRVELHGEVGVTVATPGWVESEMTKGKHLSGHGAVEV  266

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFK  488
              D+RD QV + PV + + CA+AI+++  RG R +T PAW++
Sbjct  267  DQDVRDAQVGVFPVERGERCAEAIVDAVARGRRRVTVPAWYR  308



>ref|XP_006648666.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Oryza 
brachyantha]
Length=376

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 142/214 (66%), Gaps = 3/214 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+EV ++T+   +MD+NFWGSVY T+ A PHL+ + G++VV SS+AG
Sbjct  129  HLVANAGVWSSCSFDEVTNITAFTKMMDVNFWGSVYPTYYALPHLKASRGKLVVSSSAAG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +++ RMS YNASKAA  +F+ETLR ELG ++ +T++TPG++ESE+T+GK +   G L V
Sbjct  189  TVATSRMSFYNASKAAQLRFYETLRTELGSEVSVTILTPGYVESEMTKGKAIQSGGELAV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + + RD Q+ + PVG+V+   +  ++    G+ Y+T P+ F+  +      PEV+     
Sbjct  249  NEEARDAQIGVFPVGRVEELGEVAMDGIRAGDWYITWPSLFRPLQLIACLAPEVLHRACR  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LLY T  G      LGK+I++ TG ++ ++PE +
Sbjct  309  LLYST--GGKGGQPLGKRIMEATGAKR-LFPEAL  339



>ref|XP_002973836.1| hypothetical protein SELMODRAFT_100351 [Selaginella moellendorffii]
 gb|EFJ24791.1| hypothetical protein SELMODRAFT_100351 [Selaginella moellendorffii]
Length=346

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 137/215 (64%), Gaps = 8/215 (4%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV N G+      EE + +   R +MD+NF G VY T+ A PHLR++ G+IVV +S+A 
Sbjct  128  HLVCNHGIANSFFVEEAKGLEIFRKIMDVNFMGCVYTTYFALPHLRKSRGKIVVTASTAS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDI-KITLVTPGFIESELTQGKHLNKAGRLE  359
            WL  PRMSIYNASKAA+  FF+TLR EL  DI  +T+  PG+I SE+T GK ++  G+ +
Sbjct  188  WLPIPRMSIYNASKAAVVNFFDTLRTELRSDIGGMTIAMPGYIHSEMTMGKFMSAEGKHD  247

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            ++ D+RD  V   PV     CAK I+++  RGERY+  P W+KV+  ++VF P+++E   
Sbjct  248  MNVDIRDTLVGPSPVASTQYCAKQIVSAVTRGERYVVVPTWYKVSLLFRVFVPQLLETFI  307

Query  540  LLLYMT--SPGSPPQDALGKKILD-YTGCQKIIYP  635
             LL++    PG P    + K I+D +   +K++YP
Sbjct  308  SLLFVKELQPGKP----VTKVIMDSFPSAEKVLYP  338



>tpg|DAA63854.1| TPA: hypothetical protein ZEAMMB73_332488 [Zea mays]
Length=330

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 135/218 (62%), Gaps = 20/218 (9%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ DVTS  S +                   R+ GRIVV +S+ G
Sbjct  130  HLVCNAGVASVGAFEEIPDVTSYSSQL-------------------RSRGRIVVTASATG  170

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRMSIYNA+ AA+  FFETLR ELG  + IT+VTPG++ESE+++GK L + G++EV
Sbjct  171  WNPVPRMSIYNAANAALINFFETLRTELGNQVGITVVTPGWVESEMSRGKFLKEHGQVEV  230

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRD Q+ + PV     CAKA++ +A +GERYLT PAWF     W++F PEVVE    
Sbjct  231  DQEMRDAQIGLFPVEYAKNCAKAMVQAARQGERYLTVPAWFGAMYLWRLFAPEVVEACYR  290

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
            LLYM   G+   DA  + + +  G ++++YP ++  D+
Sbjct  291  LLYMHGHGARQADAPSRTMAE-AGGKQLLYPTSLRSDE  327



>ref|XP_003575023.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brachypodium 
distachyon]
Length=346

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 144/224 (64%), Gaps = 6/224 (3%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+     F+E  ++T+   +MD+NFWGSVY TH A PHL+ + G++++  S AG
Sbjct  129  HLVANAGVWATGCFDEATNITAFAKMMDVNFWGSVYPTHYALPHLKASKGKLIISCSGAG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +++PRMS YNA+KAA  +F+ETLR E G ++ +T++TPG++ESE+TQGK + K G L V
Sbjct  189  TVATPRMSFYNATKAAQLRFYETLRSEFGTEVGVTILTPGYVESEITQGKAIQKDGVLAV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + + RD QV I PVG+V+   +  L+S  +G+ YLT P+ ++         PEV+  I  
Sbjct  249  NEETRDAQVGIFPVGRVETFCEIALDSIQKGDWYLTWPSLYRPMELIACIAPEVLNCICY  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
             LY T  G     +L ++I + TG ++ +YP T++    G KT+
Sbjct  309  QLYNTRNGG---RSLAQRIAEATGVRQ-LYPSTLL--SPGIKTE  346



>ref|XP_002449530.1| hypothetical protein SORBIDRAFT_05g017960 [Sorghum bicolor]
 gb|EES08518.1| hypothetical protein SORBIDRAFT_05g017960 [Sorghum bicolor]
Length=356

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 141/217 (65%), Gaps = 5/217 (2%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ ++T+  +V+D+NFWG+VY T+ A P+L+ + G IVV +S AG
Sbjct  133  HLVANAGIWSSCFFEEITNITAFHNVIDLNFWGAVYPTYFALPYLKASRGNIVVTASVAG  192

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + + RMS YNASK A+ +F+ETLR ELG  +++T++ PG++ S LT+GK L K G + +
Sbjct  193  RVPTARMSFYNASKGAVIRFYETLRAELGSHVRVTILMPGYVVSNLTKGKGLQKDGHVGI  252

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD+ V  MPVGK ++ A+ ++ S  RG+ Y+T P W+          PE++++ + 
Sbjct  253  DEEARDINVGPMPVGKTESLAEVVVASVRRGDYYVTWPGWYWPFHMVMCAAPELLDWFSR  312

Query  543  LLYMTSPGSPPQD---ALGKKILDYTGCQKIIYPETI  644
              Y++  G   QD   AL KKIL+  G +K +YP TI
Sbjct  313  AFYVSKSGE--QDGGAALSKKILEAVGGKKFLYPSTI  347



>ref|XP_011023956.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
 ref|XP_011023957.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
Length=307

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 118/177 (67%), Gaps = 12/177 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FE+ + ++   ++ + NFWGSVY TH A PHLR++ GR   ISS AG
Sbjct  128  HLVNNAGVVQIDMFEDCKQISDFATLTNTNFWGSVYTTHFAIPHLRKSKGRFGGISSIAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRMS Y ASKAA++ F+ETLR E+G DI IT+VTPG ++SE+TQ   L+KA     
Sbjct  188  WFPVPRMSFYGASKAAITSFYETLRAEVGSDIGITIVTPGVVDSEMTQEDFLSKA-----  242

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
                   Q++ +P    + CAKAI++SACRG+R L EP+W ++    KV  PEV+E+
Sbjct  243  -------QIDFVPAESTERCAKAIVDSACRGDRCLIEPSWTRMLFLLKVLCPEVLEW  292



>gb|AGT17053.1| hypothetical protein SHCRBa_201_F17_F_10 [Saccharum hybrid cultivar 
R570]
Length=356

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 141/217 (65%), Gaps = 5/217 (2%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ ++T+  +V+D+NFWG+VY T+ A P+L+ + G IVV +S AG
Sbjct  133  HLVANAGIWSSCFFEEITNITAFHNVIDLNFWGAVYPTYFALPYLKASRGNIVVTASVAG  192

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + + RMS YNASK A+ +F+ETLR ELG  +++T++ PG++ S LT+GK L K G + +
Sbjct  193  RVPTARMSFYNASKGAVIRFYETLRAELGSHVRVTILMPGYVVSNLTKGKGLQKDGHVGI  252

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD+ V  MPVGK ++ A+ ++ S  RG+ Y+T P W+          PE++++ + 
Sbjct  253  DEEARDINVGPMPVGKTESLAEVVVASVRRGDYYVTWPGWYWPFHMVMCAAPELLDWFSR  312

Query  543  LLYMTSPGSPPQD---ALGKKILDYTGCQKIIYPETI  644
              Y++  G   QD   AL KKIL+  G +K +YP TI
Sbjct  313  AFYVSKSGE--QDGGAALSKKILEAVGGKKFLYPSTI  347



>ref|XP_008670737.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Zea 
mays]
 tpg|DAA41996.1| TPA: hypothetical protein ZEAMMB73_718382 [Zea mays]
Length=359

 Score =   184 bits (467),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 141/218 (65%), Gaps = 6/218 (3%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ ++T+  +V+D+NFWG+VY T+ A P+L+ + G IVV +S AG
Sbjct  134  HLVANAGIWSSCFFEEITNITAFHNVIDLNFWGAVYPTYFALPYLKASRGNIVVTASVAG  193

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + + RMS YNASK A+ +F+ETLR ELG  + +T++TPG++ S LT+GK L K G + +
Sbjct  194  RVPTARMSFYNASKGAVIRFYETLRAELGSHVHVTILTPGYVVSNLTKGKGLQKDGHVGI  253

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD+ V  MPVGK ++ A+ ++ S  R + Y+T P W+          PE+V++ + 
Sbjct  254  DEEARDINVGPMPVGKTESLAEVVVASVRRRDYYVTWPGWYWPFHMVMCAAPELVDWFSR  313

Query  543  LLYMTSPGSPPQD----ALGKKILDYTGCQKIIYPETI  644
              Y++  G   QD    AL KKIL+  G +K +YP+TI
Sbjct  314  TFYVSKSGD--QDGGGGALSKKILEAVGGKKFLYPQTI  349



>ref|XP_003577550.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brachypodium 
distachyon]
Length=354

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 133/214 (62%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ ++ +   V+D+NFWG+VY T+ A P+L+ + G IVV SS AG
Sbjct  133  HLVANAGVWSSCFFEEITNIAAFHDVIDLNFWGAVYPTYFALPYLKASRGNIVVTSSVAG  192

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + + RMS YNASK A+ +F+ETLR ELG  +++T++ PG++ S LT GK + K G +  
Sbjct  193  RVPTARMSFYNASKGAVIRFYETLRAELGSHVRVTILVPGYVVSNLTMGKGIQKDGNVGF  252

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD+ V  +PVGK +  AK ++ S  RG+ Y+T P W+          PE+V++ + 
Sbjct  253  DEEARDINVGPLPVGKTETLAKVVVASVRRGDSYVTWPGWYWPFHMVMCAAPELVDWFSR  312

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
              Y+T        AL KKIL   G +K +YP+TI
Sbjct  313  AFYVTKSSDKDGQALSKKILMAVGGKKFLYPKTI  346



>ref|XP_002452151.1| hypothetical protein SORBIDRAFT_04g020710 [Sorghum bicolor]
 gb|EES05127.1| hypothetical protein SORBIDRAFT_04g020710 [Sorghum bicolor]
Length=361

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/224 (41%), Positives = 143/224 (64%), Gaps = 5/224 (2%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+EV ++T    +MD+NFWGSVY T+ A PHL+ + G+++V SS+A 
Sbjct  129  HLVANAGVWSSCFFDEVTNITGFNKMMDVNFWGSVYPTYYALPHLKASKGKLIVSSSTAA  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
               + RM++YNASKAA  +F+ETLR ELG ++ +T++T GF+ESE+T+GK + K G + +
Sbjct  189  TAPTSRMTLYNASKAAQLRFYETLRSELGSEVGVTILTAGFVESEMTKGKAIQKDGNVAI  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RDVQ+ + PV +V+   K  L+   RG+ Y+T P+ ++         PEV+ + + 
Sbjct  249  DLEARDVQIGVFPVARVEKLCKVALDGIQRGDWYVTWPSLYRPIPLIACLAPEVLTWQSY  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGPKTD  674
             LY    G PP   L +++LD TG ++  YP ++ H   G KT+
Sbjct  309  ALYNARQGKPP---LSQRMLDATGAKR-FYPPSLRH-HPGIKTE  347



