BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17521_g1_i1 len=248 path=[1958:0-247]

Length=248
                                                                      Score     E

ref|XP_007038038.1|  Hydroxysteroid dehydrogenase 1                     133   2e-35   
gb|KHG19414.1|  Dehydrogenase/reductase SDR family protein 7-like...    132   4e-35   
ref|XP_010695678.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    129   5e-34   
gb|KEH21006.1|  short-chain dehydrogenase/reductase                     129   6e-34   
ref|XP_011073095.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    129   1e-33   
gb|AAL09328.1|AF302806_1  steroleosin                                   128   1e-33   Sesamum indicum [beniseed]
ref|XP_006844627.1|  hypothetical protein AMTR_s00016p00227990          128   2e-33   
ref|XP_006347650.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    127   4e-33   
ref|XP_006347480.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    127   4e-33   
ref|XP_008239511.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    127   4e-33   
ref|XP_004241449.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    126   7e-33   
ref|XP_009597074.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    125   8e-33   
gb|KDO64428.1|  hypothetical protein CISIN_1g044010mg                   124   1e-32   
ref|XP_009597072.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    125   2e-32   
ref|XP_009760328.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    124   6e-32   
ref|XP_006436878.1|  hypothetical protein CICLE_v10031969mg             124   6e-32   
ref|XP_009778659.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    123   1e-31   
ref|XP_010536612.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    123   1e-31   
ref|XP_009359396.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    123   1e-31   
ref|XP_009359395.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    123   1e-31   
ref|XP_010086988.1|  Dehydrogenase/reductase SDR family protein 7...    122   1e-31   
ref|XP_009778660.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    121   1e-31   
ref|XP_007038040.1|  Hydroxysteroid dehydrogenase 2, putative           124   2e-31   
gb|EYU23068.1|  hypothetical protein MIMGU_mgv1a009201mg                123   2e-31   
ref|XP_004297522.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    122   2e-31   
ref|XP_009629548.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    122   3e-31   
ref|XP_004503736.1|  PREDICTED: dehydrogenase/reductase SDR famil...    122   3e-31   
ref|XP_010695677.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    122   3e-31   
ref|XP_008439964.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    122   3e-31   
ref|XP_010026329.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    122   3e-31   
ref|XP_009602452.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    121   6e-31   
ref|XP_009359394.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    120   8e-31   
ref|XP_008344913.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    120   9e-31   
ref|XP_008239510.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    120   1e-30   
ref|XP_010249449.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    120   1e-30   
ref|XP_007210136.1|  hypothetical protein PRUPE_ppa022641mg             120   1e-30   
ref|XP_010086989.1|  Dehydrogenase/reductase SDR family protein 7...    120   1e-30   
ref|XP_006366592.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    120   2e-30   
ref|XP_004297523.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    120   2e-30   
ref|XP_004298550.1|  PREDICTED: uncharacterized oxidoreductase Yq...    116   5e-30   
ref|XP_010323832.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    119   6e-30   
dbj|BAK03741.1|  predicted protein                                      119   6e-30   
gb|KDP22588.1|  hypothetical protein JCGZ_26419                         117   8e-30   
ref|XP_010250644.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    118   8e-30   
ref|XP_008392822.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    118   9e-30   
ref|XP_007160005.1|  hypothetical protein PHAVU_002G285000g             117   1e-29   
ref|XP_004503837.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    117   1e-29   
gb|ABS28874.1|  steroleosin-A                                           117   1e-29   Arachis hypogaea [goober]
ref|XP_010656935.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    117   2e-29   
ref|XP_002322681.2|  hypothetical protein POPTR_0016s04940g             117   2e-29   Populus trichocarpa [western balsam poplar]
emb|CBI38151.3|  unnamed protein product                                117   2e-29   
ref|XP_010442549.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    117   2e-29   
ref|XP_010482368.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    117   2e-29   
ref|NP_568742.1|  hydroxysteroid dehydrogenase 1                        116   4e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865819.1|  short-chain dehydrogenase/reductase family p...    116   4e-29   
ref|XP_004235330.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    116   4e-29   
ref|XP_004145220.1|  PREDICTED: dehydrogenase/reductase SDR famil...    116   4e-29   
ref|XP_002322680.1|  hypothetical protein POPTR_0016s04930g             115   5e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010249087.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    116   5e-29   
gb|KFK22922.1|  hypothetical protein AALP_AAs48765U000100               116   5e-29   
ref|XP_009127346.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    116   5e-29   
emb|CDY16353.1|  BnaA02g11570D                                          116   5e-29   
gb|ACG69523.1|  steroleosin SLO1-2                                      116   5e-29   Brassica napus [oilseed rape]
gb|ACG69522.1|  steroleosin SLO1-1                                      116   5e-29   Brassica napus [oilseed rape]
gb|ABO71657.1|  short-chain dehydrogenase reductase                     116   5e-29   Brassica napus [oilseed rape]
ref|XP_010241532.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    115   6e-29   
gb|ABM90633.1|  short-chain dehydrogenase reductase                     115   7e-29   Brassica napus [oilseed rape]
gb|EMT26675.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     115   9e-29   
ref|XP_010536607.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    114   1e-28   
ref|XP_003579631.2|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    115   1e-28   
ref|XP_006282100.1|  hypothetical protein CARUB_v10028347mg             115   1e-28   
ref|XP_010250645.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    115   1e-28   
gb|KHN16857.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     115   2e-28   
ref|NP_001242368.1|  uncharacterized protein LOC100787835               115   2e-28   
ref|XP_002511145.1|  Corticosteroid 11-beta-dehydrogenase, putative     114   2e-28   Ricinus communis
emb|CDY05818.1|  BnaA10g06020D                                          110   2e-28   
ref|XP_008446259.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    114   2e-28   
ref|XP_007211157.1|  hypothetical protein PRUPE_ppa027140mg             114   2e-28   
ref|XP_010442253.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    114   2e-28   
ref|XP_010253812.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    114   2e-28   
ref|XP_008239509.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    114   3e-28   
gb|KGN64427.1|  hypothetical protein Csa_1G051650                       113   4e-28   
emb|CBI38150.3|  unnamed protein product                                112   4e-28   
ref|XP_010656930.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    112   4e-28   
ref|XP_004162136.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    113   4e-28   
ref|XP_004145221.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    113   4e-28   
ref|XP_009124895.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    113   4e-28   
ref|XP_010270764.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    113   4e-28   
ref|XP_010663769.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    113   5e-28   
ref|XP_010270763.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    112   6e-28   
ref|XP_002266761.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    112   7e-28   Vitis vinifera
ref|XP_010929562.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    113   8e-28   
ref|XP_006653339.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    112   8e-28   
ref|XP_006402075.1|  hypothetical protein EUTSA_v10015475mg             112   9e-28   
ref|XP_009134064.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    112   9e-28   
emb|CDY34029.1|  BnaC03g27860D                                          112   9e-28   
gb|ACG69524.1|  steroleosin SLO1-3                                      112   9e-28   Brassica napus [oilseed rape]
ref|XP_004153125.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    112   1e-27   
ref|XP_004977951.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    112   1e-27   
ref|XP_010929561.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    113   1e-27   
ref|XP_010929560.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    113   1e-27   
ref|XP_008811369.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    112   1e-27   
ref|XP_010555563.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    111   2e-27   
ref|XP_007211139.1|  hypothetical protein PRUPE_ppa026374mg             112   2e-27   
ref|XP_004162134.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...    112   2e-27   
ref|XP_006436880.1|  hypothetical protein CICLE_v10031927mg             111   2e-27   
ref|XP_002318707.2|  hypothetical protein POPTR_0012s10370g             111   2e-27   Populus trichocarpa [western balsam poplar]
ref|NP_190319.1|  hydroxysteroid dehydrogenase 2                        111   2e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDP19890.1|  unnamed protein product                                112   2e-27   
emb|CDX71662.1|  BnaC09g27030D                                          110   2e-27   
ref|NP_001154667.1|  hydroxysteroid dehydrogenase 2                     111   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006653338.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    111   3e-27   
gb|EPS67142.1|  hypothetical protein M569_07637                         110   3e-27   
ref|XP_007038039.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    111   3e-27   
ref|XP_004145219.1|  PREDICTED: uncharacterized protein LOC101220214    112   3e-27   
ref|XP_010086987.1|  Dehydrogenase/reductase SDR family protein 7...    111   3e-27   
ref|XP_010251331.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    110   3e-27   
ref|XP_002511142.1|  Glucose 1-dehydrogenase, putative                  110   4e-27   Ricinus communis
ref|XP_010536608.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    110   4e-27   
ref|XP_006436879.1|  hypothetical protein CICLE_v10031927mg             111   4e-27   
emb|CBI15699.3|  unnamed protein product                                107   5e-27   
dbj|BAA96982.1|  11-beta-hydroxysteroid dehydrogenase-like              110   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199871.1|  hydroxysteroid dehydrogenase 4                        110   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011033350.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    112   5e-27   
ref|XP_007160009.1|  hypothetical protein PHAVU_002G2852000g            107   6e-27   
ref|XP_006402076.1|  hypothetical protein EUTSA_v10014225mg             109   7e-27   
ref|XP_011033248.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    110   7e-27   
gb|EEC77184.1|  hypothetical protein OsI_15677                          110   7e-27   Oryza sativa Indica Group [Indian rice]
emb|CAH66439.1|  OSIGBa0132D06.5                                        110   7e-27   Oryza sativa [red rice]
ref|XP_008446273.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    110   8e-27   
ref|XP_010277349.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    109   9e-27   
gb|KFK22923.1|  hypothetical protein AALP_AAs48765U000200               109   9e-27   
ref|NP_001052643.2|  Os04g0390800                                       110   9e-27   Oryza sativa Japonica Group [Japonica rice]
gb|KDO64429.1|  hypothetical protein CISIN_1g042560mg                   109   9e-27   
ref|XP_010525337.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    109   1e-26   
gb|EPS70609.1|  steroleosin                                             105   1e-26   
emb|CAH66438.1|  OSIGBa0132D06.4                                        109   1e-26   Oryza sativa [red rice]
ref|NP_001052642.1|  Os04g0390700                                       109   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010039131.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    109   2e-26   
ref|XP_010086991.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...    109   2e-26   
ref|XP_006404394.1|  hypothetical protein EUTSA_v10011076mg             108   2e-26   
ref|XP_002321719.2|  short-chain dehydrogenase/reductase family p...    108   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010426175.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    108   2e-26   
ref|NP_001152614.1|  steroleosin                                        108   3e-26   Zea mays [maize]
ref|XP_011044100.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    108   3e-26   
gb|AAX49394.1|  STO-1                                                   108   3e-26   Coffea canephora [robusta coffee]
ref|XP_008668191.1|  PREDICTED: steroleosin isoform X2                  108   3e-26   
ref|XP_002446311.1|  hypothetical protein SORBIDRAFT_06g013980          108   4e-26   Sorghum bicolor [broomcorn]
ref|XP_011023955.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    107   4e-26   
ref|XP_008668190.1|  PREDICTED: steroleosin isoform X1                  108   4e-26   
ref|XP_010695411.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    108   5e-26   
ref|XP_010503335.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    107   7e-26   
ref|XP_010442243.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    107   7e-26   
ref|XP_006291535.1|  hypothetical protein CARUB_v10017691mg             106   9e-26   
ref|XP_004975422.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    107   9e-26   
ref|XP_002875833.1|  short-chain dehydrogenase/reductase family p...    106   1e-25   
ref|XP_002446312.1|  hypothetical protein SORBIDRAFT_06g013990          107   1e-25   Sorghum bicolor [broomcorn]
ref|XP_006360917.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    107   1e-25   
ref|XP_006291536.1|  hypothetical protein CARUB_v10017691mg             106   1e-25   
ref|NP_190320.1|  hydroxysteroid dehydrogenase 3                        106   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011023956.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    105   2e-25   
gb|EAZ30541.1|  hypothetical protein OsJ_14589                          106   2e-25   Oryza sativa Japonica Group [Japonica rice]
gb|KGN64430.1|  hypothetical protein Csa_1G051680                       106   2e-25   
ref|XP_008446283.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    106   2e-25   
ref|XP_006579445.1|  PREDICTED: uncharacterized protein LOC100808...    105   2e-25   
ref|NP_001239786.1|  uncharacterized protein LOC100808990               105   3e-25   
ref|XP_010442546.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    105   3e-25   
ref|XP_004153126.1|  PREDICTED: dehydrogenase/reductase SDR famil...    105   3e-25   
ref|XP_010442547.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    105   4e-25   
ref|XP_010271121.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    105   6e-25   
emb|CDP19889.1|  unnamed protein product                                104   6e-25   
ref|XP_010503336.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    104   6e-25   
gb|EYU23067.1|  hypothetical protein MIMGU_mgv1a009247mg                104   7e-25   
ref|XP_003576230.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    104   8e-25   
ref|XP_007038041.1|  Glucose 1-dehydrogenase, putative                  104   8e-25   
ref|XP_006580902.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...    104   8e-25   
ref|XP_010515042.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    104   8e-25   
ref|XP_002321718.2|  hypothetical protein POPTR_0015s11200g             103   1e-24   Populus trichocarpa [western balsam poplar]
gb|EMS47145.1|  Dehydrogenase/reductase SDR family protein 7-like...    104   1e-24   
emb|CDX90560.1|  BnaA03g42210D                                          103   1e-24   
emb|CDY09733.1|  BnaC07g33280D                                          103   1e-24   
gb|KCW83129.1|  hypothetical protein EUGRSUZ_B00090                     100   1e-24   
ref|XP_003581150.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    103   2e-24   
ref|XP_009150624.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    103   2e-24   
ref|XP_010455398.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    103   2e-24   
ref|XP_010437678.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    103   2e-24   
gb|EMT26674.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     103   2e-24   
gb|KFK34034.1|  hypothetical protein AALP_AA5G093400                    105   2e-24   
ref|XP_006289482.1|  hypothetical protein CARUB_v10003016mg             103   2e-24   
ref|NP_192740.1|  hydroxysteroid dehydrogenase 5                        103   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KHG01718.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein     103   3e-24   
ref|XP_010426176.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    102   3e-24   
ref|XP_010536605.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    102   4e-24   
ref|XP_010536604.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    102   4e-24   
ref|XP_010536603.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    102   4e-24   
ref|XP_007160006.1|  hypothetical protein PHAVU_002G285100g             102   5e-24   
ref|XP_009134177.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    103   5e-24   
gb|EPS67484.1|  hypothetical protein M569_07290                         102   5e-24   
emb|CDX90742.1|  BnaA03g24220D                                          103   5e-24   
ref|XP_010645922.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    102   5e-24   
ref|XP_002279316.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    102   5e-24   Vitis vinifera
ref|XP_011073098.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    102   5e-24   
emb|CDY05081.1|  BnaC03g28790D                                          103   5e-24   
gb|ACF75106.1|  Ste-b                                                   103   5e-24   Brassica napus [oilseed rape]
gb|ACG69526.1|  steroleosin SLO2-2                                      103   5e-24   Brassica napus [oilseed rape]
gb|KEH21004.1|  hydroxysteroid 11-beta-dehydrogenase-like protein       102   5e-24   
gb|KDP22587.1|  hypothetical protein JCGZ_26418                         102   6e-24   
dbj|BAJ85563.1|  predicted protein                                      102   7e-24   
ref|XP_010421918.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    102   8e-24   
ref|XP_009765827.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    101   1e-23   
gb|EMS53803.1|  Dehydrogenase/reductase SDR family protein 7-like...    101   1e-23   
ref|XP_001767568.1|  predicted protein                                  101   1e-23   
emb|CAN76088.1|  hypothetical protein VITISV_028806                     101   1e-23   Vitis vinifera
ref|XP_009136723.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    100   1e-23   
ref|XP_002511144.1|  Corticosteroid 11-beta-dehydrogenase, putative     100   1e-23   Ricinus communis
ref|XP_002872483.1|  short-chain dehydrogenase/reductase family p...    101   1e-23   
ref|XP_010536606.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    100   1e-23   
ref|XP_009405178.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    100   2e-23   
gb|ACG69525.1|  steroleosin SLO2-1                                      101   3e-23   Brassica napus [oilseed rape]
ref|XP_011095759.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    100   3e-23   
ref|XP_009150234.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  99.8    3e-23   
emb|CDY21787.1|  BnaA06g20560D                                        99.8    3e-23   
gb|ABI20736.1|  11-beta-hydroxysteroid dehydrogenase-like protein       100   4e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006664013.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...    100   4e-23   
ref|XP_010249088.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  99.4    4e-23   
tpg|DAA38129.1|  TPA: hypothetical protein ZEAMMB73_775961            96.7    4e-23   
ref|XP_010271122.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  99.8    5e-23   
ref|XP_006397111.1|  hypothetical protein EUTSA_v10029315mg             100   5e-23   
ref|XP_006404393.1|  hypothetical protein EUTSA_v10010570mg           99.0    6e-23   
gb|ABX82800.1|  sterolesin-B                                          98.2    7e-23   Brassica napus [oilseed rape]
ref|XP_006662954.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  99.0    8e-23   
ref|XP_010271841.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  99.0    9e-23   
ref|XP_006376168.1|  short-chain dehydrogenase/reductase family p...  98.6    1e-22   
gb|EYU22738.1|  hypothetical protein MIMGU_mgv1a008685mg              99.0    1e-22   
ref|XP_010271842.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  98.2    1e-22   
ref|XP_010271120.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  98.6    1e-22   
ref|XP_007019842.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...  99.0    1e-22   
dbj|BAJ87073.1|  predicted protein                                    98.2    1e-22   
gb|ABA98146.2|  oxidoreductase, short chain dehydrogenase/reducta...  98.2    1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|KDP45630.1|  hypothetical protein JCGZ_17237                       97.8    2e-22   
ref|XP_010910414.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  98.2    2e-22   
ref|XP_007019843.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...  97.8    2e-22   
ref|XP_011006178.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  97.8    2e-22   
ref|XP_002864070.1|  short-chain dehydrogenase/reductase family p...  97.4    2e-22   
ref|NP_001066740.1|  Os12g0464400                                     98.2    2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002528042.1|  Corticosteroid 11-beta-dehydrogenase, putative   97.8    2e-22   Ricinus communis
ref|XP_010913000.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  97.4    3e-22   
ref|XP_007222177.1|  hypothetical protein PRUPE_ppa007781mg           97.1    4e-22   
gb|EMT06462.1|  hypothetical protein F775_52091                       97.1    6e-22   
ref|NP_001067940.1|  Os11g0499600                                     96.7    7e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010243359.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  96.7    7e-22   
ref|NP_001141666.2|  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase   96.3    7e-22   Zea mays [maize]
gb|ABA93830.1|  oxidoreductase, short chain dehydrogenase/reducta...  96.3    7e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010100094.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...  96.3    8e-22   
gb|KDP22589.1|  hypothetical protein JCGZ_26420                       94.4    1e-21   
ref|XP_004299863.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  95.9    1e-21   
gb|EEC69238.1|  hypothetical protein OsI_38254                        95.9    1e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_003575023.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  95.1    2e-21   
ref|NP_001147696.1|  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase   95.1    2e-21   Zea mays [maize]
gb|KFK32035.1|  hypothetical protein AALP_AA6G191600                  95.5    2e-21   
ref|XP_003577550.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  95.1    2e-21   
ref|XP_002973836.1|  hypothetical protein SELMODRAFT_100351           95.1    2e-21   
ref|XP_008670737.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  94.7    3e-21   
ref|XP_010037388.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  94.4    3e-21   
ref|XP_001756706.1|  predicted protein                                94.0    3e-21   
ref|XP_004141553.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  94.7    3e-21   
ref|XP_010270765.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  94.0    4e-21   
ref|XP_002452151.1|  hypothetical protein SORBIDRAFT_04g020710        94.4    4e-21   Sorghum bicolor [broomcorn]
ref|XP_003524470.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...  94.4    4e-21   
ref|XP_009617211.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  94.4    4e-21   
ref|NP_001046935.1|  Os02g0511400                                     94.7    4e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008669501.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  94.0    6e-21   
emb|CDX83157.1|  BnaA03g23490D                                        93.6    6e-21   
ref|XP_006441634.1|  hypothetical protein CICLE_v10020750mg           94.0    7e-21   
gb|EAZ30542.1|  hypothetical protein OsJ_14590                        93.6    7e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008219091.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  93.6    7e-21   
ref|XP_010086990.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...  95.1    8e-21   
ref|XP_008459623.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  93.6    8e-21   
ref|XP_004979317.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  93.6    9e-21   
ref|XP_002318146.2|  hypothetical protein POPTR_0012s10360g           93.2    9e-21   
ref|XP_010683155.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  93.2    9e-21   
tpg|DAA41997.1|  TPA: hypothetical protein ZEAMMB73_718382            93.6    1e-20   
gb|ABI20735.1|  11-beta-hydroxysteroid dehydrogenase-like protein     93.2    1e-20   
ref|XP_002325513.1|  short-chain dehydrogenase/reductase family p...  93.2    1e-20   
ref|XP_009797377.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  92.8    1e-20   
ref|XP_006478271.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  92.8    1e-20   
ref|XP_002449530.1|  hypothetical protein SORBIDRAFT_05g017960        92.8    1e-20   
ref|XP_003538052.2|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...  93.2    2e-20   
ref|XP_009797378.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  92.4    2e-20   
ref|XP_011036367.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  92.8    2e-20   
ref|XP_010062387.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  92.8    2e-20   
ref|XP_004962634.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  92.4    2e-20   
ref|XP_008798974.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  92.4    2e-20   
ref|XP_002463266.1|  hypothetical protein SORBIDRAFT_02g040840        92.0    2e-20   
emb|CDX83013.1|  BnaA01g20130D                                        89.0    2e-20   
gb|EEE53178.1|  hypothetical protein OsJ_36031                        92.0    3e-20   
gb|ABS28873.1|  steroleosin-B                                         91.7    4e-20   
ref|NP_001241259.1|  uncharacterized protein LOC100780731             91.7    4e-20   
ref|XP_004242256.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  91.7    5e-20   
ref|XP_009622010.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  91.3    5e-20   
gb|AGT17053.1|  hypothetical protein SHCRBa_201_F17_F_10              90.9    7e-20   
ref|XP_006356566.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  90.9    8e-20   
ref|XP_011015818.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  89.0    8e-20   
ref|XP_009799020.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  90.9    9e-20   
ref|XP_008806996.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  90.1    1e-19   
ref|XP_008806995.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  90.1    1e-19   
ref|XP_006836805.1|  hypothetical protein AMTR_s00099p00028560        89.4    1e-19   
ref|XP_010530110.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  90.5    1e-19   
ref|NP_001136546.1|  corticosteroid 11-beta-dehydrogenase isozyme...  89.7    2e-19   
ref|XP_008353114.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  89.4    2e-19   
gb|EAY86013.1|  hypothetical protein OsI_07374                        89.7    2e-19   
ref|XP_010927840.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  89.0    3e-19   
gb|ACG24673.1|  corticosteroid 11-beta-dehydrogenase isozyme 1        89.0    3e-19   
ref|XP_010927839.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  89.0    3e-19   
ref|XP_009357192.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  89.0    3e-19   
gb|EMS50702.1|  Dehydrogenase/reductase SDR family protein 7-like...  89.0    4e-19   
ref|XP_002985446.1|  hypothetical protein SELMODRAFT_424474           88.2    5e-19   
emb|CAN60641.1|  hypothetical protein VITISV_039526                   89.7    6e-19   
gb|EAY92531.1|  hypothetical protein OsI_14269                        87.8    6e-19   
ref|XP_006648666.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  88.2    9e-19   
ref|XP_008365259.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  87.8    1e-18   
ref|XP_008378718.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  87.8    1e-18   
tpg|DAA63854.1|  TPA: hypothetical protein ZEAMMB73_332488            87.4    1e-18   
ref|XP_009335461.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  87.8    1e-18   
ref|XP_010910406.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  87.0    1e-18   
ref|XP_010482377.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  86.7    1e-18   
ref|XP_003562566.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  87.4    2e-18   
ref|XP_010910399.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  87.0    2e-18   
dbj|BAK05747.1|  predicted protein                                    87.0    2e-18   
ref|XP_010482376.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  86.7    2e-18   
ref|XP_009333966.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  86.7    2e-18   
gb|EMT32988.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein   86.3    2e-18   
ref|XP_002463543.1|  hypothetical protein SORBIDRAFT_01g001700        86.3    4e-18   
ref|XP_006650876.1|  PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydr...  85.9    4e-18   
ref|XP_002979783.1|  hypothetical protein SELMODRAFT_153443           85.5    5e-18   
gb|EMS48748.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein   85.1    6e-18   
gb|KHN35097.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein   85.9    6e-18   
ref|XP_004981097.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  85.5    6e-18   
ref|XP_002966954.1|  hypothetical protein SELMODRAFT_87233            85.5    7e-18   
ref|XP_002994525.1|  hypothetical protein SELMODRAFT_138761           85.5    7e-18   
ref|XP_009127343.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  85.1    7e-18   
ref|XP_009127342.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  85.1    7e-18   
ref|XP_004511498.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  85.5    8e-18   
ref|NP_001051859.1|  Os03g0842900                                     85.1    8e-18   
gb|EEE60277.1|  hypothetical protein OsJ_13325                        85.1    9e-18   
ref|NP_001145589.1|  uncharacterized protein LOC100279063             85.1    1e-17   
ref|XP_010442316.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  84.7    1e-17   
ref|XP_009387843.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  84.3    1e-17   
ref|NP_199890.1|  hydroxysteroid dehydrogenase 6                      84.3    1e-17   
ref|WP_022830515.1|  short-chain dehydrogenase                        84.0    1e-17   
ref|XP_006282170.1|  hypothetical protein CARUB_v10028440mg           84.3    2e-17   
gb|KHN25620.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein   84.3    2e-17   
ref|XP_009408757.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  84.0    2e-17   
ref|WP_017258573.1|  short-chain dehydrogenase                        82.8    4e-17   
ref|WP_026904729.1|  short-chain dehydrogenase                        82.4    4e-17   
ref|WP_039451443.1|  short-chain dehydrogenase                        82.4    4e-17   
ref|XP_002466880.1|  hypothetical protein SORBIDRAFT_01g015790        82.8    7e-17   
ref|XP_001641021.1|  predicted protein                                82.4    7e-17   
ref|XP_005795776.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  81.6    9e-17   
ref|XP_003610951.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like ...  82.8    9e-17   
ref|XP_008666705.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  81.6    2e-16   
ref|XP_007569249.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  80.9    2e-16   
ref|XP_008336804.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  82.8    2e-16   
ref|WP_025865437.1|  short-chain dehydrogenase                        80.5    3e-16   
ref|WP_008503785.1|  short-chain dehydrogenase                        80.5    3e-16   
ref|XP_008405418.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  80.1    4e-16   
ref|XP_010536601.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  80.1    7e-16   
ref|XP_003226050.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  79.3    7e-16   
ref|WP_013632465.1|  short-chain dehydrogenase                        79.0    8e-16   
gb|KFE58907.1|  Short-chain dehydrogenase/reductase SDR               79.0    8e-16   
ref|XP_007061604.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  79.0    8e-16   
tpg|DAA38136.1|  TPA: hypothetical protein ZEAMMB73_559137            79.0    9e-16   
ref|XP_002865822.1|  hypothetical protein ARALYDRAFT_918105           77.0    1e-15   
gb|KFK39003.1|  hypothetical protein AALP_AA3G187700                  78.6    1e-15   
gb|EPS63225.1|  hypothetical protein M569_11562                       77.8    1e-15   
ref|XP_006790441.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  78.6    1e-15   
ref|XP_005727177.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  78.6    1e-15   
ref|XP_004552836.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  78.6    1e-15   
ref|XP_003451366.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  78.6    1e-15   
ref|XP_006039437.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  77.0    1e-15   
ref|XP_002603010.1|  hypothetical protein BRAFLDRAFT_84745            78.2    2e-15   
ref|WP_009254832.1|  MULTISPECIES: short-chain dehydrogenase          77.8    2e-15   
ref|XP_005932465.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  77.8    2e-15   
ref|WP_016778448.1|  short-chain dehydrogenase                        77.8    2e-15   
ref|XP_004910661.1|  PREDICTED: hydroxysteroid (11-beta) dehydrog...  77.8    2e-15   
gb|AAI35284.1|  LOC100038278 protein                                  77.8    2e-15   
ref|XP_004357175.1|  11beta-hydroxysteroid dehydrogenase-like, pu...  77.8    2e-15   
ref|XP_008405417.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  77.8    2e-15   
ref|XP_006402065.1|  hypothetical protein EUTSA_v10015936mg           77.8    2e-15   
ref|WP_015513763.1|  Dehydrogenases with different specificities ...  77.4    3e-15   
ref|XP_002983555.1|  hypothetical protein SELMODRAFT_234271           78.2    3e-15   
gb|AFW71547.1|  hypothetical protein ZEAMMB73_313921                  77.0    3e-15   
gb|ETE59841.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like prote...  77.4    3e-15   
ref|XP_003974112.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  77.4    3e-15   
ref|WP_008242159.1|  short-chain dehydrogenase                        77.0    3e-15   
ref|XP_005288751.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  77.0    4e-15   
ref|WP_036130230.1|  short-chain dehydrogenase                        77.0    4e-15   
ref|XP_004067880.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  77.0    4e-15   
emb|CDY16351.1|  BnaA02g11550D                                        77.4    4e-15   
gb|EMP34131.1|  NAD-dependent ADP-ribosyltransferase sirtuin-4        79.3    4e-15   
ref|XP_007440170.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  76.3    4e-15   
ref|NP_001090784.1|  hydroxysteroid 11-beta-dehydrogenase 1-like ...  77.0    5e-15   
ref|XP_002594767.1|  hydroxysteroid dehydrogenase 1H                  77.0    5e-15   
ref|XP_003451421.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  77.0    5e-15   
ref|WP_015202720.1|  3-oxoacyl-(acyl-carrier-protein) reductase       76.6    5e-15   
ref|XP_008788738.1|  PREDICTED: 11-beta-hydroxysteroid dehydrogen...  76.3    5e-15   
ref|XP_005727179.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  76.6    5e-15   
ref|XP_002600023.1|  hydroxysteroid dehydrogenase 1I                  77.0    5e-15   
ref|WP_039481552.1|  short-chain dehydrogenase                        76.6    5e-15   
ref|WP_002622893.1|  oxidoreductase, short chain dehydrogenase/re...  76.6    5e-15   
ref|WP_018336362.1|  short-chain dehydrogenase                        76.6    5e-15   
ref|XP_005932464.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  76.6    5e-15   
ref|XP_005727178.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  76.6    5e-15   
ref|XP_004552835.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  76.6    5e-15   
ref|XP_002611304.1|  hydroxysteroid dehydrogenase 1M                  76.6    6e-15   
ref|XP_002611300.1|  hydroxysteroid dehydrogenase 1P                  76.6    6e-15   
ref|XP_002591344.1|  hydroxysteroid dehydrogenase protein 1F          76.6    7e-15   
gb|AHF58592.1|  11-beta-hydroxysteroid dehydrogenase                  76.3    8e-15   
ref|XP_006019896.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  76.3    8e-15   
ref|XP_006019895.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  76.3    8e-15   
ref|WP_010602203.1|  short-chain dehydrogenase                        76.3    8e-15   
ref|XP_007440169.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  76.3    9e-15   
ref|WP_002619156.1|  short-chain dehydrogenase                        76.3    9e-15   
gb|KFK26701.1|  hypothetical protein AALP_AA8G282300                  76.6    9e-15   
ref|WP_014643437.1|  oxidoreductase                                   75.9    1e-14   
ref|WP_015808834.1|  short-chain dehydrogenase                        75.9    1e-14   
ref|WP_010528274.1|  short-chain dehydrogenase                        75.9    1e-14   
ref|XP_006273379.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  75.9    1e-14   
ref|XP_006273890.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  75.9    1e-14   
ref|XP_009860181.1|  PREDICTED: probable L-xylulose reductase         75.5    1e-14   
ref|XP_010731274.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  75.5    1e-14   
ref|NP_001083596.1|  hydroxysteroid 11-beta-dehydrogenase 1-like ...  75.5    1e-14   
ref|XP_006129130.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxystero...  75.5    1e-14   
ref|XP_002587683.1|  hypothetical protein BRAFLDRAFT_92730            75.9    1e-14   
ref|WP_039390059.1|  oxidoreductase                                   75.1    2e-14   
ref|XP_006790442.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  75.5    2e-14   
ref|XP_005795650.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  75.5    2e-14   
ref|WP_029278012.1|  short-chain dehydrogenase                        75.5    2e-14   
ref|WP_032669230.1|  oxidoreductase                                   75.1    2e-14   
gb|KHN23681.1|  hypothetical protein glysoja_039132                   74.7    2e-14   
ref|WP_025145316.1|  short-chain dehydrogenase                        75.1    2e-14   
emb|CAG01365.1|  unnamed protein product                              74.7    2e-14   
ref|WP_027202447.1|  short-chain dehydrogenase                        75.1    2e-14   
ref|XP_002611301.1|  hydroxysteroid dehydrogenase 1O                  75.1    2e-14   
ref|XP_002601017.1|  hypothetical protein BRAFLDRAFT_96948            75.1    2e-14   
ref|WP_036412353.1|  short-chain dehydrogenase                        75.5    2e-14   
ref|NP_001098261.1|  11-beta-hydroxysteroid dehydrogenase type 3 ...  75.1    2e-14   
ref|XP_009861866.1|  PREDICTED: 17-beta-hydroxysteroid dehydrogen...  74.3    3e-14   
ref|XP_002611393.1|  hypothetical protein BRAFLDRAFT_73210            74.3    3e-14   
gb|KFA88847.1|  short-chain dehydrogenase                             74.3    4e-14   
ref|XP_002591324.1|  hypothetical protein BRAFLDRAFT_121462           74.7    4e-14   
ref|XP_002611392.1|  hypothetical protein BRAFLDRAFT_210965           74.3    4e-14   
ref|XP_010764273.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  74.3    4e-14   
ref|XP_009095134.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  74.3    4e-14   
ref|WP_017372676.1|  oxidoreductase                                   73.9    4e-14   
ref|WP_030490408.1|  short-chain dehydrogenase                        74.7    4e-14   
ref|WP_011558959.1|  MULTISPECIES: oxidoreductase                     73.9    4e-14   
ref|WP_013666361.1|  short-chain dehydrogenase                        73.9    4e-14   
ref|XP_002601019.1|  hypothetical protein BRAFLDRAFT_232530           73.9    5e-14   
ref|WP_026174147.1|  short-chain dehydrogenase                        73.9    5e-14   
ref|WP_029289082.1|  short-chain dehydrogenase                        73.9    5e-14   
emb|CEG27299.1|  3-oxoacyl-ACP reductase                              73.6    5e-14   
ref|WP_013940811.1|  short-chain dehydrogenase                        73.6    5e-14   
ref|XP_002321720.1|  hypothetical protein POPTR_0015s11220g           73.2    6e-14   
ref|XP_007243411.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  73.9    6e-14   
ref|XP_002591323.1|  hydroxysteroid dehydrogenase protein 1D          73.9    7e-14   
ref|XP_007569248.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  73.9    7e-14   
ref|XP_009685787.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  73.9    7e-14   
ref|WP_028067087.1|  short-chain dehydrogenase                        73.6    7e-14   
ref|XP_008298781.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  73.6    7e-14   
ref|XP_002184690.1|  predicted protein                                73.2    8e-14   
ref|NP_001155449.1|  dehydrogenase-like                               73.9    9e-14   
ref|XP_008167032.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  73.6    9e-14   
ref|NP_001099077.1|  short-chain dehydrogenase/reductase 10 precu...  73.2    9e-14   
ref|XP_002594099.1|  hypothetical protein BRAFLDRAFT_68459            73.2    1e-13   
ref|XP_002611394.1|  hypothetical protein BRAFLDRAFT_120324           73.9    1e-13   
dbj|GAK29765.1|  alcohol dehydrogenase                                72.8    1e-13   
gb|ABI20737.1|  11-beta-hydroxysteroid dehydrogenase-like protein     72.8    1e-13   
ref|WP_020837643.1|  oxidoreductase                                   72.4    1e-13   
ref|XP_006817602.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  72.4    1e-13   
gb|AAI06473.1|  LOC733357 protein                                     73.2    1e-13   
dbj|GAL84330.1|  hypothetical protein MYP_1558                        73.6    2e-13   
gb|AIA17867.1|  short chain dehydrogenase                             72.8    2e-13   
ref|WP_009596236.1|  MULTISPECIES: short-chain dehydrogenase          72.4    2e-13   
gb|ETZ23526.1|  short-chain dehydrogenase                             72.4    2e-13   
gb|KFA90250.1|  short-chain dehydrogenase                             72.4    2e-13   
ref|NP_001254569.1|  11-beta-hydroxysteroid dehydrogenase type 3 ...  72.4    2e-13   
ref|XP_007072272.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  72.4    2e-13   
ref|XP_002611395.1|  hypothetical protein BRAFLDRAFT_210861           72.0    2e-13   
ref|XP_001427169.1|  hypothetical protein                             72.0    2e-13   
ref|XP_006273891.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  70.5    3e-13   
gb|KGL74613.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like A         71.6    3e-13   
gb|AHJ59462.1|  11-beta-hydroxysteroid dehydrogenase short form       70.5    3e-13   
ref|XP_009898894.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  72.0    3e-13   
gb|EMC80906.1|  Hydroxysteroid 11-beta-dehydrogenase 1-like protein   71.2    3e-13   
ref|WP_007464751.1|  short-chain dehydrogenase                        72.8    3e-13   
ref|WP_005202213.1|  short-chain dehydrogenase                        71.6    3e-13   
ref|XP_002601018.1|  hypothetical protein BRAFLDRAFT_96947            72.0    3e-13   
ref|XP_005444300.1|  PREDICTED: hydroxysteroid 11-beta-dehydrogen...  71.6    4e-13   
ref|WP_007693875.1|  dehydrogenase                                    71.2    4e-13   



