BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17504_g1_i2 len=1061 path=[2427:0-876 25:877-1060]

Length=1061
                                                                      Score     E

ref|XP_006345186.1|  PREDICTED: protein PRD1-like                       352   6e-107   
ref|XP_009610577.1|  PREDICTED: protein PRD1                            338   6e-102   
ref|XP_010318924.1|  PREDICTED: protein PRD1                            338   6e-102   
ref|XP_010650391.1|  PREDICTED: protein PRD1 isoform X2                 322   8e-97    
ref|XP_002268156.2|  PREDICTED: protein PRD1 isoform X1                 322   3e-96    Vitis vinifera
emb|CBI39380.3|  unnamed protein product                                322   4e-96    
ref|XP_011084191.1|  PREDICTED: protein PRD1-like                       300   2e-95    
ref|XP_009782988.1|  PREDICTED: protein PRD1                            312   8e-93    
ref|XP_007224979.1|  hypothetical protein PRUPE_ppa020774mg             304   6e-90    
ref|XP_002516401.1|  conserved hypothetical protein                     303   1e-89    Ricinus communis
gb|KDP32572.1|  hypothetical protein JCGZ_13122                         301   1e-88    
emb|CDP15128.1|  unnamed protein product                                300   2e-88    
ref|XP_008222797.1|  PREDICTED: protein PRD1                            296   1e-86    
ref|XP_011042773.1|  PREDICTED: protein PRD1                            293   7e-86    
ref|XP_002302892.2|  hypothetical protein POPTR_0002s23370g             288   3e-84    Populus trichocarpa [western balsam poplar]
ref|XP_004502366.1|  PREDICTED: protein PRD1-like                       285   2e-83    
gb|EYU38964.1|  hypothetical protein MIMGU_mgv1a020726mg                285   3e-83    
gb|KHN44466.1|  Protein PRD1                                            285   5e-83    
ref|XP_003537526.1|  PREDICTED: protein PRD1-like isoform X1            285   5e-83    
ref|XP_003601715.1|  hypothetical protein MTR_3g084640                  283   2e-82    
ref|XP_004298232.1|  PREDICTED: protein PRD1-like                       283   2e-82    
ref|XP_006492990.1|  PREDICTED: protein PRD1-like                       280   3e-81    
ref|XP_008337577.1|  PREDICTED: protein PRD1                            279   6e-81    
ref|XP_009373627.1|  PREDICTED: protein PRD1                            277   3e-80    
ref|XP_006421047.1|  hypothetical protein CICLE_v10004169mg             275   2e-79    
ref|XP_010278449.1|  PREDICTED: protein PRD1 isoform X2                 270   2e-78    
ref|XP_010278448.1|  PREDICTED: protein PRD1 isoform X1                 270   5e-78    
gb|KDO52829.1|  hypothetical protein CISIN_1g000855mg                   268   2e-77    
ref|XP_008775314.1|  PREDICTED: LOW QUALITY PROTEIN: protein PRD1       252   1e-73    
ref|NP_193154.1|  protein PRD1                                          254   4e-72    Arabidopsis thaliana [mouse-ear cress]
sp|O23277.3|PRD1_ARATH  RecName: Full=Protein PRD1; Short=AtPRD1;...    254   5e-72    Arabidopsis thaliana [mouse-ear cress]
gb|ABQ12642.1|  PRD1                                                    254   6e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007034167.1|  Recombination initiation defect 1, putative        253   1e-71    
ref|XP_006283017.1|  hypothetical protein CARUB_v10004006mg             252   2e-71    
ref|XP_007151616.1|  hypothetical protein PHAVU_004G0621001g            250   2e-71    
ref|XP_002870332.1|  hypothetical protein ARALYDRAFT_330097             251   9e-71    
ref|XP_010450091.1|  PREDICTED: protein PRD1                            248   1e-69    
ref|XP_010103593.1|  hypothetical protein L484_023090                   247   2e-69    
gb|KFK25469.1|  hypothetical protein AALP_AA8G118600                    241   2e-67    
gb|KFK25468.1|  hypothetical protein AALP_AA8G118600                    241   2e-67    
emb|CDY05132.1|  BnaC03g29300D                                          241   2e-67    
ref|XP_008464339.1|  PREDICTED: protein PRD1 isoform X4                 238   4e-67    
ref|XP_004138537.1|  PREDICTED: protein PRD1-like                       239   6e-67    
ref|XP_008464337.1|  PREDICTED: protein PRD1 isoform X3                 238   6e-67    
gb|KGN45916.1|  hypothetical protein Csa_6G022280                       239   8e-67    
ref|XP_009134222.1|  PREDICTED: protein PRD1 isoform X2                 239   2e-66    
emb|CDX90779.1|  BnaA03g24590D                                          238   2e-66    
ref|XP_008464335.1|  PREDICTED: protein PRD1 isoform X1                 238   2e-66    
ref|XP_009134221.1|  PREDICTED: protein PRD1 isoform X1                 238   2e-66    
ref|XP_008464336.1|  PREDICTED: protein PRD1 isoform X2                 238   3e-66    
ref|XP_010929840.1|  PREDICTED: protein PRD1                            236   9e-66    
ref|XP_010532711.1|  PREDICTED: protein PRD1                            235   3e-65    
ref|XP_006844709.1|  hypothetical protein AMTR_s00016p00250070          234   2e-64    
ref|XP_006414781.1|  hypothetical protein EUTSA_v10027320mg             233   2e-64    
ref|NP_001052517.1|  Os04g0347800                                       211   1e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009399313.1|  PREDICTED: protein PRD1                            221   2e-60    
gb|AFW87709.1|  hypothetical protein ZEAMMB73_320319                    218   8e-60    
ref|XP_002438828.1|  hypothetical protein SORBIDRAFT_10g026800          218   3e-59    Sorghum bicolor [broomcorn]
ref|XP_008659889.1|  PREDICTED: LOW QUALITY PROTEIN: protein PRD1       217   5e-59    
ref|XP_004975309.1|  PREDICTED: protein PRD1-like                       216   6e-59    
gb|EMT02906.1|  hypothetical protein F775_04500                         215   2e-58    
ref|XP_006652185.1|  PREDICTED: protein PRD1-like                       206   2e-58    
gb|KCW59905.1|  hypothetical protein EUGRSUZ_H02630                     210   2e-56    
gb|EEC77052.1|  hypothetical protein OsI_15436                          211   2e-56    Oryza sativa Indica Group [Indian rice]
emb|CAE02100.2|  OSJNBa0020I02.9                                        209   2e-56    Oryza sativa Japonica Group [Japonica rice]
gb|EEE60780.1|  hypothetical protein OsJ_14358                          210   2e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010026681.1|  PREDICTED: LOW QUALITY PROTEIN: protein PRD1       209   2e-56    
emb|CAH66368.1|  OSIGBa0130K07.4                                        209   2e-56    Oryza sativa [red rice]
ref|XP_010673442.1|  PREDICTED: protein PRD1                            207   2e-55    
gb|EMS50467.1|  Retrovirus-related Pol polyprotein from transposo...    206   4e-55    
ref|XP_010239548.1|  PREDICTED: protein PRD1                            198   2e-52    
gb|EPS70334.1|  hypothetical protein M569_04422                         194   4e-51    
emb|CAN80933.1|  hypothetical protein VITISV_017363                     190   3e-50    Vitis vinifera
ref|XP_007163798.1|  hypothetical protein PHAVU_001G2650000g            168   2e-46    
ref|XP_007224853.1|  hypothetical protein PRUPE_ppa022866mg             172   1e-44    
ref|XP_006603081.1|  PREDICTED: protein PRD1-like                       162   1e-44    
pir||C71403  hypothetical 15.1K protein - Arabidopsis thaliana          167   1e-41 
gb|KHN24038.1|  Protein PRD1                                            154   4e-38    
gb|ACU28609.1|  At4g14180-like protein                                  134   2e-34    Arabidopsis lyrata subsp. petraea
gb|ACU28611.1|  At4g14180-like protein                                  130   6e-33    Arabidopsis lyrata subsp. petraea
gb|ACU28617.1|  At4g14180-like protein                                  130   8e-33    Arabidopsis lyrata subsp. petraea
gb|ACU28614.1|  At4g14180-like protein                                  129   2e-32    Arabidopsis lyrata subsp. petraea
gb|ACU28616.1|  At4g14180-like protein                                  128   3e-32    Arabidopsis lyrata subsp. petraea
gb|ACU28608.1|  At4g14180-like protein                                  128   4e-32    Arabidopsis lyrata subsp. petraea
gb|ACU28615.1|  At4g14180-like protein                                  128   4e-32    Arabidopsis lyrata subsp. petraea
gb|ACU28613.1|  At4g14180-like protein                                  127   7e-32    Arabidopsis lyrata subsp. petraea
ref|XP_010440518.1|  PREDICTED: protein PRD1-like                       130   7e-32    
gb|ACU28610.1|  At4g14180-like protein                                  125   5e-31    Arabidopsis lyrata subsp. petraea
gb|ACU28618.1|  At4g14180-like protein                                  118   1e-28    Arabidopsis lyrata subsp. petraea
ref|XP_007163797.1|  hypothetical protein PHAVU_001G2650001g          99.4    3e-19    
ref|XP_001768570.1|  predicted protein                                73.2    1e-10    
ref|XP_006285776.1|  hypothetical protein CARUB_v10007250mg           63.9    1e-07    



>ref|XP_006345186.1| PREDICTED: protein PRD1-like [Solanum tuberosum]
Length=1372

 Score =   352 bits (904),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 175/283 (62%), Positives = 225/283 (80%), Gaps = 0/283 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGP+LI+ DE TR+ E LVFVL+LLFF+ RS +AILPGIVDCQ+LLD ++  QP PY
Sbjct  1041  ACSKGPSLIEQDEGTRSVEALVFVLSLLFFSLRSVHAILPGIVDCQYLLDPTNIPQPWPY  1100

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              SI+CHDLCKL+HFGS  IKL++S +L+E+FS + +  +RK D L+F+  YLLS  AVLE
Sbjct  1101  ISIQCHDLCKLLHFGSIPIKLLSSQYLLELFSGIEDERSRKSDTLEFRTNYLLSIMAVLE  1160

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             G IFSSD+ V+MNCSLCLSM+IGWQD++ +V +I+R++W R IVEE+ +SLA P LASKS
Sbjct  1161  GQIFSSDMSVAMNCSLCLSMLIGWQDVETEVSAIQRNNWCRFIVEELVMSLAAPSLASKS  1220

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F IHHKPAIH+AV LLR K+ P WM+S+F+ESCI  II+NI+ SNLS ELV L R+LLN 
Sbjct  1221  FMIHHKPAIHIAVELLRRKKVPQWMTSIFNESCIFAIIRNITNSNLSAELVFLLRKLLNY  1280

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAA  849
             G+L DEQI++LN+VFQECR+C+Y + +     EE   N  AA+
Sbjct  1281  GFLNDEQIAALNQVFQECRKCIYTDKLQRTGEEEKTWNVAAAS  1323



>ref|XP_009610577.1| PREDICTED: protein PRD1 [Nicotiana tomentosiformis]
Length=1296

 Score =   338 bits (867),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 165/283 (58%), Positives = 220/283 (78%), Gaps = 0/283 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGP L+D D+ TR+GE LVFVL+LLFF+ +S +AILP I+DCQ+LLD +S  QPLP+
Sbjct  965   ACSKGPCLVDQDKGTRSGEALVFVLSLLFFSLKSLHAILPRIMDCQYLLDPTSVPQPLPH  1024

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              SI CHDLCKL+HFGS  +KL++S +L+E+FSR+ +  +RKP  LKF+  Y+LS  AVLE
Sbjct  1025  ISIHCHDLCKLLHFGSIPVKLLSSQYLLELFSRIEDERSRKPGTLKFRTDYMLSVMAVLE  1084

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             G IFSSDI V+M CSLCLS++IGWQD + +V +I+R +W + IVEE+ +SLA P LASKS
Sbjct  1085  GQIFSSDITVAMKCSLCLSIIIGWQDAETEVSAIQRSNWSQFIVEELVMSLAAPSLASKS  1144

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F +HHKPA+H+AV+LLR K  P WM+S+FDESCI  I +N++  NLS ELV+L R+LL  
Sbjct  1145  FMLHHKPAVHIAVALLRRKGIPQWMTSIFDESCISAITRNVTNCNLSAELVILLRELLKH  1204

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAA  849
             G+L DEQI++LN+VFQEC++C+Y + +     EE   N  AA+
Sbjct  1205  GFLNDEQIAALNQVFQECKKCIYTDKLQHYGAEEKTLNVAAAS  1247



>ref|XP_010318924.1| PREDICTED: protein PRD1 [Solanum lycopersicum]
Length=1294

 Score =   338 bits (866),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 176/333 (53%), Positives = 238/333 (71%), Gaps = 10/333 (3%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGP+L++ +E  R+ E LVFVL+LLFF+ RS++AILPGI+D Q+LLD ++  QP  Y
Sbjct  963   ACSKGPSLLEQNEGARSVEALVFVLSLLFFSLRSAHAILPGIMDFQYLLDPTNIPQPWSY  1022