>ref|XP_008666705.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Zea 
mays]
 tpg|DAA50128.1| TPA: hypothetical protein ZEAMMB73_995594 [Zea mays]
Length=347

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/217 (39%), Positives = 149/217 (69%), Gaps = 5/217 (2%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+++ ++T+   +MD+NFWGSVY T+ A PHL+ + G+++V  S+AG
Sbjct  129  HLVANAGVWSSCAFDQITNITAFTKLMDVNFWGSVYPTYYALPHLKASKGKLIVCCSAAG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +++ RM+ YNASKAA  +F+ETLR E+G ++ IT++TPG++ESE+T+GK + K+G + V
Sbjct  189  TVATSRMAFYNASKAAQLRFYETLRTEVGSEVGITILTPGYVESEITKGKGMQKSGEVAV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD Q+ + PVG+V+A  +  L+    G+ Y+T P+ ++  +      PEV+++++ 
Sbjct  249  DEEARDAQIGVFPVGRVEALCEVALDGIRNGDWYVTWPSMYRPLQLIACLAPEVLDWMSD  308

Query  543  LLYM-TSPGSPPQDALGKKILDYTGCQKIIYPETIIH  650
             +Y  T+ G  P   LG++I++ TG ++ +YP +++ 
Sbjct  309  AMYKETTQGRRP---LGQRIMEATGAKR-LYPPSLLQ  341



>ref|XP_007038039.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein, putative 
[Theobroma cacao]
 gb|EOY22540.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein, putative 
[Theobroma cacao]
Length=407

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/189 (45%), Positives = 118/189 (62%), Gaps = 11/189 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HL +NA +    LFE+V  ++     M  NFWGS Y TH A PHLR++ G+I+VI+S AG
Sbjct  225  HLASNAAIVKLGLFEDVTQISEFAPTMSTNFWGSAYGTHFAVPHLRKSKGKIIVIASVAG  284

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   P+ S YNA KAA+  F+ETLR+E G DI IT+VTPG I++++ QG+          
Sbjct  285  WAPLPKTSFYNAGKAALISFYETLRVEFGSDIGITIVTPGLIKTDMVQGEAFTS------  338

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
                 +VQV  +P    + CAKAI+ SACRG+R LTEP+W++V    K+  PE++E+   
Sbjct  339  -----EVQVGFIPGESAEGCAKAIVASACRGDRCLTEPSWYRVGPLLKMLCPELLEWACR  393

Query  543  LLYMTSPGS  569
            L  +  PGS
Sbjct  394  LTLVGRPGS  402



>ref|XP_010270765.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Nelumbo nucifera]
Length=288

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 128/188 (68%), Gaps = 3/188 (2%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEE-VEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSA  179
            HLV NAG+ ++  FE+ +   ++ R  MD NFWG VY T+ A PHL+++ G+I+V +S A
Sbjct  96   HLVCNAGIASYCKFEDGLIGFSNFRIAMDTNFWGYVYPTYFAIPHLKKSKGKIIVNASVA  155

Query  180  GWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESEL-TQGKHLNKAGRL  356
             W  +P  S Y ASKAA+  FF+TLR+EL P+IKIT+  PGF ESE+   GK+L K G +
Sbjct  156  SWFITPYASSYGASKAALVNFFDTLRVELAPEIKITIAAPGFTESEMINNGKNLTKEGVV  215

Query  357  EVSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVE-Y  533
            E + +M +V V   P+ +V  CA+AI+N AC GERY+ EP+W+K+   ++ F PE+VE +
Sbjct  216  EDNPEMIEVLVGKFPIRRVGVCAEAIVNGACCGERYVIEPSWYKMFINFQFFCPEIVEWF  275

Query  534  INLLLYMT  557
            I L  Y+T
Sbjct  276  IVLWFYIT  283



>emb|CBI38150.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 120/189 (63%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T    FEE+ D+T    +MD+NFWG+VY T+ A PHLR+  G+I V SSS  
Sbjct  84   HLVNNAGVTGGYPFEEITDITKFALLMDVNFWGTVYPTYFAIPHLRKTKGKIFVNSSSCA  143

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            +L  PR+S Y+ASKAA+  FFE LRIEL P + IT+ T G I+SE+++GK L+K G L +
Sbjct  144  FLQPPRLSFYSASKAALIGFFEALRIELAPSVTITIATLGIIDSEMSRGKILSKDGELIL  203

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            S +         PV   +   K+I++S CRGERY+TEP W+      K   PE+VE+   
Sbjct  204  SPENSKGVFEGFPVMNTEPATKSIVDSICRGERYVTEPQWYGAIHLLKDLCPEMVEWYYS  263

Query  543  LLYMTSPGS  569
            ++Y     S
Sbjct  264  IMYFKKKSS  272



>emb|CDP19890.1| unnamed protein product [Coffea canephora]
Length=494

 Score =   185 bits (469),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 123/177 (69%), Gaps = 0/177 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            H+VNNAG+ +  L E+  D+T+L+ V D+NFWGSVY T+ A PHL+R+ G I+V +SSA 
Sbjct  124  HVVNNAGIVSMCLIEDAADITNLQPVTDVNFWGSVYPTYFAIPHLKRSKGSILVNASSAA  183

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             LS P +SIY+ASKAA+  F+ET+R+EL  +I IT+ T G +ESE+T+GKH+ K G  E 
Sbjct  184  VLSPPGLSIYSASKAALVSFYETIRVELASEISITIATLGPVESEITKGKHMTKHGTTEF  243

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
             +++  +  + +P      CAKAI++S CR ERY+T P W KV    K+  PE++E+
Sbjct  244  DSELVFIDADRLPAMSSPDCAKAIVDSVCRKERYVTVPKWCKVLLLLKILCPELIEW  300


 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 107/166 (64%), Gaps = 8/166 (5%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVM--------DINFWGSVYMTHLAAPHLRRNNGRI  158
            HLVNNAG+ +  L E+  D+T    VM        D+NFWGSV   + A P L+R  G I
Sbjct  328  HLVNNAGIGSICLIEDATDITKFEPVMFDIIQMVQDVNFWGSVCPIYFAMPSLKRTKGSI  387

Query  159  VVISSSAGWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHL  338
             V +S++  L+ P +SIY ASKAA+   +ET+R EL P+I IT  T G IE E+++GK+L
Sbjct  388  FVNASASSRLNPPGISIYAASKAALLSIYETMRAELAPEISITTATLGVIEPEMSKGKYL  447

Query  339  NKAGRLEVSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEP  476
            N+ G  +V++D  +  +N +PV    ACAK+I+++ CR ERY+TEP
Sbjct  448  NREGITQVNSDSANTFINQLPVMSASACAKSIVDAICRKERYVTEP  493



>ref|XP_010270764.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X1 [Nelumbo nucifera]
Length=321

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 128/188 (68%), Gaps = 3/188 (2%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEE-VEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSA  179
            HLV NAG+ ++  FE+ +   ++ R  MD NFWG VY T+ A PHL+++ G+I+V +S A
Sbjct  129  HLVCNAGIASYCKFEDGLIGFSNFRIAMDTNFWGYVYPTYFAIPHLKKSKGKIIVNASVA  188

Query  180  GWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESEL-TQGKHLNKAGRL  356
             W  +P  S Y ASKAA+  FF+TLR+EL P+IKIT+  PGF ESE+   GK+L K G +
Sbjct  189  SWFITPYASSYGASKAALVNFFDTLRVELAPEIKITIAAPGFTESEMINNGKNLTKEGVV  248

Query  357  EVSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVE-Y  533
            E + +M +V V   P+ +V  CA+AI+N AC GERY+ EP+W+K+   ++ F PE+VE +
Sbjct  249  EDNPEMIEVLVGKFPIRRVGVCAEAIVNGACCGERYVIEPSWYKMFINFQFFCPEIVEWF  308

Query  534  INLLLYMT  557
            I L  Y+T
Sbjct  309  IVLWFYIT  316



>gb|EMT12098.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=882

 Score =   188 bits (478),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 123/187 (66%), Gaps = 0/187 (0%)
 Frame = +3

Query  84   DINFWGSVYMTHLAAPHLRRNNGRIVVISSSAGWLSSPRMSIYNASKAAMSQFFETLRIE  263
            D+NFWG+V  T  A PHL+R  GRIVV +S+ GW   PRM  YNA+ AA+  FFETLR E
Sbjct  688  DVNFWGAVQSTFAALPHLKRTRGRIVVTASATGWNPVPRMVFYNAANAALINFFETLRSE  747

Query  264  LGPDIKITLVTPGFIESELTQGKHLNKAGRLEVSADMRDVQVNIMPVGKVDACAKAILNS  443
            LG ++ IT+VTPG+IESE+++GK L + G +EV  + RD Q+ + PV     CA+A++ +
Sbjct  748  LGSEVGITIVTPGWIESEMSKGKFLKEHGGVEVDQEYRDAQIGLFPVEYAKNCARAMVQA  807

Query  444  ACRGERYLTEPAWFKVTRWWKVFFPEVVEYINLLLYMTSPGSPPQDALGKKILDYTGCQK  623
            A +G+RYLT P+WF     W+VF PEVVE+   LLYM   G   Q     K +   G ++
Sbjct  808  ARQGDRYLTVPSWFGTMYLWRVFAPEVVEFCYRLLYMHGHGGGDQTDAPSKTMAQGGGKQ  867

Query  624  IIYPETI  644
            ++YP ++
Sbjct  868  MLYPSSL  874



>ref|XP_002266761.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B isoform X1 
[Vitis vinifera]
Length=326

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 120/189 (63%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T    FEE+ D+T    +MD+NFWG+VY T+ A PHLR+  G+I V SSS  
Sbjct  131  HLVNNAGVTGGYPFEEITDITKFALLMDVNFWGTVYPTYFAIPHLRKTKGKIFVNSSSCA  190

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            +L  PR+S Y+ASKAA+  FFE LRIEL P + IT+ T G I+SE+++GK L+K G L +
Sbjct  191  FLQPPRLSFYSASKAALIGFFEALRIELAPSVTITIATLGIIDSEMSRGKILSKDGELIL  250

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            S +         PV   +   K+I++S CRGERY+TEP W+      K   PE+VE+   
Sbjct  251  SPENSKGVFEGFPVMNTEPATKSIVDSICRGERYVTEPQWYGAIHLLKDLCPEMVEWYYS  310

Query  543  LLYMTSPGS  569
            ++Y     S
Sbjct  311  IMYFKKKSS  319



>ref|XP_006662954.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Oryza 
brachyantha]
Length=360

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 138/220 (63%), Gaps = 6/220 (3%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ ++T+ ++V+D+NFWG+VY T+ A P+L+ + G IVV SS AG
Sbjct  133  HLVANAGIWSSCFFEEITNITAFQNVIDLNFWGAVYPTYFALPYLKASRGNIVVTSSVAG  192

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + + RMS YNASK A+ +F+ETLR ELG  +++T++TPG++ S LT GK + K G + +
Sbjct  193  RVPTARMSFYNASKGAVIRFYETLRAELGSHVRVTILTPGYVVSNLTMGKGIQKDGHVGI  252

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
                RD+ V  +PVGK +  AK ++ +  RG+ Y+T P W+          PE+V++ + 
Sbjct  253  DEQARDINVGPLPVGKTEMLAKVVVAAVRRGDYYVTWPGWYWPFHMVMCAAPELVDWFSR  312