>ref|XP_007038038.1| Hydroxysteroid dehydrogenase 1 [Theobroma cacao]
 gb|EOY22539.1| Hydroxysteroid dehydrogenase 1 [Theobroma cacao]
Length=351

 Score =   133 bits (335),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 61/82 (74%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEY +RGARL L ARR+ SLQEVA+RA +LGSPD I I+ADVSN+DD
Sbjct  52   ITGASSGIGEHLAYEYGRRGARLALTARREKSLQEVADRAHDLGSPDVITIRADVSNVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R+V++T+N FG +DHLVNNA
Sbjct  112  CQRLVEETVNHFGRLDHLVNNA  133



>gb|KHG19414.1| Dehydrogenase/reductase SDR family protein 7-like protein [Gossypium 
arboreum]
Length=350

 Score =   132 bits (333),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEY +RGARL L ARR+ SLQE+A+RA +LGSPD I I+ADVS +DD
Sbjct  52   ITGASSGIGEHLAYEYGRRGARLALTARREKSLQEIADRARDLGSPDVIVIRADVSKVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR+V++T+N FG +DHLVNNA
Sbjct  112  CRRLVEETVNHFGRLDHLVNNA  133



>ref|XP_010695678.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Beta 
vulgaris subsp. vulgaris]
Length=349

 Score =   129 bits (325),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 62/82 (76%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA+RGA LVLAARR+ SL+EVAN  +ELGSPD+I + ADVSN++D
Sbjct  52   ITGASSGIGEQLAYEYARRGAYLVLAARREKSLREVANMCLELGSPDSITVNADVSNVND  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+RIVD TI  FG VDHLVNNA
Sbjct  112  CKRIVDTTITNFGRVDHLVNNA  133



>gb|KEH21006.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=351

 Score =   129 bits (324),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGARL L+ARR  +L+EVA+RA + GSPD I ++ADVS +DD
Sbjct  52   ITGASSGIGEHLAYEYAKRGARLALSARRDTALREVADRARDCGSPDVIIMRADVSKVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR+VD+T+N FG +DHLVNNA
Sbjct  112  CRRLVDETVNHFGRLDHLVNNA  133



>ref|XP_011073095.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Sesamum 
indicum]
Length=349

 Score =   129 bits (323),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYAKRGA LVLAARR+ SLQEVA RA +LGSPD + ++ADVS  +D
Sbjct  53   ITGASSGIGESLAYEYAKRGACLVLAARRERSLQEVAERARDLGSPDVVVVRADVSKAED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CR++VDQT+N FG +DHLVNNA
Sbjct  113  CRKVVDQTMNRFGRLDHLVNNA  134



>gb|AAL09328.1|AF302806_1 steroleosin [Sesamum indicum]
 gb|AAL13315.1|AF421889_1 steroleosin [Sesamum indicum]
Length=348

 Score =   128 bits (322),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 61/82 (74%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYAKRGA LVLAARR+ SLQEVA RA +LGSPD + ++ADVS  +D
Sbjct  52   ITGASSGIGESLAYEYAKRGACLVLAARRERSLQEVAERARDLGSPDVVVVRADVSKAED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CR++VDQT+N FG +DHLVNNA
Sbjct  112  CRKVVDQTMNRFGRLDHLVNNA  133



>ref|XP_006844627.1| hypothetical protein AMTR_s00016p00227990 [Amborella trichopoda]
 gb|ERN06302.1| hypothetical protein AMTR_s00016p00227990 [Amborella trichopoda]
Length=348

 Score =   128 bits (321),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AY+YAKRGARLVL ARR+ SLQEVA +A  LGSPD I + ADV+ +D+
Sbjct  52   ITGASSGIGEHMAYQYAKRGARLVLIARREQSLQEVAEKARSLGSPDVIVVHADVTRVDE  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +D+TIN FG +DHLVNNA
Sbjct  112  CKRFIDETINHFGRLDHLVNNA  133



>ref|XP_006347650.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
tuberosum]
Length=344

 Score =   127 bits (319),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGA L +AARR+ SL EVA RA++LG+PD + + ADVSN+DD
Sbjct  55   ITGASSGIGEHLAYEYARRGACLAIAARREKSLLEVAERALDLGAPDVLVVPADVSNVDD  114

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD+T++ FG +DHLVNNA
Sbjct  115  CRRIVDRTMSHFGRLDHLVNNA  136