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              SI+CHDLCKL+HFGS  IKL++S +L+E+FS + +  +RK D L+F+  YL S  AVLE
Sbjct  1023  ISIQCHDLCKLLHFGSIPIKLLSSQYLLELFSGIEDEKSRKSDTLEFRTNYLTSIMAVLE  1082

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             G +FSSD+ V+MNCSLCLSM+IGWQD++ +V +I+R++W R IVEE+ +SLA P LASKS
Sbjct  1083  GQLFSSDMSVAMNCSLCLSMLIGWQDVETEVSAIQRNNWCRFIVEELVISLAAPSLASKS  1142

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F IHHKPAIH+AV LLR K+   WM+S+FDESCI  I +NI+ SNLS ELV L R+LLN 
Sbjct  1143  FMIHHKPAIHIAVELLRRKKVLQWMTSIFDESCIFAITRNITNSNLSAELVFLLRKLLNY  1202

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDLRNASVLFDGKEI  900
             G+L DEQI++LN+VFQECR+C+Y + +     EE   N  AA+           + GK  
Sbjct  1203  GFLNDEQIAALNQVFQECRKCIYTDKLQHAGAEEKTWNVAAASD----------YVGKVC  1252

Query  901   NQIQQYKILSPSEGLEHRSFVMEQRYLVRFLEV  999
               +       PS G+E   F  E+R L+  +++
Sbjct  1253  QFLISLVTTQPSSGMESSRFQSEKRELLEEIDL  1285



>ref|XP_010650391.1| PREDICTED: protein PRD1 isoform X2 [Vitis vinifera]
Length=1151

 Score =   322 bits (826),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 167/282 (59%), Positives = 214/282 (76%), Gaps = 1/282 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             +CSKGPALI+ DE TR GE L FVL L FF+ RS  A+LPG +D Q+LLD S+  QPL  
Sbjct  824   SCSKGPALIEDDEETRNGETLTFVLLLHFFSCRSFNAVLPGTLDWQNLLDPSNKTQPLSL  883

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              SI CHDLC+L+HFGS ++KLVASY L+E+F+R+++   RK D LK+  G+L+S  A+LE
Sbjct  884   ISIHCHDLCRLMHFGSPLVKLVASYCLMELFTRITDLRNRKHDELKWNMGHLISVMAILE  943

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQ-VPSIERDSWFRLIVEEVAVSLAVPCLASK  537
             GL+F SDI+V+MNC+LCLSM++GW+ L  Q    I R +W RLIVEE+A+SLAVP LASK
Sbjct  944   GLVFYSDIRVAMNCALCLSMILGWEKLWMQDTKVIGRCNWCRLIVEELAMSLAVPSLASK  1003

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SF  HHKPA+HVAV+LL++   P WM SVFD+SCI GII+N+S SN+S E VLLFR+LLN
Sbjct  1004  SFMNHHKPAVHVAVALLKLHSIPGWMKSVFDDSCISGIIENLSVSNVSMETVLLFRELLN  1063

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVA  843
               YLKDEQI+ LNRVFQ CR+ +Y  N  +   EE+ +  +A
Sbjct  1064  HEYLKDEQIACLNRVFQACRKHIYSGNTQDESREENIEKVIA  1105



>ref|XP_002268156.2| PREDICTED: protein PRD1 isoform X1 [Vitis vinifera]
Length=1291

 Score =   322 bits (825),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 167/282 (59%), Positives = 214/282 (76%), Gaps = 1/282 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             +CSKGPALI+ DE TR GE L FVL L FF+ RS  A+LPG +D Q+LLD S+  QPL  
Sbjct  964   SCSKGPALIEDDEETRNGETLTFVLLLHFFSCRSFNAVLPGTLDWQNLLDPSNKTQPLSL  1023

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              SI CHDLC+L+HFGS ++KLVASY L+E+F+R+++   RK D LK+  G+L+S  A+LE
Sbjct  1024  ISIHCHDLCRLMHFGSPLVKLVASYCLMELFTRITDLRNRKHDELKWNMGHLISVMAILE  1083

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQ-VPSIERDSWFRLIVEEVAVSLAVPCLASK  537
             GL+F SDI+V+MNC+LCLSM++GW+ L  Q    I R +W RLIVEE+A+SLAVP LASK
Sbjct  1084  GLVFYSDIRVAMNCALCLSMILGWEKLWMQDTKVIGRCNWCRLIVEELAMSLAVPSLASK  1143

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SF  HHKPA+HVAV+LL++   P WM SVFD+SCI GII+N+S SN+S E VLLFR+LLN
Sbjct  1144  SFMNHHKPAVHVAVALLKLHSIPGWMKSVFDDSCISGIIENLSVSNVSMETVLLFRELLN  1203

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVA  843
               YLKDEQI+ LNRVFQ CR+ +Y  N  +   EE+ +  +A
Sbjct  1204  HEYLKDEQIACLNRVFQACRKHIYSGNTQDESREENIEKVIA  1245



>emb|CBI39380.3| unnamed protein product [Vitis vinifera]
Length=1312

 Score =   322 bits (825),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 167/282 (59%), Positives = 214/282 (76%), Gaps = 1/282 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             +CSKGPALI+ DE TR GE L FVL L FF+ RS  A+LPG +D Q+LLD S+  QPL  
Sbjct  985   SCSKGPALIEDDEETRNGETLTFVLLLHFFSCRSFNAVLPGTLDWQNLLDPSNKTQPLSL  1044

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              SI CHDLC+L+HFGS ++KLVASY L+E+F+R+++   RK D LK+  G+L+S  A+LE
Sbjct  1045  ISIHCHDLCRLMHFGSPLVKLVASYCLMELFTRITDLRNRKHDELKWNMGHLISVMAILE  1104

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQ-VPSIERDSWFRLIVEEVAVSLAVPCLASK  537
             GL+F SDI+V+MNC+LCLSM++GW+ L  Q    I R +W RLIVEE+A+SLAVP LASK
Sbjct  1105  GLVFYSDIRVAMNCALCLSMILGWEKLWMQDTKVIGRCNWCRLIVEELAMSLAVPSLASK  1164

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SF  HHKPA+HVAV+LL++   P WM SVFD+SCI GII+N+S SN+S E VLLFR+LLN
Sbjct  1165  SFMNHHKPAVHVAVALLKLHSIPGWMKSVFDDSCISGIIENLSVSNVSMETVLLFRELLN  1224

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVA  843
               YLKDEQI+ LNRVFQ CR+ +Y  N  +   EE+ +  +A
Sbjct  1225  HEYLKDEQIACLNRVFQACRKHIYSGNTQDESREENIEKVIA  1266



>ref|XP_011084191.1| PREDICTED: protein PRD1-like [Sesamum indicum]
Length=341

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/278 (57%), Positives = 206/278 (74%), Gaps = 0/278 (0%)
 Frame = +1

Query  1    ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
            ACSKGPAL DHDE TR G+VL+FVL LLFF+ RS  AILPGI+D Q LLD   + QPL Y
Sbjct  60   ACSKGPALSDHDEGTRIGDVLIFVLLLLFFSLRSIRAILPGIIDFQILLDEGRNMQPLSY  119

Query  181  TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
             SI+CHDLCKL+HFGS  +KL+AS+ LVE+FS +S+  +R    LK + GYL S +AVLE
Sbjct  120  VSIRCHDLCKLMHFGSAPVKLIASFCLVELFSGISDYTSRTLVDLKLREGYLSSLAAVLE  179

Query  361  GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
            GLIF +D++V++NCSLC S +  W++LQ +    E+D W RLIVEE+ +SL+ P L +KS
Sbjct  180  GLIFFNDVRVALNCSLCFSSLTTWRELQVEPMISEKDHWCRLIVEELVMSLSAPSLTTKS  239

Query  541  FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
              IHHKPA +VAVSLL++ + P WM+ VFD+S I GII+NIS S+++ ELV+LFRQLL S
Sbjct  240  LMIHHKPAANVAVSLLKLSKIPSWMTKVFDDSSIRGIIQNISPSDVNIELVILFRQLLVS  299

Query  721  GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKN  834
            G L    I+ LNRVFQ CRR +Y  +I +   E+H ++
Sbjct  300  GRLNPSHIADLNRVFQACRRQVYTNDIQDSSIEDHMQH  337



>ref|XP_009782988.1| PREDICTED: protein PRD1 [Nicotiana sylvestris]
Length=1296

 Score =   312 bits (800),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 164/283 (58%), Positives = 218/283 (77%), Gaps = 0/283 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSK P+L+D D+  R+GEVLVFVL+LLFF+ +S + ILPGI+DCQ+LLD +S  QP P+
Sbjct  965   ACSKVPSLVDQDKGMRSGEVLVFVLSLLFFSLKSLHVILPGIMDCQYLLDPTSIPQPWPH  1024

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              SI CHDLCKL+HFGS  IKL++S +++E+FSR+ +  +RKPD LKF+  YLLS  AVLE
Sbjct  1025  ISIHCHDLCKLLHFGSIPIKLLSSQYMLELFSRIEDERSRKPDTLKFRTHYLLSVMAVLE  1084

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             G IFSSDI V+MNCSLCLS++I WQD + +V +I+R +W R IVEE+ +SLA P LASK 
Sbjct  1085  GQIFSSDITVAMNCSLCLSIIIRWQDAETEVSAIQRSNWSRFIVEELVMSLAAPSLASKV  1144

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F +H+KP +H+AV+LLR  + P WM+S+FDESCI  I +NI+  NLS ELVLL R+LL  
Sbjct  1145  FMLHYKPTVHIAVALLRRMEIPQWMASIFDESCISAITRNITNCNLSAELVLLLRELLKH  1204

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAA  849
             G+L DEQI++LN+VFQEC++C+Y + +     EE   N  AA+
Sbjct  1205  GFLNDEQIAALNKVFQECKKCIYTDKLQHYGAEEKTLNVAAAS  1247



>ref|XP_007224979.1| hypothetical protein PRUPE_ppa020774mg [Prunus persica]
 gb|EMJ26178.1| hypothetical protein PRUPE_ppa020774mg [Prunus persica]
Length=1316

 Score =   304 bits (779),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 161/290 (56%), Positives = 213/290 (73%), Gaps = 5/290 (2%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC KGPAL+DHDE T +GEVL+FVL L FF+ RS + + PGI+D ++  D     QP+ +
Sbjct  982   ACLKGPALVDHDEETSSGEVLIFVLLLNFFSLRSLHTVFPGIMDWKNFFDPRDRLQPISF  1041

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFGS ++KLVASY L+E+F+R+S+   R  + L     YL+S  AVLE
Sbjct  1042  IRIFCHDLCRLVHFGSPLVKLVASYCLLELFTRISDQRNRTGEELVCTMDYLMSVMAVLE  1101

Query  361   GLIFSSDIQVSMNCSLCLSMMIGW--QDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLAS  534
             GLIF SD++V+MNC LCLSM++GW  Q +Q  +  I ++ W R+IVEE+A+SLAVPCLAS
Sbjct  1102  GLIFYSDLRVAMNCGLCLSMILGWGLQGMQGTI-VITKNHWSRMIVEELAMSLAVPCLAS  1160

Query  535   KSFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLL  714
             KSF   HKPAIHVAV+LL++ + P WM SVFD+SCI GII+N++A+NLS E+VLLFR LL
Sbjct  1161  KSFINLHKPAIHVAVTLLKLPKVPEWMRSVFDDSCISGIIQNLAANNLSTEIVLLFRALL  1220

Query  715   NSGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDL  864
             NS YLK EQI S+N++ Q CR+  Y +N  +   +EH K   A AIL D+
Sbjct  1221  NSEYLKAEQICSVNQLLQACRKQKYTDNSQDESAKEHKKK--AVAILDDM  1268



>ref|XP_002516401.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46018.1| conserved hypothetical protein [Ricinus communis]
Length=1304

 Score =   303 bits (777),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 158/289 (55%), Positives = 213/289 (74%), Gaps = 1/289 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGP+L D++E T  GE L+FVL L +F+ RS + +LP  VD Q LLD S+  QPL  
Sbjct  971   ACSKGPSLFDYNEGTSIGEALIFVLLLYYFSLRSLHVVLPEAVDWQSLLDVSNRTQPLSV  1030

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              SI CHDLC+L+HFGS  +KLVASY L+E F+R+SE   RK + +K   GYL+S +A+LE
Sbjct  1031  ISIDCHDLCRLMHFGSPPVKLVASYCLLEFFTRLSEQRNRKNEEIKCSTGYLMSITAILE  1090

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F SD++VS+NCSLCLSM++GW+        I   +W RLIVEE+A+SLAVP L SKS
Sbjct  1091  GLVFYSDVRVSINCSLCLSMILGWEKPNIDSRVIADTTWCRLIVEEMAISLAVPSLPSKS  1150