Query  543  LLYMTSPGSPPQD------ALGKKILDYTGCQKIIYPETI  644
              Y++              AL +KILD  G +K +YP+TI
Sbjct  313  AFYVSKSSDHGGSSGHGGAALSQKILDAVGGKKFLYPKTI  352



>gb|EMS50702.1| Dehydrogenase/reductase SDR family protein 7-like protein [Triticum 
urartu]
Length=361

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 134/218 (61%), Gaps = 1/218 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ +V++ ++VMD+NFWG+VY T+ A P+L+ + G IVV +S AG
Sbjct  143  HLVANAGVWSSCFFEEITNVSAFQNVMDLNFWGAVYPTYFALPYLKASRGNIVVTASVAG  202

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
                 RMS YNASKAA+ +F+ETLR ELGP +++T++ PG++ S LT GK + K G +  
Sbjct  203  RGPVARMSFYNASKAAVIRFYETLRAELGPHVRVTILMPGYVVSNLTMGKGVQKDGNVGF  262

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              D RD+ V  +PVG+ +  A+ ++ S  RG+ Y+T P W+          PE+V+  + 
Sbjct  263  DEDARDINVGPLPVGRTETLAEVVVASVRRGDSYVTWPGWYWPFHMVMCAAPELVDCFSR  322

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQ  656
              Y++       DAL KKIL   G  K  YP+ I   Q
Sbjct  323  AFYVSKSSDKDGDALSKKILMAVGGDK-FYPKNIRSSQ  359



>ref|XP_006653339.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Oryza 
brachyantha]
Length=354

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 129/214 (60%), Gaps = 0/214 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA +     FEEV DV   R +MDINFWG VY T  A PHL++ +GRIV ++S++ 
Sbjct  133  HLVNNAAIWQVGKFEEVTDVNHFRKLMDINFWGHVYPTRYAIPHLKKTHGRIVGVTSNSS  192

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            ++  PR + YNASKAA+  F++TLR+EL  D+ +T V PG +ESE+T+GK L K G + V
Sbjct  193  YIFIPRNTFYNASKAAVLNFYDTLRMELAGDVAVTEVVPGVVESEITKGKMLTKDGAMAV  252

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
                RD  +   P  +    A+A +  ACRG+R++ EP W++     +V  PE +E+   
Sbjct  253  DQAERDAILGTAPAERAGDFARAAVRGACRGQRHVFEPRWYRAAYLLRVCLPEALEWSAR  312

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
            LL +   G    D +G+ +L   G + +  P ++
Sbjct  313  LLAVRRVGPATTDTVGRWLLGLPGQRWLAQPASL  346



>tpg|DAA38136.1| TPA: hypothetical protein ZEAMMB73_559137 [Zea mays]
Length=275

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 128/205 (62%), Gaps = 17/205 (8%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNG-RIVVISSSA  179
            HLVNNAG+     FE+V DV +L+ V+ +NFWG+V+ TH A PHL+++ G ++ V SS+A
Sbjct  72   HLVNNAGVANVCWFEDVPDVAALKRVLAVNFWGAVHATHCALPHLKKSGGGKVFVNSSAA  131

Query  180  GWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLE  359
              L+ P MS+YNAS+AA+  FFETLR+EL  ++ IT+ T G+I SE+T GK L+K G +E
Sbjct  132  AALAMPGMSLYNASEAAVLNFFETLRVELRDEVGITIATSGWIVSEMTGGKQLSKEGTVE  191

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V+                  CA+A +++ CRG R+LT P W++    W+   PEVVE+  
Sbjct  192  VAVR----------------CAEATVDAICRGRRHLTVPLWYRALFLWRALAPEVVEFSQ  235

Query  540  LLLYMTSPGSPPQDALGKKILDYTG  614
             LL   + G     A GK++ + TG
Sbjct  236  RLLCRRTAGGRGHQAKGKRLQEVTG  260



>tpg|DAA38134.1| TPA: hypothetical protein ZEAMMB73_559137 [Zea mays]
 tpg|DAA38135.1| TPA: hypothetical protein ZEAMMB73_559137 [Zea mays]
Length=252

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 128/205 (62%), Gaps = 17/205 (8%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNG-RIVVISSSA  179
            HLVNNAG+     FE+V DV +L+ V+ +NFWG+V+ TH A PHL+++ G ++ V SS+A
Sbjct  49   HLVNNAGVANVCWFEDVPDVAALKRVLAVNFWGAVHATHCALPHLKKSGGGKVFVNSSAA  108

Query  180  GWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLE  359
              L+ P MS+YNAS+AA+  FFETLR+EL  ++ IT+ T G+I SE+T GK L+K G +E
Sbjct  109  AALAMPGMSLYNASEAAVLNFFETLRVELRDEVGITIATSGWIVSEMTGGKQLSKEGTVE  168

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V+                  CA+A +++ CRG R+LT P W++    W+   PEVVE+  
Sbjct  169  VAVR----------------CAEATVDAICRGRRHLTVPLWYRALFLWRALAPEVVEFSQ  212

Query  540  LLLYMTSPGSPPQDALGKKILDYTG  614
             LL   + G     A GK++ + TG
Sbjct  213  RLLCRRTAGGRGHQAKGKRLQEVTG  237



>ref|NP_001046935.1| Os02g0511400 [Oryza sativa Japonica Group]
 dbj|BAD23084.1| putative steroleosin [Oryza sativa Japonica Group]
 dbj|BAF08849.1| Os02g0511400 [Oryza sativa Japonica Group]
 dbj|BAG99655.1| unnamed protein product [Oryza sativa Japonica Group]
Length=395

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 141/214 (66%), Gaps = 3/214 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   F+EV ++T+   +MD+NFWGSVY T+ A PHL+ + G++VV  S+AG
Sbjct  129  HLVANAGIWSSCSFDEVTNITAFTKMMDVNFWGSVYPTYYALPHLKASKGKLVVSCSAAG  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             + + RMS YNA+KAA  +F+ETLR ELG ++ IT++TPG++ESE+T+GK +   G + V
Sbjct  189  TVGTSRMSFYNATKAAQLRFYETLRAELGSEVGITVLTPGYVESEITKGKGIQSGGDVAV  248

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
            + + RD Q+ + PVG+V    +  ++    G+ Y+T P+ F+  +      P V+++   
Sbjct  249  NEEARDEQIGVFPVGRVAELGEVAMDGIRAGDWYVTWPSLFRPLQLVACLAPGVLDWACR  308

Query  543  LLYMTSPGSPPQDALGKKILDYTGCQKIIYPETI  644
             LY T  G+ P   LGK+I++ TG ++ ++PE +
Sbjct  309  ALYGTRKGARPP--LGKRIMEATGMKR-LFPEAL  339



>ref|XP_009597072.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Nicotiana tomentosiformis]
Length=327

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 121/179 (68%), Gaps = 2/179 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+T+     +V D+T   SVMDINFWGSVY T+ A PHL++  G++ V SSS  
Sbjct  132  HLVNNAGITSLCSINDVTDITKFTSVMDINFWGSVYPTYFAIPHLKKTRGKVFVNSSSVA  191

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             L  P +S Y ASKAA+  F+ET+R+EL P+I IT+ T GF +SE+T+GKHL K G L+V
Sbjct  192  ILHPPSLSFYTASKAALIGFYETMRLELAPEISITIATLGFTDSEITRGKHL-KDGVLQV  250

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
             +++ +  V ++PV     CAK+I+++ CR +RY+TEP +F V  + K   P   E+ N
Sbjct  251  ESELAN-NVVVLPVISSSDCAKSIVSAICRKKRYITEPKYFWVLFFAKTVCPRAFEWFN  308



>emb|CDX91557.1| BnaC02g16030D [Brassica napus]
Length=286

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 111/153 (73%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE+++D++     MDINFWGSVY T  A+ +L+++ G+IVVI+S  G
Sbjct  134  HLVTNAGVAPLYLFEDIDDLSMAMPAMDINFWGSVYCTFFASSYLKKSRGKIVVIASGCG  193

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             ++SPR+S Y ASKAA+  F+ETLRIE G  + +T+V PG ++SE+TQGK + K G+  V
Sbjct  194  CIASPRLSFYCASKAAVIAFYETLRIEFGSKVGVTIVAPGVVDSEMTQGKFMTKNGQFIV  253

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGER  461
              ++RDV ++++PV   + CAKA+L S CRG+R
Sbjct  254  DKELRDVHISLLPVESAERCAKAVLRSVCRGDR  286



>emb|CAH66439.1| OSIGBa0132D06.5 [Oryza sativa Indica Group]
Length=355

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 122/201 (61%), Gaps = 1/201 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA +     FEE+ DV   R +MDINFWG VY T  A PHL++  GRIV ++S++ 
Sbjct  132  HLVNNASIWQVGKFEELTDVNHFRKLMDINFWGHVYPTRHAIPHLKKTRGRIVGVTSNSS  191

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPD-IKITLVTPGFIESELTQGKHLNKAGRLE  359
            ++  PR + YNASKAA +  +ETLR+EL  D I IT V PG +ESE+T+GK L K G + 
Sbjct  192  YIFMPRNTFYNASKAAAANLYETLRMELAGDGIAITEVIPGVVESEITKGKMLTKEGDMR  251

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V  D RD  +   PV +    A+A +   C GERY+ EP W++     +V FPE +E+  
Sbjct  252  VDQDERDAILGAAPVERAGEFARATVRGVCGGERYVFEPRWYRAAYTLRVCFPEALEWCA  311

Query  540  LLLYMTSPGSPPQDALGKKIL  602
             LL +   G    D +G+ +L
Sbjct  312  RLLTVWRLGPATTDTVGRWLL  332



>gb|EAZ23188.1| hypothetical protein OsJ_06873 [Oryza sativa Japonica Group]
Length=325

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 147/247 (60%), Gaps = 26/247 (11%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVM-----------------------DINFWGSVYM  113
            HLV NAG+ +   F+E+ ++T+  ++M                       D+NFWG+VY 
Sbjct  69   HLVANAGIWSTCPFDEITNITAFTTIMISCTGYFEACNNKSKGIVYMNFKDVNFWGAVYP  128

Query  114  THLAAPHLRRNNGRIVVISSSAGWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLV  293
            T+ A PHL+ + G++VV SS+AG +++ RMS YNASKAA+ +F+ETLR ELG ++ +T++
Sbjct  129  TYYALPHLKASRGKLVVCSSAAGTVATSRMSFYNASKAAVLRFYETLRAELGSEVGVTIL  188

Query  294  TPGFIESELTQGKHLNKAGRLEVSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTE  473
            T G++ESE+T GK + K G L V  + RDVQ+ + PVG V A  +  ++   RG+RY+T 
Sbjct  189  THGYVESEMTMGKAVQKDGVLVVDQEARDVQIGVFPVGGVGAMCRVAMDGIRRGDRYVTW  248

Query  474  PAWFKVTRWWKVFFPEVVEYINLLLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHD  653
            P+ ++  +      PE+V +++  +Y T  G      L K+ LD TG ++  +PE +  +
Sbjct  249  PSVYRPLQLVACLAPEIVSWLSYAMYNTKAGGGAP--LSKRALDATGARR-FFPEGLRRN  305

Query  654  QEGPKTD  674
                KTD
Sbjct  306  PVVIKTD  312



>ref|XP_010037388.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Eucalyptus 
grandis]
 gb|KCW49097.1| hypothetical protein EUGRSUZ_K02702 [Eucalyptus grandis]
Length=312

 Score =   174 bits (442),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 115/185 (62%), Gaps = 12/185 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    LFE++  ++    +MD+NFWG+VY T  A PHL+++ G+I VI+S AG
Sbjct  130  HLVNNAGIAKLGLFEDLSHISDYTRIMDVNFWGTVYGTSYAIPHLKKSKGKIAVIASCAG  189

