BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17504_g4_i1 len=176 path=[4729:0-175]

Length=176
                                                                      Score     E

ref|XP_009610577.1|  PREDICTED: protein PRD1                          54.3    1e-06   
ref|XP_009782988.1|  PREDICTED: protein PRD1                          53.5    2e-06   
ref|XP_008222797.1|  PREDICTED: protein PRD1                          52.4    6e-06   
ref|XP_007224979.1|  hypothetical protein PRUPE_ppa020774mg           52.4    6e-06   
ref|XP_008464340.1|  PREDICTED: protein PRD1 isoform X5               52.0    7e-06   
ref|XP_008464336.1|  PREDICTED: protein PRD1 isoform X2               52.0    8e-06   
ref|XP_008464335.1|  PREDICTED: protein PRD1 isoform X1               52.0    9e-06   
ref|XP_008464339.1|  PREDICTED: protein PRD1 isoform X4               51.6    1e-05   
ref|XP_008464337.1|  PREDICTED: protein PRD1 isoform X3               51.6    1e-05   
gb|EYU38964.1|  hypothetical protein MIMGU_mgv1a020726mg              51.2    1e-05   
ref|XP_006345186.1|  PREDICTED: protein PRD1-like                     51.2    1e-05   
ref|XP_004138537.1|  PREDICTED: protein PRD1-like                     50.4    2e-05   
gb|KGN45916.1|  hypothetical protein Csa_6G022280                     50.4    3e-05   
ref|XP_002268156.2|  PREDICTED: protein PRD1 isoform X1               50.4    3e-05   Vitis vinifera
ref|XP_010318924.1|  PREDICTED: protein PRD1                          50.4    3e-05   
emb|CBI39380.3|  unnamed protein product                              50.4    3e-05   
emb|CAN80933.1|  hypothetical protein VITISV_017363                   50.1    3e-05   Vitis vinifera
ref|XP_010650391.1|  PREDICTED: protein PRD1 isoform X2               50.1    3e-05   
ref|XP_004298232.1|  PREDICTED: protein PRD1-like                     49.7    5e-05   
ref|XP_006492990.1|  PREDICTED: protein PRD1-like                     48.5    1e-04   
ref|XP_011042773.1|  PREDICTED: protein PRD1                          47.4    3e-04   
ref|XP_011084192.1|  PREDICTED: protein PRD1-like                     47.4    3e-04   
ref|XP_002302892.2|  hypothetical protein POPTR_0002s23370g           47.0    4e-04   Populus trichocarpa [western balsam poplar]
gb|KDO52829.1|  hypothetical protein CISIN_1g000855mg                 46.2    7e-04   
ref|XP_006421047.1|  hypothetical protein CICLE_v10004169mg           46.2    8e-04   



>ref|XP_009610577.1| PREDICTED: protein PRD1 [Nicotiana tomentosiformis]
Length=1296

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  ETKIFANIlfsfswfsfsfgllglFPTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            ETKIFAN+LF+ SWFSF++G LG FP+EKMK +VYL+FS++++ ++GDDSG+ IRD
Sbjct  569  ETKIFANVLFTSSWFSFAYGCLGFFPSEKMKMKVYLIFSVMTDIILGDDSGRSIRD  624



>ref|XP_009782988.1| PREDICTED: protein PRD1 [Nicotiana sylvestris]
Length=1296

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  ETKIFANIlfsfswfsfsfgllglFPTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            ETKIFAN+LF+ SWFSF++G LG  P+EKMK +VYL+FS++++ ++GDD+G+ IRD
Sbjct  569  ETKIFANVLFTSSWFSFAYGCLGFLPSEKMKMKVYLIFSVMTDIILGDDTGRSIRD  624



>ref|XP_008222797.1| PREDICTED: protein PRD1 [Prunus mume]
Length=1460

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            PTEKMKWRVYL+ S L + L+G+DSGQ IRD
Sbjct  607  PTEKMKWRVYLMLSSLVDVLVGNDSGQPIRD  637