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F+  HKPA H+AV+LL++++ P WM +VFD+ CI GII+NI+ASN++ E+VLLFR+L+NS
Sbjct  1151  FTNCHKPAAHIAVALLKLQKCPVWMRTVFDDPCISGIIRNIAASNITTEMVLLFRELVNS  1210

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKV-AAAILGDL  864
              +LK +QI+SLNRV QECR+ +Y E+     T EH + +V     LGD+
Sbjct  1211  EFLKTDQIASLNRVLQECRKHIYSEDSQNECTYEHIEKRVFTKGDLGDV  1259



>gb|KDP32572.1| hypothetical protein JCGZ_13122 [Jatropha curcas]
Length=1439

 Score =   301 bits (772),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/281 (57%), Positives = 207/281 (74%), Gaps = 1/281 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPAL+D +E T  GE L+FVL LL F+ R    +LPG VD Q LLD S+ EQP   
Sbjct  979   ACSKGPALLDFNEGTSIGEALIFVLLLLCFSLRCLQVLLPGAVDWQILLDPSNGEQPFSI  1038

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              SI CHDLC+L+HFGS ++KLVASY L+E  +R+SE   R  + LK   GYL+S  A+LE
Sbjct  1039  LSINCHDLCRLMHFGSPLVKLVASYCLLEFITRISEQINRTKEELKCSIGYLMSMIAILE  1098

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERD-SWFRLIVEEVAVSLAVPCLASK  537
             GLIF SDIQV++NCSLCLS +  W+ L  +   +  D +W RLIVEE+A+SLA PCL SK
Sbjct  1099  GLIFYSDIQVAINCSLCLSTISRWEKLNMKETRVTADNTWCRLIVEEMALSLAAPCLPSK  1158

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SF+ +HKPA+HVAVSLL++++ P WMS+VFD+ CI GIIKN++ASN+S E+VLLFRQL+ 
Sbjct  1159  SFANYHKPAVHVAVSLLKLQKRPQWMSTVFDDPCISGIIKNLAASNVSIEMVLLFRQLVK  1218

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKV  840
             S +LK +QI+ LNRV QECR+ +   ++    TEEH + +V
Sbjct  1219  SEFLKADQIACLNRVLQECRKHISTGDVQNNSTEEHTEKRV  1259


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  610   WMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNSGYLKDEQISSLNRVFQECRRCMY  789
             WMS+VFD+ CI GIIKN++ASN+S E+VLLFRQL+ S +LK +QI+ LNRV QECR+ + 
Sbjct  1309  WMSTVFDDPCISGIIKNLAASNVSIEMVLLFRQLVKSEFLKADQIACLNRVLQECRKHIS  1368

Query  790   RENIGEVRTEEHAKNKV  840
               ++    TEEH + +V
Sbjct  1369  TGDVQNNSTEEHTEKRV  1385



>emb|CDP15128.1| unnamed protein product [Coffea canephora]
Length=1295

 Score =   300 bits (768),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/279 (54%), Positives = 208/279 (75%), Gaps = 1/279 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPAL+DHDE T+ GE L+ +L L+FF+ RS  A+LPGI +  +LL + + +QP+ Y
Sbjct  965   ACSKGPALVDHDEETKNGEALICLLLLIFFSLRSLPAVLPGITELHNLLKDGNEKQPIAY  1024

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              S+ C D CKL+HFGS  IKLV+SY L+E+ +++S+  +R+ DGL  + GYLLS  A+LE
Sbjct  1025  ISLHCRDFCKLLHFGSPPIKLVSSYCLLELLNKISDQGSRESDGLNIRSGYLLSIMAILE  1084

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GLIFSSD++ S+NCS CLSM + W++L  +  + E + W R+IVEE+ + LAVP + S S
Sbjct  1085  GLIFSSDVRTSLNCSRCLSMFLDWKELDGKELAAESNIWCRMIVEELVMFLAVPRIGSTS  1144

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F IHHKPAI+VA++LL+ K+ P WM+SV D+S +  I++NI+ SN+S ELVLLFR+LLNS
Sbjct  1145  FMIHHKPAINVAIALLKSKETPHWMASVLDDSSLTAIVQNITTSNVSRELVLLFRELLNS  1204

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNK  837
             GYLK E I+SLNRVFQ CR+ +Y + + +  T E  K K
Sbjct  1205  GYLKAEHIASLNRVFQACRKHLYVDEV-QNDTSEVQKEK  1242



>ref|XP_008222797.1| PREDICTED: protein PRD1 [Prunus mume]
Length=1460

 Score =   296 bits (757),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 160/290 (55%), Positives = 209/290 (72%), Gaps = 5/290 (2%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC KGPAL+DHDE T +GEVL+FVL L FF+ RS + +LPGIVD  +  D     QP+ +
Sbjct  979   ACLKGPALVDHDEETISGEVLIFVLLLNFFSLRSLHTVLPGIVDWTNFFDPPDRLQPISF  1038

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFGS ++KLVASY L+E+F+R+S+   R  + L     YL+S  AVLE
Sbjct  1039  IRIFCHDLCRLVHFGSPLVKLVASYCLLELFTRISDQRNRTGEELVCTMDYLMSVMAVLE  1098

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQ--DLQKQVPSIERDSWFRLIVEEVAVSLAVPCLAS  534
             GLIF SD++V+ NC LCLSM++GW    +Q  +  I ++ W R+IVEE+A+SLAVPCLAS
Sbjct  1099  GLIFYSDLRVATNCGLCLSMILGWGLPGMQGTI-VITKNHWSRMIVEELAMSLAVPCLAS  1157

Query  535   KSFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLL  714
             KSF   HKPAIHVAV+LL++ + P WM SVFD SCI GII+N +A+NLS E+VLLFR LL
Sbjct  1158  KSFINLHKPAIHVAVTLLKLPKVPEWMRSVFDVSCISGIIQNFAANNLSTEIVLLFRALL  1217

Query  715   NSGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDL  864
             +S YLK EQI S+N++ Q CR+  Y +N  +   +EH K   A AIL D+
Sbjct  1218  DSEYLKAEQICSVNQLLQACRKQKYTDNSQDESAKEHKKK--AVAILDDM  1265



>ref|XP_011042773.1| PREDICTED: protein PRD1 [Populus euphratica]
 ref|XP_011042774.1| PREDICTED: protein PRD1 [Populus euphratica]
 ref|XP_011042775.1| PREDICTED: protein PRD1 [Populus euphratica]
Length=1331

 Score =   293 bits (749),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 206/281 (73%), Gaps = 1/281 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGP+L+D DE T TGE L+F L L +F+ RS + ++P  VD Q+ L+ S+  QP+  
Sbjct  998   ACSKGPSLLDCDEETSTGENLMFALLLFYFSLRSIHTVVPESVDWQNFLNPSNRMQPIST  1057

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              SI CHDLC+L+HFGS  +KLVA Y L+E+ +R+SE    + + LK    YL S   +L+
Sbjct  1058  VSIHCHDLCRLLHFGSPPVKLVAPYCLLELITRLSEQRKTRHEELKSSVAYLTSIMVILK  1117

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQ-VPSIERDSWFRLIVEEVAVSLAVPCLASK  537
             GL+F SDI+VS NCSLCLSM++GW+ L       I +++W+RLIVEE+A+SLA P LASK
Sbjct  1118  GLVFYSDIRVSTNCSLCLSMILGWEKLDMTGARVIAKNNWWRLIVEEMAISLAGPSLASK  1177

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SF  HHKPA+HVAV+LL+++++P WM +VFD+ CI GIIKN+ ASN+S E+VLLFR+LLN
Sbjct  1178  SFINHHKPAVHVAVALLKLQKSPEWMRTVFDDPCISGIIKNLEASNISSEMVLLFRELLN  1237

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKV  840
             S +LKDEQI+ LNR+ QECR+ +Y E+     T+E  + + 
Sbjct  1238  SRFLKDEQIACLNRILQECRKRLYTEDCQNDCTDEKIEKRT  1278



>ref|XP_002302892.2| hypothetical protein POPTR_0002s23370g [Populus trichocarpa]
 gb|EEE82165.2| hypothetical protein POPTR_0002s23370g [Populus trichocarpa]
Length=1343

 Score =   288 bits (737),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 212/310 (68%), Gaps = 22/310 (7%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGP+L+D DE T TGE L+F L L +F+ RS + ++PG VD Q+ L+ S+  QP+  
Sbjct  990   ACSKGPSLLDCDEETSTGENLMFALLLFYFSLRSIHTVVPGTVDWQNFLNPSNRLQPISM  1049

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              SI CHDLC+L+HFGS  +KLVASY L+E+ +R+SE      + LK    YL S   +L+
Sbjct  1050  VSIHCHDLCRLLHFGSPPVKLVASYCLLELITRLSEQRNTSHEELKSSVAYLTSIMVILK  1109

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQ-VPSIERDSWFRLIVEEVAVSLAVPCLASK  537
             GL+F SDI+VS NCSLCLSM++GW+ L       I +++W+RLIVEE+A+SLA P LAS+
Sbjct  1110  GLVFYSDIRVSTNCSLCLSMILGWEKLDMTGARVIAKNTWWRLIVEEMAISLAAPSLASE  1169

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SFS HHKPA+HVAV+LL+++++P WM +VFD+ CI GIIKN+ ASN+S E+VLLFR+LLN
Sbjct  1170  SFSNHHKPAVHVAVALLKLQKSPEWMRTVFDDPCISGIIKNLEASNISSEMVLLFRELLN  1229

Query  718   SGYLKDEQISSLNRVF--------------------QECRRCMYRENIGEVRTEEH-AKN  834
             S +LKDEQI+ LNR+                     QECR+ +Y E+     T+E   K 
Sbjct  1230  SMFLKDEQIACLNRILQLVSSLSMDKKAKEGKSKGAQECRKRLYTEDCQNDCTDEKIEKR  1289

Query  835   KVAAAILGDL  864
              +    LG++
Sbjct  1290  TITTDDLGEV  1299



>ref|XP_004502366.1| PREDICTED: protein PRD1-like [Cicer arietinum]
Length=1233

 Score =   285 bits (730),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/289 (49%), Positives = 210/289 (73%), Gaps = 1/289 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             A SKGPAL+DHDE T +GE LVF+L L +FA +S +AILPG VD Q+ L +++S +P  +
Sbjct  898   ASSKGPALVDHDEETSSGETLVFILLLHYFAVKSLHAILPGFVDWQNFLVSTNSSEPQAF  957

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I+CHDLC+L+HFGS ++K++ASY L+E+F+R+S+    K + LK   GYL+S  ++LE
Sbjct  958   IGIRCHDLCRLLHFGSPVVKIIASYSLLELFNRISDQIKSKHEELKCTVGYLMSIRSILE  1017

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F +D +V+ NC+ CLS+++ W++L K+   + + SWFRLI+EE+ VSLA P LAS+S
Sbjct  1018  GLVFYNDPRVATNCAFCLSVIVQWENLAKETEMLGKSSWFRLIIEEMTVSLAAPALASQS  1077

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F     PA+ +A++LL++ + P WM SVF+ SCI GI++N++A+NLSPE+++LFRQLL S
Sbjct  1078  FMNSQTPAVLIAIALLKLHKIPQWMRSVFNNSCISGILENLAATNLSPEILVLFRQLLKS  1137

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAI-LGDL  864
              +L  EQI+++N + QECR+ MY  N  +    E  K  +A    LGD+
Sbjct  1138  DFLSTEQIAAINHMLQECRKHMYTNNAQDGLPSEPIKKVLATPYDLGDV  1186



>gb|EYU38964.1| hypothetical protein MIMGU_mgv1a020726mg [Erythranthe guttata]
Length=1227

 Score =   285 bits (729),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 194/256 (76%), Gaps = 4/256 (2%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKG AL DHDE TRTGEVL+FVL LLFF+ RS   ILPGI+D Q LLD  +  QPL Y
Sbjct  963   ACSKGHALFDHDEGTRTGEVLIFVLLLLFFSMRSLLTILPGIIDFQTLLDEGNERQPLSY  1022

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              SI+CHDLCKL+HFGS  +KL+AS+ LV++F+ +SE+ + +P   KF++GYLLS S+VLE
Sbjct  1023  VSIRCHDLCKLMHFGSAPVKLIASFCLVQLFTGISESTSTEPVNFKFRQGYLLSISSVLE  1082

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GLIF  D++V++NCS CLS ++ W+ L+ +      D W RLIVEE+ +SL+ P + SKS
Sbjct  1083  GLIFFGDVRVALNCSRCLSTLMTWKQLKIE----SMDVWCRLIVEELVMSLSTPSVTSKS  1138

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F IHHKPA ++A +LL++ +AP WM+SVFD+S +  II N+SASNLS ELV LFR+LL S
Sbjct  1139  FMIHHKPAANIASALLKLGKAPSWMNSVFDDSSVRSIIHNMSASNLSTELVALFRELLVS  1198