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PR+  YNASKAA+  F+ETLR E+G  + IT+VTPG IESE+T  +H+ K+    +
Sbjct  190  WYPVPRLCFYNASKAAVISFYETLRTEIGDSVGITIVTPGVIESEMTMPRHIPKSKSRSI  249

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +              +  A+AI+ S CRG+ YLTEP W  V   WKV FP+V E+ N 
Sbjct  250  LLE------------STERAARAIVRSTCRGDMYLTEPFWMSVLYPWKVLFPQVTEWCNR  297

Query  543  LLYMT  557
             +  T
Sbjct  298  WICFT  302



>gb|EEC77184.1| hypothetical protein OsI_15677 [Oryza sativa Indica Group]
Length=355

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 122/201 (61%), Gaps = 1/201 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA +     FEE+ DV   R +MDINFWG VY T  A PHL++  GRIV ++S++ 
Sbjct  132  HLVNNASIWQVGKFEELTDVNHFRKLMDINFWGHVYPTRHAIPHLKKTRGRIVGVTSNSS  191

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPD-IKITLVTPGFIESELTQGKHLNKAGRLE  359
            ++  PR + YNASKAA +  +ETLR+EL  D I IT V PG +ESE+T+GK L K G + 
Sbjct  192  YIFMPRNTFYNASKAAAANLYETLRMELAGDGIAITEVIPGVVESEITKGKMLTKEGDMR  251

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V  D RD  +   PV +    A+A +   C GERY+ EP W++     +V FPE +E+  
Sbjct  252  VDQDERDAILGAAPVERAGEFARAAVRGVCGGERYVFEPRWYRAAYTLRVCFPEALEWCA  311

Query  540  LLLYMTSPGSPPQDALGKKIL  602
             LL +   G    D +G+ +L
Sbjct  312  RLLTVWRLGPATTDTVGRWLL  332



>ref|NP_001239786.1| uncharacterized protein LOC100808990 [Glycine max]
 gb|ACU21528.1| unknown [Glycine max]
 gb|KHN17485.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Glycine 
soja]
Length=323

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 125/190 (66%), Gaps = 13/190 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSL-FEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSA  179
            HLVNNAG++  S+  E+  DV+    +MDINFWG+VY T  A PHL+ N GRI+VI+S  
Sbjct  128  HLVNNAGISRKSVGVEDWLDVSEFTPIMDINFWGAVYGTLYAIPHLKINKGRIIVIASGC  187

Query  180  GWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLE  359
            GW   PR+SIYNASKAA+  FFETLR+ELG DI IT+ TPGF++++LT      +A   E
Sbjct  188  GWFPLPRISIYNASKAAVINFFETLRMELGWDIGITIATPGFVKTDLTL-----RAMEFE  242

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
             +       V  +P+G    CA AI++SACRG+ Y+T P+W KV   WK+  PE+V++  
Sbjct  243  PT-------VGRIPMGSACECAIAIVDSACRGDMYVTNPSWVKVLLPWKLLCPELVDWAC  295

Query  540  LLLYMTSPGS  569
             L++  S  S
Sbjct  296  CLVFGVSQNS  305



>ref|XP_008669501.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Zea 
mays]
Length=350

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 128/205 (62%), Gaps = 17/205 (8%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNG-RIVVISSSA  179
            HLVNNAG+     FE+V DV +L+ V+ +NFWG+V+ TH A PHL+++ G ++ V SS+A
Sbjct  147  HLVNNAGVANVCWFEDVPDVAALKRVLAVNFWGAVHATHCALPHLKKSGGGKVFVNSSAA  206

Query  180  GWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLE  359
              L+ P MS+YNAS+AA+  FFETLR+EL  ++ IT+ T G+I SE+T GK L+K G +E
Sbjct  207  AALAMPGMSLYNASEAAVLNFFETLRVELRDEVGITIATSGWIVSEMTGGKQLSKEGTVE  266

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V+                  CA+A +++ CRG R+LT P W++    W+   PEVVE+  
Sbjct  267  VAVR----------------CAEATVDAICRGRRHLTVPLWYRALFLWRALAPEVVEFSQ  310

Query  540  LLLYMTSPGSPPQDALGKKILDYTG  614
             LL   + G     A GK++ + TG
Sbjct  311  RLLCRRTAGGRGHQAKGKRLQEVTG  335



>gb|EAY86013.1| hypothetical protein OsI_07374 [Oryza sativa Indica Group]
Length=386

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 147/247 (60%), Gaps = 26/247 (11%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVM-----------------------DINFWGSVYM  113
            HLV NAG+ +   F+E+ ++T+  ++M                       D+NFWG+VY 
Sbjct  130  HLVANAGIWSTCPFDEITNITAFTTIMISCTGYFEACNNKSKGIVYMNFKDVNFWGAVYP  189

Query  114  THLAAPHLRRNNGRIVVISSSAGWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLV  293
            T+ A PHL+ + G++VV SS+AG +++ RMS YNASKAA+ +F+ETLR ELG ++ +T++
Sbjct  190  TYYALPHLKASRGKLVVCSSAAGTVATSRMSFYNASKAAVLRFYETLRAELGSEVGVTIL  249

Query  294  TPGFIESELTQGKHLNKAGRLEVSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTE  473
            T G++ESE+T GK + K G L V  + RDVQ+ + PVG V A  +  ++   RG+RY+T 
Sbjct  250  THGYVESEMTMGKAVQKDGVLVVDEEARDVQIGVFPVGSVSAMCRVAMDGIRRGDRYVTW  309

Query  474  PAWFKVTRWWKVFFPEVVEYINLLLYMTSPGSPPQDALGKKILDYTGCQKIIYPETIIHD  653
            P+ ++  +      PE+V +++  +Y T  G      L K+ LD TG ++  +PE +  +
Sbjct  310  PSMYRPLQLVACLAPEIVSWLSYAMYNTKAGGGAP--LSKRALDATGARR-FFPEGLRRN  366

Query  654  QEGPKTD  674
                KTD
Sbjct  367  PVVIKTD  373



>ref|NP_001052643.2| Os04g0390800 [Oryza sativa Japonica Group]
 dbj|BAF14557.2| Os04g0390800, partial [Oryza sativa Japonica Group]
Length=361

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 122/201 (61%), Gaps = 1/201 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNA +     FEE+ DV   R +MDINFWG VY T  A PHL++  GRIV ++S++ 
Sbjct  138  HLVNNASIWQVGKFEELTDVNHFRKLMDINFWGHVYPTRHAIPHLKKTRGRIVGVTSNSS  197

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPD-IKITLVTPGFIESELTQGKHLNKAGRLE  359
            ++  PR + YNASKAA +  +ETLR+EL  D I IT V PG +ESE+T+GK L K G + 
Sbjct  198  YIFMPRNTFYNASKAAAANLYETLRMELAGDGIAITEVIPGVVESEITKGKMLTKEGDMR  257

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
            V  D RD  +   PV +    A+A +   C GERY+ EP W++     +V FPE +E+  
Sbjct  258  VDQDERDAILGAAPVERAGEFARAAVRGVCGGERYVFEPRWYRAAYTLRVCFPEALEWCA  317

Query  540  LLLYMTSPGSPPQDALGKKIL  602
             LL +   G    D +G+ +L
Sbjct  318  RLLTVWRLGPATTDTVGRWLL  338



>ref|XP_007038041.1| Glucose 1-dehydrogenase, putative [Theobroma cacao]
 gb|EOY22542.1| Glucose 1-dehydrogenase, putative [Theobroma cacao]
Length=319

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 119/201 (59%), Gaps = 33/201 (16%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV +AG+    LFE+ +D+T     MDINFW S +                        
Sbjct  128  HLVTSAGVAPVCLFEDYDDITKASPAMDINFWASQW------------------------  163

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
                P+     ASKAA+  F+ETLRIE    I IT+VT G I++E+T+GK L++ G+L V
Sbjct  164  ----PK-----ASKAALISFYETLRIEFRTQIGITIVTLGLIKTEMTEGKFLSREGKLVV  214

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +MRDVQV++MP+   D CAKA+++SACRGE YLT P+W K T  WKVF PE++E+ N 
Sbjct  215  DREMRDVQVSLMPLESADKCAKAVVDSACRGENYLTLPSWTKATLLWKVFCPEIIEWWNR  274

Query  543  LLYMTSPGSPPQDALGKKILD  605
            LL MT PGS   D   KKI D
Sbjct  275  LLLMTGPGSSHGDVPSKKIFD  295



>ref|XP_009778659.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Nicotiana sylvestris]
Length=327

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 129/200 (65%), Gaps = 7/200 (4%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+++     +V D+T   SVMDINFWGSVY T+ A PHL++  G++ V SSS  
Sbjct  132  HLVNNAGISSVCSINDVTDITKYTSVMDINFWGSVYPTYFAIPHLKKTRGKVFVNSSSVA  191

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             L  P +S Y ASKAA+  F+ET+R+EL P+I IT+ T GF +SE+ +GKHL K G L+V
Sbjct  192  ILHPPSLSFYTASKAALIGFYETMRLELAPEISITIATLGFTDSEIIRGKHL-KDGVLQV  250

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVE--YI  536
             +++ +  V ++PV     CAK+I+++ CR +RY+TEP +F V  + K   P+  E  Y 
Sbjct  251  ESELAN-NVVVLPVISSSDCAKSIVSAICRKKRYITEPKYFWVLFFAKTACPQAFEWYYR  309

Query  537  NLLLYMTSPGSPPQDALGKK  596
              +L + + G   Q   GKK
Sbjct  310  TFMLKLCTGGLQSQ---GKK  326



>ref|XP_010656935.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Vitis 
vinifera]
Length=331

 Score =   172 bits (436),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 124/178 (70%), Gaps = 1/178 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ +    EE+ D+T+  S+MD+N+WGSVY T+ A PHLR+  G+IVV SS++ 
Sbjct  131  HLVNNAGIGSVCALEEITDITNSGSLMDVNYWGSVYPTYFAIPHLRKTKGKIVVNSSTSA  190

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +  P MS Y +SKAA+  FFE+LR EL P++ +++VT GF+ESE+T+GK ++  G + V
Sbjct  191  LVQPPSMSFYTSSKAAVIGFFESLRGELDPEVTVSIVTLGFVESEMTEGKLVSGNGEVIV  250

Query  363  SADM-RDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
            + ++ + +    +P  +    AK I+++ CRGERY+TEP W+++   +K   PEV+E+
Sbjct  251  APNLIKAISPTGLPKMRAGLAAKVIVDAICRGERYVTEPKWYRMLTLFKYLCPEVIEW  308



>emb|CBI38151.3| unnamed protein product [Vitis vinifera]
Length=370

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 124/178 (70%), Gaps = 1/178 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ +    EE+ D+T+  S+MD+N+WGSVY T+ A PHLR+  G+IVV SS++ 
Sbjct  170  HLVNNAGIGSVCALEEITDITNSGSLMDVNYWGSVYPTYFAIPHLRKTKGKIVVNSSTSA  229

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +  P MS Y +SKAA+  FFE+LR EL P++ +++VT GF+ESE+T+GK ++  G + V
Sbjct  230  LVQPPSMSFYTSSKAAVIGFFESLRGELDPEVTVSIVTLGFVESEMTEGKLVSGNGEVIV  289

Query  363  SADM-RDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
            + ++ + +    +P  +    AK I+++ CRGERY+TEP W+++   +K   PEV+E+
Sbjct  290  APNLIKAISPTGLPKMRAGLAAKVIVDAICRGERYVTEPKWYRMLTLFKYLCPEVIEW  347