>ref|XP_006347480.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
tuberosum]
Length=349

 Score =   127 bits (319),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 63/82 (77%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYAKRGA L LAARR+ SL EVA  A ELGSPD I IQADVS  +D
Sbjct  54   ITGASSGIGEYLAYEYAKRGACLTLAARRERSLNEVAEGARELGSPDVITIQADVSKAED  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVDQT++ FG +DHLVNNA
Sbjct  114  CRRIVDQTMSHFGRLDHLVNNA  135



>ref|XP_008239511.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Prunus 
mume]
Length=353

 Score =   127 bits (319),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGARLVL  RR+ SL+EV +RA + GSPD + + ADVS ++D
Sbjct  55   ITGASSGIGEHLAYEYAKRGARLVLVGRREDSLREVVDRASDCGSPDVLMVGADVSKVED  114

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+RIVD+TIN FG +DHLVNNA
Sbjct  115  CKRIVDETINHFGRLDHLVNNA  136



>ref|XP_004241449.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
lycopersicum]
Length=349

 Score =   126 bits (317),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 63/82 (77%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYAKRGA L LAARR  SL EVA  A ELGSPD I IQADVS  +D
Sbjct  54   ITGASSGIGEYLAYEYAKRGACLTLAARRDRSLNEVAEGARELGSPDVITIQADVSKAED  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVDQT++ FG +DHLVNNA
Sbjct  114  CRRIVDQTMSHFGRLDHLVNNA  135



>ref|XP_009597074.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Nicotiana tomentosiformis]
Length=267

 Score =   125 bits (313),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA+RG+ +V+ ARR+  LQ+VA +A+ LGSPD ++I+ADVSN+DD
Sbjct  56   ITGASSGIGEELAYEYARRGSSIVIVARREEQLQKVAEKAMCLGSPDVLSIRADVSNVDD  115

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R+VDQT+N FG +DHLVNNA
Sbjct  116  CKRLVDQTVNHFGRLDHLVNNA  137



>gb|KDO64428.1| hypothetical protein CISIN_1g044010mg [Citrus sinensis]
Length=248

 Score =   124 bits (310),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGA L L ARR+ SL+EVA+ A E+GSPD I I+ADVS +DD
Sbjct  52   ITGASSGIGEHLAYEYARRGACLALCARREKSLEEVADTAREIGSPDVITIRADVSKVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CR +V++T+N FG +DHLVNNA
Sbjct  112  CRSLVEETMNHFGRLDHLVNNA  133



>ref|XP_009597072.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Nicotiana tomentosiformis]
Length=327

 Score =   125 bits (313),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA+RG+ +V+ ARR+  LQ+VA +A+ LGSPD ++I+ADVSN+DD
Sbjct  56   ITGASSGIGEELAYEYARRGSSIVIVARREEQLQKVAEKAMCLGSPDVLSIRADVSNVDD  115

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R+VDQT+N FG +DHLVNNA
Sbjct  116  CKRLVDQTVNHFGRLDHLVNNA  137



>ref|XP_009760328.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
sylvestris]
Length=352

 Score =   124 bits (311),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYA+RGA L +AARR+ SL+EVA RA++LGSPD + + ADVS +DD
Sbjct  55   ITGASSGIGEYLAYEYARRGACLTIAARREKSLREVAERALDLGSPDVLVVPADVSKVDD  114

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+RIVD+T++ FG +DHLVNNA
Sbjct  115  CKRIVDKTMSHFGRLDHLVNNA  136



>ref|XP_006436878.1| hypothetical protein CICLE_v10031969mg [Citrus clementina]
 ref|XP_006493234.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Citrus 
sinensis]
 gb|ESR50118.1| hypothetical protein CICLE_v10031969mg [Citrus clementina]
Length=349

 Score =   124 bits (310),  Expect = 6e-32, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGA L L ARR+ SL+EVA+ A E+GSPD I I+ADVS +DD
Sbjct  52   ITGASSGIGEHLAYEYARRGACLALCARREKSLEEVADTAREIGSPDVITIRADVSKVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CR +V++T+N FG +DHLVNNA
Sbjct  112  CRSLVEETMNHFGRLDHLVNNA  133



>ref|XP_009778659.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Nicotiana sylvestris]
Length=327

 Score =   123 bits (308),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA+RG+ +V+ ARR+  L++VA +A  LGSPD ++I+ADVSN+DD
Sbjct  56   ITGASSGIGEELAYEYARRGSSIVIVARREEQLRKVAEKARSLGSPDVLSIRADVSNVDD  115

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R+VDQT+N FG +DHLVNNA
Sbjct  116  CKRLVDQTVNHFGRLDHLVNNA  137



>ref|XP_010536612.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B [Tarenaya 
hassleriana]
Length=349

 Score =   123 bits (309),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 61/82 (74%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEY  RGA L LAARRK  LQEVA  A+ELGSPD I + ADVS  +D
Sbjct  52   ITGASSGIGEHLAYEYGSRGACLALAARRKNRLQEVAELALELGSPDVITVLADVSQPED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD TI+ FG +DHLVNNA
Sbjct  112  CRRIVDDTISHFGRLDHLVNNA  133



>ref|XP_009359396.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Pyrus x bretschneideri]
Length=350

 Score =   123 bits (309),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGARL L  RR+ +L+EV +RA + GSPD + I ADVS ++D
Sbjct  53   ITGASSGIGEHLAYEYAKRGARLALVGRRENALREVVDRASDFGSPDVLMIHADVSKVED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+RIVD T+N +G +DHLVNNA
Sbjct  113  CKRIVDDTMNHYGRLDHLVNNA  134



>ref|XP_009359395.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Pyrus x bretschneideri]
Length=355

 Score =   123 bits (309),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGARL L  RR+ +L+EV +RA + GSPD + I ADVS ++D
Sbjct  53   ITGASSGIGEHLAYEYAKRGARLALVGRRENALREVVDRASDFGSPDVLMIHADVSKVED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+RIVD T+N +G +DHLVNNA
Sbjct  113  CKRIVDDTMNHYGRLDHLVNNA  134



>ref|XP_010086988.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
 gb|EXB25267.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
Length=310

 Score =   122 bits (307),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L LAARR+  L+ VA +AV LGSPDA  I+ADVS ++D
Sbjct  53   ITGASSGIGEHLAYEYAKRGASLALAARREDRLRAVAAKAVGLGSPDAFVIRADVSKVED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R+VD+T+N FG +D+L+NNA
Sbjct  113  CKRLVDETVNHFGQLDYLINNA  134



>ref|XP_009778660.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Nicotiana sylvestris]
Length=267

 Score =   121 bits (304),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA+RG+ +V+ ARR+  L++VA +A  LGSPD ++I+ADVSN+DD
Sbjct  56   ITGASSGIGEELAYEYARRGSSIVIVARREEQLRKVAEKARSLGSPDVLSIRADVSNVDD  115

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R+VDQT+N FG +DHLVNNA
Sbjct  116  CKRLVDQTVNHFGRLDHLVNNA  137



>ref|XP_007038040.1| Hydroxysteroid dehydrogenase 2, putative [Theobroma cacao]
 gb|EOY22541.1| Hydroxysteroid dehydrogenase 2, putative [Theobroma cacao]
Length=434

 Score =   124 bits (310),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGARL L ARR   LQ+VA RA ++GSPD I I ADVS ++D
Sbjct  51   ITGASSGIGEHLAYEYARRGARLALVARRTDRLQKVAERARQMGSPDVIVITADVSKVED  110

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R VD+T+N FG +DHLVNNA
Sbjct  111  CKRFVDKTVNHFGQLDHLVNNA  132


 Score = 84.3 bits (207),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 7/76 (9%)
 Frame = -2

Query  247  ITGASSGIGE-------HLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQA  89
            ITGASSGIGE       HLA+EYA RGARL LAARR+   + VA +A +LGSPDAI ++ 
Sbjct  303  ITGASSGIGEVLLWAMKHLAHEYANRGARLALAARREHRPRAVAEKASQLGSPDAIVVRV  362

Query  88   DVSNLDDCRRIVDQTI  41
            DVS  +DC++ V++ +
Sbjct  363  DVSKAEDCKQFVNKAV  378



>gb|EYU23068.1| hypothetical protein MIMGU_mgv1a009201mg [Erythranthe guttata]
Length=349

 Score =   123 bits (308),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYAKRGA LVLAARR+ SLQEVA  A + GSPD + ++ADVS ++D
Sbjct  52   ITGASSGIGESLAYEYAKRGACLVLAARRERSLQEVAETARDCGSPDVVVVRADVSKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CR+I+D T+N FG +DHLVNNA
Sbjct  112  CRKIIDHTMNHFGRLDHLVNNA  133



>ref|XP_004297522.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Fragaria vesca subsp. vesca]
Length=348

 Score =   122 bits (307),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA RGA L L ARR+  LQ+VANRAV +GSPD + I ADVS ++D
Sbjct  52   ITGASSGIGEHLAYEYASRGACLALVARREHRLQQVANRAVSIGSPDVLIIPADVSKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R VD T+N FG +DHLVNNA
Sbjct  112  CKRFVDATVNHFGRLDHLVNNA  133



>ref|XP_009629548.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
tomentosiformis]
Length=348

 Score =   122 bits (306),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYA+RGA L +AARR+ SL+EVA RA++LGSPD + + ADVS ++D
Sbjct  55   ITGASSGIGEYLAYEYARRGACLTIAARREKSLREVAERALDLGSPDVLVVPADVSKVED  114

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+RIVD+T++ FG +DHLVNNA
Sbjct  115  CKRIVDKTMSHFGRLDHLVNNA  136



>ref|XP_004503736.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cicer arietinum]
Length=351

 Score =   122 bits (306),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L L+ARR+ +L+EVA+RA + GSPD I I+ADVS ++D
Sbjct  52   ITGASSGIGEHLAYEYAKRGALLALSARRETALREVADRARDYGSPDVIIIRADVSKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R++D+T+  FG +DHLVNNA
Sbjct  112  CLRLIDETVQHFGRLDHLVNNA  133



>ref|XP_010695677.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Beta 
vulgaris subsp. vulgaris]
Length=348

 Score =   122 bits (306),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA LVL+ARR+ SL+EVA+  +E+G+PDAI +  DV+ ++D
Sbjct  52   ITGASSGIGEHLAYEYAKRGACLVLSARREGSLREVADLCLEMGAPDAIVVSGDVAKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRI+D TI+ +G +DHLVNNA
Sbjct  112  CRRIIDATISRYGRLDHLVNNA  133



>ref|XP_008439964.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=349

 Score =   122 bits (306),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAY+YA+RGARL L  RR+  L EVA+ A   GSPD I I ADVSNL D
Sbjct  52   ITGASSGIGEHLAYQYAQRGARLALVDRRERPLHEVADIARYYGSPDIITIPADVSNLQD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRI+D+TIN FG +DHLVNNA
Sbjct  112  CRRIIDETINHFGRLDHLVNNA  133



>ref|XP_010026329.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Eucalyptus 
grandis]
 gb|KCW83128.1| hypothetical protein EUGRSUZ_B00089 [Eucalyptus grandis]
Length=349

 Score =   122 bits (305),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYA+RGA L L ARR+ SL+EVA  A ELGSPD I IQADVS +DD
Sbjct  52   ITGASSGIGEYLAYEYARRGACLALVARRENSLREVAEGARELGSPDVIVIQADVSQVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR+V++T+N F  +DHLVNNA
Sbjct  112  CRRLVNETMNHFQRLDHLVNNA  133



>ref|XP_009602452.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
tomentosiformis]
Length=353

 Score =   121 bits (304),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGARLVLAARR  SLQ+VA+ A  LGSPD + + ADVS ++D
Sbjct  56   ITGASSGIGEHLAYEYAKRGARLVLAARRHRSLQQVADMAYWLGSPDVVPVHADVSKVED  115

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R++++ IN FG +DHLV NA
Sbjct  116  CQRLIEEAINNFGRLDHLVINA  137



>ref|XP_009359394.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Pyrus 
x bretschneideri]
Length=312

 Score =   120 bits (301),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGARL LAARR+  L+ VA++A  +GSPD I + ADVS L+ 
Sbjct  52   ITGASSGIGEHLAYEYAKRGARLALAARREDRLRAVADKARRIGSPDVIVLPADVSKLEH  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R+V++T+N FG +DHLVNNA
Sbjct  112  CNRVVNETVNHFGQLDHLVNNA  133



>ref|XP_008344913.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Malus 
domestica]
 ref|XP_008367477.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Malus 
domestica]
Length=350

 Score =   120 bits (302),  Expect = 9e-31, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGARL L  R + +L+EV +RA + GSPD + I+ADVS ++D
Sbjct  53   ITGASSGIGEHLAYEYAKRGARLALVGRSENALREVVDRASDFGSPDVLMIRADVSKVED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+RIVD T+N +G +DHLVNNA
Sbjct  113  CKRIVDDTMNHYGRLDHLVNNA  134



>ref|XP_008239510.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Prunus 
mume]
Length=314

 Score =   120 bits (301),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGARL LAARR+  L+ VA++A  LGSPDAI + ADVS L+ 
Sbjct  52   ITGASSGIGEHLAYEYAKRGARLALAARREDRLRAVADKARGLGSPDAIVLPADVSILEH  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R+V++T+N FG +DHLVNNA
Sbjct  112  CNRLVNETVNHFGQLDHLVNNA  133



>ref|XP_010249449.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=351

 Score =   120 bits (302),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAY+YAKRGARL+L ARRK  LQEVA +A   GSPD + +QADVS +DD
Sbjct  54   ITGASSGIGEQLAYQYAKRGARLLLVARRKNCLQEVAEKARGFGSPDVVVVQADVSKVDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R VD+ I+ FG +DHLV+NA
Sbjct  114  CKRFVDEAISHFGRMDHLVSNA  135



>ref|XP_007210136.1| hypothetical protein PRUPE_ppa022641mg [Prunus persica]
 gb|EMJ11335.1| hypothetical protein PRUPE_ppa022641mg [Prunus persica]
Length=310

 Score =   120 bits (300),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGARL LAARR+  L+ VA++A  LGSPDAI + ADVS L+ 
Sbjct  52   ITGASSGIGEHLAYEYAKRGARLALAARREDRLRAVADKARGLGSPDAIVLPADVSILEH  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R+V++T+N FG +DHLVNNA
Sbjct  112  CNRLVNETVNHFGQLDHLVNNA  133



>ref|XP_010086989.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
 gb|EXB25268.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
Length=311

 Score =   120 bits (300),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG SSGIGEHLAYEYA+RGA L L ARR+  L+ VA +AV LGSPDAI I ADVS ++D
Sbjct  53   ITGGSSGIGEHLAYEYARRGASLALVARREERLKAVATKAVGLGSPDAIVICADVSEVED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R+VD+T++ FG +DHLVNNA
Sbjct  113  CKRLVDETMDHFGQLDHLVNNA  134



>ref|XP_006366592.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
tuberosum]
Length=353

 Score =   120 bits (301),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAK+GARLVLAARR+ SL++VA+ A  LGSP  I+I ADVS ++D
Sbjct  56   ITGASSGIGEHLAYEYAKKGARLVLAARRRKSLEQVADMAYWLGSPRVISIHADVSKVED  115

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R++++TI+ FG +DHLV+NA
Sbjct  116  CQRLIEETISNFGRLDHLVSNA  137



>ref|XP_004297523.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Fragaria vesca subsp. vesca]
Length=412

 Score =   120 bits (301),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGARL L  RR+ +L+EV +RAV  G PD I I ADVS  +D
Sbjct  115  ITGASSGIGEHLAYEYARRGARLALVGRRENALREVVDRAVNCGCPDVIMIVADVSKAED  174

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R+VD+TI+ FG +DHLVNNA
Sbjct  175  CKRLVDETISHFGRLDHLVNNA  196



>ref|XP_004298550.1| PREDICTED: uncharacterized oxidoreductase YqjQ-like [Fragaria 
vesca subsp. vesca]
Length=206

 Score =   116 bits (290),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEY +RGARL LAARR+  L EV ++A  LGSPDAI I ADVS L+D
Sbjct  53   ITGASSGIGEHLAYEYGRRGARLALAARREDRLFEVVDKARRLGSPDAIMILADVSKLED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R+V+ T+N FG ++HLVNNA
Sbjct  113  CNRLVNDTVNHFGQLNHLVNNA  134



>ref|XP_010323832.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
lycopersicum]
Length=353

 Score =   119 bits (297),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAK+GARLVLAARR  SL++VA+ A  LGSP  I++ ADVS ++D
Sbjct  56   ITGASSGIGEHLAYEYAKKGARLVLAARRHKSLEQVADMAYWLGSPHVISVHADVSKVED  115

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R++++TI  FG +DHLV+NA
Sbjct  116  CKRLINETITNFGRLDHLVSNA  137



>dbj|BAK03741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   119 bits (297),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L L ARR+ SL+EVA+ A  LGSP+ + + ADVS  DD
Sbjct  69   ITGASSGIGEHLAYEYAKRGANLALVARREASLREVADNASALGSPNVLVLPADVSKPDD  128

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CR+ +D T+ +FG +DHLVNNA
Sbjct  129  CRKFMDDTVAYFGRLDHLVNNA  150



>gb|KDP22588.1| hypothetical protein JCGZ_26419 [Jatropha curcas]
Length=302

 Score =   117 bits (294),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYA++GARL LAARR+  LQ VA++A +LGSPD IA++ DVS ++D
Sbjct  45   ITGASSGIGEHIAYEYARKGARLALAARREDRLQAVADKARKLGSPDVIAMRTDVSRIED  104

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +D+  N FG +DHLVNNA
Sbjct  105  CKRFIDEAFNHFGRLDHLVNNA  126



>ref|XP_010250644.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=349

 Score =   118 bits (296),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEY +RGARLVL ARR+ SL+EVA +A +LGSPD + ++ADVS ++D
Sbjct  52   ITGASSGIGEHLAYEYGRRGARLVLVARRENSLREVAKKAGQLGSPDVLVVRADVSKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R + + +N FG +DHL+ NA
Sbjct  112  CKRFIQEAVNHFGRIDHLICNA  133



>ref|XP_008392822.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Malus 
domestica]
Length=349

 Score =   118 bits (295),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGA L L ARR+  L++VAN A+  GSPD +AI ADVS ++D
Sbjct  52   ITGASSGIGEHLAYEYARRGACLALVARRENRLRDVANTAICFGSPDVLAITADVSRVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R VD T+N FG +DHLVNNA
Sbjct  112  CKRFVDVTVNHFGRLDHLVNNA  133



>ref|XP_007160005.1| hypothetical protein PHAVU_002G285000g [Phaseolus vulgaris]
 gb|ESW31999.1| hypothetical protein PHAVU_002G285000g [Phaseolus vulgaris]
Length=347

 Score =   117 bits (294),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGARL L ARR+  ++EVA  A  LGSPD I I ADVS   D
Sbjct  52   ITGASSGIGEHLAYEYAKRGARLALVARRENRIKEVAGNAKLLGSPDVITIPADVSRPQD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V+ TIN FG +DHLVNNA
Sbjct  112  CQRFVESTINHFGRLDHLVNNA  133



>ref|XP_004503837.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cicer arietinum]
Length=347

 Score =   117 bits (294),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEY KRGARL L ARR+  L EVA++A   GSPD I I ADVS + D
Sbjct  52   ITGASSGIGEHMAYEYGKRGARLALVARRENRLNEVASKAKFFGSPDVITIPADVSCVQD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R VD T+N FG +DHLVNNA
Sbjct  112  CKRFVDLTVNHFGQLDHLVNNA  133



>gb|ABS28874.1| steroleosin-A [Arachis hypogaea]
 gb|ABX38844.1| steroleosin A [Arachis hypogaea]
Length=349

 Score =   117 bits (294),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYAKRGA L L+ARR+ +L +VA+ A  LGSPD I ++ADVS  +D
Sbjct  52   ITGASSGIGEYLAYEYAKRGACLALSARRETALHQVADTARHLGSPDVIVMRADVSKPED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R++DQT+N FG +DHLVNNA
Sbjct  112  CMRLIDQTVNHFGRLDHLVNNA  133



>ref|XP_010656935.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Vitis 
vinifera]
Length=331

 Score =   117 bits (293),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK GA L L ARRK  L+ VA RA  LGSPD +A++ADVSN++D
Sbjct  55   ITGASSGIGEHMAYEYAKMGACLALVARRKEKLEAVAARARGLGSPDVLALRADVSNVND  114

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +D TIN FG ++HLVNNA
Sbjct  115  CKRSIDDTINHFGKLNHLVNNA  136



>ref|XP_002322681.2| hypothetical protein POPTR_0016s04940g [Populus trichocarpa]
 gb|EEF04442.2| hypothetical protein POPTR_0016s04940g [Populus trichocarpa]
Length=326

 Score =   117 bits (293),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA+RGARL L ARR+  L+EVA++A ELGSP+A  I+A+V+ ++D
Sbjct  54   ITGASSGIGEGLAYEYARRGARLALVARREDRLREVADKAHELGSPEAFVIRANVAKVED  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+RIVD+ +N FG +DHLV+NA
Sbjct  114  CKRIVDEAVNHFGQLDHLVSNA  135