Query  721   GYLKDEQISSLNRVFQ  768
             G+L    I+ LNRVFQ
Sbjct  1199  GHLNSAHIADLNRVFQ  1214



>gb|KHN44466.1| Protein PRD1 [Glycine soja]
Length=1292

 Score =   285 bits (728),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 205/289 (71%), Gaps = 1/289 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             A SKGPAL+DHDE T TGE L+FVL L +FA +S +AILPG VD Q    +++  +PL +
Sbjct  964   ASSKGPALVDHDEGTSTGETLIFVLLLHYFAVKSLHAILPGFVDWQSFFASTNPSEPLAF  1023

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I+CHDLC+L+HFGS +IK+ ASY L+E+F R+S+      + L+   GY++S  ++LE
Sbjct  1024  IGIRCHDLCRLLHFGSTVIKIAASYSLLELFKRISDQINSNHEELRCTIGYIMSIRSILE  1083

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F +D++V+ NCSLCLSM++GW+ L K+   +E  SW RLI+EE+ VSLA P LAS+S
Sbjct  1084  GLVFYNDLRVATNCSLCLSMILGWEKLTKETKVLEESSWCRLIIEEMTVSLAAPALASQS  1143

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F  + +PA+ VA++LL++ + P WM SVFD S I GI+ N+SASNLS E++ LFR+LL S
Sbjct  1144  FMNNQRPAVLVAIALLKLHKIPQWMRSVFDNSSISGILGNLSASNLSSEILALFRELLKS  1203

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAI-LGDL  864
              +L  EQI+++N++ QECR+ MY  N  E    E  K  +  +  +GD+
Sbjct  1204  NFLSTEQIATINQMLQECRKRMYSNNAQEDLPNEPIKKVLTTSYNMGDI  1252



>ref|XP_003537526.1| PREDICTED: protein PRD1-like isoform X1 [Glycine max]
Length=1292

 Score =   285 bits (728),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 205/289 (71%), Gaps = 1/289 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             A SKGPAL+DHDE T TGE L+FVL L +FA +S +AILPG VD Q    +++  +PL +
Sbjct  964   ASSKGPALVDHDEGTSTGETLIFVLLLHYFAVKSLHAILPGFVDWQSFFASTNPSEPLAF  1023

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I+CHDLC+L+HFGS +IK+ ASY L+E+F R+S+      + L+   GY++S  ++LE
Sbjct  1024  IGIRCHDLCRLLHFGSTVIKIAASYSLLELFKRISDQINSNHEELRCTIGYIMSIRSILE  1083

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F +D++V+ NCSLCLSM++GW+ L K+   +E  SW RLI+EE+ VSLA P LAS+S
Sbjct  1084  GLVFYNDLRVATNCSLCLSMILGWEKLTKETKVLEESSWCRLIIEEMTVSLAAPALASQS  1143

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F  + +PA+ VA++LL++ + P WM SVFD S I GI+ N+SASNLS E++ LFR+LL S
Sbjct  1144  FMNNQRPAVLVAIALLKLHKIPQWMRSVFDNSSISGILGNLSASNLSSEILALFRELLKS  1203

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAI-LGDL  864
              +L  EQI+++N++ QECR+ MY  N  E    E  K  +  +  +GD+
Sbjct  1204  NFLSTEQIATINQMLQECRKRMYSNNAQEDLPNEPIKKVLTTSYNMGDI  1252



>ref|XP_003601715.1| hypothetical protein MTR_3g084640 [Medicago truncatula]
 gb|AES71966.1| recombination initiation defect protein, putative [Medicago truncatula]
Length=1276

 Score =   283 bits (724),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/289 (49%), Positives = 211/289 (73%), Gaps = 1/289 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             A SKGPAL+DHDE T TGE L+FVL L  FA +S +AILPG VD Q  L + +S +PL +
Sbjct  942   ASSKGPALVDHDEGTSTGETLIFVLLLHIFAVKSLHAILPGFVDWQKFLVSMNSSEPLAF  1001

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I+CHDLC+L+HFGS ++K++ASY L+E+F+R+S+    K + LK   GYL+S  ++LE
Sbjct  1002  IGIRCHDLCRLLHFGSPVVKIIASYSLLELFNRISDQINTKQEELKCTVGYLMSIRSILE  1061

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             G++F +D++V+ NC+LCLS+++ W++L K+   + + SW RLI+EE+ VSLA P LAS+S
Sbjct  1062  GMVFYNDLRVATNCALCLSILLRWENLAKETEQLGKSSWCRLIMEEMTVSLAAPALASQS  1121

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F  +  PA+ VA +LL++ + P WM SVF+ SCI GI++N++A+NLSPE+++LFR+LL S
Sbjct  1122  FMNNQTPAVLVASALLKLHKIPQWMRSVFNNSCISGILENLAANNLSPEILVLFRELLKS  1181

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAI-LGDL  864
              +L  EQI++++++ QECR+ MY  N  +    E  K  +A +  LGD+
Sbjct  1182  DFLSTEQIATISQMLQECRKQMYTNNAQDGLPSEPIKKVLATSYDLGDV  1230



>ref|XP_004298232.1| PREDICTED: protein PRD1-like [Fragaria vesca subsp. vesca]
Length=1248

 Score =   283 bits (723),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/276 (53%), Positives = 198/276 (72%), Gaps = 1/276 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC KGPAL+DHDE T +GE L+F+L L +F  RSS+ ++P I+D +  LD S   Q   +
Sbjct  915   ACLKGPALVDHDEGTGSGETLIFLLLLNYFTLRSSHIVVPWIMDWKVFLDPSGRVQSFSF  974

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFGS ++KL ASY L+E+F+R+SE   R  + L     YL S  AVLE
Sbjct  975   VGIYCHDLCRLMHFGSPVVKLTASYCLLELFTRISEQRNRTGEELLLDTKYLSSVMAVLE  1034

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIE-RDSWFRLIVEEVAVSLAVPCLASK  537
             GL+F SD++V+MNC LCLS+++GW+       S++ + +W R++VEE+A+SLAVPCLASK
Sbjct  1035  GLVFYSDLRVAMNCGLCLSIIMGWELPDIHEISVDAKYTWSRMVVEELAMSLAVPCLASK  1094

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SF   HKPAIHVAV+LL++   P WM SVFD++CI  II+N++A NLS E+VLLFR LLN
Sbjct  1095  SFINLHKPAIHVAVALLKLPNIPNWMRSVFDDTCISSIIQNVAAKNLSTEIVLLFRALLN  1154

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEH  825
               +LK EQI+SLN++ Q CR+  Y +N  +   +EH
Sbjct  1155  LEFLKTEQIASLNQLLQVCRKQKYTDNSKDEGGQEH  1190



>ref|XP_006492990.1| PREDICTED: protein PRD1-like [Citrus sinensis]
Length=1309

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 152/295 (52%), Positives = 207/295 (70%), Gaps = 6/295 (2%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEv----lvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQ  168
             AC KGPA+ D+DE   TGE     L+FVL L +F+ RS  A LPG +D Q+ LD  S +Q
Sbjct  971   ACLKGPAMTDYDEEASTGEYEYEYLIFVLLLYYFSIRSLQASLPGALDWQNFLDPFSKKQ  1030

Query  169   PLPYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSAS  348
              L   +I+CHDLC+L+HFGS ++KLV+SY ++E+F+R+S+    + D L+   G+L S  
Sbjct  1031  SLSTINIRCHDLCRLMHFGSPLVKLVSSYCMLELFTRLSDHEDGEHDELECSMGFLSSVM  1090

Query  349   AVLEGLIFSSDIQVSMNCSLCLSMMIGWQDLQ-KQVPSIERDSWFRLIVEEVAVSLAVPC  525
             AVLEGL+F SDI+V+MNC  CLSM++GW+ L   +   I ++ W RLIVEE+A+SLAVP 
Sbjct  1091  AVLEGLVFYSDIRVAMNCGFCLSMILGWEKLDLHERTIIAKNYWCRLIVEEMAMSLAVPH  1150

Query  526   LASKSFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFR  705
             LASKSF  HHKPA+H+AV+LL+ ++ P WM++VFD SCI GII N+ ASN+  E+VLLFR
Sbjct  1151  LASKSFFNHHKPAVHIAVALLKHEKIPGWMTTVFDSSCISGIIGNLGASNMGAEMVLLFR  1210

Query  706   QLLNSGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHA-KNKVAAAILGDLR  867
             +LL+S +LK EQISSLN V Q CR+ +Y     +  T +H  K       LG++R
Sbjct  1211  ELLDSEFLKAEQISSLNHVLQACRKYVYTNCTQDEHTNKHLYKTFTKLDDLGEVR  1265



>ref|XP_008337577.1| PREDICTED: protein PRD1 [Malus domestica]
Length=1318

 Score =   279 bits (713),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 149/289 (52%), Positives = 203/289 (70%), Gaps = 1/289 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC KGPAL DHDE T +GEVL+FVL L +F+ RS + +LPGIVD +H  D     +P+ +
Sbjct  982   ACLKGPALADHDEETSSGEVLIFVLLLNYFSLRSLHTVLPGIVDWKHFFDPPDRVRPISF  1041

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I C+DLC+L+HFGS  +KLV+SY L+E+F+R+S+   R    +     + +S +AVLE
Sbjct  1042  IGIYCYDLCRLLHFGSGSVKLVSSYCLLELFNRLSDQQNRTGKEIICTMKHQMSITAVLE  1101

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIE-RDSWFRLIVEEVAVSLAVPCLASK  537
             GLIF +D++V+MNC LCLSM++ W+    Q  S   +++W R+IVEE+A+SLAVP LASK
Sbjct  1102  GLIFYTDLRVAMNCGLCLSMILKWESAGMQGTSASTKNNWSRMIVEELAMSLAVPSLASK  1161

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SF   HKPAI+VAV+LLR ++ P WM SVFD+SCI  +I+N+ A NLS E+VLLFR LLN
Sbjct  1162  SFINLHKPAIYVAVTLLRRQKVPEWMRSVFDDSCISAVIQNLEAHNLSTEIVLLFRALLN  1221

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDL  864
             S +LK EQI+S+N++ Q CR+  Y  N      EE  K   AA +L D+
Sbjct  1222  SEFLKTEQIASVNQLLQVCRKQKYSGNSRGESGEEGKKKAKAATVLDDM  1270



>ref|XP_009373627.1| PREDICTED: protein PRD1 [Pyrus x bretschneideri]
Length=1317

 Score =   277 bits (709),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 147/289 (51%), Positives = 200/289 (69%), Gaps = 1/289 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC KGPAL DHDE T +GEVL++VL L +F+ RS   +LPGIVD +H  D     QP+ +
Sbjct  981   ACLKGPALADHDEETSSGEVLIYVLLLNYFSLRSLDTVLPGIVDWKHFFDPPDRVQPISF  1040

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFGS  +KL ASY L+E+F+R+S+   R    +     + +S +AVLE
Sbjct  1041  IGIYCHDLCRLLHFGSGSVKLFASYCLLELFNRLSDQQNRTGKEIICTTKHQMSITAVLE  1100

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIE-RDSWFRLIVEEVAVSLAVPCLASK  537
             GLIF +D++V+MNC LCLSM++ W+    Q  S   +++W R+IVEE+A+SLAVP LASK
Sbjct  1101  GLIFYTDLRVAMNCGLCLSMILRWESAGMQGTSASTKNNWSRMIVEELAMSLAVPSLASK  1160

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SF   HKPAI+VAV+LLR ++ P WM SVFD+SCI  +I+N+ A NLS E+VLLFR LLN
Sbjct  1161  SFINLHKPAIYVAVTLLRRQKVPEWMRSVFDDSCISAVIQNLEAHNLSAEIVLLFRALLN  1220

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDL  864
             S +L  EQ++S+N++ Q CR+  Y  N      EE+     AA +L D+
Sbjct  1221  SEFLNTEQVASVNQLLQVCRKRKYSGNSRGESAEEYKMKAKAATVLDDM  1269



>ref|XP_006421047.1| hypothetical protein CICLE_v10004169mg [Citrus clementina]
 gb|ESR34287.1| hypothetical protein CICLE_v10004169mg [Citrus clementina]
Length=1281

 Score =   275 bits (702),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/295 (50%), Positives = 202/295 (68%), Gaps = 6/295 (2%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvf----vlallffafRSSYAILPGIVDCQHLLDNSSSEQ  168
             AC KGPA+ D+DE   TGE        VL L +F+ RS  A LPG +D Q+ LD  S +Q
Sbjct  943   ACLKGPAMTDYDEEASTGEYEYEYLIFVLLLYYFSIRSLQASLPGALDWQNFLDPFSEKQ  1002

Query  169   PLPYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSAS  348
              L   +I+CHDLC+L+HFGS ++KLV+SY ++E+F+R+S+    + D L+   G+L S  
Sbjct  1003  SLSTINIRCHDLCRLMHFGSPLVKLVSSYCMLELFTRLSDHEDGEHDELECSMGFLSSVM  1062