>ref|XP_010536605.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X3 [Tarenaya hassleriana]
Length=305

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 114/177 (64%), Gaps = 12/177 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+  F  FE+   +T+    MD NFWGSV+ TH A PHL+R+ G+IVV++S++G
Sbjct  128  HLVNNAGIIEFRAFEDHSQLTNAVRQMDTNFWGSVFATHFAIPHLKRSKGKIVVMASASG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W S P++SIY A+KAAM  F+ETLRIELGP+I +T++ PGF ++E+   + L K G    
Sbjct  188  WFSYPKLSIYGATKAAMINFYETLRIELGPEIGVTIIGPGFTKTEMATPEILAKEGW---  244

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
                       MPV     CAK+I++  CR ER++T+P+W     W K   PE+ ++
Sbjct  245  ---------GFMPVLSATTCAKSIVDGVCRKERFVTKPSWIGSFFWVKTLCPELTDW  292



>ref|XP_010536604.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X2 [Tarenaya hassleriana]
Length=305

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 114/177 (64%), Gaps = 12/177 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+  F  FE+   +T+    MD NFWGSV+ TH A PHL+R+ G+IVV++S++G
Sbjct  128  HLVNNAGIIEFRAFEDHSQLTNAVRQMDTNFWGSVFATHFAIPHLKRSKGKIVVMASASG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W S P++SIY A+KAAM  F+ETLRIELGP+I +T++ PGF ++E+   + L K G    
Sbjct  188  WFSYPKLSIYGATKAAMINFYETLRIELGPEIGVTIIGPGFTKTEMATPEILAKEGW---  244

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
                       MPV     CAK+I++  CR ER++T+P+W     W K   PE+ ++
Sbjct  245  ---------GFMPVLSATTCAKSIVDGVCRKERFVTKPSWIGSFFWVKTLCPELTDW  292



>gb|KDP22588.1| hypothetical protein JCGZ_26419 [Jatropha curcas]
Length=302

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 117/178 (66%), Gaps = 12/178 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+   S+ E+  D +S   VMD+NFWGSV  + LA P+LR+N G+IVVI+S A 
Sbjct  121  HLVNNAGIAPRSMLEDCYDFSSFVPVMDVNFWGSVRCSQLAVPYLRKNRGKIVVIASIAP  180

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WLS+P++S YNASKAA+  F+ET+RIE G  I IT+V PG IESE+T    L++ G    
Sbjct  181  WLSTPKLSFYNASKAALISFYETMRIECGSHIGITIVIPGLIESEITTPDFLSEFG--AE  238

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYI  536
            SA +   QV          CAKAI+NSA RG+ YLT P+  KV    K F PE++E +
Sbjct  239  SAAVESTQV----------CAKAIVNSARRGDMYLTVPSGMKVMFLLKTFCPELLERL  286



>ref|XP_010536608.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Tarenaya 
hassleriana]
Length=307

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 122/194 (63%), Gaps = 15/194 (8%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRS-VMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSA  179
            HLVNNAG+    +FE+  +++   + VM+ NFWGSV+ TH A PHL+R NG+I V+SS A
Sbjct  128  HLVNNAGIVDLKMFEDYSNISEAAARVMNTNFWGSVHATHFAIPHLKRTNGKIAVVSSIA  187

Query  180  GWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLE  359
            GW S P +SIY ASKAAM  F+ETLRIE+GP+I IT+VTPG I++E+   + L       
Sbjct  188  GWSSPPYLSIYGASKAAMINFYETLRIEIGPEIGITIVTPGLIKTEIVNPELLGA-----  242

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
                MR +     P      CA+ I++  CR +R++TEP+WF V+ W K   P++++   
Sbjct  243  ----MRGLA--FFPAMSAGRCARGIVDGVCRRQRFVTEPSWFGVSFWVKTLCPDLMDM--  294

Query  540  LLLYMTSPGSPPQD  581
               ++ SP  P +D
Sbjct  295  FYRFILSP-RPKRD  307



>ref|XP_002983555.1| hypothetical protein SELMODRAFT_234271 [Selaginella moellendorffii]
 gb|EFJ15456.1| hypothetical protein SELMODRAFT_234271 [Selaginella moellendorffii]
Length=339

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 131/211 (62%), Gaps = 8/211 (4%)
 Frame = +3

Query  15   NAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAGWLSS  194
            +  + T S    +   +S R   D+NF G VY T+ A PHLR++ G+IVV +S+A WL  
Sbjct  125  DTQLITLSAIMVLRTASSSRKRKDVNFMGCVYTTYFALPHLRKSRGKIVVTASTASWLPI  184

Query  195  PRMSIYNASKAAMSQFFETLRIELGPDI-KITLVTPGFIESELTQGKHLNKAGRLEVSAD  371
            PRMS+YNASKAA+  FF+TLR E   DI  +T+  PG+I SE+T GK ++  G+  ++ D
Sbjct  185  PRMSMYNASKAAVVNFFDTLRTEERSDIGGMTIAMPGYIHSEMTMGKFMSAEGKQYMNVD  244

Query  372  MRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINLLLY  551
            +RD  V   PV     CAK I+++A RGERY+  PAW+KV+  ++VF P+++E    L +
Sbjct  245  IRDTLVGPSPVASTQYCAKQIVSAATRGERYVVVPAWYKVSPLFRVFVPQLLETFISLFF  304

Query  552  MT--SPGSPPQDALGKKILD-YTGCQKIIYP  635
            +    PG P    + K I+D +   ++++YP
Sbjct  305  VKELQPGKP----VTKVIMDSFPSVERVLYP  331



>ref|XP_002511144.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
 gb|EEF51746.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
Length=317

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 124/195 (64%), Gaps = 13/195 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ T S+  +   +   R VM+IN+WG+VY TH A PHL ++ G+I+V +S  G
Sbjct  128  HLVNNAGVGTDSITNDNVFIKP-RRVMEINYWGTVYSTHFAIPHLSKSKGKIMVTASGLG  186

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W  +P+   Y ASKAA+  ++E+LR E+G DI IT+VTPG I+++++     NK   L  
Sbjct  187  WFPTPKTGFYGASKAAVINYYESLRSEIGCDIGITIVTPGLIKTDMSDELEKNKGVNL--  244

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
                      I+P+   ++CAKA++NS CRG++YL EP+W ++   WKVF+PE+VE+ N 
Sbjct  245  ----------IVPLESKESCAKAMVNSVCRGDKYLVEPSWIRILFSWKVFYPEIVEFGNH  294

Query  543  LLYMTSPGSPPQDAL  587
                 + G+P +  +
Sbjct  295  WAIFRNRGTPKKSPI  309



>ref|XP_007160006.1| hypothetical protein PHAVU_002G285100g [Phaseolus vulgaris]
 gb|ESW32000.1| hypothetical protein PHAVU_002G285100g [Phaseolus vulgaris]
Length=320

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 116/178 (65%), Gaps = 13/178 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSL-FEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSA  179
            HLVNNAG+   S+  E +  V+   +VMD+NFWG+V  T  A PHL+ N GRI+VI+S +
Sbjct  128  HLVNNAGIGGKSVRVENLRHVSDCAAVMDVNFWGAVNATLYATPHLKINKGRIIVIASVS  187

Query  180  GWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLE  359
            GW   P +SIYNASKAA+  FFETLR+E+G  I IT+ TPG I + LT+   L+K     
Sbjct  188  GWFPMPLISIYNASKAAIISFFETLRMEVGCTIAITIATPGLINTHLTRALKLDK-----  242

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
                   V +  +P+G  + CAKAI+ SACRG+ Y+T P+W+KV   WK+  P+ V++
Sbjct  243  -------VALGKVPLGSANECAKAIVESACRGDMYVTYPSWYKVLFPWKLLHPQFVDW  293



>emb|CDX83014.1| BnaA01g20140D [Brassica napus]
Length=202

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 118/186 (63%), Gaps = 12/186 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HL+NNAG+T   +FE+   + +   +MDINFWGS Y+T+ A PHLR++ G+++VI+S A 
Sbjct  21   HLINNAGVTQTVVFEDYFHIQAANPIMDINFWGSTYITYFAIPHLRKSKGKVIVITSGAA  80

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             ++ P  S+Y+ASKAA+ +FFETLRIEL PDIKIT+V PG + +++T  + +   G   +
Sbjct  81   NIALPVASVYSASKAALLRFFETLRIELNPDIKITIVFPGVVATDMTTPRCIEHYGSDFI  140

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +         PV +   CAK I N  CRGE Y+ EP+W K     K   PE+VEY+  
Sbjct  141  FTE---------PVSR---CAKGIFNGICRGETYIEEPSWMKWIYVMKNVCPEIVEYVLN  188

Query  543  LLYMTS  560
             +Y+ S
Sbjct  189  YIYIRS  194



>gb|KEH21004.1| hydroxysteroid 11-beta-dehydrogenase-like protein [Medicago truncatula]
Length=324

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 114/178 (64%), Gaps = 13/178 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFS-LFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSA  179
            HLVNNAG++    L E++ D+T    +MD NFWG+V+ T  A PHL+ + GRI+V++S  
Sbjct  128  HLVNNAGVSGIPILIEDIHDLTKYNPIMDTNFWGAVHGTLYAIPHLKNSKGRIIVVASGC  187

Query  180  GWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLE  359
            GW   PR+SIYNASKAA   FFETLRIELG  I IT+VTPGFI++ +             
Sbjct  188  GWFPLPRLSIYNASKAATISFFETLRIELGWSIGITIVTPGFIKTNMA------------  235

Query  360  VSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
            + A   +  +  +P+G  + CAK I+ SACRG+ Y+T P+W K     K+ FPE+V++
Sbjct  236  LKAYEEEASLQWIPLGSANECAKDIVKSACRGDMYVTNPSWLKAVFPSKLLFPELVDW  293



>ref|XP_009150624.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Brassica 
rapa]
Length=309

 Score =   166 bits (420),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 118/186 (63%), Gaps = 12/186 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HL+NNAG+T   +FE+   + +   +MDINFWGS Y+T+ A PHLR++ G+++VISS A 
Sbjct  128  HLINNAGVTQTVVFEDYIHIQAANPIMDINFWGSTYITYFAIPHLRKSKGKVIVISSGAA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             ++ P  S+Y+ASKAA+ +FFETLRIEL PDIKIT+V PG + +++T  + +   G   +
Sbjct  188  NIALPVASVYSASKAALLRFFETLRIELNPDIKITIVFPGVVATDMTTPRCIEHYGSDFI  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              +         PV +   CAK I N  CRGE Y+ EP+W K     K   PE+VEY+  
Sbjct  248  FTE---------PVSR---CAKGIFNGICRGETYIEEPSWMKWIYVMKNVCPEIVEYVLN  295

Query  543  LLYMTS  560
             +Y+ S
Sbjct  296  YIYIRS  301



>ref|XP_010536603.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X1 [Tarenaya hassleriana]
Length=305

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 112/177 (63%), Gaps = 12/177 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     FE    +T+   +MD NFWG V+ TH A PHL+R+ G+I+V++S++G
Sbjct  128  HLVNNAGIADIRAFEVYSQLTNAVRLMDTNFWGPVFATHFAIPHLKRSKGKILVMASASG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W S P++SIY A+KAAM  F+ETLRIELGP+I +T++ PGF ++E+   + L K G    
Sbjct  188  WFSHPKLSIYGATKAAMINFYETLRIELGPEIGVTIIGPGFTKTEMATPEILAKEGW---  244

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
                       MPV     CAK+I++  CR ER++T+P+W     W K   PE+ ++
Sbjct  245  ---------GFMPVLSATTCAKSIVDGVCRKERFVTKPSWIGSFFWVKTLCPELTDW  292



>gb|KDO64428.1| hypothetical protein CISIN_1g044010mg [Citrus sinensis]
Length=248