>emb|CBI38151.3| unnamed protein product [Vitis vinifera]
Length=370

 Score =   117 bits (294),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK GA L L ARRK  L+ VA RA  LGSPD +A++ADVSN++D
Sbjct  94   ITGASSGIGEHMAYEYAKMGACLALVARRKEKLEAVAARARGLGSPDVLALRADVSNVND  153

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +D TIN FG ++HLVNNA
Sbjct  154  CKRSIDDTINHFGKLNHLVNNA  175



>ref|XP_010442549.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B [Camelina 
sativa]
Length=350

 Score =   117 bits (293),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA RGA L L ARRK  L+EVA  A E+GSP+   + ADVS  DD
Sbjct  52   ITGASSGIGEHLAYEYASRGACLALTARRKNRLEEVAEIAREIGSPNVFTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR+VD TI  FG +DHLVNNA
Sbjct  112  CRRLVDDTITHFGRLDHLVNNA  133



>ref|XP_010482368.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Camelina 
sativa]
Length=350

 Score =   117 bits (292),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA RGA L L ARRK  L+EVA  A E+GSP+   + ADVS  DD
Sbjct  52   ITGASSGIGEHLAYEYASRGACLALTARRKNRLEEVAEIAREIGSPNVFTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR+VD TI  FG +DHLVNNA
Sbjct  112  CRRLVDDTITHFGRLDHLVNNA  133



>ref|NP_568742.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
 ref|NP_680418.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
 sp|P0DKC6.1|HSD1B_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase 1B; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase 1B; AltName: Full=Hydroxysteroid 
dehydrogenase 1; Short=AtHSD1 [Arabidopsis 
thaliana]
 sp|P0DKC5.1|HSD1A_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase 1A; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase 1A; AltName: Full=Hydroxysteroid 
dehydrogenase 1; Short=AtHSD1 [Arabidopsis 
thaliana]
 gb|AAL38621.1|AF446888_1 AT5g50700/MFB16_9 [Arabidopsis thaliana]
 dbj|BAA96983.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 dbj|BAB09145.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AAK96564.1| AT5g50700/MFB16_9 [Arabidopsis thaliana]
 gb|AAL32846.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AAM10215.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 dbj|BAD95411.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AED95967.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
 gb|AED95981.1| hydroxysteroid dehydrogenase 1 [Arabidopsis thaliana]
Length=349

 Score =   116 bits (291),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA RGA L L ARRK  L+EVA  A ELGSP+ + + ADVS  DD
Sbjct  52   ITGASSGIGEQLAYEYACRGACLALTARRKNRLEEVAEIARELGSPNVVTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD TI  FG +DHLVNNA
Sbjct  112  CRRIVDDTITHFGRLDHLVNNA  133



>ref|XP_002865819.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42078.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=349

 Score =   116 bits (291),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA RGA L L ARRK  L+EVA  A ELGSP+ + + ADVS  DD
Sbjct  52   ITGASSGIGEQLAYEYACRGACLALTARRKNRLEEVAEIARELGSPNVVTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD TI  FG +DHLVNNA
Sbjct  112  CRRIVDDTITHFGRLDHLVNNA  133



>ref|XP_004235330.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
lycopersicum]
Length=352

 Score =   116 bits (291),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYA+RGA L +AARR+ SL+EVA RA++LG+ D + + ADVS ++D
Sbjct  55   ITGASSGIGEYLAYEYARRGACLTIAARREKSLREVAERALDLGALDVLVVPADVSKVED  114

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR+VD+T++ +G +DHLVNNA
Sbjct  115  CRRVVDKTMSHYGRLDHLVNNA  136



>ref|XP_004145220.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
 ref|XP_004153124.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
 ref|XP_004162135.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
 gb|KGN64428.1| hypothetical protein Csa_1G051660 [Cucumis sativus]
Length=349

 Score =   116 bits (290),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA LVL ARR+  L+EVA+ A   GSP  I I+ADVS  +D
Sbjct  52   ITGASSGIGEHLAYEYAKRGACLVLVARRQNLLEEVADIARYYGSPGVITIKADVSKFED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR++++T+N FG +DHLVNNA
Sbjct  112  CRRVINETMNNFGRLDHLVNNA  133



>ref|XP_002322680.1| hypothetical protein POPTR_0016s04930g [Populus trichocarpa]
 gb|EEF04441.1| hypothetical protein POPTR_0016s04930g [Populus trichocarpa]
Length=311

 Score =   115 bits (289),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA RGARL L ARR+  L+ VA++A  LGSPD   ++AD+S ++D
Sbjct  53   ITGASSGIGEDLAYEYAVRGARLALVARREDRLRAVADKARNLGSPDVFQVRADISKVED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRI+D+T+N FG +DHLVNNA
Sbjct  113  CRRIIDETLNHFGQLDHLVNNA  134



>ref|XP_010249087.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Nelumbo nucifera]
Length=379

 Score =   116 bits (291),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA LVL ARR+ SL+EVA +AV+LGSPD +A+ ADVS + +
Sbjct  82   ITGASSGIGEHIAYEYAKKGASLVLVARRENSLREVARKAVQLGSPDVLAVPADVSKVHE  141

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ V++ +N FG +DHLV NA
Sbjct  142  CKKFVEEAVNHFGRLDHLVCNA  163



>gb|KFK22922.1| hypothetical protein AALP_AAs48765U000100 [Arabis alpina]
Length=349

 Score =   116 bits (290),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEY  RGA L L ARRK  L+EVA  A E+GSP+ I + ADVS  DD
Sbjct  52   ITGASSGIGEQLAYEYGSRGACLALTARRKNRLEEVAEIAREMGSPNVITVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD TI+ FG +DHLVNNA
Sbjct  112  CRRIVDDTISHFGRLDHLVNNA  133



>ref|XP_009127346.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B [Brassica 
rapa]
Length=349

 Score =   116 bits (290),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA +GA L L ARRK  L+EVA  A E+GSP+ + + ADVS  DD
Sbjct  52   ITGASSGIGEQLAYEYASKGACLALTARRKNRLEEVAEIAREVGSPNVVTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD+TI+ FG +DHLVNNA
Sbjct  112  CRRIVDETISHFGRLDHLVNNA  133



>emb|CDY16353.1| BnaA02g11570D [Brassica napus]
Length=349

 Score =   116 bits (290),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA +GA L L ARRK  L+EVA  A E+GSP+ + + ADVS  DD
Sbjct  52   ITGASSGIGEQLAYEYASKGACLALTARRKNRLEEVAEIAREVGSPNVVTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD+TI+ FG +DHLVNNA
Sbjct  112  CRRIVDETISHFGRLDHLVNNA  133



>gb|ACG69523.1| steroleosin SLO1-2 [Brassica napus]
 emb|CDY68167.1| BnaCnng57830D [Brassica napus]
Length=349

 Score =   116 bits (290),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA +GA L L ARRK  L+EVA  A E+GSP+ + + ADVS  DD
Sbjct  52   ITGASSGIGEQLAYEYASKGACLALTARRKNRLEEVAEIAREVGSPNVVTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD+TI+ FG +DHLVNNA
Sbjct  112  CRRIVDETISHFGRLDHLVNNA  133



>gb|ACG69522.1| steroleosin SLO1-1 [Brassica napus]
Length=349

 Score =   116 bits (290),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA +GA L L ARRK  L+EVA  A E+GSP+ + + ADVS  DD
Sbjct  52   ITGASSGIGEQLAYEYASKGACLALTARRKNRLEEVAEIAREVGSPNVVTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD+TI+ FG +DHLVNNA
Sbjct  112  CRRIVDETISHFGRLDHLVNNA  133



>gb|ABO71657.1| short-chain dehydrogenase reductase [Brassica napus]
Length=349

 Score =   116 bits (290),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA +GA L L ARRK  L+EVA  A E+GSP+ + + ADVS  DD
Sbjct  52   ITGASSGIGEQLAYEYASKGACLALTARRKNRLEEVAEIAREVGSPNVVTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD+TI+ FG +DHLVNNA
Sbjct  112  CRRIVDETISHFGRLDHLVNNA  133



>ref|XP_010241532.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=316

 Score =   115 bits (288),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEY +RGA LVL ARR+ SL+EVA RA ELGSPD + + ADVS  +D
Sbjct  52   ITGASSGIGEHLAYEYGRRGAFLVLVARREKSLKEVAKRAAELGSPDVLVVCADVSKPED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +D+ ++ FG +DHL+ NA
Sbjct  112  CQRFIDEAVSHFGRLDHLICNA  133



>gb|ABM90633.1| short-chain dehydrogenase reductase [Brassica napus]
 gb|ADW77633.1| steroleosin-A [Brassica napus]
 gb|ADW77634.1| steroleosin-A [Brassica napus]
Length=349

 Score =   115 bits (289),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA +GA L L ARRK  L+EVA  A E+GSP+ + + ADVS  DD
Sbjct  52   ITGASSGIGEQLAYEYASKGACLALTARRKNRLEEVAEIAREVGSPNVVTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD+TI+ FG +DHLVNNA
Sbjct  112  CRRIVDETISHFGRLDHLVNNA  133



>gb|EMT26675.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Aegilops 
tauschii]
Length=307

 Score =   115 bits (287),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L L ARR+ SL+EVA+ A  LGSP  + + ADVS  DD
Sbjct  53   ITGASSGIGEHLAYEYAKRGANLALVARREASLREVADNASALGSPSVLVLPADVSKPDD  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C + +D T+ +FG +DHLVNNA
Sbjct  113  CLKFIDDTVAYFGRLDHLVNNA  134



>ref|XP_010536607.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Tarenaya 
hassleriana]
Length=305

 Score =   114 bits (286),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            +TGASSGIGEH+AYEYA+RGARL L ARR+  L+ VA ++  LGSPD + I  DVSN++D
Sbjct  52   VTGASSGIGEHIAYEYARRGARLALVARREDRLRAVAEKSRRLGSPDVVVISGDVSNVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V +TIN FG +DHLVNNA
Sbjct  112  CKRFVQETINHFGRLDHLVNNA  133



>ref|XP_003579631.2| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brachypodium 
distachyon]
Length=352

 Score =   115 bits (288),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L L ARR+ SL++VA+ A+ LGSP  + + ADVS  D+
Sbjct  55   ITGASSGIGEHLAYEYAKRGANLALVARREASLRKVADNALALGSPVVLVLPADVSKPDE  114

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CR+ +D T+ +FG +DHLVNNA
Sbjct  115  CRKFIDDTVTYFGRLDHLVNNA  136



>ref|XP_006282100.1| hypothetical protein CARUB_v10028347mg [Capsella rubella]
 gb|EOA14998.1| hypothetical protein CARUB_v10028347mg [Capsella rubella]
Length=349

 Score =   115 bits (287),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA RGA L L ARRK  L+EVA  A E+GSP+ I + ADVS  DD
Sbjct  52   ITGASSGIGERLAYEYACRGACLALTARRKNRLEEVAEIAREVGSPNVITVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD TI  FG +DHLVNNA
Sbjct  112  CRRIVDDTITHFGRLDHLVNNA  133



>ref|XP_010250645.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=353

 Score =   115 bits (287),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIG+ LAY+YAK+GA LVL ARR+  L+EVA +A  LGSPD +++QADVS +DD
Sbjct  55   ITGASSGIGKQLAYQYAKKGACLVLVARRQNLLEEVAEKARLLGSPDVMSVQADVSKVDD  114

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +D+T+N FG +DHLV NA
Sbjct  115  CQRFIDETVNHFGRLDHLVTNA  136



>gb|KHN16857.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Glycine 
soja]
Length=377

 Score =   115 bits (287),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEY +RGARL L ARR+  L+EVA+ A   GSP+ I I ADVS+  D
Sbjct  82   ITGASSGIGEHLAYEYGRRGARLALVARRENRLKEVASIAKLFGSPEVIIIPADVSSSQD  141

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R VD TIN FG +DHLVNNA
Sbjct  142  CKRFVDSTINHFGQLDHLVNNA  163



>ref|NP_001242368.1| uncharacterized protein LOC100787835 [Glycine max]
 gb|ACU17782.1| unknown [Glycine max]
Length=377

 Score =   115 bits (287),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEY +RGARL L ARR+  L+EVA+ A   GSP+ I I ADVS+  D
Sbjct  82   ITGASSGIGEHLAYEYGRRGARLALVARRENRLKEVASIAKLFGSPEVIIIPADVSSSQD  141

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R VD TIN FG +DHLVNNA
Sbjct  142  CKRFVDSTINHFGQLDHLVNNA  163



>ref|XP_002511145.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
 gb|EEF51747.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
Length=349

 Score =   114 bits (286),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L L ARR+  L++V  RA E GSPD + I ADV  +DD
Sbjct  52   ITGASSGIGEHLAYEYAKRGACLALVARREKRLRDVVYRAEEYGSPDVLMILADVQKVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R+V++TI+ FG +DHLVNNA
Sbjct  112  CNRLVEETISHFGRLDHLVNNA  133



>emb|CDY05818.1| BnaA10g06020D [Brassica napus]
Length=156

 Score =   110 bits (276),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG+SSGIGEHLAYEYA+RGA L L ARR+  LQ VANR   LGSPD   ++ DVS ++D
Sbjct  52   ITGSSSGIGEHLAYEYARRGAYLTLVARREDRLQLVANRCRRLGSPDVAVVRGDVSVIED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +++TI+ FG +DHLVNNA
Sbjct  112  CKRFIEETISRFGRLDHLVNNA  133



>ref|XP_008446259.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=349

 Score =   114 bits (286),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA LVL ARR+  L+EVA+ A   GSP+ I I+ADVS  +D
Sbjct  52   ITGASSGIGEHLAYEYAKRGACLVLVARRQNLLEEVADIARYYGSPNVITIKADVSKFED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR++++T+N F  +DHLVNNA
Sbjct  112  CRRVINETMNHFRRLDHLVNNA  133



>ref|XP_007211157.1| hypothetical protein PRUPE_ppa027140mg [Prunus persica]
 gb|EMJ12356.1| hypothetical protein PRUPE_ppa027140mg [Prunus persica]
Length=326

 Score =   114 bits (285),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYA+RGA L L ARR+  LQ VA+RA+ +GSPD + I ADVS +++
Sbjct  53   ITGASSGIGEHMAYEYARRGACLALVARRENLLQSVASRAMSIGSPDILVIPADVSKVEN  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR VD  +N FG +DHLVNNA
Sbjct  113  CRRFVDVAVNHFGRLDHLVNNA  134



>ref|XP_010442253.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Camelina 
sativa]
Length=350

 Score =   114 bits (286),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYA RGA L L ARRK  L+EVA  A E+GSP+   + ADVS  DD
Sbjct  52   ITGASSGIGENLAYEYASRGACLALTARRKNRLEEVAEIAREIGSPNVFTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR+VD TI  FG +DHLVNNA
Sbjct  112  CRRLVDDTITHFGRLDHLVNNA  133



>ref|XP_010253812.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=326

 Score =   114 bits (285),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGA LVL ARR+ SL+EVA RA +LGSPD + I+ADVS + +
Sbjct  52   ITGASSGIGEHLAYEYARRGASLVLVARREKSLREVAERARQLGSPDVLVIRADVSKVAE  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R VD+T++ F  +DHLV NA
Sbjct  112  CKRFVDRTMDHFRRMDHLVCNA  133



>ref|XP_008239509.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Prunus 
mume]
Length=343

 Score =   114 bits (284),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYA+RGA L L  RR+  LQ VA+RA+ +GSPD + I ADVS +++
Sbjct  53   ITGASSGIGEHMAYEYARRGACLALVDRRENLLQSVASRAMSIGSPDVLVIPADVSKVEN  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR VD  +N FG +DHLVNNA
Sbjct  113  CRRFVDVAVNHFGRLDHLVNNA  134



>gb|KGN64427.1| hypothetical protein Csa_1G051650 [Cucumis sativus]
Length=331

 Score =   113 bits (283),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAY+YA+RGARL L  RRK  L EVA+ A   GSPD I I ADVS L D
Sbjct  52   ITGASSGIGEHLAYQYAQRGARLALVDRRKSPLHEVADIARYYGSPDVITIPADVSKLQD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
             RRI+  TIN FG +DHLVNNA
Sbjct  112  SRRIIYDTINHFGRLDHLVNNA  133



>emb|CBI38150.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   112 bits (281),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYAK+GA LV+ ARRK  L+EVA +A ELGSPD + +  DVSN+++
Sbjct  8    ITGASSGIGEQMAYEYAKKGACLVIVARRKKKLEEVAAQARELGSPDVVVVCGDVSNINE  67

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+ I+ FG +DHLVNNA
Sbjct  68   CKQFIDEAIHHFGRLDHLVNNA  89



>ref|XP_010656930.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B isoform X2 
[Vitis vinifera]
Length=282

 Score =   112 bits (281),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYAK+GA LV+ ARRK  L+EVA +A ELGSPD + +  DVSN+++
Sbjct  55   ITGASSGIGEQMAYEYAKKGACLVIVARRKKKLEEVAAQARELGSPDVVVVCGDVSNINE  114

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+ I+ FG +DHLVNNA
Sbjct  115  CKQFIDEAIHHFGRLDHLVNNA  136



>ref|XP_004162136.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
Length=349

 Score =   113 bits (283),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAY+YA+RGARL L  RRK  L EVA+ A   GSPD I I ADVS L D
Sbjct  52   ITGASSGIGEHLAYQYAQRGARLALVDRRKSPLHEVADIARYYGSPDVITIPADVSKLQD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
             RRI+  TIN FG +DHLVNNA
Sbjct  112  SRRIIYDTINHFGRLDHLVNNA  133



>ref|XP_004145221.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
 ref|XP_004153123.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
Length=349

 Score =   113 bits (283),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAY+YA+RGARL L  RRK  L EVA+ A   GSPD I I ADVS L D
Sbjct  52   ITGASSGIGEHLAYQYAQRGARLALVDRRKSPLHEVADIARYYGSPDVITIPADVSKLQD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
             RRI+  TIN FG +DHLVNNA
Sbjct  112  SRRIIYDTINHFGRLDHLVNNA  133



>ref|XP_009124895.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Brassica 
rapa]
Length=299

 Score =   113 bits (282),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG+SSGIGEHLAYEYA+RGA L L ARR+  LQ VANR   LGSPD   ++ DVS ++D
Sbjct  52   ITGSSSGIGEHLAYEYARRGAYLTLVARREDRLQLVANRCQRLGSPDVAVVRGDVSVIED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +++TI+ FG +DHLVNNA
Sbjct  112  CKRFIEETISRFGRLDHLVNNA  133



>ref|XP_010270764.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X1 [Nelumbo nucifera]
Length=321

 Score =   113 bits (282),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAK+GA LVL ARR+  L++VA +A +LGSPD + I+ADVS +D+
Sbjct  53   ITGASSGIGEHLAYEYAKKGAFLVLVARREEMLEQVAKKAGQLGSPDVLEIRADVSQVDE  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V +T+  FG +DHLV NA
Sbjct  113  CKRFVQETVRRFGRLDHLVCNA  134



>ref|XP_010663769.1| PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydroxysteroid dehydrogenase 
1B-like [Vitis vinifera]
Length=348

 Score =   113 bits (283),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            +TGASSGIGEH+AYEYAKRGA LVLA+ R+  LQEV   A  LG+PD   + ADVS L+D
Sbjct  52   VTGASSGIGEHVAYEYAKRGACLVLASTRENRLQEVGXVARALGAPDVRVVPADVSKLED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+RIVD+  N FG VDHLVNNA
Sbjct  112  CKRIVDEAANHFGRVDHLVNNA  133



>ref|XP_010270763.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=318

 Score =   112 bits (281),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA LVL ARR+  L EVA +A +LGSPD   I+ADVS  D+
Sbjct  52   ITGASSGIGEHLAYEYAKRGAFLVLVARREKMLVEVAKKAGQLGSPDVFVIRADVSQADE  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V +T+  FG +DHLV NA
Sbjct  112  CKRFVQETVRRFGRLDHLVCNA  133



>ref|XP_002266761.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B isoform X1 
[Vitis vinifera]
Length=326

 Score =   112 bits (281),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYAK+GA LV+ ARRK  L+EVA +A ELGSPD + +  DVSN+++
Sbjct  55   ITGASSGIGEQMAYEYAKKGACLVIVARRKKKLEEVAAQARELGSPDVVVVCGDVSNINE  114

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+ I+ FG +DHLVNNA
Sbjct  115  CKQFIDEAIHHFGRLDHLVNNA  136



>ref|XP_010929562.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X3 [Elaeis guineensis]
Length=349

 Score =   113 bits (282),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AY+YAK+GA LVL ARR+ SL EVA RA ELGSPD + + ADV+  ++
Sbjct  52   ITGASSGIGEQMAYQYAKKGACLVLVARRESSLLEVAKRAQELGSPDVLVLPADVAKPEE  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR +D T++ FG +DHLVNNA
Sbjct  112  CRRFIDATLSHFGRLDHLVNNA  133



>ref|XP_006653339.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Oryza 
brachyantha]
Length=354

 Score =   112 bits (281),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGA L L ARR+ SL+EV + A  LGSP  +   ADVS+ DD
Sbjct  57   ITGASSGIGEHLAYEYARRGAYLALVARREESLREVGDAAAALGSPGVLVTPADVSSPDD  116