>ref|XP_007224979.1| hypothetical protein PRUPE_ppa020774mg [Prunus persica]
 gb|EMJ26178.1| hypothetical protein PRUPE_ppa020774mg [Prunus persica]
Length=1316

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            PTEKMKWRVYL+ S L + L+G+DSGQ IRD
Sbjct  610  PTEKMKWRVYLMLSSLVDVLVGNDSGQPIRD  640



>ref|XP_008464340.1| PREDICTED: protein PRD1 isoform X5 [Cucumis melo]
Length=1015

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            P+EKMKWRVYL+ S L + + G+DSGQCIR+
Sbjct  580  PSEKMKWRVYLMLSSLVDVIFGNDSGQCIRE  610



>ref|XP_008464336.1| PREDICTED: protein PRD1 isoform X2 [Cucumis melo]
Length=1240

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            P+EKMKWRVYL+ S L + + G+DSGQCIR+
Sbjct  580  PSEKMKWRVYLMLSSLVDVIFGNDSGQCIRE  610



>ref|XP_008464335.1| PREDICTED: protein PRD1 isoform X1 [Cucumis melo]
Length=1275

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            P+EKMKWRVYL+ S L + + G+DSGQCIR+
Sbjct  580  PSEKMKWRVYLMLSSLVDVIFGNDSGQCIRE  610



>ref|XP_008464339.1| PREDICTED: protein PRD1 isoform X4 [Cucumis melo]
Length=1054

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            P+EKMKWRVYL+ S L + + G+DSGQCIR+
Sbjct  359  PSEKMKWRVYLMLSSLVDVIFGNDSGQCIRE  389



>ref|XP_008464337.1| PREDICTED: protein PRD1 isoform X3 [Cucumis melo]
Length=1128

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            P+EKMKWRVYL+ S L + + G+DSGQCIR+
Sbjct  433  PSEKMKWRVYLMLSSLVDVIFGNDSGQCIRE  463



>gb|EYU38964.1| hypothetical protein MIMGU_mgv1a020726mg [Erythranthe guttata]
Length=1227

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            PTEKMKWRVY++FS + + L+G DSGQ IRD
Sbjct  589  PTEKMKWRVYMIFSSIIDVLLGSDSGQPIRD  619



>ref|XP_006345186.1| PREDICTED: protein PRD1-like [Solanum tuberosum]
Length=1372

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  TETKIFANIlfsfswfsfsfgllglFPTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            TETKIFAN+L + SWFSF++G LG FP+EKMK +VYL+FS++++ ++G DS +CI D
Sbjct  644  TETKIFANVLLTSSWFSFAYGCLGFFPSEKMKRKVYLIFSVMTDIILGVDSARCISD  700



>ref|XP_004138537.1| PREDICTED: protein PRD1-like [Cucumis sativus]
 ref|XP_004160229.1| PREDICTED: protein PRD1-like [Cucumis sativus]
Length=1256

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            P+E+MKWRVYL+ S L + + G+DSGQCIR+
Sbjct  561  PSEQMKWRVYLMLSSLVDVIFGNDSGQCIRE  591



>gb|KGN45916.1| hypothetical protein Csa_6G022280 [Cucumis sativus]
Length=1275

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            P+E+MKWRVYL+ S L + + G+DSGQCIR+
Sbjct  580  PSEQMKWRVYLMLSSLVDVIFGNDSGQCIRE  610



>ref|XP_002268156.2| PREDICTED: protein PRD1 isoform X1 [Vitis vinifera]
Length=1291

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            P+EKMKWRVYL+FS + + L+G++SGQ IRD
Sbjct  589  PSEKMKWRVYLMFSSIVDVLLGNESGQPIRD  619