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+++ +LFE++ ++T  + +M+INFWGSVY T  A PHLR   G+IVV+SS+A 
Sbjct  128  HLVNNAGISSVALFEDIVNITDFKQIMNINFWGSVYTTRFAVPHLRYTKGKIVVLSSAAS  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHL  338
            WL++PRMS YNASKAA+  FFETLR+ELG D+ +T+VTPGFIESELTQGK L
Sbjct  188  WLTAPRMSFYNASKAALVLFFETLRVELGSDVGVTIVTPGFIESELTQGKFL  239



>emb|CDX71662.1| BnaC09g27030D [Brassica napus]
Length=299

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 110/175 (63%), Gaps = 10/175 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     FE+   ++ +  +M+ NFWG VY TH A PHL++  G+IV ++S AG
Sbjct  128  HLVNNAGIAEAKFFEDYLQISDVLPIMNTNFWGPVYTTHFAIPHLKKTKGKIVAVASPAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRMSIY ASKAAM  F+ETLRIELGP+I +T+V PG +E+E T    L        
Sbjct  188  WSGVPRMSIYAASKAAMINFYETLRIELGPEIGVTIVFPGLVENENTNPDLL--------  239

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVV  527
             A+ +D    ++ +     CAKA++N  CRG+ +L EP+W +V  W  +  PE++
Sbjct  240  -AEKQDWS-QVVAIESATECAKAVVNGICRGKTFLAEPSWVRVLFWLSILCPELL  292



>ref|XP_002322680.1| hypothetical protein POPTR_0016s04930g [Populus trichocarpa]
 gb|EEF04441.1| hypothetical protein POPTR_0016s04930g [Populus trichocarpa]
Length=311

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 117/187 (63%), Gaps = 13/187 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG++  + FE+  +V+ L  +MD+NFWGS + +  A PHL+R+ G+IVVISS A 
Sbjct  129  HLVNNAGISQAAYFEDCTEVSDLTHIMDVNFWGSTFCSRFAIPHLKRSKGKIVVISSIAP  188

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W  +P++S+YNASKAA+  F+ TLR+E+G  I IT+V PG I++E+T    L K      
Sbjct  189  WSLTPKLSVYNASKAALISFYGTLRLEIGSHIGITIVMPGLIDTEMTSPSSLAK------  242

Query  363  SADMRDVQVNIMPVGK-VDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYIN  539
                    V   P  +  + CAKAI+ S CRG+RYLTEP+W+     +K   PE ++ I 
Sbjct  243  ------YSVKYCPPNEPANQCAKAIVKSTCRGDRYLTEPSWWNALFMFKSLCPEALDLIL  296

Query  540  LLLYMTS  560
               +M +
Sbjct  297  CWAFMVN  303



>ref|XP_006360917.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
tuberosum]
Length=348

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+ +     +V D+T   S+MDINFWGSVY T++  PHL++  G++ V SSS  
Sbjct  131  HLVNNAGIISLCSINDVTDITMFTSLMDINFWGSVYPTYVTIPHLKKTRGKVFVNSSSGA  190

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
                P +S Y ASKAA+  F+ET+R+EL P+I IT+ T G+ +SE+  GKHL K G +++
Sbjct  191  IFHPPSISFYTASKAALISFYETMRVELAPEISITIATLGYTDSEILGGKHL-KDGVMQI  249

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYI  536
            ++ +      ++PV     CAK+I+++ CR ERY+TEP +  V  + K   P+  E+I
Sbjct  250  NSQLFS-DATVLPVISCSDCAKSIISAICRKERYITEPKYISVLFFVKSVCPQAFEWI  306



>ref|XP_009124895.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Brassica 
rapa]
Length=299

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 110/175 (63%), Gaps = 10/175 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     FE+   ++ +  +M+ NFWG VY TH A PHL+++ G+IV ++S AG
Sbjct  128  HLVNNAGIAEAKFFEDYLQISDVLPIMNTNFWGPVYTTHFAIPHLKKSKGKIVAVASPAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRMSIY ASKAAM  F+ETLRIELGP+I +T+V PG +E+  T    L        
Sbjct  188  WSGVPRMSIYAASKAAMINFYETLRIELGPEIGVTIVFPGLVENGNTNPDLL--------  239

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVV  527
             A+ +D    ++ +     CAKA++N  CRG+ +L EP+W +V  W  +  PE++
Sbjct  240  -AEKQDWS-QVVAIESATECAKAVVNGICRGKTFLAEPSWVRVLFWLSILCPELL  292



>ref|XP_007038040.1| Hydroxysteroid dehydrogenase 2, putative [Theobroma cacao]
 gb|EOY22541.1| Hydroxysteroid dehydrogenase 2, putative [Theobroma cacao]
Length=434

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 106/162 (65%), Gaps = 12/162 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     F+   +++    VMDINFWGSVY TH A PHLR+  G+++V+SS++ 
Sbjct  127  HLVNNAGVGAVQSFKVTNNISDFVPVMDINFWGSVYGTHFAVPHLRKRRGKMIVMSSASA  186

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  P+ S Y ASKAA   F+E+LRIE+GP+I IT+VTPGF+ESE+T+     K G+L+ 
Sbjct  187  WLGLPKTSFYAASKAAQIGFYESLRIEVGPEIGITIVTPGFVESEMTRSNQQRK-GKLQF  245

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFK  488
              +              D CAKAI+ S CRG+ YLTEP W +
Sbjct  246  LGNE-----------PADVCAKAIVESTCRGDMYLTEPFWVR  276



>ref|XP_006436880.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
 gb|ESR50120.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
Length=282

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+    LFE+  D+T     MDINFWGS Y T+ A P+L++  G+I+V++S+AG
Sbjct  128  HLVTNAGVVPMCLFEDYTDITKPAPAMDINFWGSAYGTYFAIPYLKQTKGKIIVVASAAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS YNASKAA    +ETLRIE G DI IT+VTPG IESE+T GK LNK G+LEV
Sbjct  188  WLPPPRMSFYNASKAAKIALYETLRIEFGGDIGITIVTPGLIESEITGGKFLNKNGKLEV  247

Query  363  SADMRDVQV  389
              ++RDV +
Sbjct  248  DQEIRDVSL  256



>ref|XP_010086990.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Morus notabilis]
 gb|EXB25269.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Morus notabilis]
Length=521

 Score =   166 bits (419),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 110/180 (61%), Gaps = 21/180 (12%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG   FS FE+   ++    VMDINFWG+V   H A PHL+++ G+IVVISS  G
Sbjct  128  HLVNNAGTARFSKFEDTSQISDHHPVMDINFWGTVNGIHYAIPHLKKSKGKIVVISSVCG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   P +SIYNASKAA+  F ETLR ELGP I IT+V PG I++ LT+ +          
Sbjct  188  WYPLPTLSIYNASKAALISFCETLRTELGPSIGITIVKPGLIKTNLTKSQ----------  237

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWW---KVFFPEVVEY  533
                 D  + ++P    + CAKAI++ ACRG+ Y+TEPAW    RW    K+  PE + Y
Sbjct  238  -----DTLIPVIPEESAEVCAKAIVSGACRGDLYVTEPAWI---RWLFPVKMACPEQLAY  289


 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 95/185 (51%), Gaps = 50/185 (27%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG      FE++  ++  R VMD NFWG+V   H A PHL+++ G+IVVISS  G
Sbjct  352  HLVNNAGTARVIKFEDINQLSDHRHVMDTNFWGTVNGIHFAIPHLKKSGGKIVVISSVCG  411

Query  183  WLSSPRMSIYN-----------------------------------ASKAAMSQFFETLR  257
            W   P +SIYN                                   ASKAA+  F ETLR
Sbjct  412  WYPLPALSIYNVRTKNITNGRIYMSTSNSYFESSNKPPSSNCFFYKASKAALISFCETLR  471

Query  258  IELGPDIKITLVTPGFIESELTQGKHLNKAGRLEVSADMRDVQVNIMPVGKVDACAKAIL  437
             ELG  I IT+ TPG I++ +T+ +++ ++               ++P G  + CAKAI+
Sbjct  472  TELGSAIGITIFTPGLIKTTMTKKQNIFRS---------------LVPEGSAEGCAKAIV  516

Query  438  NSACR  452
            ++ACR
Sbjct  517  SAACR  521



>ref|XP_010431074.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 2 [Camelina 
sativa]
Length=245

 Score =   159 bits (402),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 114/184 (62%), Gaps = 12/184 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HL+NNAG+    LFE    +     +MDINFWGS Y+T+ A PHLR++ G+IVVI+S++ 
Sbjct  64   HLINNAGIPQAVLFEHFTQIQDANHIMDINFWGSTYITYFAIPHLRKSKGKIVVITSASA  123

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +  P  S+Y+ASKAA+ +FFETLR+E+ PDIKIT+V PG+I +++T  + + K G   +
Sbjct  124  NIPLPSSSVYSASKAALLKFFETLRVEISPDIKITIVMPGYISTDMTTPRFIEKLGSDFI  183

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
             ++             V  CAKAI     RGE Y+ EP+W K     +   PE+V+Y+  
Sbjct  184  LSE------------SVSKCAKAIFKGIGRGETYIAEPSWIKWILLTQNVCPEIVDYVVN  231

Query  543  LLYM  554
             L++
Sbjct  232  YLFV  235



>ref|XP_011033248.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
Length=310

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 113/178 (63%), Gaps = 11/178 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG++    FE+  +V+ L  +MD+NFWGS + +  A PHL+R+ G+IVVISS A 
Sbjct  128  HLVNNAGISQAEYFEDCTEVSDLTHIMDVNFWGSAFCSRFAIPHLKRSKGKIVVISSVAP  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W  +P++S+YNASKAA+  F++TLR+E+G  I IT+V PG I++E+T    L K   L+ 
Sbjct  188  WSRTPKLSVYNASKAALISFYDTLRVEIGSHIGITIVMPGLIDTEMTSPSSLAKYS-LKF  246

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYI  536
                        P    + CA+AI+ S CRG+RYLTEP+W+      K   PE ++ +
Sbjct  247  CP----------PNESANQCAQAIVKSTCRGDRYLTEPSWWNALFIVKSLCPEALDLL  294



>ref|XP_006404393.1| hypothetical protein EUTSA_v10010570mg [Eutrema salsugineum]
 gb|ESQ45846.1| hypothetical protein EUTSA_v10010570mg [Eutrema salsugineum]
Length=309

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 109/177 (62%), Gaps = 12/177 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HL+NNAG+    LFE++  +     +MDINFWGS Y+T+ A PHLR++ G+I+VISS + 
Sbjct  128  HLINNAGVFQTVLFEDITQIKDTNPIMDINFWGSTYITYFAIPHLRKSKGKIIVISSGSA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +  P  SIY+ASKAA+ +FFETLR+EL PDIKIT+V PG I +++T  + + K G   +
Sbjct  188  NMPLPLASIYSASKAALLRFFETLRVELSPDIKITIVLPGLIATDMTTPRFIEKYGSDFI  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
             ++             V  CAKAI     RGE Y+ EP+W K     K   PE+ +Y
Sbjct  248  MSE------------SVSTCAKAIFRGIGRGETYIEEPSWMKWIFLMKTICPEIFDY  292



>ref|XP_010555563.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Tarenaya 
hassleriana]
Length=306

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 105/176 (60%), Gaps = 12/176 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     FE    ++    VM+INFWGSVY THL+ PHL+R+ G+I+ +SS +G
Sbjct  128  HLVNNAGIGEVKAFESYSRISEAARVMEINFWGSVYTTHLSVPHLKRSKGKIIAVSSVSG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WLS P M  Y A+KAAM  F+E LRIELG +I IT+ TPG I++++     L   G    
Sbjct  188  WLSQPYMGFYGAAKAAMINFYEALRIELGHEIGITVATPGLIQTDMVTPDVLATEG----  243