Query  349   AVLEGLIFSSDIQVSMNCSLCLSMMIGWQDLQ-KQVPSIERDSWFRLIVEEVAVSLAVPC  525
             AVLEGL+F SDI+V+MNC  CLSM++GW+ L   +   I ++ W RLIVEE+A+SLAVP 
Sbjct  1063  AVLEGLVFYSDIRVAMNCGFCLSMILGWEKLDLHERTIIAKNYWCRLIVEEMAMSLAVPH  1122

Query  526   LASKSFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFR  705
             LASKSF  HHKPA+++AV+LL+ ++ P WM +VFD  CI GII N+ ASN+  E+VLLFR
Sbjct  1123  LASKSFFNHHKPAVYIAVALLKHEKIPEWMRTVFDSPCISGIIGNLGASNMGAEMVLLFR  1182

Query  706   QLLNSGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHA-KNKVAAAILGDLR  867
             +LL+S +LK EQISSLN V Q CR+ +Y     +  T +H  K       LG++R
Sbjct  1183  ELLDSEFLKAEQISSLNHVLQACRKYVYTNCTQDEHTNKHLYKTFTKLDDLGEVR  1237



>ref|XP_010278449.1| PREDICTED: protein PRD1 isoform X2 [Nelumbo nucifera]
Length=1020

 Score =   270 bits (691),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 197/283 (70%), Gaps = 2/283 (1%)
 Frame = +1

Query  1    ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSE-QPLP  177
            ACSKG AL++HD  T TGE L+FVL L FF+ RS +A+LP  +D    L +S +  QPL 
Sbjct  687  ACSKGYALVEHDAETVTGETLIFVLLLNFFSLRSLHALLPENLDWLSFLQSSPNGIQPLS  746

Query  178  YTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVL  357
            +  I CHDLC+L+HFGS  +KLVAS+ L+E+ + +++    K D LK   GYL S  +VL
Sbjct  747  FICICCHDLCRLMHFGSPPVKLVASHCLLEMMTTITDQRHNKHDELKCSMGYLKSVMSVL  806

Query  358  EGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLAS  534
            EGL+F+SD +V+MN +LCLSM++GW+ L  Q  S+ RD  W RL+VEE+ +SL  P LAS
Sbjct  807  EGLVFNSDTRVAMNSALCLSMILGWEKLGMQEASVVRDGKWCRLVVEELVLSLTAPGLAS  866

Query  535  KSFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLL  714
             SF  +HKPA  +A++LLR+ Q P WM SVFD SCI GIIKN+SASN+S E+  LFR+LL
Sbjct  867  TSFRNYHKPASKIAIALLRLDQVPKWMPSVFDHSCISGIIKNLSASNVSAEMARLFRELL  926

Query  715  NSGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVA  843
               YL  EQI  LN VFQ CR+ +Y++N  +  TEEH +  VA
Sbjct  927  IHDYLNAEQILGLNGVFQACRKHVYKDNYQKCNTEEHLEKVVA  969



>ref|XP_010278448.1| PREDICTED: protein PRD1 isoform X1 [Nelumbo nucifera]
Length=1242

 Score =   270 bits (690),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 197/283 (70%), Gaps = 2/283 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSE-QPLP  177
             ACSKG AL++HD  T TGE L+FVL L FF+ RS +A+LP  +D    L +S +  QPL 
Sbjct  909   ACSKGYALVEHDAETVTGETLIFVLLLNFFSLRSLHALLPENLDWLSFLQSSPNGIQPLS  968

Query  178   YTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVL  357
             +  I CHDLC+L+HFGS  +KLVAS+ L+E+ + +++    K D LK   GYL S  +VL
Sbjct  969   FICICCHDLCRLMHFGSPPVKLVASHCLLEMMTTITDQRHNKHDELKCSMGYLKSVMSVL  1028

Query  358   EGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLAS  534
             EGL+F+SD +V+MN +LCLSM++GW+ L  Q  S+ RD  W RL+VEE+ +SL  P LAS
Sbjct  1029  EGLVFNSDTRVAMNSALCLSMILGWEKLGMQEASVVRDGKWCRLVVEELVLSLTAPGLAS  1088

Query  535   KSFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLL  714
              SF  +HKPA  +A++LLR+ Q P WM SVFD SCI GIIKN+SASN+S E+  LFR+LL
Sbjct  1089  TSFRNYHKPASKIAIALLRLDQVPKWMPSVFDHSCISGIIKNLSASNVSAEMARLFRELL  1148

Query  715   NSGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVA  843
                YL  EQI  LN VFQ CR+ +Y++N  +  TEEH +  VA
Sbjct  1149  IHDYLNAEQILGLNGVFQACRKHVYKDNYQKCNTEEHLEKVVA  1191



>gb|KDO52829.1| hypothetical protein CISIN_1g000855mg [Citrus sinensis]
Length=1252

 Score =   268 bits (686),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 192/261 (74%), Gaps = 5/261 (2%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEv----lvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQ  168
             AC KGPA+ D+DE   TGE     L+FVL L +F+ RS  A LPG +D Q+ LD  S +Q
Sbjct  990   ACLKGPAMTDYDEEASTGEYEYEYLIFVLLLYYFSIRSLQASLPGALDWQNFLDPFSKKQ  1049

Query  169   PLPYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSAS  348
              L   +I+CHDLC+L+HFGS ++KLV+SY ++E+F+R+S+    + D L+   G+L S  
Sbjct  1050  SLSTINIRCHDLCRLMHFGSPLVKLVSSYCMLELFTRLSDHEDGEHDELECSMGFLSSVM  1109

Query  349   AVLEGLIFSSDIQVSMNCSLCLSMMIGWQDLQ-KQVPSIERDSWFRLIVEEVAVSLAVPC  525
             AVLEGL+F SDI+V+MNC  CLSM++GW+ L   +   I ++ W RLIVEE+A+SLAVP 
Sbjct  1110  AVLEGLVFYSDIRVAMNCGFCLSMILGWEKLDLHERTIIAKNYWCRLIVEEMAMSLAVPH  1169

Query  526   LASKSFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFR  705
             LASKSF  HHKPA+H+AV+LL+ ++ P WM++VFD SCI GII N+ ASN+  E+VLLFR
Sbjct  1170  LASKSFFNHHKPAVHIAVALLKHEKIPGWMTTVFDSSCISGIIGNLGASNMGAEMVLLFR  1229

Query  706   QLLNSGYLKDEQISSLNRVFQ  768
             +LL+S +LK EQISSLN V Q
Sbjct  1230  ELLDSEFLKAEQISSLNHVLQ  1250



>ref|XP_008775314.1| PREDICTED: LOW QUALITY PROTEIN: protein PRD1 [Phoenix dactylifera]
Length=672

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 211/334 (63%), Gaps = 13/334 (4%)
 Frame = +1

Query  1    ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
            AC+KGPAL+D+DE T  GE L+FVL L FF+ +S +A L   +D Q  L +S+  Q L  
Sbjct  343  ACAKGPALVDYDEETTIGESLLFVLLLYFFSLKSLHATLQETMDWQDFLQSSNEAQTLSV  402

Query  181  TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              ++CHDLC+L HFGS ++KLVAS  LVE  +R+S+    K D L+    YL S  AV E
Sbjct  403  LCLRCHDLCRLTHFGSSLVKLVASQCLVEFLTRISDQRNSKNDELRCSLRYLESMMAVTE  462

Query  361  GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
            GL+F  D  V+ NC +C SM++GW+    Q     +DS W RL++EE+A+SLA P LAS 
Sbjct  463  GLLFYGDTSVATNCGVCFSMILGWEKFGLQEKRAIKDSKWCRLVMEELAMSLAAPGLAST  522

Query  538  SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
            SF+  HKPA+HVAV+LL++ Q P WM SVFD S I GI+ N+SASN++ E+V LF +L+ 
Sbjct  523  SFTNQHKPAVHVAVALLKLDQVPGWMKSVFDTSNISGIVDNLSASNVTAEMVKLFTELMT  582

Query  718  SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDLRNASVLFDGKE  897
              Y+  EQ+S+L+R+FQ CR+ +Y+++      EE+    V A+I  D+        GK 
Sbjct  583  RKYMNKEQVSALHRLFQVCRKQVYKDSSKRQLREENC--DVVASIPEDI--------GK-  631

Query  898  INQIQQYKILSPSEGLEHRSFVMEQRYLVRFLEV  999
            +  +  + +LSP    +H     EQ  L++ ++V
Sbjct  632  VCSLLIHLMLSPPMD-DHTEIQTEQEMLLKEIDV  664



>ref|NP_193154.1| protein PRD1 [Arabidopsis thaliana]
 emb|CAB46002.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78460.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83390.1| protein PRD1 [Arabidopsis thaliana]
Length=1268

 Score =   254 bits (649),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 187/280 (67%), Gaps = 0/280 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPAL    + T  GE L F L L FF+ RS   +L G VD Q     S+S + LP 
Sbjct  917   ACSKGPALTQCQDETNIGEALAFTLLLYFFSLRSLQIVLAGAVDWQTFFGTSTSLETLPV  976

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CH+LC+L+HFG+  IKL+ASY L+E+ + +SE    K + L+    YL S  AVL 
Sbjct  977   VCIHCHNLCRLMHFGAPQIKLIASYCLLELLTGLSEQVDIKKEQLQCSSSYLKSMKAVLG  1036

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS +
Sbjct  1037  GLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEEMSVSLAMPCSASST  1096

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             +  HHKPA+++ V++LR+K  P W+ +VFDESCI  +I+N++  N+S E+V+LFR+L+ +
Sbjct  1097  YVNHHKPAVYLTVAMLRLKNKPVWLRTVFDESCISSMIQNLNGINISREIVILFRELMQA  1156

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKV  840
               L  +Q++ L+R FQECR+ M+R    +   EE  + K+
Sbjct  1157  ELLNSQQVTKLDRAFQECRKQMHRNGTRDETVEEQVQRKI  1196



>sp|O23277.3|PRD1_ARATH RecName: Full=Protein PRD1; Short=AtPRD1; AltName: Full=Protein 
PUTATIVE RECOMBINATION INITIATION DEFECT 1 [Arabidopsis thaliana]
Length=1330

 Score =   254 bits (649),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 187/280 (67%), Gaps = 0/280 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPAL    + T  GE L F L L FF+ RS   +L G VD Q     S+S + LP 
Sbjct  979   ACSKGPALTQCQDETNIGEALAFTLLLYFFSLRSLQIVLAGAVDWQTFFGTSTSLETLPV  1038

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CH+LC+L+HFG+  IKL+ASY L+E+ + +SE    K + L+    YL S  AVL 
Sbjct  1039  VCIHCHNLCRLMHFGAPQIKLIASYCLLELLTGLSEQVDIKKEQLQCSSSYLKSMKAVLG  1098

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS +
Sbjct  1099  GLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEEMSVSLAMPCSASST  1158

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             +  HHKPA+++ V++LR+K  P W+ +VFDESCI  +I+N++  N+S E+V+LFR+L+ +
Sbjct  1159  YVNHHKPAVYLTVAMLRLKNKPVWLRTVFDESCISSMIQNLNGINISREIVILFRELMQA  1218

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKV  840
               L  +Q++ L+R FQECR+ M+R    +   EE  + K+
Sbjct  1219  ELLNSQQVTKLDRAFQECRKQMHRNGTRDETVEEQVQRKI  1258



>gb|ABQ12642.1| PRD1 [Arabidopsis thaliana]
Length=1330

 Score =   254 bits (648),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 187/280 (67%), Gaps = 0/280 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPAL    + T  GE L F L L FF+ RS   +L G VD Q     S+S + LP 
Sbjct  979   ACSKGPALTQCQDETNIGEALAFTLLLYFFSLRSLQIVLAGAVDWQAFFGTSTSLETLPV  1038

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CH+LC+L+HFG+  IKL+ASY L+E+ + +SE    K + L+    YL S  AVL 
Sbjct  1039  VCIYCHNLCRLMHFGAPQIKLIASYCLLELLTGLSEQVDIKKEQLQCSSSYLKSMKAVLG  1098

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS +
Sbjct  1099  GLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEEMSVSLALPCSASST  1158

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             +  HHKPA+++ V++LR+K  P W+ +VFDESCI  +I+N++  N+S E+V+LFR+L+ +
Sbjct  1159  YVNHHKPAVYLTVAMLRLKNKPVWLRTVFDESCISSMIQNLNGINISREIVILFRELMQA  1218

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKV  840
               L  +Q++ L+R FQECR+ M+R    +   EE  + K+
Sbjct  1219  ELLNSQQVTKLDRAFQECRKQMHRNGTRDETVEEQVQRKI  1258



>ref|XP_007034167.1| Recombination initiation defect 1, putative [Theobroma cacao]
 gb|EOY05093.1| Recombination initiation defect 1, putative [Theobroma cacao]
Length=1359

 Score =   253 bits (647),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/280 (48%), Positives = 195/280 (70%), Gaps = 2/280 (1%)
 Frame = +1

Query  10    KGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPYTSI  189
             +GPALI++DE T + E L+F+L L +F+ R   A+LP ++D Q  L++ +  QPL   +I
Sbjct  1036  RGPALIEYDEGTSSEENLIFLLLLYYFSLRCLRAVLPEVLDWQTFLNSPNMMQPLSTINI  1095