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CR+ VD TI +FG +DHLVNNA
Sbjct  117  CRKFVDDTIRYFGRLDHLVNNA  138



>ref|XP_006402075.1| hypothetical protein EUTSA_v10015475mg [Eutrema salsugineum]
 gb|ESQ43528.1| hypothetical protein EUTSA_v10015475mg [Eutrema salsugineum]
Length=349

 Score =   112 bits (281),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYA RGA L L ARRK  L+EVA  A E+GSP+   + ADVS  DD
Sbjct  52   ITGASSGIGENLAYEYASRGACLALTARRKNRLEEVAEIAREIGSPNVFTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD+TI  FG +DHLVN A
Sbjct  112  CRRIVDETITHFGRLDHLVNIA  133



>ref|XP_009134064.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brassica 
rapa]
Length=341

 Score =   112 bits (281),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA +GA L L A RK  L+EVA  A E+GSP+ + + ADVS  DD
Sbjct  52   ITGASSGIGERLAYEYASKGACLALTALRKNRLEEVAEIAREVGSPNVVTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD+TI+ FG +DHLVNNA
Sbjct  112  CRRIVDETISHFGRLDHLVNNA  133



>emb|CDY34029.1| BnaC03g27860D [Brassica napus]
Length=341

 Score =   112 bits (281),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA +GA L L A RK  L+EVA  A E+GSP+ + + ADVS  DD
Sbjct  52   ITGASSGIGERLAYEYASKGACLALTALRKNRLEEVAEIAREVGSPNVVTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD+TI+ FG +DHLVNNA
Sbjct  112  CRRIVDETISHFGRLDHLVNNA  133



>gb|ACG69524.1| steroleosin SLO1-3 [Brassica napus]
Length=341

 Score =   112 bits (281),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA +GA L L A RK  L+EVA  A E+GSP+ + + ADVS  DD
Sbjct  52   ITGASSGIGERLAYEYASKGACLALTALRKNRLEEVAEIAREVGSPNVVTVHADVSKPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRRIVD+TI+ FG +DHLVNNA
Sbjct  112  CRRIVDETISHFGRLDHLVNNA  133



>ref|XP_004153125.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like 
[Cucumis sativus]
 gb|KGN64429.1| hypothetical protein Csa_1G051670 [Cucumis sativus]
Length=347

 Score =   112 bits (281),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAKRGA L L ARR+  L+EVA  A  LGSP A+ I ADVSN+DD
Sbjct  52   ITGASSGIGEHVAYEYAKRGAYLALVARREHRLREVAEVAEILGSPFALLIHADVSNVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V  T+  FG +DHLVNNA
Sbjct  112  CKRCVQTTLTHFGRLDHLVNNA  133



>ref|XP_004977951.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Setaria 
italica]
Length=350

 Score =   112 bits (281),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKR A L L ARR++SL+EV +RA+ LGSP  + + ADVS  +D
Sbjct  52   ITGASSGIGEHLAYEYAKRRAYLALVARREMSLREVGDRALGLGSPGVLVLPADVSKPED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C + +D TI +FG +DHLVNNA
Sbjct  112  CEKFIDDTIRYFGRLDHLVNNA  133



>ref|XP_010929561.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Elaeis guineensis]
Length=389

 Score =   113 bits (282),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AY+YAK+GA LVL ARR+ SL EVA RA ELGSPD + + ADV+  ++
Sbjct  52   ITGASSGIGEQMAYQYAKKGACLVLVARRESSLLEVAKRAQELGSPDVLVLPADVAKPEE  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR +D T++ FG +DHLVNNA
Sbjct  112  CRRFIDATLSHFGRLDHLVNNA  133



>ref|XP_010929560.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X1 [Elaeis guineensis]
Length=390

 Score =   113 bits (282),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AY+YAK+GA LVL ARR+ SL EVA RA ELGSPD + + ADV+  ++
Sbjct  52   ITGASSGIGEQMAYQYAKKGACLVLVARRESSLLEVAKRAQELGSPDVLVLPADVAKPEE  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR +D T++ FG +DHLVNNA
Sbjct  112  CRRFIDATLSHFGRLDHLVNNA  133



>ref|XP_008811369.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Phoenix 
dactylifera]
Length=330

 Score =   112 bits (279),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AY+YAK+GA LVL ARR+ SL EVA RA ELGSPD + + ADV+  ++
Sbjct  52   ITGASSGIGEQMAYQYAKKGACLVLVARRESSLLEVAKRAQELGSPDVLVLPADVAKPEE  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR +D  I+ FG +DHLVNNA
Sbjct  112  CRRFIDAAISHFGRLDHLVNNA  133



>ref|XP_010555563.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Tarenaya 
hassleriana]
Length=306

 Score =   111 bits (278),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGAR+ L ARR+  L+ VA ++  LGSPD I I  DVS ++D
Sbjct  52   ITGASSGIGEHLAYEYARRGARMALVARREERLRAVAEKSRRLGSPDVIVITGDVSVVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V  TI+ FG +DHLVNNA
Sbjct  112  CKRFVQGTIDHFGRLDHLVNNA  133



>ref|XP_007211139.1| hypothetical protein PRUPE_ppa026374mg [Prunus persica]
 gb|EMJ12338.1| hypothetical protein PRUPE_ppa026374mg [Prunus persica]
Length=337

 Score =   112 bits (279),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/74 (68%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  223  GEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDDCRRIVDQT  44
            G+HLAYEYAKRGARLVL  RR+ SL+EV +RA + GSPD + ++ADVS ++DC+RIVD+T
Sbjct  47   GKHLAYEYAKRGARLVLVGRREDSLREVVDRASDCGSPDVLMVRADVSKVEDCKRIVDET  106

Query  43   INWFGCVDHLVNNA  2
            IN FG +DHLVNNA
Sbjct  107  INHFGRLDHLVNNA  120



>ref|XP_004162134.1| PREDICTED: hydroxysteroid 11-beta-dehydrogenase 1-like protein-like, 
partial [Cucumis sativus]
Length=429

 Score =   112 bits (280),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAKRGA L L ARR+  L+EVA  A  LGSP A+ I ADVSN+DD
Sbjct  52   ITGASSGIGEHVAYEYAKRGAYLALVARREHRLREVAEVAEILGSPFALLIHADVSNVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V  T+  FG +DHLVNNA
Sbjct  112  CKRCVQTTLTHFGRLDHLVNNA  133


 Score = 81.6 bits (200),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L L ARR+  L+EVA  A  LGSP A+ I AD+S ++D
Sbjct  370  ITGASSGIGEHLAYEYAKRGAYLALVARRENRLREVAAVAQYLGSPYALVIPADISKIED  429



>ref|XP_006436880.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
 gb|ESR50120.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
Length=282

 Score =   111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIG+HLAYEYA+R ARLVL ARR+  L+EVA++A  +GSP A+AI ADVS +DD
Sbjct  52   ITGASSGIGKHLAYEYARRRARLVLVARRERQLREVADQAELMGSPFALAIPADVSKVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  VD T+  FG +DHLV NA
Sbjct  112  CKHFVDVTMEHFGRLDHLVTNA  133



>ref|XP_002318707.2| hypothetical protein POPTR_0012s10370g [Populus trichocarpa]
 gb|EEE96927.2| hypothetical protein POPTR_0012s10370g [Populus trichocarpa]
Length=327

 Score =   111 bits (278),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AY+YA+RGARL L ARR+  L+ VA+ A ++GSPD I I+ADVS ++D
Sbjct  53   ITGASSGIGEQIAYQYARRGARLALVARREDRLRGVASEARKMGSPDVIMIRADVSKVED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R VD+ I  FG +DHLVNNA
Sbjct  113  CKRFVDEAIRHFGQLDHLVNNA  134



>ref|NP_190319.1| hydroxysteroid dehydrogenase 2 [Arabidopsis thaliana]
 sp|Q9STY8.1|HSD2_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase-like 2; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase-like 2; AltName: 
Full=Hydroxysteroid dehydrogenase 2; Short=AtHSD2 [Arabidopsis 
thaliana]
 emb|CAB51207.1| putative protein [Arabidopsis thaliana]
 gb|AEE78268.1| hydroxysteroid dehydrogenase 2 [Arabidopsis thaliana]
Length=308

 Score =   111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA+L L ARRK  L+ VA  + +LGS D I I  DVSN++D
Sbjct  51   ITGASSGIGEHVAYEYAKKGAKLALVARRKDRLEIVAETSRQLGSGDVIIIPGDVSNVED  110

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+TI+ FG +DHL+NNA
Sbjct  111  CKKFIDETIHHFGKLDHLINNA  132



>emb|CDP19890.1| unnamed protein product [Coffea canephora]
Length=494

 Score =   112 bits (281),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHL YEYAKRGA LV+ ARR+  L+EVA  A +LGSPD + I ADV  +DD
Sbjct  48   ITGASSGIGEHLTYEYAKRGACLVIVARRENLLKEVAENARKLGSPDVVPICADVLKVDD  107

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V++T++ FG +DH+VNNA
Sbjct  108  CKRFVEETVDHFGRLDHVVNNA  129



>emb|CDX71662.1| BnaC09g27030D [Brassica napus]
Length=299

 Score =   110 bits (276),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG+SSGIGEHLAYEYA+RGA L L ARR+  L+ VANR   LGSPD   ++ DVS ++D
Sbjct  52   ITGSSSGIGEHLAYEYARRGAYLTLVARREDRLRLVANRCRRLGSPDVAVVRGDVSVIED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +++TI+ FG +DHLVNNA
Sbjct  112  CKRFIEETISRFGRLDHLVNNA  133



>ref|NP_001154667.1| hydroxysteroid dehydrogenase 2 [Arabidopsis thaliana]
 gb|AEE78269.1| hydroxysteroid dehydrogenase 2 [Arabidopsis thaliana]
Length=321

 Score =   111 bits (277),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA+L L ARRK  L+ VA  + +LGS D I I  DVSN++D
Sbjct  51   ITGASSGIGEHVAYEYAKKGAKLALVARRKDRLEIVAETSRQLGSGDVIIIPGDVSNVED  110

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+TI+ FG +DHL+NNA
Sbjct  111  CKKFIDETIHHFGKLDHLINNA  132



>ref|XP_006653338.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Oryza 
brachyantha]
Length=313

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            +TGASSGIGE +AY YA+RGARL L ARR+ SL+EVA RA ELGSPD + +  DV+  DD
Sbjct  71   VTGASSGIGEQVAYRYARRGARLALVARREASLREVAARARELGSPDVLVVPGDVARPDD  130

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR V  T+  FG +DHLVNNA
Sbjct  131  CRRFVQATVEHFGRLDHLVNNA  152



>gb|EPS67142.1| hypothetical protein M569_07637, partial [Genlisea aurea]
Length=294

 Score =   110 bits (276),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE++AYEYAKRGA L L ARR+  LQ+V  +A   GSPD + I  DVS+ DD
Sbjct  34   ITGASSGIGEYMAYEYAKRGASLALVARREDRLQKVGAKARCFGSPDVLVICGDVSSFDD  93

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CR+ V+ T+N FG +DHLVNNA
Sbjct  94   CRKFVNTTVNHFGRLDHLVNNA  115



>ref|XP_007038039.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein, putative 
[Theobroma cacao]
 gb|EOY22540.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein, putative 
[Theobroma cacao]
Length=407

 Score =   111 bits (278),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA++GARL L ARR+  L  VA+ +  LGSPD + I ADVS L+D
Sbjct  149  ITGASSGIGEHLAYEYARKGARLALIARREDRLCVVADESRRLGSPDVVVIPADVSKLED  208

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +D+ +N+FG +DHL +NA
Sbjct  209  CKRFIDKAVNYFGRLDHLASNA  230



>ref|XP_004145219.1| PREDICTED: uncharacterized protein LOC101220214 [Cucumis sativus]
Length=520

 Score =   112 bits (281),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAKRGA L L ARR+  L+EVA  A  LGSP A+ I ADVSN+DD
Sbjct  52   ITGASSGIGEHVAYEYAKRGAYLALVARREHRLREVAEVAEILGSPFALLIHADVSNVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V  T+  FG +DHLVNNA
Sbjct  112  CKRCVQTTLTHFGRLDHLVNNA  133



>ref|XP_010086987.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
 gb|EXB25266.1| Dehydrogenase/reductase SDR family protein 7-like protein [Morus 
notabilis]
Length=373

 Score =   111 bits (278),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEY  RGA L L ARR+  L++V  +A ++GSPD + I ADVS ++D
Sbjct  53   ITGASSGIGEHLAYEYGSRGACLALVARREDRLRDVVEQARDIGSPDVLMIVADVSKVED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+RIVD+T++ FG +DHLVNNA
Sbjct  113  CKRIVDETMDHFGRLDHLVNNA  134



>ref|XP_010251331.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=330

 Score =   110 bits (276),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG SSGIGEHLAYEYAK GA LVL ARR+ SL+EVA +AV LGSPD + + ADVS +D+
Sbjct  83   ITGGSSGIGEHLAYEYAKGGASLVLIARRENSLREVARKAVGLGSPDVLVVGADVSKVDE  142

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ V+  +N FG +DHLV NA
Sbjct  143  CKQFVEAAVNHFGRLDHLVCNA  164



>ref|XP_002511142.1| Glucose 1-dehydrogenase, putative [Ricinus communis]
 gb|EEF51744.1| Glucose 1-dehydrogenase, putative [Ricinus communis]
Length=323

 Score =   110 bits (276),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGARL L ARR+  L +VA+ A E+GSPDAI I  DVS ++D
Sbjct  52   ITGASSGIGEHLAYEYAKRGARLALVARRENRLLQVASIAEEIGSPDAIIIPGDVSKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C   V+ T+  FG +DHLV NA
Sbjct  112  CEDFVNATVKHFGQLDHLVTNA  133



>ref|XP_010536608.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Tarenaya 
hassleriana]
Length=307

 Score =   110 bits (275),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA+RGAR+ L ARR+  L+ VA ++ +LGSPD + I  DVS ++D
Sbjct  52   ITGASSGIGEELAYEYARRGARITLVARREDRLRAVAEKSRQLGSPDVVVIYGDVSVVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V +TIN FG +DHLVNNA
Sbjct  112  CKRFVQETINHFGQLDHLVNNA  133



>ref|XP_006436879.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
 ref|XP_006493235.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Citrus 
sinensis]
 gb|ESR50119.1| hypothetical protein CICLE_v10031927mg [Citrus clementina]
Length=359

 Score =   111 bits (277),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIG+HLAYEYA+R ARLVL ARR+  L+EVA++A  +GSP A+AI ADVS +DD
Sbjct  52   ITGASSGIGKHLAYEYARRRARLVLVARRERQLREVADQAELMGSPFALAIPADVSKVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  VD T+  FG +DHLV NA
Sbjct  112  CKHFVDVTMEHFGRLDHLVTNA  133



>emb|CBI15699.3| unnamed protein product [Vitis vinifera]
Length=162

 Score =   107 bits (267),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAY+YA+RGA LVL AR++ S+QEVA+RA  LGSP+ + I+ADVS ++ 
Sbjct  52   ITGASSGIGEHLAYQYARRGACLVLVARKEKSIQEVADRARSLGSPEVLVIRADVSKVEV  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  VD+ +  F  +DHLVNNA
Sbjct  112  CKSFVDEAVEHFRRLDHLVNNA  133



>dbj|BAA96982.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
Length=303

 Score =   110 bits (274),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG+SSGIGEHLAYEYA+RGA L L ARR+  LQ VA+R  +LGSPD   ++ DVS + D
Sbjct  52   ITGSSSGIGEHLAYEYARRGAYLTLVARREDRLQVVADRCRKLGSPDVAVVRGDVSVIKD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V +TI+ FG +DHLVNNA
Sbjct  112  CKRFVQETISRFGRLDHLVNNA  133



>ref|NP_199871.1| hydroxysteroid dehydrogenase 4 [Arabidopsis thaliana]
 ref|NP_680417.1| hydroxysteroid dehydrogenase 7 [Arabidopsis thaliana]
 sp|P0DKC7.1|HSD4A_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase-like 4A; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase-like 4A; AltName: 
Full=Hydroxysteroid dehydrogenase 4; Short=AtHSD4 [Arabidopsis 
thaliana]
 sp|Q9LUF2.2|HSD4B_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase-like 4B; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase-like 4B; AltName: 
Full=Hydroxysteroid dehydrogenase 7; Short=AtHSD7 [Arabidopsis 
thaliana]
 dbj|BAB09144.1| 11-beta-hydroxysteroid dehydrogenase-like [Arabidopsis thaliana]
 gb|AAY78859.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
thaliana]
 gb|ABG48422.1| At5g50590 [Arabidopsis thaliana]
 gb|AED95966.1| hydroxysteroid dehydrogenase 4 [Arabidopsis thaliana]
 gb|AED95980.1| hydroxysteroid dehydrogenase 7 [Arabidopsis thaliana]
Length=299

 Score =   110 bits (274),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG+SSGIGEHLAYEYA+RGA L L ARR+  LQ VA+R  +LGSPD   ++ DVS + D
Sbjct  52   ITGSSSGIGEHLAYEYARRGAYLTLVARREDRLQVVADRCRKLGSPDVAVVRGDVSVIKD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V +TI+ FG +DHLVNNA
Sbjct  112  CKRFVQETISRFGRLDHLVNNA  133



>ref|XP_011033350.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
Length=537

 Score =   112 bits (279),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA RGARL L ARR+  L+ VA++A  LGSP+   ++ADVS ++D
Sbjct  52   ITGASSGIGEDLAYEYAVRGARLALVARREDRLRAVADKARNLGSPNVFHVRADVSKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+RI+D+T+N FG +DHLVNNA
Sbjct  112  CKRIIDETLNHFGHLDHLVNNA  133


 Score =   109 bits (272),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 55/93 (59%), Positives = 71/93 (76%), Gaps = 11/93 (12%)
 Frame = -2

Query  247  ITGASSGIGE-----------HLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAI  101
            ITGASSGIGE            LAYEYA+RGARL L ARR+  L+EVA++A ELGSP+A+
Sbjct  276  ITGASSGIGEVLLYCMWKKTMGLAYEYARRGARLALVARREDRLREVADKAHELGSPEAV  335

Query  100  AIQADVSNLDDCRRIVDQTINWFGCVDHLVNNA  2
             I+ADV+ ++DC+RIVD+ +N FG +DHLV+NA
Sbjct  336  VIRADVAKVEDCKRIVDEAVNHFGHLDHLVSNA  368



>ref|XP_007160009.1| hypothetical protein PHAVU_002G2852000g, partial [Phaseolus vulgaris]
 ref|XP_007160010.1| hypothetical protein PHAVU_002G2852000g, partial [Phaseolus vulgaris]
 gb|ESW32003.1| hypothetical protein PHAVU_002G2852000g, partial [Phaseolus vulgaris]
 gb|ESW32004.1| hypothetical protein PHAVU_002G2852000g, partial [Phaseolus vulgaris]
Length=155

 Score =   107 bits (266),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGA+SGIGE +AYEYA+RGA+L L   RK  L+ V+++A  LGSPD   I ADVS + D
Sbjct  52   ITGAASGIGEEIAYEYARRGAKLSLVDIRKEKLEAVSDKARSLGSPDVTIIGADVSKVQD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R+VD+TIN+FG +DHLVNN 
Sbjct  112  CKRLVDETINYFGRLDHLVNNT  133



>ref|XP_006402076.1| hypothetical protein EUTSA_v10014225mg [Eutrema salsugineum]
 gb|ESQ43529.1| hypothetical protein EUTSA_v10014225mg [Eutrema salsugineum]
Length=299

 Score =   109 bits (273),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG+SSGIGEHLAYEYA+RGA L L ARR+  LQ VA+R  +LGSPD   ++ DV+ ++D
Sbjct  52   ITGSSSGIGEHLAYEYARRGAYLTLVARREDRLQVVADRCRKLGSPDVAVVRGDVTVIED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V +TI+ FG +DHLVNNA
Sbjct  112  CKRFVQETISRFGRLDHLVNNA  133



>ref|XP_011033248.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
Length=310

 Score =   110 bits (274),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA RGARL L ARR+  L+ VA++A  LGSP+   ++ADVS ++D
Sbjct  52   ITGASSGIGEDLAYEYAVRGARLALVARREDRLRAVADKARNLGSPNVFHVRADVSKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+RI+D+T+N FG +DHLVNNA
Sbjct  112  CKRIIDETLNHFGHLDHLVNNA  133



>gb|EEC77184.1| hypothetical protein OsI_15677 [Oryza sativa Indica Group]
Length=355

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGA L L ARR+ SL+EV + A+  GSP  + +  DVS+ DD
Sbjct  56   ITGASSGIGEHLAYEYARRGAYLALVARREESLREVGDAALAAGSPGVLVVAGDVSSPDD  115

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CR+ VD TI +FG +DHLVNNA
Sbjct  116  CRKFVDDTIRYFGRLDHLVNNA  137



>emb|CAH66439.1| OSIGBa0132D06.5 [Oryza sativa Indica Group]
Length=355

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGA L L ARR+ SL+EV + A+  GSP  + +  DVS+ DD
Sbjct  56   ITGASSGIGEHLAYEYARRGAYLALVARREESLREVGDAALAAGSPGVLVVAGDVSSPDD  115