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVE  530
                       +P+     CAK I++  CR +R +T P+WF V  W K   PE++E
Sbjct  244  --------WEWVPMLSATGCAKGIVDGVCRRDRNVTVPSWFNVLFWLKTLVPELME  291



>ref|XP_009333966.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Pyrus 
x bretschneideri]
Length=359

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 135/230 (59%), Gaps = 14/230 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVN   +     FEEV D +    ++DINFWG+VY T++A P+LRR NG+I+V +S   
Sbjct  128  HLVNTVSLGHTFYFEEVTDTSVFPHLLDINFWGNVYPTYVALPYLRRTNGKIIVNASVES  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS+Y A+KAA+  F+ETLR+E+  ++ IT+ T G+IESE+T+GK + + G    
Sbjct  188  WLPLPRMSLYAAAKAALVNFYETLRLEVNHEVGITIATHGWIESEMTRGKFMLEEGAEMQ  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + R+V V     G V+  A+ I+  ACRG+ Y+  P+W+ +   +++F P  + +   
Sbjct  248  WKEEREVHV---IGGPVEDFARLIVAGACRGDSYVKYPSWYDIFLLYRLFVPNTLHWTFR  304

Query  543  LLY---------MTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGP  665
            L+          +   G P  +  G+ +L+ T  ++ + P TI   Q+GP
Sbjct  305  LILPTHGGRRTSLVGTGRPISEGYGRPLLEGTPPRRFVGPNTI--SQQGP  352



>ref|XP_010536607.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Tarenaya 
hassleriana]
Length=305

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 112/187 (60%), Gaps = 12/187 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG++    FE+   +T    VM+INFWGSVY+TH A P+L+R+ G+I+ ISS + 
Sbjct  128  HLVNNAGISELKAFEDYSCITDASRVMNINFWGSVYVTHFAVPYLKRSRGKIIAISSVSV  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WLS P +S Y A+KAAM  F+E LR+ELG +I +T+V PG I++++   + +   G    
Sbjct  188  WLSPPYLSFYVAAKAAMINFYEALRVELGREITVTVVNPGLIQTDMVTPEMVAAEG----  243

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
                       +P+    +CA+ I+   CR ER++TEP W+ V+ W     PE+ E+   
Sbjct  244  --------WAWLPLTSARSCARGIVEGVCRRERFVTEPKWYAVSFWLMALCPELTEWYGR  295

Query  543  LLYMTSP  563
            L    SP
Sbjct  296  LNMNPSP  302



>ref|XP_010525337.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Tarenaya 
hassleriana]
Length=307

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 109/180 (61%), Gaps = 10/180 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG     +FEE  +++   S+M+ NFWG VY TH A PHL+++ G+IV ++S AG
Sbjct  128  HLVNNAGTVEAKMFEEYSNISDAHSLMNTNFWGPVYATHFAVPHLKKSKGKIVAVASPAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   P+MSIY A+KAAM  F+ETLR+EL PDI IT V PG +E+ +T           E+
Sbjct  188  WSGVPKMSIYAATKAAMINFYETLRMELHPDITITTVFPGLVENGVTDP---------EL  238

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
             A+ R     ++P      CA+A+++  C G+  + EP+W  V  W     PE++E+  L
Sbjct  239  IAEARGRH-GLVPKQSATECARAVVDGICSGKTSVAEPSWIGVLFWLSTMCPELMEWAQL  297



>gb|EMT06462.1| hypothetical protein F775_52091 [Aegilops tauschii]
Length=422

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 119/189 (63%), Gaps = 0/189 (0%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLV NAG+ +   FEE+ +V++ ++VMD+NFWG+VY T+ A P+L+ + G IVV +S AG
Sbjct  133  HLVANAGVWSSCFFEEITNVSAFQNVMDLNFWGAVYPTYFALPYLKASRGNIVVTASVAG  192

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +   RMS YNASKAA+ +F+ETLR E+GP +++T++ PG++ S LT GK + K G +  
Sbjct  193  RVPVARMSFYNASKAAVIRFYETLRAEVGPHVRVTILMPGYVVSNLTMGKGVQKDGNVGF  252

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + RD+ V  +PVGK +  A+    S  RG+ Y+T P W+          PE+V+  + 
Sbjct  253  DEEARDINVGPLPVGKTETLAEVGGGSVRRGDHYVTWPGWYWPFHMVMCAAPELVDCFSR  312

Query  543  LLYMTSPGS  569
                 SP +
Sbjct  313  AFTSPSPAT  321



>ref|XP_010426176.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Camelina 
sativa]
Length=309

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 113/185 (61%), Gaps = 12/185 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HL+NNAG+    LFE+   +    S+MDINFWG+ Y+T+ A PHLR++ G+I+VI+S + 
Sbjct  128  HLINNAGVFQTVLFEDFTQIQDANSIMDINFWGTTYITYFAIPHLRKSKGKIIVIASGSA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +  P  SIY+ASKAA+ +FFETLRIEL PDIKIT+V PG + +++T    L K G    
Sbjct  188  NIPLPLASIYSASKAALLRFFETLRIELSPDIKITIVLPGVVSTDMTTPHCLEKYGS---  244

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
                     + +    V  CAK+I     RGE Y+ EP+W K     K   PE+V+Y+  
Sbjct  245  ---------DFLLSESVSRCAKSIFRGIGRGETYIEEPSWMKWVFVMKNVCPEIVDYLLN  295

Query  543  LLYMT  557
             L+++
Sbjct  296  YLFVS  300



>gb|EPS67142.1| hypothetical protein M569_07637, partial [Genlisea aurea]
Length=294

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+  F       ++T    VMD NFWGSVY T+ A PHL++  G+IVV SS A 
Sbjct  110  HLVNNAGIFNFYSVNWGVEITKFSPVMDTNFWGSVYPTYFAMPHLKKTRGKIVVNSSVAA  169

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +  P ++ Y ASKAA+  F+E LR E+ P++ IT+ T GF+ESE++ GK ++K G++  
Sbjct  170  TVHIPTLAFYCASKAALWSFYEALRAEVEPEVGITIATLGFVESEMSDGKVMSKEGKM--  227

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYI  536
            +  +R  QV    +   +ACA+AI+  ACRG R +TEP WFKV       FP++++++
Sbjct  228  NDGVRIPQVVRETIMGTEACARAIVGGACRGRRRVTEPQWFKVLAMANYLFPDILQWV  285



>gb|KFK22923.1| hypothetical protein AALP_AAs48765U000200 [Arabis alpina]
Length=299

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 110/175 (63%), Gaps = 10/175 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FE+   ++ +  VM+ NFWG VY TH A P+L+R  G+I+ ++S AG
Sbjct  128  HLVNNAGVAEAKIFEDYLQISDILPVMNTNFWGPVYATHFAIPYLKRAKGKIIAVASPAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   P+MSIY ASKAAM  F+ETL +ELGP+I +T+V PG IE+  T           ++
Sbjct  188  WSGVPKMSIYAASKAAMINFYETLSVELGPEIGVTVVFPGLIENGNTSP---------DL  238

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVV  527
             A+ R     ++ +   ++CAKAI+N  CRG+ ++ EP+W +V  W     PE++
Sbjct  239  IAEKRKWS-QVVAIESAESCAKAIVNGVCRGKTFVVEPSWVRVLLWLSALCPELL  292



>ref|XP_006402076.1| hypothetical protein EUTSA_v10014225mg [Eutrema salsugineum]
 gb|ESQ43529.1| hypothetical protein EUTSA_v10014225mg [Eutrema salsugineum]
Length=299

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 107/175 (61%), Gaps = 10/175 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FE+   ++ +  +M+ NFWG VY TH A PHL++  G+IV ++S AG
Sbjct  128  HLVNNAGIAEAKIFEDYSQISDVLPIMNTNFWGPVYATHFAIPHLKKTKGKIVAVASPAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRMSIY ASKAAM  F+ETLRIEL P+I +T+V PG IE+  T    L  A + E 
Sbjct  188  WAGVPRMSIYAASKAAMINFYETLRIELRPEIGVTIVFPGLIENGNTDPDLL--AEKQEW  245

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVV  527
            S         ++ +     CAKA++   CRG+ ++ EP+W +V  W     PE++
Sbjct  246  S--------QVVAIESATECAKAVVYGICRGKTFVAEPSWVRVLFWLSTLCPELL  292



>ref|NP_199871.1| hydroxysteroid dehydrogenase 4 [Arabidopsis thaliana]
 ref|NP_680417.1| hydroxysteroid dehydrogenase 7 [Arabidopsis thaliana]
 sp|P0DKC7.1|HSD4A_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase-like 4A; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase-like 4A; AltName: 
Full=Hydroxysteroid dehydrogenase 4; Short=AtHSD4 [Arabidopsis 
thaliana]
 sp|Q9LUF2.2|HSD4B_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase-like 4B; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase-like 4B; AltName: 
Full=Hydroxysteroid dehydrogenase 7; Short=AtHSD7 [Arabidopsis 
thaliana]
 dbj|BAB09144.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AAY78859.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
thaliana]
 gb|ABG48422.1| At5g50590 [Arabidopsis thaliana]
 gb|AED95966.1| hydroxysteroid dehydrogenase 4 [Arabidopsis thaliana]
 gb|AED95980.1| hydroxysteroid dehydrogenase 7 [Arabidopsis thaliana]
Length=299

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 108/175 (62%), Gaps = 10/175 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     FE+  +++ +  +++ NFWG VY TH A PHL++  G+I+ ++S AG
Sbjct  128  HLVNNAGIAEAKFFEDYSEISDVLPIVNTNFWGPVYATHFAIPHLKKTKGKIIAVASPAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRMSIY ASKAAM  F+ETLRIEL P++ +T+V PG IE+  T    L        
Sbjct  188  WSGVPRMSIYAASKAAMINFYETLRIELHPEVGVTIVFPGLIENGNTNPDLL--------  239

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVV  527
             A+ +D    ++ +     CAKA++N  CRG+ ++ EP+W +V  W     PE++
Sbjct  240  -AEKQDWS-QVVTIESAAECAKAVVNGICRGKTFVAEPSWVRVLFWLSAICPELL  292



>ref|XP_007222177.1| hypothetical protein PRUPE_ppa007781mg [Prunus persica]
 gb|EMJ23376.1| hypothetical protein PRUPE_ppa007781mg [Prunus persica]
Length=356

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 128/217 (59%), Gaps = 12/217 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVN   +     FEEV D T    ++DINFWG+VY T++A PHLR+ NG+I+V +S   
Sbjct  128  HLVNTVSLGHTFYFEEVTDTTVFPHLLDINFWGNVYPTYVALPHLRQTNGKIIVNASVES  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS+Y A+KAA+  F+ETLR+E+  ++ IT+ T G+I SELT+GK + + G    
Sbjct  188  WLPLPRMSLYAAAKAALVNFYETLRLEVDHEVGITIATHGWIGSELTRGKFMVEEGAEMQ  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + R+V V     G VD  A+ I+  ACRG+ Y+  P+W+ +   ++VF P+V+ +   
Sbjct  248  WKEEREVHVT---GGPVDDFARLIVAGACRGDAYVKYPSWYDIFLLYRVFAPKVLNWTFR  304

Query  543  LLY---------MTSPGSPPQDALGKKILDYTGCQKI  626
            L+          +   G P  +  G+ + + T  +K+
Sbjct  305  LILPTHGGRRTSLVGTGRPISEGYGRPLFEGTPPRKL  341



>ref|XP_006291536.1| hypothetical protein CARUB_v10017691mg [Capsella rubella]
 gb|EOA24434.1| hypothetical protein CARUB_v10017691mg [Capsella rubella]
Length=309