Query  190   KCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLEGLI  369
               HDLC+L+HFGS ++KLVAS  L+E+FS +S    RK + L+   G L+S   VLEGL+
Sbjct  1096  HWHDLCRLMHFGSPMVKLVASSCLLELFSGISYQTKRKHEELQCFMGQLMSIMTVLEGLV  1155

Query  370   FSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKSFSI  549
             F  DI+V+MNC LCLS+++GW++L  +   I R +W+RLIVEE+ +++AVPCLAS S   
Sbjct  1156  FYDDIRVAMNCCLCLSIILGWEELDMRESGIARSNWYRLIVEEMVMTMAVPCLASTSIIN  1215

Query  550   HHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNSGYL  729
             +HKPA+HV V+LL++++ P WM +VFD+  I  II N+   ++SPE+VLLFR LLNSG+L
Sbjct  1216  YHKPAVHVTVALLKLQKVPGWMRTVFDDLSISCIIDNLKM-DVSPEMVLLFRALLNSGFL  1274

Query  730   KDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAA  849
             K E I SLN   Q CR+ MY  N  E   ++H +  V+++
Sbjct  1275  KAEHIGSLNHALQACRKRMYN-NAEEHLMDKHVQKIVSSS  1313



>ref|XP_006283017.1| hypothetical protein CARUB_v10004006mg [Capsella rubella]
 gb|EOA15915.1| hypothetical protein CARUB_v10004006mg [Capsella rubella]
Length=1245

 Score =   252 bits (643),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/291 (44%), Positives = 192/291 (66%), Gaps = 1/291 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPAL  + + T  G+ L F L L FF+ RS   +L G VD Q     SS+   LP 
Sbjct  918   ACSKGPALTQYQDETDIGKALAFTLPLYFFSLRSLQIVLAGAVDWQTFFGPSSNLDTLPV  977

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CH+ C+L+HFG+  IKL+AS  L+E+F+ +S+    K + L+   GYL S  AVL 
Sbjct  978   VCIHCHNFCRLMHFGTPQIKLIASCCLLELFTGLSQQIDIKNEQLRCSSGYLKSVKAVLG  1037

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS +
Sbjct  1038  GLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEEMSVSLAMPCSASNT  1097

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F  HHKPA++V V++LR+K  P W+ +VFDESCI  +I+N++  N+S E+V+LFR+L+ +
Sbjct  1098  FVNHHKPAVYVTVAMLRLKNKPAWLRTVFDESCISSMIQNLNGMNISREIVILFRELMQA  1157

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAA-ILGDLRN  870
               L  EQ++ LNR FQE R+ M+R    +   EE  +  +++    G++RN
Sbjct  1158  ELLNSEQVTKLNRSFQELRKQMHRNGTQDETVEEQEQQTISSIHDNGEVRN  1208



>ref|XP_007151616.1| hypothetical protein PHAVU_004G0621001g, partial [Phaseolus vulgaris]
 gb|ESW23610.1| hypothetical protein PHAVU_004G0621001g, partial [Phaseolus vulgaris]
Length=943

 Score =   250 bits (638),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/257 (47%), Positives = 183/257 (71%), Gaps = 0/257 (0%)
 Frame = +1

Query  1    ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
            A  KGPAL++HDE T TGE L+FVL L +FA +S +AILPG VD Q  L +S   +PL +
Sbjct  662  ASLKGPALVEHDEGTSTGETLIFVLLLHYFAVKSLHAILPGFVDWQSFLVSSKPLEPLAF  721

Query  181  TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              I C+DLC+L+HFGS +IK+   Y L+E+F+R+S+      + L+   GYL+S  ++LE
Sbjct  722  IGICCNDLCRLLHFGSPVIKIAVFYSLLELFNRISDQINSNHEELRCTVGYLMSIRSILE  781

Query  361  GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
            GL+F +D++V+ NC  CLSM++GW++L K+   +E  SW RLI+EE+ +S A P LAS+S
Sbjct  782  GLVFYNDLRVATNCCFCLSMILGWENLTKETKLLEGSSWCRLIIEEMTISFAAPALASQS  841

Query  541  FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
            F     P + +A+++L++++ P WM SVFD S I GI+ N++ASNLS E+++LFR+LL  
Sbjct  842  FMNKQSPQVLIAIAVLKLRKIPQWMRSVFDSSSISGILDNLTASNLSSEILVLFRELLKC  901

Query  721  GYLKDEQISSLNRVFQE  771
             +L  EQI+++N++ QE
Sbjct  902  NFLTTEQIATINKILQE  918



>ref|XP_002870332.1| hypothetical protein ARALYDRAFT_330097 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46591.1| hypothetical protein ARALYDRAFT_330097 [Arabidopsis lyrata subsp. 
lyrata]
Length=1339

 Score =   251 bits (640),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 124/282 (44%), Positives = 188/282 (67%), Gaps = 0/282 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPAL  + + T  GE L F L+L FF+ RS   +L G VD Q     S+S + LP 
Sbjct  979   ACSKGPALTQYQDETDIGEALAFTLSLYFFSLRSLQIVLAGAVDWQTFFGTSTSLETLPV  1038

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CH+LC+L+HFG+  IKL+ASY L+E+ + +SE    K +  +    YL S   VL 
Sbjct  1039  VCIHCHNLCRLMHFGAPQIKLIASYCLLELLTGLSEQIDIKKEQPRCSSSYLKSMKTVLG  1098

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC A  +
Sbjct  1099  GLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEEMSVSLAMPCSAFSA  1158

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             +  HHKPA+++ V++LR+K  P W+ +VFDESCI  +I+N++  N+S E+V+LFR+L+ +
Sbjct  1159  YVNHHKPAVYLTVAMLRLKNKPVWLGTVFDESCISSMIQNLNGINISREIVILFRELMQA  1218

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAA  846
               L  +Q++ LNR FQECR+ M+R    +   EE  + K+++
Sbjct  1219  ELLNSQQVTKLNRAFQECRKQMHRNGTRDEAVEEQVQLKISS  1260



>ref|XP_010450091.1| PREDICTED: protein PRD1 [Camelina sativa]
Length=1342

 Score =   248 bits (632),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 129/291 (44%), Positives = 190/291 (65%), Gaps = 1/291 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPAL  + + T  GE L F L L FF+ RS   +L G VD Q     SS+   LP 
Sbjct  979   ACSKGPALTQYQDETDIGEALAFTLPLYFFSLRSLQIVLAGAVDWQTFFGPSSNLDTLPV  1038

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CH+ C+L+HFG+  IKL+AS  L+E+F+ +S+    K + L+    YL S  AVL 
Sbjct  1039  VCIHCHNFCRLMHFGTPQIKLIASCCLLELFTGLSQQIDIKREQLRCSSSYLKSMKAVLG  1098

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS +
Sbjct  1099  GLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEEMSVSLAMPCSASNT  1158

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F  HHKPA++V V++LR+K  P W+ +VFDESCI  +I+N++  N+S E+V+LFR+L+ +
Sbjct  1159  FVNHHKPAVYVTVAMLRLKNKPAWLRTVFDESCISSMIQNLNGMNISREIVILFRELMLA  1218

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAA-ILGDLRN  870
               L  EQ++ L R FQE ++ M+R    E   EE  +  +++    GD+RN
Sbjct  1219  ELLNSEQVTKLIRAFQEFKKQMHRNGTREETVEEQVQQAISSIHDHGDVRN  1269



>ref|XP_010103593.1| hypothetical protein L484_023090 [Morus notabilis]
 gb|EXB96370.1| hypothetical protein L484_023090 [Morus notabilis]
Length=1355

 Score =   247 bits (630),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 200/317 (63%), Gaps = 28/317 (9%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC KGPAL DHDE T  G+ LVFVL L +F+ +S  A+LPGI+D Q   D     QPL  
Sbjct  989   ACLKGPALADHDEGTSYGQRLVFVLLLNYFSLKSLRAVLPGIMDWQSFFDPPDRTQPLSM  1048

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CH LC+L+ FGS ++KLVAS+ L+E+F+ ++     + + LK    YL+S  +VLE
Sbjct  1049  IGISCHGLCRLMCFGSPLVKLVASHCLLELFAEIAHQRNTECEELKSTVQYLISVISVLE  1108

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPS-IERDSWFRLIVEEVAVSLAVPCLASK  537
             G +F SD +V++NCSLCLSM+ G + L  +  S I ++SW RLIVEE+AVSL+V  LASK
Sbjct  1109  GFVFYSDQRVAVNCSLCLSMIFGREMLDSEDASMIGKNSWSRLIVEELAVSLSVQSLASK  1168

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SF   H PAI+VA++LL+++  P WM  VFD+ CI GII+N++ASN++ E+V LFR+LLN
Sbjct  1169  SFINQHNPAIYVALALLKLENIPSWMRIVFDDPCISGIIENLTASNVTSEIVALFRELLN  1228

Query  718   SGYLKDEQISSLNRVF--------------------------QECRRCMYRENIGEVRTE  819
              G+LK EQI+ L+ VF                          + CR+ +Y +N      +
Sbjct  1229  CGFLKKEQIACLHHVFKVTIFSSFNVFVWFLLLFRIGHYVSVKACRKRLYTDNAISDSQD  1288

Query  820   EHAKNKVA-AAILGDLR  867
             EH K  V  +  LG++R
Sbjct  1289  EHTKKAVTMSGDLGEIR  1305



>gb|KFK25469.1| hypothetical protein AALP_AA8G118600 [Arabis alpina]
Length=1309

 Score =   241 bits (615),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/282 (45%), Positives = 182/282 (65%), Gaps = 0/282 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGP L  + + T  GE L F L L FF+ RS   +L   VD Q     SS+ + LP 
Sbjct  967   ACSKGPTLTQYQDETDIGEALAFTLLLYFFSLRSLQIVLARAVDWQTFFGPSSNLETLPV  1026

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CH+LC+L+HFG+  IKL+ASY L+E+FS + E    K + L+    YL S  AVL 
Sbjct  1027  VCIHCHNLCRLMHFGTPQIKLIASYCLLELFSGLLEQIDVKKEQLRCSSSYLKSMKAVLG  1086

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F  D +V+ N +LCLSM+IGW+D++ +   ++  SW+  I EE++VSLA+PC AS +
Sbjct  1087  GLVFYDDKRVATNSALCLSMIIGWEDMEGRTEILKTSSWYSFIAEEMSVSLAMPCSASIT  1146

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F  HHKPA++V V++LR+K  P W+ +VFDESCI  +I+N++ +N+S E+V+LFR+L+ +
Sbjct  1147  FVNHHKPAVYVTVAMLRLKNKPEWLRTVFDESCISSMIQNLTGTNISCEIVILFRELMQA  1206

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAA  846
               L  EQ + LNRVFQ  R+ M      +   EE  +  V++
Sbjct  1207  QLLNSEQAAKLNRVFQASRKQMLINGTLDETVEEQVQRTVSS  1248



>gb|KFK25468.1| hypothetical protein AALP_AA8G118600 [Arabis alpina]
Length=1331

 Score =   241 bits (615),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/282 (45%), Positives = 182/282 (65%), Gaps = 0/282 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGP L  + + T  GE L F L L FF+ RS   +L   VD Q     SS+ + LP 
Sbjct  989   ACSKGPTLTQYQDETDIGEALAFTLLLYFFSLRSLQIVLARAVDWQTFFGPSSNLETLPV  1048

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CH+LC+L+HFG+  IKL+ASY L+E+FS + E    K + L+    YL S  AVL 
Sbjct  1049  VCIHCHNLCRLMHFGTPQIKLIASYCLLELFSGLLEQIDVKKEQLRCSSSYLKSMKAVLG  1108

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F  D +V+ N +LCLSM+IGW+D++ +   ++  SW+  I EE++VSLA+PC AS +
Sbjct  1109  GLVFYDDKRVATNSALCLSMIIGWEDMEGRTEILKTSSWYSFIAEEMSVSLAMPCSASIT  1168

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F  HHKPA++V V++LR+K  P W+ +VFDESCI  +I+N++ +N+S E+V+LFR+L+ +
Sbjct  1169  FVNHHKPAVYVTVAMLRLKNKPEWLRTVFDESCISSMIQNLTGTNISCEIVILFRELMQA  1228

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAA  846
               L  EQ + LNRVFQ  R+ M      +   EE  +  V++
Sbjct  1229  QLLNSEQAAKLNRVFQASRKQMLINGTLDETVEEQVQRTVSS  1270



>emb|CDY05132.1| BnaC03g29300D [Brassica napus]
Length=1335

 Score =   241 bits (615),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/282 (44%), Positives = 185/282 (66%), Gaps = 0/282 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACS+GPAL    + T   E L F L L FF+ RS   +L G VD Q     SS+ + LP 
Sbjct  975   ACSRGPALTQSQDETEIWEALAFTLPLCFFSLRSLQIVLAGAVDWQTFCGPSSNLETLPV  1034