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CR+ VD TI +FG +DHLVNNA
Sbjct  116  CRKFVDDTIRYFGRLDHLVNNA  137



>ref|XP_008446273.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=351

 Score =   110 bits (274),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAKRGA L L ARR+  L+EVA  A  LGSP A+ I ADVS +DD
Sbjct  52   ITGASSGIGEHVAYEYAKRGAYLALVARREHRLREVAEVAEILGSPFALVIHADVSKVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V  T+  FG +DHLVNNA
Sbjct  112  CKRCVQTTLAHFGRLDHLVNNA  133



>ref|XP_010277349.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nelumbo 
nucifera]
Length=317

 Score =   109 bits (273),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA LVL ARR+  L+ +A +   LGSP  + + ADVS +DD
Sbjct  52   ITGASSGIGEHLAYEYAKRGASLVLVARRENYLRVIAEKCRLLGSPHVLVVPADVSKVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V++T+N FG +DHLV NA
Sbjct  112  CQRFVEETVNQFGRLDHLVCNA  133



>gb|KFK22923.1| hypothetical protein AALP_AAs48765U000200 [Arabis alpina]
Length=299

 Score =   109 bits (272),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG+SSGIGEHLAYEYA+RGA L L ARR+  L+ VA+R  +LGSPD   I+ DVS ++D
Sbjct  52   ITGSSSGIGEHLAYEYARRGAYLTLVARREDRLRVVADRCRKLGSPDVAVIRGDVSVIED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V +TI+ FG +DHLVNNA
Sbjct  112  CKRFVQETISQFGRLDHLVNNA  133



>ref|NP_001052643.2| Os04g0390800 [Oryza sativa Japonica Group]
 dbj|BAF14557.2| Os04g0390800, partial [Oryza sativa Japonica Group]
Length=361

 Score =   110 bits (274),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGA L L ARR+ SL+EV + A+  GSP  + +  DVS+ DD
Sbjct  62   ITGASSGIGEHLAYEYARRGAYLALVARREESLREVGDAALAAGSPGVLVVAGDVSSPDD  121

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CR+ VD TI +FG +DHLVNNA
Sbjct  122  CRKFVDDTIRYFGRLDHLVNNA  143



>gb|KDO64429.1| hypothetical protein CISIN_1g042560mg, partial [Citrus sinensis]
Length=287

 Score =   109 bits (272),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIG+HLAYEYA+R ARLVL ARR+  L+EVA++A  +GSP A+AI ADVS ++D
Sbjct  52   ITGASSGIGKHLAYEYARRRARLVLVARRERQLREVADQAELMGSPFALAIPADVSKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  VD T+  FG +DHLV NA
Sbjct  112  CKHFVDVTMEHFGRLDHLVTNA  133



>ref|XP_010525337.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Tarenaya 
hassleriana]
Length=307

 Score =   109 bits (272),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+R ARL L ARR+  L+ VANR  ELGSP  I  + DVS + D
Sbjct  52   ITGASSGIGEHLAYEYARREARLTLVARREDRLKMVANRCRELGSPAVIVTRGDVSLVKD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R ++ T++ FG +DHLVNNA
Sbjct  112  CKRFIEDTVSQFGRLDHLVNNA  133



>gb|EPS70609.1| steroleosin, partial [Genlisea aurea]
Length=124

 Score =   105 bits (261),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYAK+GA LVLAARR+ SL+EVA+RA  LGSPD +   ADVS L D
Sbjct  51   ITGASSGIGESLAYEYAKKGACLVLAARRERSLEEVADRARYLGSPDVLVEPADVSELGD  110

Query  67   CRRIVDQTINWFG  29
            CRR++D+T+N FG
Sbjct  111  CRRVIDRTMNHFG  123



>emb|CAH66438.1| OSIGBa0132D06.4 [Oryza sativa Indica Group]
 gb|EAY93903.1| hypothetical protein OsI_15676 [Oryza sativa Indica Group]
Length=368

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            +TGASSGIGE +AY YA+RGARL L ARR+ SL EVA RA  LGSPD +A+  DV+  DD
Sbjct  71   VTGASSGIGEQVAYRYARRGARLALVARREASLGEVAARARALGSPDVLAVPGDVARPDD  130

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR V  T+  FG +DHLVNNA
Sbjct  131  CRRFVQATVEHFGRLDHLVNNA  152



>ref|NP_001052642.1| Os04g0390700 [Oryza sativa Japonica Group]
 emb|CAD40535.1| OSJNBa0055C08.3 [Oryza sativa Japonica Group]
 dbj|BAF14556.1| Os04g0390700 [Oryza sativa Japonica Group]
 dbj|BAG98013.1| unnamed protein product [Oryza sativa Japonica Group]
Length=368

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            +TGASSGIGE +AY YA+RGARL L ARR+ SL EVA RA  LGSPD +A+  DV+  DD
Sbjct  71   VTGASSGIGEQVAYRYARRGARLALVARREASLGEVAARARALGSPDVLAVPGDVARPDD  130

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR V  T+  FG +DHLVNNA
Sbjct  131  CRRFVQATVEHFGRLDHLVNNA  152



>ref|XP_010039131.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Eucalyptus 
grandis]
 gb|KCW49098.1| hypothetical protein EUGRSUZ_K02704 [Eucalyptus grandis]
Length=369

 Score =   109 bits (273),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAY YAKRGA L L ARR+  L +VAN A +LGSPD + I+ DV+  +D
Sbjct  70   ITGASSGIGEHLAYSYAKRGACLALVARRENRLTDVANIAYQLGSPDVVVIRGDVTRAED  129

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R V++TI+ FG +DHLV NA
Sbjct  130  CERFVNRTIDHFGRLDHLVTNA  151



>ref|XP_010086991.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Morus notabilis]
 gb|EXB25270.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Morus notabilis]
Length=365

 Score =   109 bits (272),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYA++GARL L ARR+  LQ VA+ A  LG  D I I+ADVS ++D
Sbjct  52   ITGASSGIGERMAYEYARKGARLALVARRENRLQSVASIATLLGCKDVITIRADVSKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R V +TIN++G +DHLVNNA
Sbjct  112  CERFVYETINYYGRLDHLVNNA  133



>ref|XP_006404394.1| hypothetical protein EUTSA_v10011076mg [Eutrema salsugineum]
 gb|ESQ45847.1| hypothetical protein EUTSA_v10011076mg [Eutrema salsugineum]
Length=309

 Score =   108 bits (270),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAK+GA L L ARRK  LQ VA  + +LGS D I I  DV+ ++D
Sbjct  52   ITGASSGIGEHLAYEYAKKGAYLALVARRKDRLQIVAETSRQLGSGDVIIIPGDVAKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+TI+ FG +DHL+NNA
Sbjct  112  CKKFIDETIHHFGKLDHLINNA  133



>ref|XP_002321719.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEF05846.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=298

 Score =   108 bits (270),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYA+RGA L L+ARR+  L+ VA++A ELGSPD I I  D+S ++D
Sbjct  52   ITGASSGIGEYLAYEYARRGACLALSARREERLRAVADKARELGSPDVIVIATDISKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R V++ +N FG +DHLVNNA
Sbjct  112  CERFVNEAMNHFGKLDHLVNNA  133



>ref|XP_010426175.1| PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydroxysteroid dehydrogenase-like 
2 [Camelina sativa]
Length=309

 Score =   108 bits (270),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAK+GA L L ARRK  L+ VA    +LGS D I I  DVSN++D
Sbjct  52   ITGASSGIGEHLAYEYAKKGACLALVARRKDRLEIVAETLRQLGSGDVIIIPGDVSNVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+TI  FG +DHL+NNA
Sbjct  112  CKKFIDETIRHFGKLDHLINNA  133



>ref|NP_001152614.1| steroleosin [Zea mays]
 gb|ACG48577.1| steroleosin [Zea mays]
 tpg|DAA38130.1| TPA: steroleosin [Zea mays]
Length=350

 Score =   108 bits (271),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L L ARR+ SL+EV + A+ LGSP  + + ADVS   D
Sbjct  54   ITGASSGIGEHLAYEYAKRGAYLALVARREASLREVGDVALGLGSPGVLVLPADVSKPRD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C   +D TI++FG +DHLVNNA
Sbjct  114  CEGFIDDTISYFGRLDHLVNNA  135



>ref|XP_011044100.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
Length=307

 Score =   108 bits (269),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYA+RGA L LAARR+  L+ V+++A  LGSPDAI I  D+S ++D
Sbjct  52   ITGASSGIGEYLAYEYARRGACLALAARREERLRAVSDKARMLGSPDAIVISTDISKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R + + +N FG +DHLVNNA
Sbjct  112  CERFITEAVNHFGRLDHLVNNA  133



>gb|AAX49394.1| STO-1 [Coffea canephora]
 emb|CDP00863.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   108 bits (271),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYAKRGA LVL ARR   L  +A+ A  LGS   + + ADV   +D
Sbjct  52   ITGASSGIGEQIAYEYAKRGANLVLVARRDNRLHGIADNAQRLGSRHVLIMAADVVKEED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR +++TIN+FGCVDHLVN A
Sbjct  112  CRRFINETINYFGCVDHLVNTA  133



>ref|XP_008668191.1| PREDICTED: steroleosin isoform X2 [Zea mays]
Length=368

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L L ARR+ SL+EV + A+ LGSP  + + ADVS   D
Sbjct  54   ITGASSGIGEHLAYEYAKRGAYLALVARREASLREVGDVALGLGSPGVLVLPADVSKPRD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C   +D TI++FG +DHLVNNA
Sbjct  114  CEGFIDDTISYFGRLDHLVNNA  135



>ref|XP_002446311.1| hypothetical protein SORBIDRAFT_06g013980 [Sorghum bicolor]
 gb|EES10639.1| hypothetical protein SORBIDRAFT_06g013980 [Sorghum bicolor]
Length=406

 Score =   108 bits (270),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AY+YAK+GARL L ARR  SL +VA RA ++GSPD + +  DV+NL+D
Sbjct  109  ITGASSGIGEQIAYQYAKKGARLALVARRVGSLHDVATRAKDVGSPDVLVVAGDVANLED  168

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V  T+  FG +DHLVNNA
Sbjct  169  CQRFVQATVEHFGRLDHLVNNA  190



>ref|XP_011023955.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
Length=298

 Score =   107 bits (268),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYA+RGA L L+ARR+  L+ VA++A ELGSPD I I  D+S ++D
Sbjct  52   ITGASSGIGEYLAYEYARRGACLALSARREGRLRAVADKARELGSPDVIVIATDISKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R V++ +N FG +DHLVNNA
Sbjct  112  CERFVNEAMNHFGKLDHLVNNA  133



>ref|XP_008668190.1| PREDICTED: steroleosin isoform X1 [Zea mays]
Length=373

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L L ARR+ SL+EV + A+ LGSP  + + ADVS   D
Sbjct  54   ITGASSGIGEHLAYEYAKRGAYLALVARREASLREVGDVALGLGSPGVLVLPADVSKPRD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C   +D TI++FG +DHLVNNA
Sbjct  114  CEGFIDDTISYFGRLDHLVNNA  135



>ref|XP_010695411.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Beta 
vulgaris subsp. vulgaris]
Length=342

 Score =   108 bits (269),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGA L L ARR+  LQ VA  A  LG+PD I I ADVS L+D
Sbjct  52   ITGASSGIGEHLAYEYARRGACLALVARRRQHLQNVAKTAHHLGAPDVIVIPADVSKLED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
             +  + +T+  FG +DHLVNNA
Sbjct  112  SKHFITETVEHFGRLDHLVNNA  133



>ref|XP_010503335.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 2 [Camelina 
sativa]
Length=309

 Score =   107 bits (267),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA L L ARRK  L+ VA  + +LGS D I I  DVSN++D
Sbjct  52   ITGASSGIGEHVAYEYAKKGACLALVARRKDRLEIVAETSRQLGSGDVIIIPGDVSNVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+TI  FG +DHL+NNA
Sbjct  112  CKKFIDETILHFGKLDHLINNA  133



>ref|XP_010442243.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Camelina 
sativa]
Length=299

 Score =   107 bits (266),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG+SSGIGEHLAYEYA+RGA L L ARR+  LQ VA+R   LGSPD   ++ DVS ++D
Sbjct  52   ITGSSSGIGEHLAYEYARRGAYLTLVARREDRLQVVADRCRRLGSPDVAVVRGDVSVIED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  V +TI  FG +DHLVNNA
Sbjct  112  CKGFVQETIARFGRLDHLVNNA  133



>ref|XP_006291535.1| hypothetical protein CARUB_v10017691mg [Capsella rubella]
 gb|EOA24433.1| hypothetical protein CARUB_v10017691mg [Capsella rubella]
Length=278

 Score =   106 bits (265),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE++AYEYAK+GA L L ARRK  L+ VA    +LGS D I I  DVSNLDD
Sbjct  52   ITGASSGIGENVAYEYAKKGACLALVARRKDRLEIVAETLRQLGSRDVIIIPGDVSNLDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  +D+TI+ FG +DHL+NNA
Sbjct  112  CKMFIDETIHHFGKLDHLINNA  133



>ref|XP_004975422.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Setaria 
italica]
Length=370

 Score =   107 bits (267),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            +TGASSGIGE +AY+YAK+GARL L ARR+ SL +VA +A ++GSPD + +  DV+N +D
Sbjct  71   VTGASSGIGEQIAYQYAKKGARLALVARREASLHDVAAKAKDVGSPDVLVVAGDVANPED  130

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR V  T+  FG +DHLVNNA
Sbjct  131  CRRFVQTTVEHFGQLDHLVNNA  152



>ref|XP_002875833.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH52092.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=309

 Score =   106 bits (265),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA L L ARR+  L+ VA  + +LGS + I I  DVSN++D
Sbjct  52   ITGASSGIGEHVAYEYAKKGAYLALVARRRDRLEIVAETSRQLGSGNVITIPGDVSNVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+TI  FG +DHL+NNA
Sbjct  112  CKKFIDETIRHFGKLDHLINNA  133



>ref|XP_002446312.1| hypothetical protein SORBIDRAFT_06g013990 [Sorghum bicolor]
 gb|EES10640.1| hypothetical protein SORBIDRAFT_06g013990 [Sorghum bicolor]
Length=348

 Score =   107 bits (266),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGA+SGIGEHLAYEYAKRGA L L ARR+ SL+EV + A+ LGSP  + + ADVS   D
Sbjct  51   ITGAASGIGEHLAYEYAKRGAYLALVARREASLREVGDVALGLGSPGVLVLPADVSKPQD  110

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C   +D TI ++G +DHLVNNA
Sbjct  111  CESFIDDTIRYYGRLDHLVNNA  132



>ref|XP_006360917.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Solanum 
tuberosum]
Length=348

 Score =   107 bits (266),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA+RG  L + ARR+  L +VA +A  LG  D I+I+ADVSN+  
Sbjct  55   ITGASSGIGEELAYEYARRGCSLAIVARREKKLWKVAEKAKSLGCLDVISIRADVSNVQH  114

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R VDQT+  FG +DHLVNNA
Sbjct  115  CKRFVDQTVKHFGRLDHLVNNA  136



>ref|XP_006291536.1| hypothetical protein CARUB_v10017691mg [Capsella rubella]
 gb|EOA24434.1| hypothetical protein CARUB_v10017691mg [Capsella rubella]
Length=309

 Score =   106 bits (265),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE++AYEYAK+GA L L ARRK  L+ VA    +LGS D I I  DVSNLDD
Sbjct  52   ITGASSGIGENVAYEYAKKGACLALVARRKDRLEIVAETLRQLGSRDVIIIPGDVSNLDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  +D+TI+ FG +DHL+NNA
Sbjct  112  CKMFIDETIHHFGKLDHLINNA  133



>ref|NP_190320.1| hydroxysteroid dehydrogenase 3 [Arabidopsis thaliana]
 sp|Q9STY7.1|HSD3_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase-like 3; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase-like 3; AltName: 
Full=Hydroxysteroid dehydrogenase 3; Short=AtHSD3 [Arabidopsis 
thaliana]
 emb|CAB51208.1| putative protein [Arabidopsis thaliana]
 gb|AEE78270.1| hydroxysteroid dehydrogenase 3 [Arabidopsis thaliana]
Length=309

 Score =   106 bits (264),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA L L ARR+  L+ VA  + +LGS + I I  DVSN++D
Sbjct  52   ITGASSGIGEHVAYEYAKKGAYLALVARRRDRLEIVAETSRQLGSGNVIIIPGDVSNVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+TI  FG +DHL+NNA
Sbjct  112  CKKFIDETIRHFGKLDHLINNA  133



>ref|XP_011023956.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
 ref|XP_011023957.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A [Populus 
euphratica]
Length=307

 Score =   105 bits (263),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYA+RGA L LAARR+  L+ VA++A  LGSPD I I  D+S L+D
Sbjct  52   ITGASSGIGEYLAYEYARRGACLALAARRQERLRAVADKARALGSPDVIVIPTDISKLED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
              R +++ +N FG +DHLVNNA
Sbjct  112  SERFINEAVNHFGKLDHLVNNA  133



>gb|EAZ30541.1| hypothetical protein OsJ_14589 [Oryza sativa Japonica Group]
Length=326

 Score =   106 bits (264),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            + GASSGIGE +AY YA++GARL L ARR+ SL EVA RA  LGSPD +A+  DV+  DD
Sbjct  29   VKGASSGIGEQVAYRYARKGARLALVARREASLGEVAARARALGSPDVLAVPGDVARPDD  88

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR V  T+  FG +DHLVNNA
Sbjct  89   CRRFVQATVEHFGRLDHLVNNA  110



>gb|KGN64430.1| hypothetical protein Csa_1G051680 [Cucumis sativus]
Length=351

 Score =   106 bits (264),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L L ARR+  L+EVA  A  LGSP A+ I AD+S ++D
Sbjct  52   ITGASSGIGEHLAYEYAKRGAYLALVARRENRLREVAAVAQYLGSPYALVIPADISKIED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +  T+  F  +DHLVNNA
Sbjct  112  CKRCIQTTVTHFRRLDHLVNNA  133



>ref|XP_008446283.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Cucumis 
melo]
Length=352

 Score =   106 bits (264),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L L ARR+  L+EVA  A  LGSP A+ I AD+S ++D
Sbjct  52   ITGASSGIGEHLAYEYAKRGAYLALVARRENRLREVAAVAQYLGSPYALVIPADISKIED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +  T+  F  +DHLVNNA
Sbjct  112  CKRCIQTTVTHFRRLDHLVNNA  133



>ref|XP_006579445.1| PREDICTED: uncharacterized protein LOC100808990 isoform X1 [Glycine 
max]
Length=263

 Score =   105 bits (261),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGA+SGIGE +AYEYA+RGA+L L   RK  L  VA++A  LGSPD   I ADVS + D
Sbjct  52   ITGAASGIGEQVAYEYARRGAKLSLVDIRKDKLVAVADKARSLGSPDVTIIGADVSKVQD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R VD+T+N FG +DHLVNNA
Sbjct  112  CNRFVDETVNHFGRLDHLVNNA  133



>ref|NP_001239786.1| uncharacterized protein LOC100808990 [Glycine max]
 gb|ACU21528.1| unknown [Glycine max]
 gb|KHN17485.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Glycine 
soja]
Length=323

 Score =   105 bits (263),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGA+SGIGE +AYEYA+RGA+L L   RK  L  VA++A  LGSPD   I ADVS + D
Sbjct  52   ITGAASGIGEQVAYEYARRGAKLSLVDIRKDKLVAVADKARSLGSPDVTIIGADVSKVQD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R VD+T+N FG +DHLVNNA
Sbjct  112  CNRFVDETVNHFGRLDHLVNNA  133



>ref|XP_010442546.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X1 [Camelina sativa]
Length=299

 Score =   105 bits (262),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG+SSGIGEHLAYEYA+RGA L L ARR+  L+ VA+R   LGSPD   ++ DVS ++D
Sbjct  52   ITGSSSGIGEHLAYEYARRGAYLTLVARREDRLRVVADRCRRLGSPDVAVVRGDVSVIED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  V +TI  FG +DHLVNNA
Sbjct  112  CKHFVQETIARFGRLDHLVNNA  133



>ref|XP_004153126.1| PREDICTED: dehydrogenase/reductase SDR family protein 7-like 
[Cucumis sativus]
Length=344

 Score =   105 bits (263),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L L ARR+  L+EVA  A  LGSP A+ I AD+S ++D
Sbjct  45   ITGASSGIGEHLAYEYAKRGAYLALVARRENRLREVAAVAQYLGSPYALVIPADISKIED  104

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +  T+  F  +DHLVNNA
Sbjct  105  CKRCIQTTVTHFRRLDHLVNNA  126



>ref|XP_010442547.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X2 [Camelina sativa]
Length=296

 Score =   105 bits (261),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG+SSGIGEHLAYEYA+RGA L L ARR+  L+ VA+R   LGSPD   ++ DVS ++D
Sbjct  52   ITGSSSGIGEHLAYEYARRGAYLTLVARREDRLRVVADRCRRLGSPDVAVVRGDVSVIED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  V +TI  FG +DHLVNNA
Sbjct  112  CKHFVQETIARFGRLDHLVNNA  133