>ref|XP_010318924.1| PREDICTED: protein PRD1 [Solanum lycopersicum]
Length=1294

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 35/57 (61%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  TETKIFANIlfsfswfsfsfgllglFPTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            TETKIFAN+L + SWFSF++G LGLFP+EKMK  VYL+FS++++ ++G DS +CI D
Sbjct  566  TETKIFANVLLTSSWFSFAYGCLGLFPSEKMKRNVYLIFSVMTDIILGVDSARCISD  622



>emb|CBI39380.3| unnamed protein product [Vitis vinifera]
Length=1312

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            P+EKMKWRVYL+FS + + L+G++SGQ IRD
Sbjct  610  PSEKMKWRVYLMFSSIVDVLLGNESGQPIRD  640



>emb|CAN80933.1| hypothetical protein VITISV_017363 [Vitis vinifera]
Length=928

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            P+EKMKWRVYL+FS + + L+G++SGQ IRD
Sbjct  423  PSEKMKWRVYLMFSSIVDVLLGNESGQPIRD  453



>ref|XP_010650391.1| PREDICTED: protein PRD1 isoform X2 [Vitis vinifera]
Length=1151

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            P+EKMKWRVYL+FS + + L+G++SGQ IRD
Sbjct  449  PSEKMKWRVYLMFSSIVDVLLGNESGQPIRD  479



>ref|XP_004298232.1| PREDICTED: protein PRD1-like [Fragaria vesca subsp. vesca]
Length=1248

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            PTEKMKWRVYL+ S L + L+G D+GQ IRD
Sbjct  584  PTEKMKWRVYLMLSSLVDVLLGTDTGQPIRD  614



>ref|XP_006492990.1| PREDICTED: protein PRD1-like [Citrus sinensis]
Length=1309

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            PTEK+KWRVYL+ S L + L G+D+GQ IRD
Sbjct  594  PTEKIKWRVYLMLSSLVDVLFGNDTGQPIRD  624



>ref|XP_011042773.1| PREDICTED: protein PRD1 [Populus euphratica]
 ref|XP_011042774.1| PREDICTED: protein PRD1 [Populus euphratica]
 ref|XP_011042775.1| PREDICTED: protein PRD1 [Populus euphratica]
Length=1331

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            PTEKMKWRVYL+ S L E L+ +D+GQ IR+
Sbjct  623  PTEKMKWRVYLMLSSLVEILLENDAGQLIRE  653



>ref|XP_011084192.1| PREDICTED: protein PRD1-like [Sesamum indicum]
Length=897

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            P+EKMKWRVYL+FS + + L+G D GQ IRD
Sbjct  586  PSEKMKWRVYLIFSSIVDVLLGVDFGQPIRD  616



>ref|XP_002302892.2| hypothetical protein POPTR_0002s23370g [Populus trichocarpa]
 gb|EEE82165.2| hypothetical protein POPTR_0002s23370g [Populus trichocarpa]
Length=1343

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            PTEKMKWRVYL+ S L E L+ +D+GQ IR+
Sbjct  615  PTEKMKWRVYLMLSSLVEILLENDAGQPIRE  645



>gb|KDO52829.1| hypothetical protein CISIN_1g000855mg [Citrus sinensis]
Length=1252

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            PTEK+KWRVYL+ S L + L  +D+GQ IRD
Sbjct  613  PTEKIKWRVYLMLSSLVDVLFSNDTGQPIRD  643



>ref|XP_006421047.1| hypothetical protein CICLE_v10004169mg [Citrus clementina]
 gb|ESR34287.1| hypothetical protein CICLE_v10004169mg [Citrus clementina]
Length=1281

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -3

Query  93   PTEKMKWRVYLLFSLLSEALIGDDSGQCIRD  1
            PTEK+KWRVYL+ S L + L  +D+GQ IRD
Sbjct  566  PTEKIKWRVYLMLSSLVDVLFSNDTGQPIRD  596



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511558873218