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I+CH+LC+L+HFG+  IKL+ASY L+E+F+ +S+    + + L+    YL +  AVL 
Sbjct  1035  VCIQCHNLCRLMHFGTPQIKLMASYCLLELFTGLSQQIDIRKEQLRCSPSYLKAMKAVLS  1094

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F  DI+V+ N +LCLSM++GW+ ++ +   ++  SW+R I EE++VSLA+PC AS +
Sbjct  1095  GLVFYDDIRVATNSALCLSMILGWEGMEGRTEMLKTSSWYRFITEEMSVSLAMPCSASNT  1154

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F  HHKPA++  V++LR+K  P W+ SVFDESCI G+I+N++ +N+S E+V+LFR+L+ +
Sbjct  1155  FVNHHKPAVYATVAMLRLKNKPAWLRSVFDESCISGMIQNLNGTNISSEIVILFRELMQA  1214

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAA  846
               L  +Q++ LN VF   R+ M R    E   EE  +  V++
Sbjct  1215  QLLNSDQVTKLNLVFLASRKQMLRNGTLEETVEEQMQRTVSS  1256



>ref|XP_008464339.1| PREDICTED: protein PRD1 isoform X4 [Cucumis melo]
Length=1054

 Score =   238 bits (608),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 128/282 (45%), Positives = 188/282 (67%), Gaps = 3/282 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPALID  E T  G+ ++ VL L++F+ RS  A+LPG VD Q+ L  S+  + L +
Sbjct  731   ACSKGPALIDEHEGTNMGKTIILVLFLVYFSMRSLQAVLPGAVDWQNNLGQSNGTR-LSF  789

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFGS  IKL+ASY L E+F+++S+    K + LK    YL S    LE
Sbjct  790   ICISCHDLCRLLHFGSTSIKLMASYCLFELFTQLSDQRTSKQEELKCNTNYLRSVITTLE  849

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIE-RDSWFRLIVEEVAVSLAVPCLASK  537
             GL+   + +V+ NCSLCLSM++GW++++     +  ++ W R IVEE+  S++ PCL S 
Sbjct  850   GLVVYGNQRVATNCSLCLSMVLGWKEMEMLEARVTVKNKWCRFIVEELVASISRPCLVSN  909

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             +F+   +P+I+VAV+LL++++   WM S+F E+CI  II+N++ SNLSPELV LFR+LLN
Sbjct  910   TFT-EERPSIYVAVALLKLQKDFGWMRSIFHEACISRIIENVTISNLSPELVTLFRELLN  968

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVA  843
             S ++  + IS+LN   Q CR+ +Y E   + +TE    N  A
Sbjct  969   SEFMLADHISNLNLALQTCRKHIYYEKDEDTQTEREIGNVFA  1010



>ref|XP_004138537.1| PREDICTED: protein PRD1-like [Cucumis sativus]
 ref|XP_004160229.1| PREDICTED: protein PRD1-like [Cucumis sativus]
Length=1256

 Score =   239 bits (611),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 129/282 (46%), Positives = 189/282 (67%), Gaps = 3/282 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPALID  E T  G+ ++ VL L++F+ RS  A+LPG VD Q+    S+  + L +
Sbjct  933   ACSKGPALIDEHEGTNMGKTIILVLFLVYFSMRSLQAVLPGAVDWQNNHGQSNGTR-LSF  991

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFGS  IKLVASY L E+F+++S+    K + L+    YL S  A LE
Sbjct  992   ICISCHDLCRLLHFGSTSIKLVASYCLFELFTQLSDQRTSKQEELRCTTNYLRSVIATLE  1051

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIE-RDSWFRLIVEEVAVSLAVPCLASK  537
             GL+   +  V+ NCSLCLSM++ W+++  +   +  ++ W R+IVEE+  S++ PCL S 
Sbjct  1052  GLVVYDNHCVATNCSLCLSMVLEWKEMDMRETRVTVKNKWCRIIVEELVASISRPCLISN  1111

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             +F+   +P I+V V+LL++++   WM S+FDE+CI  IIKN++ SNLSPE+V LFR+LLN
Sbjct  1112  TFT-EKRPTIYVTVALLKLQKDFGWMRSIFDEACISRIIKNVTISNLSPEMVTLFRELLN  1170

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVA  843
             S ++  + IS+LN V Q CR+ +Y E  G+ +TE+   N  A
Sbjct  1171  SEFMLADHISNLNLVLQTCRKHIYNEKDGDTQTEKEIGNVFA  1212



>ref|XP_008464337.1| PREDICTED: protein PRD1 isoform X3 [Cucumis melo]
Length=1128

 Score =   238 bits (608),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 128/282 (45%), Positives = 188/282 (67%), Gaps = 3/282 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPALID  E T  G+ ++ VL L++F+ RS  A+LPG VD Q+ L  S+  + L +
Sbjct  805   ACSKGPALIDEHEGTNMGKTIILVLFLVYFSMRSLQAVLPGAVDWQNNLGQSNGTR-LSF  863

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFGS  IKL+ASY L E+F+++S+    K + LK    YL S    LE
Sbjct  864   ICISCHDLCRLLHFGSTSIKLMASYCLFELFTQLSDQRTSKQEELKCNTNYLRSVITTLE  923

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIE-RDSWFRLIVEEVAVSLAVPCLASK  537
             GL+   + +V+ NCSLCLSM++GW++++     +  ++ W R IVEE+  S++ PCL S 
Sbjct  924   GLVVYGNQRVATNCSLCLSMVLGWKEMEMLEARVTVKNKWCRFIVEELVASISRPCLVSN  983

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             +F+   +P+I+VAV+LL++++   WM S+F E+CI  II+N++ SNLSPELV LFR+LLN
Sbjct  984   TFT-EERPSIYVAVALLKLQKDFGWMRSIFHEACISRIIENVTISNLSPELVTLFRELLN  1042

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVA  843
             S ++  + IS+LN   Q CR+ +Y E   + +TE    N  A
Sbjct  1043  SEFMLADHISNLNLALQTCRKHIYYEKDEDTQTEREIGNVFA  1084



>gb|KGN45916.1| hypothetical protein Csa_6G022280 [Cucumis sativus]
Length=1275

 Score =   239 bits (610),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 129/282 (46%), Positives = 189/282 (67%), Gaps = 3/282 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPALID  E T  G+ ++ VL L++F+ RS  A+LPG VD Q+    S+  + L +
Sbjct  952   ACSKGPALIDEHEGTNMGKTIILVLFLVYFSMRSLQAVLPGAVDWQNNHGQSNGTR-LSF  1010

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFGS  IKLVASY L E+F+++S+    K + L+    YL S  A LE
Sbjct  1011  ICISCHDLCRLLHFGSTSIKLVASYCLFELFTQLSDQRTSKQEELRCTTNYLRSVIATLE  1070

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIE-RDSWFRLIVEEVAVSLAVPCLASK  537
             GL+   +  V+ NCSLCLSM++ W+++  +   +  ++ W R+IVEE+  S++ PCL S 
Sbjct  1071  GLVVYDNHCVATNCSLCLSMVLEWKEMDMRETRVTVKNKWCRIIVEELVASISRPCLISN  1130

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             +F+   +P I+V V+LL++++   WM S+FDE+CI  IIKN++ SNLSPE+V LFR+LLN
Sbjct  1131  TFT-EKRPTIYVTVALLKLQKDFGWMRSIFDEACISRIIKNVTISNLSPEMVTLFRELLN  1189

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVA  843
             S ++  + IS+LN V Q CR+ +Y E  G+ +TE+   N  A
Sbjct  1190  SEFMLADHISNLNLVLQTCRKHIYNEKDGDTQTEKEIGNVFA  1231



>ref|XP_009134222.1| PREDICTED: protein PRD1 isoform X2 [Brassica rapa]
Length=1334

 Score =   239 bits (609),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/282 (44%), Positives = 184/282 (65%), Gaps = 0/282 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACS+GPAL    + T   E L F L L F + RS   +L G VD Q     SS+ + LP 
Sbjct  979   ACSRGPALTQSQDETEIWEALAFTLPLCFSSLRSLQIVLAGAVDWQTFCGPSSNLETLPV  1038

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CH+LC+L+HFG+  IKL+ASY L+E+F+ +S+    + + L+    YL +  AVL 
Sbjct  1039  VCIHCHNLCRLMHFGTPQIKLMASYCLLELFTGLSQQIDIRKEQLRCSSSYLKAMKAVLC  1098

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F  DI+V+ N +LCLSM+IGW+D++ +   ++  SW+R I EE++VSLA+PC AS +
Sbjct  1099  GLVFYDDIRVATNSALCLSMIIGWEDMEGRTEMLKTCSWYRFITEEMSVSLAMPCSASNT  1158

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F  HHKPA++V V++LR+K  P W+ SVFDESCI  +I+N++ +N+S E+V+LFR+L+ +
Sbjct  1159  FVNHHKPAVYVTVAMLRLKNKPVWLRSVFDESCISSMIQNLNVTNISSEIVILFRELIQA  1218

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAA  846
               L  +Q++ LN VF   R+ M R    +   EE  +  V++
Sbjct  1219  QLLNSDQVTKLNLVFLASRKQMQRNGTLDETVEEQMQRTVSS  1260



>emb|CDX90779.1| BnaA03g24590D [Brassica napus]
Length=1334

 Score =   238 bits (608),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/282 (44%), Positives = 185/282 (66%), Gaps = 0/282 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACS+GPAL    + T   E L F L L FF+ RS   +L G VD Q     SS+ + LP 
Sbjct  979   ACSRGPALTQSQDETEIWEALAFTLPLCFFSLRSLQIVLAGAVDWQTFCGPSSNLETLPV  1038

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I+CH+LC+L+HFG+  IKL+ASY L+E+F+ +S+    + + L+    YL S  AVL 
Sbjct  1039  VCIQCHNLCRLMHFGTPQIKLMASYCLLELFTGLSQQIDIRKEQLRCSSSYLKSMKAVLC  1098

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS +
Sbjct  1099  GLVFYDDIRVATNSALCLSMIMGWEDMEGRTEMLKTSSWYRFITEEMSVSLAMPCSASIT  1158

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F  HHKPA++V V++LR K  P W+ SVFDESCI  +I+N++ +N+S E+V+LFR+L+ +
Sbjct  1159  FVNHHKPAVYVTVAMLRHKNKPAWLRSVFDESCISSMIQNLNGTNISSEIVILFRELMQA  1218

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAA  846
               L  +Q++ LN VF   R+ M R    +   EE  +  V++
Sbjct  1219  QLLNSDQVTKLNLVFLASRKQMQRNGTLDETVEEQMQRTVSS  1260



>ref|XP_008464335.1| PREDICTED: protein PRD1 isoform X1 [Cucumis melo]
Length=1275

 Score =   238 bits (607),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/282 (45%), Positives = 188/282 (67%), Gaps = 3/282 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPALID  E T  G+ ++ VL L++F+ RS  A+LPG VD Q+ L  S+  + L +
Sbjct  952   ACSKGPALIDEHEGTNMGKTIILVLFLVYFSMRSLQAVLPGAVDWQNNLGQSNGTR-LSF  1010

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFGS  IKL+ASY L E+F+++S+    K + LK    YL S    LE
Sbjct  1011  ICISCHDLCRLLHFGSTSIKLMASYCLFELFTQLSDQRTSKQEELKCNTNYLRSVITTLE  1070

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIE-RDSWFRLIVEEVAVSLAVPCLASK  537
             GL+   + +V+ NCSLCLSM++GW++++     +  ++ W R IVEE+  S++ PCL S 
Sbjct  1071  GLVVYGNQRVATNCSLCLSMVLGWKEMEMLEARVTVKNKWCRFIVEELVASISRPCLVSN  1130

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             +F+   +P+I+VAV+LL++++   WM S+F E+CI  II+N++ SNLSPELV LFR+LLN
Sbjct  1131  TFT-EERPSIYVAVALLKLQKDFGWMRSIFHEACISRIIENVTISNLSPELVTLFRELLN  1189

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVA  843
             S ++  + IS+LN   Q CR+ +Y E   + +TE    N  A
Sbjct  1190  SEFMLADHISNLNLALQTCRKHIYYEKDEDTQTEREIGNVFA  1231



>ref|XP_009134221.1| PREDICTED: protein PRD1 isoform X1 [Brassica rapa]
Length=1371

 Score =   238 bits (608),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/282 (44%), Positives = 184/282 (65%), Gaps = 0/282 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACS+GPAL    + T   E L F L L F + RS   +L G VD Q     SS+ + LP 
Sbjct  1016  ACSRGPALTQSQDETEIWEALAFTLPLCFSSLRSLQIVLAGAVDWQTFCGPSSNLETLPV  1075

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CH+LC+L+HFG+  IKL+ASY L+E+F+ +S+    + + L+    YL +  AVL 
Sbjct  1076  VCIHCHNLCRLMHFGTPQIKLMASYCLLELFTGLSQQIDIRKEQLRCSSSYLKAMKAVLC  1135