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 109/178 (61%), Gaps = 12/178 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HL+NNAG+    +FE+   +     +MDINFWGS Y+++ A PHLR++ G+IVVISS+  
Sbjct  128  HLINNAGVPQAIIFEDFTQIQDANHIMDINFWGSTYISYFAIPHLRKSKGKIVVISSATA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +  P  SIY+ASKAA+ +F+ETLR+E+ PDI+IT+  PGF+ ++LT    +   G   +
Sbjct  188  NIPLPLASIYSASKAALLKFYETLRVEISPDIRITIAIPGFVSTDLTTPHFIKMYGSDFI  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYI  536
             ++             V  CAKAI     RGERY+ EP+W K     +   PE+++Y+
Sbjct  248  LSE------------SVSKCAKAIFRGIGRGERYIIEPSWIKWIFLMQYVCPEIIDYV  293



>ref|XP_009150234.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Brassica 
rapa]
Length=310

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 108/177 (61%), Gaps = 12/177 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HL+NNAG+    LFE++  V     +MDINFWG+ Y+T+ A PHLR++NG+I+V +S++ 
Sbjct  128  HLINNAGVFQTVLFEDLTQVQDANHIMDINFWGTTYITYFAIPHLRKSNGKIIVNTSNSA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +  P  S+Y+ASKAA+ +FFETLR+EL PDIKI ++ PGFI + +T    + K G   +
Sbjct  188  NIPLPLSSVYSASKAALLRFFETLRVELSPDIKIIIILPGFIATNMTSPHFIEKYGSDFI  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
             ++             V  CAKAI     RGE Y+ EP+W K     K   PE VEY
Sbjct  248  LSE------------SVKKCAKAIFRGIARGETYIEEPSWTKWIVLVKNLCPEFVEY  292



>emb|CDY21787.1| BnaA06g20560D [Brassica napus]
Length=310

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 108/177 (61%), Gaps = 12/177 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HL+NNAG+    LFE++  V     +MDINFWG+ Y+T+ A PHLR++NG+I+V +S++ 
Sbjct  128  HLINNAGVFQTVLFEDLTQVQDANHIMDINFWGTTYITYFAIPHLRKSNGKIIVNTSNSA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +  P  S+Y+ASKAA+ +FFETLR+EL PDIKI ++ PGFI + +T    + K G   +
Sbjct  188  NIPLPLSSVYSASKAALLRFFETLRVELSPDIKIIIILPGFIATNMTSPHFIEKYGSDFI  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEY  533
             ++             V  CAKAI     RGE Y+ EP+W K     K   PE VEY
Sbjct  248  LSE------------SVKKCAKAIFRGIARGETYIEEPSWTKWMVLVKNLCPEFVEY  292



>ref|XP_008347866.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Malus 
domestica]
Length=279

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/230 (36%), Positives = 134/230 (58%), Gaps = 14/230 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVN   +     FEEV D +    ++DINFWG+VY T++A P+LRR NG+I+V +S   
Sbjct  48   HLVNTVSLGHTFYFEEVTDTSVFPLLLDINFWGNVYPTYVALPYLRRTNGKIIVNASVES  107

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS+Y A+KAA+  F+ETLR+E+  ++ IT+ T G+I SE+T+GK + + G    
Sbjct  108  WLPLPRMSLYAAAKAALVNFYETLRLEVNHEVGITIATHGWIGSEMTRGKFMLEEGAEMQ  167

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + R+V V     G V+  A+ I+  AC+G+ Y+  P+W+ +   ++VF P ++ +   
Sbjct  168  WKEEREVHVI---GGPVEDFARLIVAGACQGDSYVKYPSWYDIFLLYRVFVPNILHWTFR  224

Query  543  LLY---------MTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGP  665
            L+          +   G P  +  G+ +L+ T  ++ + P TI   Q+ P
Sbjct  225  LILPTHGGRRTSLVGTGGPISEGYGRPLLEGTPPRRFVGPNTI--SQQSP  272



>dbj|BAA96982.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
Length=303

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 107/175 (61%), Gaps = 6/175 (3%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+     FE+  +++ +  +++ NFWG VY TH A PHL++  G+I+ ++S AG
Sbjct  128  HLVNNAGIAEAKFFEDYSEISDVLPIVNTNFWGPVYATHFAIPHLKKTKGKIIAVASPAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   PRMSIY ASKAAM  F+ETLRIEL P++ +T+V PG IE+  T    L  A  L  
Sbjct  188  WSGVPRMSIYAASKAAMINFYETLRIELHPEVGVTIVFPGLIENGNTNPDLL--AESLLQ  245

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVV  527
              D   V    + +     CAKA++N  CRG+ ++ EP+W +V  W     PE++
Sbjct  246  KQDWSQV----VTIESAAECAKAVVNGICRGKTFVAEPSWVRVLFWLSAICPELL  296



>ref|XP_010503335.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 2 [Camelina 
sativa]
Length=309

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 108/178 (61%), Gaps = 12/178 (7%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HL+NNAG+    LFE    +     +MDINFWGS Y+T+ A PHLR++ G+IVV +S++ 
Sbjct  128  HLINNAGVPQTILFENFTQIQDANHIMDINFWGSTYITYFAIPHLRKSKGKIVVTTSASA  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
             +  P  S+Y+ASKAA+ +FFETLR+E+ PDIKIT+V PGFI + +T    ++  G    
Sbjct  188  VIPLPSASVYSASKAALLKFFETLRVEISPDIKITIVIPGFISTNMTTPLFIDMYGS---  244

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYI  536
                     +++    V  CAK+I     RGE Y+ EP+W K     +   PE+V+Y+
Sbjct  245  ---------DLILSESVSKCAKSIFKGIARGETYIAEPSWIKWIFMIQKVCPEIVDYV  293



>ref|XP_010442243.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Camelina 
sativa]
Length=299

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 104/173 (60%), Gaps = 10/173 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVNNAG+    +FE+  +++ +  +++ NFWG VY TH A PHL++  G+I+ ++S AG
Sbjct  128  HLVNNAGIMEAKMFEDYSEISDVLPIVNTNFWGPVYATHFAIPHLKKTKGKIIAVASPAG  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            W   P+MSIY ASKAAM  F+ETLRIEL P I +T+V PG IE+  T    L +      
Sbjct  188  WAGVPKMSIYAASKAAMINFYETLRIELHPQIGVTIVFPGLIENGSTNPDLLTE------  241

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPE  521
                +     ++ +     CAKA++N  CRG+ ++ EP+W +V  W     PE
Sbjct  242  ----KQDWSQVVAIESAAECAKAVINGICRGKTFVAEPSWVRVLFWLSAICPE  290



>ref|XP_010421918.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Camelina 
sativa]
Length=377

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 116/185 (63%), Gaps = 3/185 (2%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVN A +     FEEV D T    +MDINFWG+VY T++A P+L++ NGRIVV +S   
Sbjct  130  HLVNTASLGHTFYFEEVSDTTVFPHLMDINFWGNVYPTYVALPYLQQTNGRIVVNASVEN  189

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS+Y+A+KAA+  F+ETLR EL  D+ IT+ T G+I SE+T+GK + + G    
Sbjct  190  WLPLPRMSLYSAAKAALVNFYETLRFELNEDVGITIATHGWIGSEMTRGKFMLEEGAEMQ  249

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + R+V  N    G ++  AK I+  ACRG+ Y+  P W+ V   ++VF P V+ +   
Sbjct  250  WKEEREVPAN---GGPLEEFAKMIVAGACRGDPYVKFPNWYDVFLLYRVFTPNVLRWTFK  306

Query  543  LLYMT  557
            LL  T
Sbjct  307  LLLST  311



>ref|XP_010437678.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Camelina 
sativa]
Length=382

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 116/185 (63%), Gaps = 3/185 (2%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVN A +     FEEV D T    +MDINFWG+VY T++A P+L++ NGRIVV +S   
Sbjct  130  HLVNTASLGHTFYFEEVSDTTVFPHLMDINFWGNVYPTYVALPYLQQTNGRIVVNASVEN  189

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS+Y+A+KAA+  F+ETLR EL  D+ IT+ T G+I SE+T+GK + + G    
Sbjct  190  WLPLPRMSLYSAAKAALVNFYETLRFELNEDVGITIATHGWIGSEMTRGKFMLEEGAEMQ  249

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + R+V  N    G ++  AK I+  ACRG+ Y+  P W+ V   ++VF P V+ +   
Sbjct  250  WKEEREVSAN---GGPLEDFAKMIVAGACRGDPYVKFPNWYDVFLLYRVFTPNVLRWTFK  306

Query  543  LLYMT  557
            LL  T
Sbjct  307  LLLST  311



>ref|XP_009357192.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Pyrus 
x bretschneideri]
Length=359

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/230 (37%), Positives = 135/230 (59%), Gaps = 14/230 (6%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMTHLAAPHLRRNNGRIVVISSSAG  182
            HLVN   +     FEEV D +    ++DINFWG+VY T++A P+LR+ NG+I+V +S   
Sbjct  128  HLVNTVSLGHTFYFEEVTDTSVFPQLLDINFWGNVYPTYVALPYLRQTNGKIIVNASVES  187

Query  183  WLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAGRLEV  362
            WL  PRMS+Y A+KAA+  F+ETLR+E+  ++ IT+ T G+I SE+T+GK + + G    
Sbjct  188  WLPLPRMSLYAAAKAALVNFYETLRLEVNHEVGITIATHGWIGSEMTRGKFMLEEGAEMQ  247

Query  363  SADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVEYINL  542
              + R+V V     G V+  A+ I+  ACRG+ Y+  P+W+     ++VF P+V+ +   
Sbjct  248  WKEEREVHVT---GGPVEDFARLIVAGACRGDSYVKYPSWYDRILLYRVFAPKVLNWTFR  304

Query  543  LLY---------MTSPGSPPQDALGKKILDYTGCQKIIYPETIIHDQEGP  665
            L+          +   G P  +  G+ +L+ T  +++I P T+   Q+ P
Sbjct  305  LVLPTHGGRRTSLVGTGRPISEGYGRPLLEGTPPRRLIGPNTV--SQQSP  352



>ref|XP_006580902.1| PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydroxysteroid dehydrogenase 
1B-like [Glycine max]
Length=323

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 127/219 (58%), Gaps = 37/219 (17%)
 Frame = +3

Query  3    HLVNNAGMTTFSLFEEVEDVTSLRSVMDINFWGSVYMT----HLAAPHLRRNNGRIVVIS  170
            HLVN+A ++  +LFEE +D+T  R +M IN + +V +       A PHL+++ G+IV +S
Sbjct  129  HLVNSAAISFATLFEEADDITKXRPIMVINCFLAVKLISAFIFFALPHLKKSRGKIVAMS  188

Query  171  SSAGWLSSPRMSIYNASKAAMSQFFETLRIELGPDIKITLVTPGFIESELTQGKHLNKAG  350
            S+   + +PR ++YNASKAA+   +ETLR+E+G D+ IT+VTPG+  S L  G       
Sbjct  189  SADSXMPAPRRNLYNASKAALVSMYETLRVEVGSDVGITIVTPGY--SRLVSG-------  239

Query  351  RLEVSADMRDVQVNIMPVGKVDACAKAILNSACRGERYLTEPAWFKVTRWWKVFFPEVVE  530
                                   CAKAI+N   R +R LT PAWFKVT   K+  PE+VE
Sbjct  240  -----------------------CAKAIVNGTLRVDRVLTVPAWFKVTYLLKLLCPELVE  276

Query  531  YINLLLYMT-SPGSPPQDALGKKILDYTGCQKIIYPETI  644
            +   ++YMT S  +  ++A  KKILD TG +K  YP +I
Sbjct  277  WSFRMMYMTESTRTTAREAPSKKILDTTGVKKFFYPSSI  315



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2230116990256