>ref|XP_010271121.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X2 [Nelumbo nucifera]
Length=364

 Score =   105 bits (261),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG SSGIGEH+AYEYAKR A LVL ARR+  LQ VA R  +LGSPD + + ADVS   +
Sbjct  87   ITGGSSGIGEHIAYEYAKRRASLVLVARREAKLQSVAERTRQLGSPDVVIVPADVSMAAE  146

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V++ +N FG +DHLV NA
Sbjct  147  CKRFVEEAVNHFGRLDHLVCNA  168



>emb|CDP19889.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   104 bits (260),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLD-  71
            ITGASSGIGEH AYEYAKR A LV+ ARR+  L+EVA +A +LGSPD + I ADV  +D 
Sbjct  48   ITGASSGIGEHRAYEYAKRRACLVIVARRENLLREVAEKARKLGSPDVVPICADVLMVDE  107

Query  70   DCRRIVDQTINWFGCVDHLVNNA  2
            DC+R V++ +N FG +DHLVNNA
Sbjct  108  DCKRFVEEAVNHFGRLDHLVNNA  130



>ref|XP_010503336.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Camelina 
sativa]
Length=309

 Score =   104 bits (260),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA L L ARRK  L+ VA  + +LGS D I I  DV+ ++D
Sbjct  52   ITGASSGIGEHVAYEYAKKGACLALVARRKDRLEIVAETSRQLGSGDVIIIPGDVAKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+T++ FG +DHL+NNA
Sbjct  112  CKKFIDETVHHFGKLDHLINNA  133



>gb|EYU23067.1| hypothetical protein MIMGU_mgv1a009247mg [Erythranthe guttata]
Length=348

 Score =   104 bits (260),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            I GASSG+GEH+AYEY KRGA LV+ ARR+ +LQ+VA  A  LGSP AI I+ D+S  +D
Sbjct  52   IAGASSGMGEHIAYEYGKRGAFLVIGARREKALQQVAETAHLLGSPRAIPIRTDISKPED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR++ + IN FG +DHLV +A
Sbjct  112  CRRLIQEAINQFGKLDHLVMSA  133



>ref|XP_003576230.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brachypodium 
distachyon]
Length=349

 Score =   104 bits (260),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAY+YA +GA L L ARR+ SL++VA++A+ELG+PD + +  DVSN +D
Sbjct  53   ITGASSGIGEHLAYQYAMKGASLALVARREWSLRQVADKALELGAPDVLILPGDVSNSED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R V  TI+ +  +DHLV NA
Sbjct  113  CTRFVQATIDRYSRLDHLVCNA  134



>ref|XP_007038041.1| Glucose 1-dehydrogenase, putative [Theobroma cacao]
 gb|EOY22542.1| Glucose 1-dehydrogenase, putative [Theobroma cacao]
Length=319

 Score =   104 bits (259),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSG+GE+LAY+YA+RGARL L ARR+  LQEVA      GSP+AI I  D+S ++D
Sbjct  52   ITGASSGVGENLAYKYARRGARLALVARREHRLQEVAAIFEITGSPEAIYILGDISKIED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R VD T+N FG +DHLV +A
Sbjct  112  CKRFVDATVNHFGHLDHLVTSA  133



>ref|XP_006580902.1| PREDICTED: LOW QUALITY PROTEIN: 11-beta-hydroxysteroid dehydrogenase 
1B-like [Glycine max]
Length=323

 Score =   104 bits (259),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 52/83 (63%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVS-LQEVANRAVELGSPDAIAIQADVSNLD  71
            IT ASS IGEHLAYEYAKRGA L L+ARR+ + L+EVA+R  + GSPD I ++ADVS ++
Sbjct  52   ITVASSVIGEHLAYEYAKRGACLALSARRETAVLREVADRTRDCGSPDVIIMRADVSKVE  111

Query  70   DCRRIVDQTINWFGCVDHLVNNA  2
            DC R+VD+T+N F  +DHLVN+A
Sbjct  112  DCFRLVDETVNHFXRLDHLVNSA  134



>ref|XP_010515042.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Camelina 
sativa]
Length=309

 Score =   104 bits (259),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA L L ARRK  L+ VA  + +LGS D I I  DV+ ++D
Sbjct  52   ITGASSGIGEHVAYEYAKKGACLALVARRKDRLEIVAETSRQLGSGDVIIILGDVAKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+T++ FG +DHL+NNA
Sbjct  112  CKKFIDETVHHFGKLDHLINNA  133



>ref|XP_002321718.2| hypothetical protein POPTR_0015s11200g [Populus trichocarpa]
 gb|EEF05845.2| hypothetical protein POPTR_0015s11200g [Populus trichocarpa]
Length=307

 Score =   103 bits (258),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYA+RGA L LAARR+  L+ VA +A  LGSPD I I  D+S ++D
Sbjct  52   ITGASSGIGEYLAYEYARRGACLALAARRQERLRAVAGKARALGSPDVIVIPTDISKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
              R +++ +N FG +DHLVNNA
Sbjct  112  SERFINEAVNHFGKLDHLVNNA  133



>gb|EMS47145.1| Dehydrogenase/reductase SDR family protein 7-like protein [Triticum 
urartu]
Length=365

 Score =   104 bits (259),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            +TGASSGIGE +AY+YAK+GARL L ARR+ SL EVA +A +LGSPD + +  DV+  +D
Sbjct  71   VTGASSGIGEQIAYQYAKKGARLALVARRQGSLHEVAAKATDLGSPDVLVVPGDVARPED  130

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  V  T+  FG +DHLVNNA
Sbjct  131  CKAFVQATVERFGRLDHLVNNA  152



>emb|CDX90560.1| BnaA03g42210D [Brassica napus]
Length=309

 Score =   103 bits (257),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA L L ARR+  LQ VA+ + +LGS D I I  DV+ ++D
Sbjct  52   ITGASSGIGEHVAYEYAKKGADLALVARREDRLQIVADTSRKLGSRDVIIIPGDVTKIND  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C + + +TI+ FG VDHL+NNA
Sbjct  112  CMKFISETISHFGKVDHLINNA  133



>emb|CDY09733.1| BnaC07g33280D [Brassica napus]
Length=309

 Score =   103 bits (257),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA L L ARR+  LQ VA+ + +LGS D I I  DV+ ++D
Sbjct  52   ITGASSGIGEHVAYEYAKKGADLALVARREDRLQIVADTSRKLGSRDVIIIPGDVTKIND  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C + + +TI+ FG VDHL+NNA
Sbjct  112  CMKFISETISHFGKVDHLINNA  133



>gb|KCW83129.1| hypothetical protein EUGRSUZ_B00090 [Eucalyptus grandis]
Length=150

 Score =   100 bits (249),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYA+ GA   L ARR++SL+EVA  A +LGSPD + IQADVS +DD
Sbjct  52   ITGASSGIGEYLAYEYARTGACSALVARREISLREVAEGARKLGSPDVVVIQADVSLVDD  111

Query  67   CRRIVDQTINWF  32
            CRR+V++T+N F
Sbjct  112  CRRLVNETMNQF  123



>ref|XP_003581150.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Brachypodium 
distachyon]
Length=368

 Score =   103 bits (258),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            +TGASSGIGE +AY+YAK+GARL L ARR+ SL++VA RA +LGSPD + +  DV+  +D
Sbjct  71   VTGASSGIGEQIAYQYAKKGARLALVARREGSLRDVAARATDLGSPDVLVLPGDVARPED  130

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  V+ T+  FG +DHLVNNA
Sbjct  131  CKAFVEATVERFGRLDHLVNNA  152



>ref|XP_009150624.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Brassica 
rapa]
Length=309

 Score =   103 bits (257),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAK+GA L L ARR+  L  VA  + +LGS D I I  DV+ ++D
Sbjct  52   ITGASSGIGEHLAYEYAKKGAYLALVARREDRLDIVAETSRQLGSGDVIIIPGDVAEVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  +D+TI  FG +DHL+NNA
Sbjct  112  CKEFIDETIRHFGKLDHLINNA  133



>ref|XP_010455398.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Camelina 
sativa]
Length=382

 Score =   103 bits (258),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGE +AYEYAKRGA LVL ARR+  L+ V+N+A ++G+   I I ADV   DD
Sbjct  54   ITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNKAKQIGANHVIIIAADVIKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR + Q +N++G VDHLVN A
Sbjct  114  CRRFITQAVNYYGRVDHLVNTA  135



>ref|XP_010437678.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Camelina 
sativa]
Length=382

 Score =   103 bits (258),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGE +AYEYAKRGA LVL ARR+  L+ V+N+A ++G+   I I ADV   DD
Sbjct  54   ITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNKAKQIGANHVIIIAADVIKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR + Q +N++G VDHLVN A
Sbjct  114  CRRFITQAVNYYGRVDHLVNTA  135



>gb|EMT26674.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Aegilops 
tauschii]
Length=405

 Score =   103 bits (258),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AY+YAK+GARL L ARR+ SL+EVA +A +LGSPD + +  DV+  +D
Sbjct  152  ITGASSGIGEQIAYQYAKKGARLALVARREGSLREVAAKATDLGSPDVLVVPGDVARPED  211

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  V  T+  FG +DHLVNNA
Sbjct  212  CKAFVQATVERFGRLDHLVNNA  233



>gb|KFK34034.1| hypothetical protein AALP_AA5G093400 [Arabis alpina]
Length=528

 Score =   105 bits (261),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA L L ARRK  L+ VA  + +LGS D I I  DVS ++D
Sbjct  310  ITGASSGIGEHVAYEYAKKGACLALVARRKDHLEIVAETSRQLGSGDVIIISGDVSKVED  369

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D TI+ FG +DHL+NNA
Sbjct  370  CKKFIDVTIHHFGKLDHLINNA  391


 Score =   103 bits (257),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA L L ARRK  L+ VA  + +LGS + I I  DV+ L+D
Sbjct  52   ITGASSGIGEHVAYEYAKKGAYLALVARRKDRLEIVAETSRQLGSGNVIIIPGDVAKLED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+TI  FG +DHL+NNA
Sbjct  112  CKKFIDETILHFGKLDHLINNA  133



>ref|XP_006289482.1| hypothetical protein CARUB_v10003016mg [Capsella rubella]
 gb|EOA22380.1| hypothetical protein CARUB_v10003016mg [Capsella rubella]
Length=389

 Score =   103 bits (258),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGE +AYEYAKRGA LVL ARR+  L+ V+N+A ++G+   I I ADV   DD
Sbjct  54   ITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNKAKQIGANHVIIIAADVIKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR + Q +N++G VDHLVN A
Sbjct  114  CRRFITQAVNYYGRVDHLVNTA  135



>ref|NP_192740.1| hydroxysteroid dehydrogenase 5 [Arabidopsis thaliana]
 sp|Q9T0G0.1|HSD5_ARATH RecName: Full=11-beta-hydroxysteroid dehydrogenase-like 5; AltName: 
Full=17-beta-hydroxysteroid dehydrogenase-like 5; AltName: 
Full=Hydroxysteroid dehydrogenase 5; Short=AtHSD5 [Arabidopsis 
thaliana]
 emb|CAB39626.1| putative oxidoreductase [Arabidopsis thaliana]
 emb|CAB78125.1| putative oxidoreductase [Arabidopsis thaliana]
 gb|AEE82830.1| hydroxysteroid dehydrogenase 5 [Arabidopsis thaliana]
Length=389

 Score =   103 bits (258),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGE +AYEYAKRGA LVL ARR+  L+ V+N+A ++G+   I I ADV   DD
Sbjct  54   ITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNKAKQIGANHVIIIAADVIKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR + Q +N++G VDHLVN A
Sbjct  114  CRRFITQAVNYYGRVDHLVNTA  135



>gb|KHG01718.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Gossypium 
arboreum]
 gb|KHG29574.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein [Gossypium 
arboreum]
Length=355

 Score =   103 bits (256),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYAKR A LVL ARR+  L+ ++ +A  LG+  AI I ADV   DD
Sbjct  54   ITGASSGIGEQIAYEYAKRRANLVLVARREQRLRAISEKARYLGANSAIVIAADVVKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR V++T+N++G VDHLVN A
Sbjct  114  CRRFVNETVNFYGRVDHLVNAA  135



>ref|XP_010426176.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Camelina 
sativa]
Length=309

 Score =   102 bits (255),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA L L ARRK  L+ VA  + +LGS D I I  DV+ ++D
Sbjct  52   ITGASSGIGEHVAYEYAKKGACLALVARRKDRLEIVAETSRQLGSGDVIIIPGDVAKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +++T++ FG +DHL+NNA
Sbjct  112  CKKFINETVHHFGKLDHLINNA  133



>ref|XP_010536605.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X3 [Tarenaya hassleriana]
Length=305

 Score =   102 bits (254),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA+RGA L+L   R+  L  VA +   +GSPD +++  DV+ ++D
Sbjct  52   ITGASSGIGEQLAYEYARRGALLMLVDLREDRLPPVAEKCRRIGSPDVVSVGGDVTVVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R VD+TIN FG +DHLVNNA
Sbjct  112  CERFVDETINHFGRLDHLVNNA  133



>ref|XP_010536604.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X2 [Tarenaya hassleriana]
Length=305

 Score =   102 bits (254),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA+RGA L+L   R+  L  VA +   +GSPD +++  DV+ ++D
Sbjct  52   ITGASSGIGEQLAYEYARRGALLMLVDLREDRLPPVAEKCRRIGSPDVVSVGGDVTVVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R VD+TIN FG +DHLVNNA
Sbjct  112  CERFVDETINHFGRLDHLVNNA  133



>ref|XP_010536603.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X1 [Tarenaya hassleriana]
Length=305

 Score =   102 bits (254),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA+RGA L+L   R+  L  VA +   +GSPD +++  DV+ ++D
Sbjct  52   ITGASSGIGEQLAYEYARRGALLMLVDLREDRLPPVAEKCRRIGSPDVVSVGGDVTVVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R VD+TIN FG +DHLVNNA
Sbjct  112  CERFVDETINHFGRLDHLVNNA  133



>ref|XP_007160006.1| hypothetical protein PHAVU_002G285100g [Phaseolus vulgaris]
 gb|ESW32000.1| hypothetical protein PHAVU_002G285100g [Phaseolus vulgaris]
Length=320

 Score =   102 bits (254),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGA+SGIGE +AYEYA+RGA+L L   RK  L+ V ++A  LGSPD   I ADVS + D
Sbjct  52   ITGAASGIGEEIAYEYARRGAKLSLVDIRKEKLEAVGDKARSLGSPDVAIIGADVSKVQD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  V +TIN+FG +DHLVNNA
Sbjct  112  CKLFVHETINYFGRLDHLVNNA  133



>ref|XP_009134177.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Brassica 
rapa]
Length=447

 Score =   103 bits (256),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGE +AYEYAKRGA LVL ARR+  L+ V+N A ++G+   I I ADV   DD
Sbjct  54   ITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNNARQIGANHVIIIAADVVKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR + Q +N++G VDHLVN+A
Sbjct  114  CRRFITQAVNYYGRVDHLVNSA  135



>gb|EPS67484.1| hypothetical protein M569_07290, partial [Genlisea aurea]
Length=345

 Score =   102 bits (254),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AY+YAKRGA LVL ARR+  L+ ++  A  LG+P  + + ADV   DD
Sbjct  54   ITGASSGIGEQIAYQYAKRGANLVLVARREHRLRGISENARRLGAPFVLVMAADVVKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVN  8
            CRR +++TIN+FG +DHLVN
Sbjct  114  CRRFINETINYFGRLDHLVN  133



>emb|CDX90742.1| BnaA03g24220D [Brassica napus]
Length=451

 Score =   103 bits (256),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGE +AYEYAKRGA LVL ARR+  L+ V+N A ++G+   I I ADV   DD
Sbjct  54   ITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNNARQIGANHVIIIAADVVKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR + Q +N++G VDHLVN+A
Sbjct  114  CRRFITQAVNYYGRVDHLVNSA  135



>ref|XP_010645922.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 isoform 
X2 [Vitis vinifera]
Length=352

 Score =   102 bits (254),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYAK+GA+LVL ARR+  L  +   A +LG+   + + ADV  LDD
Sbjct  52   ITGASSGIGEQVAYEYAKKGAKLVLVARRENRLLGIGENARQLGAKHVMIMAADVVKLDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR V +T+N++G VDHLVN A
Sbjct  112  CRRFVTETVNYYGRVDHLVNTA  133



>ref|XP_002279316.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 isoform 
X1 [Vitis vinifera]
 emb|CBI31355.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   102 bits (254),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYAK+GA+LVL ARR+  L  +   A +LG+   + + ADV  LDD
Sbjct  52   ITGASSGIGEQVAYEYAKKGAKLVLVARRENRLLGIGENARQLGAKHVMIMAADVVKLDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR V +T+N++G VDHLVN A
Sbjct  112  CRRFVTETVNYYGRVDHLVNTA  133



>ref|XP_011073098.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 6 [Sesamum 
indicum]
Length=349

 Score =   102 bits (254),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            I GASSGIGEH+AYEY KRGA LV+ ARR+ +L+EVA RA  +GSP AI + +D+S ++D
Sbjct  52   IAGASSGIGEHVAYEYGKRGAFLVIGARRENALREVAERAYLVGSPRAIPVPSDISKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+ ++ + IN FG +DHLV  A
Sbjct  112  CKTLIQEAINQFGRLDHLVMAA  133



>emb|CDY05081.1| BnaC03g28790D [Brassica napus]
Length=456

 Score =   103 bits (256),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGE +AYEYAKRGA LVL ARR+  L+ V+N A ++G+   I I ADV   DD
Sbjct  54   ITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNNARQIGANHVIIIAADVVKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR + Q +N++G VDHLVN+A
Sbjct  114  CRRFITQAVNYYGRVDHLVNSA  135



>gb|ACF75106.1| Ste-b [Brassica napus]
Length=461

 Score =   103 bits (256),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGE +AYEYAKRGA LVL ARR+  L+ V+N A ++G+   I I ADV   DD
Sbjct  54   ITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNNARQIGANHVIIIAADVVKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR + Q +N++G VDHLVN+A
Sbjct  114  CRRFITQAVNYYGRVDHLVNSA  135



>gb|ACG69526.1| steroleosin SLO2-2 [Brassica napus]
Length=461

 Score =   103 bits (256),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGE +AYEYAKRGA LVL ARR+  L+ V+N A ++G+   I I ADV   DD
Sbjct  54   ITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNNARQIGANHVIIIAADVVKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR + Q +N++G VDHLVN+A
Sbjct  114  CRRFITQAVNYYGRVDHLVNSA  135



>gb|KEH21004.1| hydroxysteroid 11-beta-dehydrogenase-like protein [Medicago truncatula]
Length=324

 Score =   102 bits (253),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGA+SGIGE LAYEYAKRGARL L   RK +L  VA+ A  LGSPD   I ADVS ++D
Sbjct  52   ITGAASGIGEELAYEYAKRGARLSLIDIRKENLVTVADMARSLGSPDVTIIGADVSKVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
             +R +D+T+  FG +DHLVNNA
Sbjct  112  SKRFIDETMKHFGRLDHLVNNA  133



>gb|KDP22587.1| hypothetical protein JCGZ_26418 [Jatropha curcas]
Length=396

 Score =   102 bits (254),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA+RGA L L ARRK  LQ VA  A E+GSPDAI +  DV+  +D
Sbjct  88   ITGASSGIGEHLAYEYARRGACLALVARRKHRLQVVAAIAEEIGSPDAIILPGDVTKTND  147

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+  VD T+  F  VDHLV NA
Sbjct  148  CQEFVDATVKHF--VDHLVANA  167



>dbj|BAJ85563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=349

 Score =   102 bits (253),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAY+YA +GA L L ARR+ SL++VA+RA +LG+PD I +  DV++ DD
Sbjct  52   ITGASSGIGEQLAYQYAAKGACLALVARREWSLRQVADRAFDLGAPDVIILPGDVADPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R +  TI+ +G +DHLV NA
Sbjct  112  CNRFIQATIDHYGRLDHLVCNA  133



>ref|XP_010421918.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Camelina 
sativa]
Length=377

 Score =   102 bits (253),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGE +AYEYAKRGA LVL ARR+  L+ V+++A ++G+   I I ADV   DD
Sbjct  54   ITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSDKAKQIGANHVIIIAADVIKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR + Q +N++G VDHLVN A
Sbjct  114  CRRFITQAVNYYGRVDHLVNTA  135



>ref|XP_009765827.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Nicotiana 
sylvestris]
Length=353

 Score =   101 bits (252),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGARLVLAARR+ SLQ+VA+ A  LGSPD + + ADVS ++D
Sbjct  56   ITGASSGIGEHLAYEYAKRGARLVLAARRRRSLQQVADMAYWLGSPDVVPVHADVSKVED  115

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R++++ I+ FG +DHLV NA
Sbjct  116  CQRLIEEAISNFGRLDHLVTNA  137



>gb|EMS53803.1| Dehydrogenase/reductase SDR family protein 7-like protein [Triticum 
urartu]
Length=305

 Score =   101 bits (251),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAY+YA +GA L L ARR+ SL++VA+RA ELG+PD I +  DV++ DD
Sbjct  52   ITGASSGIGEQLAYQYATKGACLALVARREWSLRQVADRAFELGAPDVIILPGDVADPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R V    + FG +DHLV NA
Sbjct  112  CNRFVQAAADHFGRLDHLVCNA  133



>ref|XP_001767568.1| predicted protein [Physcomitrella patens]
 gb|EDQ67703.1| predicted protein [Physcomitrella patens]
Length=341

 Score =   101 bits (251),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GARL L  RR+  L EVA+RA+  G+ D   +  DV+   D
Sbjct  52   ITGASSGIGEHIAYEYAKKGARLALVGRRENLLMEVADRAITRGASDVKVLVGDVTKEAD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R +++TI  +G +DHLVNNA
Sbjct  112  CKRFLEETIQKYGRLDHLVNNA  133



>emb|CAN76088.1| hypothetical protein VITISV_028806 [Vitis vinifera]
Length=392

 Score =   101 bits (252),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYAK+GA+LVL ARR+  L  +   A +LG+   + + ADV  LDD
Sbjct  52   ITGASSGIGEQVAYEYAKKGAKLVLVARRENRLLGIGENARQLGAKHVMIMAADVVKLDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR V +T+N++G VDHLVN A
Sbjct  112  CRRFVTETVNYYGRVDHLVNMA  133



>ref|XP_009136723.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Brassica 
rapa]
Length=309

 Score =   100 bits (250),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA L L ARR+  L  VA  + +LGS D I I  DV+ ++D
Sbjct  52   ITGASSGIGEHVAYEYAKKGADLALVARREDRLHIVAETSRKLGSRDVIIIPGDVTKIND  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C + + +TI+ FG VDHL+NNA
Sbjct  112  CMKFISETISHFGKVDHLINNA  133



>ref|XP_002511144.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
 gb|EEF51746.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
Length=317

 Score =   100 bits (250),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGA+ GIGE LAYEYA+RGA LVL   ++  L  V N+A +LGSPD I+I ADVSN++D
Sbjct  52   ITGAAKGIGEQLAYEYARRGACLVLVDIKEDRLGPVVNKARQLGSPDVISIGADVSNIED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
             +R ++  IN FG +DHLVNNA
Sbjct  112  SQRFIEGAINHFGRLDHLVNNA  133



>ref|XP_002872483.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH48742.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=382

 Score =   101 bits (251),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGE +AYEYAKRGA LVL ARR+  L+ V+N+A E+G+   I I ADV   DD
Sbjct  54   ITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNKAKEIGANHVIIIAADVIKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R + Q +N++G VDHLVN A
Sbjct  114  CCRFITQAVNYYGRVDHLVNTA  135



>ref|XP_010536606.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X4 [Tarenaya hassleriana]
Length=267

 Score =   100 bits (249),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYA+RGA L+L   R+  L  VA +   +GSPD +++  DV+ ++D
Sbjct  52   ITGASSGIGEQLAYEYARRGALLMLVDLREDRLPPVAEKCRRIGSPDVVSVGGDVTVVED  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R VD+TIN FG +DHLVNNA
Sbjct  112  CERFVDETINHFGRLDHLVNNA  133



>ref|XP_009405178.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Musa 
acuminata subsp. malaccensis]
Length=354

 Score =   100 bits (250),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAYEYAKRGA + LAARR+ +L+ V+ +A ELG+PD + I AD+SN  +
Sbjct  53   ITGASSGIGEQLAYEYAKRGASMALAARRERALETVSAKARELGAPDVLVIAADISNPSE  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
              R+V  TI  FG ++HLV NA
Sbjct  113  ANRVVQATIGRFGQLNHLVCNA  134



>gb|ACG69525.1| steroleosin SLO2-1 [Brassica napus]
Length=456

 Score =   101 bits (251),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGAS  IGE +AYEYAKRGA LVL ARR+  L+ V+N A ++G+   I I ADV   DD
Sbjct  54   ITGASPAIGEQIAYEYAKRGANLVLVARREQRLRVVSNNARQIGANHVIIIAADVVKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR + Q +N++G VDHLVN+A
Sbjct  114  CRRFITQAVNYYGRVDHLVNSA  135



>ref|XP_011095759.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Sesamum 
indicum]
 gb|AAM46847.1|AF498264_1 steroleosin-B [Sesamum indicum]
Length=362

 Score =   100 bits (249),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AY+YAKRGA LVL ARR+  L+ ++  A  LG+P+ + + ADV   ++
Sbjct  53   ITGASSGIGEQIAYQYAKRGANLVLVARREHRLRGISENARRLGAPNVLIMAADVVKEEE  112

Query  67   CRRIVDQTINWFGCVDHLVN  8
            CRR +++TIN++G VDHLVN
Sbjct  113  CRRFINETINYYGRVDHLVN  132



>ref|XP_009150234.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 3 [Brassica 
rapa]
Length=310

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA L L  R +  L+ VA  + +LGS + I I  DV+N+DD
Sbjct  52   ITGASSGIGEHVAYEYAKKGAYLALVDRLEDRLEMVAETSRKLGSSNVIIIPGDVANVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +++TI+ FG +DHL+NNA
Sbjct  112  CKKFINETIHHFGKLDHLINNA  133



>emb|CDY21787.1| BnaA06g20560D [Brassica napus]
Length=310

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AYEYAK+GA L L  R +  L+ VA  + +LGS + I I  DV+N+DD
Sbjct  52   ITGASSGIGEHVAYEYAKKGAYLALVDRLEDRLEMVAETSRKLGSSNVIIIPGDVANVDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +++TI+ FG +DHL+NNA
Sbjct  112  CKKFINETIHHFGKLDHLINNA  133



>gb|ABI20736.1| 11-beta-hydroxysteroid dehydrogenase-like protein [Triticum aestivum]
Length=349

 Score =   100 bits (248),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAY+YA +GA L L AR++ SL++VA+RA +LG+PD I +  DV++ DD
Sbjct  52   ITGASSGIGEQLAYQYAAKGACLALVARKEWSLRQVADRAFDLGAPDVIILPGDVADPDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C R V  T++ +G +DHLV NA
Sbjct  112  CNRFVQATVDHYGRLDHLVCNA  133



>ref|XP_006664013.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Oryza 
brachyantha]
Length=349

 Score =   100 bits (248),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAY+YA + A LVL ARR+ SL++VA++A ELG+PD I +  DV+N +D
Sbjct  53   ITGASSGIGEQLAYQYALKRASLVLVARREWSLRKVADQAFELGAPDVIILPGDVANPED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V   I+ +G +DHLV NA
Sbjct  113  CKRFVQAAIDHYGRLDHLVCNA  134



>ref|XP_010249088.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Nelumbo nucifera]
Length=293

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 44/73 (60%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -2

Query  220  EHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDDCRRIVDQTI  41
            EH+AYEYAK+GA LVL ARR+ SL+EVA +AV+LGSPD +A+ ADVS + +C++ V++ +
Sbjct  5    EHIAYEYAKKGASLVLVARRENSLREVARKAVQLGSPDVLAVPADVSKVHECKKFVEEAV  64

Query  40   NWFGCVDHLVNNA  2
            N FG +DHLV NA
Sbjct  65   NHFGRLDHLVCNA  77



>tpg|DAA38129.1| TPA: hypothetical protein ZEAMMB73_775961 [Zea mays]
Length=148

 Score = 96.7 bits (239),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAKRGA L L ARR+ SL+EV + A+ LGSP  + + ADVS   D
Sbjct  54   ITGASSGIGEHLAYEYAKRGAYLALVARREASLREVGDVALGLGSPGVLVLPADVSKPRD  113

Query  67   CRRIVDQTINWFG  29
            C   +D TI++FG
Sbjct  114  CEGFIDDTISYFG  126



>ref|XP_010271122.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X3 [Nelumbo nucifera]
Length=335

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 50/88 (57%), Positives = 61/88 (69%), Gaps = 6/88 (7%)
 Frame = -2

Query  247  ITGASSGIGE------HLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQAD  86
            ITG SSGIGE      H+AYEYAKR A LVL ARR+  LQ VA R  +LGSPD + + AD
Sbjct  52   ITGGSSGIGEVYRSSTHIAYEYAKRRASLVLVARREAKLQSVAERTRQLGSPDVVIVPAD  111

Query  85   VSNLDDCRRIVDQTINWFGCVDHLVNNA  2
            VS   +C+R V++ +N FG +DHLV NA
Sbjct  112  VSMAAECKRFVEEAVNHFGRLDHLVCNA  139



>ref|XP_006397111.1| hypothetical protein EUTSA_v10029315mg [Eutrema salsugineum]
 gb|ESQ38564.1| hypothetical protein EUTSA_v10029315mg [Eutrema salsugineum]
Length=401

 Score =   100 bits (248),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGE +AYEYAKRGA LVL ARR+  L+ V+N+A  +G+   I I ADV   DD
Sbjct  54   ITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNKARIIGANHVIIIAADVIKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVN  8
            CRR + Q +N++G VDHLVN
Sbjct  114  CRRFITQAVNYYGRVDHLVN  133



>ref|XP_006404393.1| hypothetical protein EUTSA_v10010570mg [Eutrema salsugineum]
 gb|ESQ45846.1| hypothetical protein EUTSA_v10010570mg [Eutrema salsugineum]
Length=309

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYAK+GA L L ARRK  L+ VA  + +LGS D I I  DV+ ++D
Sbjct  53   ITGASSGIGEHLAYEYAKKGAYLALVARRKDRLEIVAETSRQLGSGDVIIIPGDVAKVED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C++ +D+TI+ FG   HL+NNA
Sbjct  113  CKKFIDKTIHHFGKY-HLINNA  133



>gb|ABX82800.1| sterolesin-B [Brassica napus]
Length=253

 Score = 98.2 bits (243),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGE +AYEYAKRGA LVL ARR+  L+ V+N A ++G+   I I ADV   DD
Sbjct  30   ITGASSAIGEQIAYEYAKRGANLVLVARREQRLRVVSNNARQIGANHVIIIAADVVKEDD  89

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR + Q +N++G VDHLVN+A
Sbjct  90   CRRFITQAVNYYGRVDHLVNSA  111



>ref|XP_006662954.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Oryza 
brachyantha]
Length=360

 Score = 99.0 bits (245),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            +TGASSGIGEHL YEYAK+GA + L AR +++L+ VA  A +LGSPD + + AD++ LDD
Sbjct  57   VTGASSGIGEHLVYEYAKKGACVALTARTEIALRAVAKTARDLGSPDVLVVPADITKLDD  116

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
             +R V++T+  FG ++HLV NA
Sbjct  117  AKRAVEETVAHFGKLNHLVANA  138



>ref|XP_010271841.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X1 [Nelumbo nucifera]
Length=328

 Score = 99.0 bits (245),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGEH+AYEYAKRGA LVL A R+  L +VA RA +LGSPD + I ADVS + +
Sbjct  52   ITGASSAIGEHIAYEYAKRGAYLVLVATREDCLGKVAGRARQLGSPDVVLICADVSQIKE  111

Query  67   CRRIVDQTIN-WFGCVDHLVNN  5
            C+R V++ +N  FG +DHLV N
Sbjct  112  CKRFVEEAVNHHFGRLDHLVCN  133



>ref|XP_006376168.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|ERP53965.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=326

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYAKR A LVL ARR+  L+ V+ +A  +G+   + + ADV   DD
Sbjct  52   ITGASSGIGEQIAYEYAKRKAILVLIARREHRLRGVSEKARYIGAKRVLIMAADVVKEDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR V++TIN+FG VDHLVN A
Sbjct  112  CRRFVNETINYFGRVDHLVNTA  133



>gb|EYU22738.1| hypothetical protein MIMGU_mgv1a008685mg [Erythranthe guttata]
Length=365

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AY+YAK+GA LVL ARR+  L+ ++  A  +G+   + + ADV   DD
Sbjct  53   ITGASSGIGEQIAYQYAKKGANLVLVARREQRLRGISENARRMGAQHVLIMAADVVKEDD  112

Query  67   CRRIVDQTINWFGCVDHLVN  8
            CRR +++TIN+FG VDHLVN
Sbjct  113  CRRFINETINYFGRVDHLVN  132



>ref|XP_010271842.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like isoform 
X2 [Nelumbo nucifera]
Length=287

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASS IGEH+AYEYAKRGA LVL A R+  L +VA RA +LGSPD + I ADVS + +
Sbjct  11   ITGASSAIGEHIAYEYAKRGAYLVLVATREDCLGKVAGRARQLGSPDVVLICADVSQIKE  70

Query  67   CRRIVDQTIN-WFGCVDHLVNN  5
            C+R V++ +N  FG +DHLV N
Sbjct  71   CKRFVEEAVNHHFGRLDHLVCN  92



>ref|XP_010271120.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 4A isoform 
X1 [Nelumbo nucifera]
Length=370

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 50/88 (57%), Positives = 61/88 (69%), Gaps = 6/88 (7%)
 Frame = -2

Query  247  ITGASSGIGE------HLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQAD  86
            ITG SSGIGE      H+AYEYAKR A LVL ARR+  LQ VA R  +LGSPD + + AD
Sbjct  87   ITGGSSGIGEVYRSSTHIAYEYAKRRASLVLVARREAKLQSVAERTRQLGSPDVVIVPAD  146

Query  85   VSNLDDCRRIVDQTINWFGCVDHLVNNA  2
            VS   +C+R V++ +N FG +DHLV NA
Sbjct  147  VSMAAECKRFVEEAVNHFGRLDHLVCNA  174



>ref|XP_007019842.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein isoform 1 
[Theobroma cacao]
 gb|EOY17067.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein isoform 1 
[Theobroma cacao]
Length=412

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYA+R A LVL ARR+  L+ ++ +A  +G+ + I I ADV   DD
Sbjct  108  ITGASSGIGEQIAYEYARRRANLVLVARREHRLRGISEKARHIGAKNVIIIAADVVKEDD  167

Query  67   CRRIVDQTINWFGCVDHLVN  8
            CRR V +TIN++G VDHLVN
Sbjct  168  CRRFVTETINFYGRVDHLVN  187



>dbj|BAJ87073.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92171.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=352

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEHLAYEYA++GA + L AR +++L+ VA  A ELGSPD + + AD++++++
Sbjct  57   ITGASSGIGEHLAYEYARKGACVALVARTEIALRAVAKTARELGSPDTLVVPADITDVEE  116

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
             RR V++T+  FG ++HLV NA
Sbjct  117  ARRAVEETVAHFGKLNHLVANA  138



>gb|ABA98146.2| oxidoreductase, short chain dehydrogenase/reductase family protein, 
expressed [Oryza sativa Japonica Group]
Length=349

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAY YA   A LVL ARR+ SL++VA++A ELG+PD I +  DV+N +D
Sbjct  53   ITGASSGIGEQLAYNYALNRASLVLVARREWSLRKVADQAFELGAPDVIILPGDVANPED  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V   I+ +G +DHLV NA
Sbjct  113  CKRFVQTAIDHYGRLDHLVCNA  134



>gb|KDP45630.1| hypothetical protein JCGZ_17237 [Jatropha curcas]
Length=308

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            +TGASSGIGE +AYEYAKR A LVL ARR+  L+ ++ +A ++G+     I ADV   DD
Sbjct  8    VTGASSGIGEQIAYEYAKRKANLVLIARREHRLRGISEKARQVGAKHVTIIAADVVKEDD  67

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR V++TIN++G VDHLVN A
Sbjct  68   CRRFVNETINFYGRVDHLVNTA  89



>ref|XP_010910414.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Elaeis 
guineensis]
Length=349

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AY+YA RGA LVL ARR+ +L  VA  A+ELG+PD +   AD+S  ++
Sbjct  53   ITGASSGIGEHIAYQYAMRGASLVLVARREHALNSVAKTAIELGAPDVLVKPADISIPNE  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
              RI+++TI  FG ++HLV NA
Sbjct  113  SERIIEETIAHFGQLNHLVVNA  134



>ref|XP_007019843.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein isoform 2 
[Theobroma cacao]
 gb|EOY17068.1| Hydroxysteroid 11-beta-dehydrogenase 1-like protein isoform 2 
[Theobroma cacao]
Length=314

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYA+R A LVL ARR+  L+ ++ +A  +G+ + I I ADV   DD
Sbjct  54   ITGASSGIGEQIAYEYARRRANLVLVARREHRLRGISEKARHIGAKNVIIIAADVVKEDD  113

Query  67   CRRIVDQTINWFGCVDHLVN  8
            CRR V +TIN++G VDHLVN
Sbjct  114  CRRFVTETINFYGRVDHLVN  133



>ref|XP_011006178.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase-like 5 [Populus 
euphratica]
Length=336

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYAKR A LVL AR++  L+ V+ +A  +G+   + + ADV   DD
Sbjct  62   ITGASSGIGEQIAYEYAKRKAILVLIARKEHRLRGVSEKARYIGAKHVLIMAADVVKEDD  121

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR V++TIN+FG VDHLVN A
Sbjct  122  CRRFVNETINYFGRVDHLVNTA  143



>ref|XP_002864070.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40329.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=294

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 5/82 (6%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITG+SSGIGEHLAYEYA+RGA L L ARR+  LQ VA+R  +LGSPD       VS ++D
Sbjct  52   ITGSSSGIGEHLAYEYARRGAYLTLVARREDRLQVVADRCRKLGSPDVT-----VSVIED  106

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V +TI+ FG +D LVNNA
Sbjct  107  CKRFVQETISRFGRLDRLVNNA  128



>ref|NP_001066740.1| Os12g0464400 [Oryza sativa Japonica Group]
 dbj|BAF29759.1| Os12g0464400, partial [Oryza sativa Japonica Group]
Length=393

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE LAY YA   A LVL ARR+ SL++VA++A ELG+PD I +  DV+N +D
Sbjct  97   ITGASSGIGEQLAYNYALNRASLVLVARREWSLRKVADQAFELGAPDVIILPGDVANPED  156

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            C+R V   I+ +G +DHLV NA
Sbjct  157  CKRFVQTAIDHYGRLDHLVCNA  178



>ref|XP_002528042.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
 gb|EEF34360.1| Corticosteroid 11-beta-dehydrogenase, putative [Ricinus communis]
Length=352

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYAKR A LVL ARR+  L+ ++ +A   G+   + + ADV   DD
Sbjct  52   ITGASSGIGEQIAYEYAKRKANLVLIARREQRLRGISEKARLFGAKHVMIMAADVVKEDD  111

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
            CRR V++TIN++G VDHLVN A
Sbjct  112  CRRFVEETINFYGRVDHLVNTA  133



>ref|XP_010913000.1| PREDICTED: 11-beta-hydroxysteroid dehydrogenase 1B-like [Elaeis 
guineensis]
Length=349

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGEH+AY+YA RGA LVL ARR+ +L  VA  A+ELG+PD +   AD+S  ++
Sbjct  53   ITGASSGIGEHIAYQYAVRGASLVLVARREHALNSVAKTAIELGAPDVLVKPADISIPNE  112

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
             +RI+++TI  FG ++HLV NA
Sbjct  113  SKRIMEETIAHFGRLNHLVVNA  134



>ref|XP_007222177.1| hypothetical protein PRUPE_ppa007781mg [Prunus persica]
 gb|EMJ23376.1| hypothetical protein PRUPE_ppa007781mg [Prunus persica]
Length=356

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE +AYEYAKRGA+LVL ARR   L+ ++  A  +G+   + + ADV   ++
Sbjct  52   ITGASSGIGEQIAYEYAKRGAKLVLVARRDNRLRLISENARHMGAKHVMIVAADVVKEEE  111

Query  67   CRRIVDQTINWFGCVDHLVN  8
            CRR V++TIN++G VDHLVN
Sbjct  112  CRRFVNETINFYGRVDHLVN  131



>gb|EMT06462.1| hypothetical protein F775_52091 [Aegilops tauschii]
Length=422

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            ITGASSGIGE+LAYEYA++GA + L AR +++L+ VA  A ELG+PD + + AD++N+D+
Sbjct  57   ITGASSGIGENLAYEYARKGACVALVARTEIALRAVAKTARELGAPDTLVVPADITNVDE  116

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
             +R V++T+  FG ++HLV NA
Sbjct  117  AKRAVEETVAHFGKLNHLVANA  138



>ref|NP_001067940.1| Os11g0499600 [Oryza sativa Japonica Group]
 gb|ABA93829.1| oxidoreductase, short chain dehydrogenase/reductase family protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF28303.1| Os11g0499600 [Oryza sativa Japonica Group]
 gb|EAY81017.1| hypothetical protein OsI_36200 [Oryza sativa Indica Group]
 gb|EAZ18442.1| hypothetical protein OsJ_33972 [Oryza sativa Japonica Group]
Length=354

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  247  ITGASSGIGEHLAYEYAKRGARLVLAARRKVSLQEVANRAVELGSPDAIAIQADVSNLDD  68
            +TGASSGIGEHL YEYAK+GA + L AR +++L+ VA  A +LG+PD + + AD++ +DD
Sbjct  57   VTGASSGIGEHLVYEYAKKGACVALTARTEIALRAVAKTARDLGAPDVLVVPADITKVDD  116

Query  67   CRRIVDQTINWFGCVDHLVNNA  2
             +R V++T+  FG ++HLV NA
Sbjct  117  AKRAVEETVAHFGKLNHLVANA  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512543153186