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GL+F  DI+V+ N +LCLSM+IGW+D++ +   ++  SW+R I EE++VSLA+PC AS +
Sbjct  1136  GLVFYDDIRVATNSALCLSMIIGWEDMEGRTEMLKTCSWYRFITEEMSVSLAMPCSASNT  1195

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
             F  HHKPA++V V++LR+K  P W+ SVFDESCI  +I+N++ +N+S E+V+LFR+L+ +
Sbjct  1196  FVNHHKPAVYVTVAMLRLKNKPVWLRSVFDESCISSMIQNLNVTNISSEIVILFRELIQA  1255

Query  721   GYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAA  846
               L  +Q++ LN VF   R+ M R    +   EE  +  V++
Sbjct  1256  QLLNSDQVTKLNLVFLASRKQMQRNGTLDETVEEQMQRTVSS  1297



>ref|XP_008464336.1| PREDICTED: protein PRD1 isoform X2 [Cucumis melo]
Length=1240

 Score =   238 bits (606),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/282 (45%), Positives = 188/282 (67%), Gaps = 3/282 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             ACSKGPALID  E T  G+ ++ VL L++F+ RS  A+LPG VD Q+ L  S+  + L +
Sbjct  952   ACSKGPALIDEHEGTNMGKTIILVLFLVYFSMRSLQAVLPGAVDWQNNLGQSNGTR-LSF  1010

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFGS  IKL+ASY L E+F+++S+    K + LK    YL S    LE
Sbjct  1011  ICISCHDLCRLLHFGSTSIKLMASYCLFELFTQLSDQRTSKQEELKCNTNYLRSVITTLE  1070

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIE-RDSWFRLIVEEVAVSLAVPCLASK  537
             GL+   + +V+ NCSLCLSM++GW++++     +  ++ W R IVEE+  S++ PCL S 
Sbjct  1071  GLVVYGNQRVATNCSLCLSMVLGWKEMEMLEARVTVKNKWCRFIVEELVASISRPCLVSN  1130

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             +F+   +P+I+VAV+LL++++   WM S+F E+CI  II+N++ SNLSPELV LFR+LLN
Sbjct  1131  TFT-EERPSIYVAVALLKLQKDFGWMRSIFHEACISRIIENVTISNLSPELVTLFRELLN  1189

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVA  843
             S ++  + IS+LN   Q CR+ +Y E   + +TE    N  A
Sbjct  1190  SEFMLADHISNLNLALQTCRKHIYYEKDEDTQTEREIGNVFA  1231



>ref|XP_010929840.1| PREDICTED: protein PRD1 [Elaeis guineensis]
Length=1322

 Score =   236 bits (603),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 140/336 (42%), Positives = 207/336 (62%), Gaps = 17/336 (5%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC+KGPAL+D+D  T  G+ L+FVL L FF+ +S +A L   +D Q  L +S+    L  
Sbjct  993   ACAKGPALVDYDAETTLGKSLIFVLLLYFFSLKSLHATLQETMDWQDFLQSSNEAHMLSV  1052

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               ++CHDLC+LIHFGS +IKLVAS  LVE+ +R+S+    K D L+    YL S  AV E
Sbjct  1053  LCLRCHDLCRLIHFGSSLIKLVASQCLVELLTRISDQRNGKNDELRCSLRYLESMMAVTE  1112

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
             GL+F  D  V+ NCS+C S+++GW+    Q     +DS W RL++EE+A++LA P LAS+
Sbjct  1113  GLLFYGDTTVATNCSVCFSIILGWEKFGLQEKRAIKDSKWCRLVMEELAMTLAAPGLASR  1172

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SF+  HKPA HVAV+LL++ Q P WM  VF+ S I GII N+SA +++ E+V LF +L+ 
Sbjct  1173  SFTNQHKPAAHVAVALLKLDQVPGWMKFVFNTSSISGIIDNLSARSMTAEMVRLFTELMT  1232

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDLRNASVLF--DG  891
               Y+  EQ+S+L+ +FQ CR+ +Y ++  +   EE+             R+  VL   D 
Sbjct  1233  RKYMNKEQVSALHHLFQVCRKQVYNDSYKKQLREEN-------------RDVVVLIPEDI  1279

Query  892   KEINQIQQYKILSPSEGLEHRSFVMEQRYLVRFLEV  999
              ++  +  + +LSP    +H     EQ  L++ +EV
Sbjct  1280  GKVCSLLIHLMLSPPMD-DHNEIQTEQEILLKEIEV  1314



>ref|XP_010532711.1| PREDICTED: protein PRD1 [Tarenaya hassleriana]
Length=1307

 Score =   235 bits (599),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/285 (44%), Positives = 187/285 (66%), Gaps = 3/285 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPG-IVDCQHLLDNSSSEQPLP  177
             ACSKGPAL ++   T  G  L FVL L FF  +S  A+LP   VD Q+    S + + LP
Sbjct  971   ACSKGPALGENYHGTDIGNSLAFVLLLSFFTMKSLQAVLPAEAVDWQNFFGPSENRESLP  1030

Query  178   YTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVL  357
                + CHDLC+L+HFGS +IKL+ASY L+E+F+ +SE    + + L+    Y+ S  AVL
Sbjct  1031  VIGVYCHDLCRLMHFGSPVIKLIASYCLLELFTELSEHITAENERLRCSLSYIKSVKAVL  1090

Query  358   EGLIFSSDIQVSMNCSLCLSMMIGWQDLQ--KQVPSIERDSWFRLIVEEVAVSLAVPCLA  531
              GLIF  DI+V++N +LCLS+++G +D++  ++  ++   SW+RLI E+++V LAVPCL 
Sbjct  1091  VGLIFYEDIRVAINSALCLSIILGLEDMEMEERGETLTTSSWYRLIAEKMSVYLAVPCLP  1150

Query  532   SKSFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQL  711
             SK F  HHKPAI+V V+LL+++  P W+ +V DESC+  +I+N++ +N+S E+VLLFR+ 
Sbjct  1151  SKVFITHHKPAIYVTVALLKLRNKPGWLRNVLDESCVSRMIQNLTPTNISSEIVLLFREF  1210

Query  712   LNSGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAA  846
               S YL  EQI+ LN +F   R+ M+R        EE A+  + +
Sbjct  1211  RRSQYLNTEQIAMLNHIFLASRKQMHRSETQNETVEERAEGTICS  1255



>ref|XP_006844709.1| hypothetical protein AMTR_s00016p00250070 [Amborella trichopoda]
 gb|ERN06384.1| hypothetical protein AMTR_s00016p00250070 [Amborella trichopoda]
Length=1927

 Score =   234 bits (596),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/281 (44%), Positives = 174/281 (62%), Gaps = 1/281 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC KGPAL D D+ T +GE L  VL   FF  RS   +L   +D    L +S   Q L  
Sbjct  951   ACEKGPALADQDKETSSGETLNSVLLFYFFVLRSLGGLLQEQIDWHDFLQSSQESQKLSV  1010

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              S++CHDLC+LIHFGS   KL+AS  L+E+ +  S    R  +      GY+ S  AVLE
Sbjct  1011  ISVRCHDLCRLIHFGSSSTKLIASSCLLELLTNTSSQRNRTTNERNCSVGYIQSVMAVLE  1070

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDL-QKQVPSIERDSWFRLIVEEVAVSLAVPCLASK  537
             GL+F  D+ +SM+CSLCLS+++GW+     +  ++  D W R ++EE+A+SLA P +AS+
Sbjct  1071  GLVFHEDVNISMSCSLCLSILLGWEKFGPNEKRAVHEDKWCRFLMEELALSLAAPSMASR  1130

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             S    H+P  H+A++LLR+++ P WM SVF+   + GII N+SAS ++ E+VLLF++LL 
Sbjct  1131  SLMNQHRPLAHLAIALLRLERVPTWMKSVFEAVSLSGIISNLSASKVTVEMVLLFQELLR  1190

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKV  840
              GYL  EQI  L+ VFQ CR+  Y  N  +  TE+   N +
Sbjct  1191  CGYLTAEQIRGLHSVFQVCRKHAYMLNTQDKHTEDKVGNVI  1231



>ref|XP_006414781.1| hypothetical protein EUTSA_v10027320mg [Eutrema salsugineum]
 gb|ESQ56234.1| hypothetical protein EUTSA_v10027320mg [Eutrema salsugineum]
Length=1269

 Score =   233 bits (593),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/290 (43%), Positives = 187/290 (64%), Gaps = 2/290 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSS-EQPLP  177
             ACSKGPAL    + +  GE L F L L FF+ RS   +L G VD Q     S + E  LP
Sbjct  913   ACSKGPALTQCQDESDIGEALAFTLPLYFFSLRSLQIVLAGAVDWQIFFAQSGNLETTLP  972

Query  178   YTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVL  357
                I CH+LC+L+HFG+  IKL+ASY L+E+ + +SE    K + L+    YL S  +VL
Sbjct  973   VICIYCHNLCRLMHFGTPQIKLIASYCLLELLTGLSEQVETKNEQLRCSPNYLKSVKSVL  1032

Query  358   EGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASK  537
              GL+F  D++V+ N +LCLSM++  +D++ +   ++  SW+R I EE++VSLA+PC AS 
Sbjct  1033  GGLVFYDDVRVATNSALCLSMILRLEDMEGRTEMLKTSSWYRFIAEEMSVSLAMPCSASN  1092

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             +F  HHKPA++V V++LR++  P W+ +VFDESC+  +I+N++ +N+S E+V+LFR+L+ 
Sbjct  1093  TFVNHHKPAVYVTVAMLRLRSKPVWLRTVFDESCVSSMIQNLTGTNISCEIVILFRELMQ  1152

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAA-ILGDL  864
             +  L  EQ + LNRVFQ  R+ M R    +   EE  +  +++   LGD+
Sbjct  1153  AQLLSSEQAAKLNRVFQASRQQMQRNGTRDEIVEEQVEQTISSVHDLGDV  1202



>ref|NP_001052517.1| Os04g0347800 [Oryza sativa Japonica Group]
 dbj|BAF14431.1| Os04g0347800, partial [Oryza sativa Japonica Group]
Length=426

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/290 (41%), Positives = 178/290 (61%), Gaps = 2/290 (1%)
 Frame = +1

Query  1    ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
            AC+KGP+L  H++ T  GE+L+ +L L+FF+ RS  AIL   +D Q  L  S   +    
Sbjct  92   ACAKGPSLFQHNQETTFGELLILMLLLIFFSVRSLQAILEASIDWQEFLQYSDDTESSSV  151

Query  181  TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              I CHDLC+L+HFG   +KL+AS  L+E+ +R+S+  +     L+    YL S  AV E
Sbjct  152  LGIPCHDLCRLMHFGPSPVKLIASQCLLELLNRISDQRSCLNAELRCSAKYLKSMIAVTE  211

Query  361  GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
            G++F  D +V+ NC  CL++++GW+    +  ++ R+S W RLI+EE AV+L  P L SK
Sbjct  212  GMVFDQDSRVAENCGACLTVILGWERFGSREKAVIRESKWSRLILEEFAVALTAPGLTSK  271

Query  538  SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
            SFS   K A ++A+SLL++ Q P W++S+F +S I GI+ N+SA N++ E+V LF +L+ 
Sbjct  272  SFSNQQKIAANIALSLLQLSQVPDWLTSLFSDSLISGIVANLSARNVTAEIVTLFSELMA  331

Query  718  SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDLR  867
              YL  E I+ L+ +FQ CRR  Y E  G  + +   +   AA    D+R
Sbjct  332  KNYLNQEHIAGLHNLFQVCRRQAY-EGGGGSKAQPSEQKAAAARCADDVR  380



>ref|XP_009399313.1| PREDICTED: protein PRD1 [Musa acuminata subsp. malaccensis]
Length=1276

 Score =   221 bits (563),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/278 (44%), Positives = 171/278 (62%), Gaps = 5/278 (2%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC KGPAL  +DE T  GE L+F+L L  F+ RS +A+    +D Q     +    P   
Sbjct  948   ACEKGPALNAYDEETPIGETLIFLLLLYVFSLRSLHAVFQETMDWQDFFQLADESYPSSV  1007

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               IKCHDLC+L+HFGS I+KLV+S  L+E+ + VSE   +K     +   Y+ S   V E
Sbjct  1008  ICIKCHDLCRLLHFGSSIVKLVSSQCLLELLTTVSEQREKKKKEPNWSVRYVESVITVAE  1067

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQ---DLQKQVPSIERDSWFRLIVEEVAVSLAVPCLA  531
             GL+F  D   S NC  CLSM++GW+    L K+V  I    WFRL++EE+ ++LA PC A
Sbjct  1068  GLLFYGDFTTSSNCRACLSMLLGWEKSGSLDKKV--IGNSKWFRLVMEELIMTLAAPCFA  1125

Query  532   SKSFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQL  711
             S+SF+  HKPA H+A+  L+M + P WM SVF  S I GI+ N+SA +L+ ++V LFR+L
Sbjct  1126  SRSFTNQHKPAAHMAIFFLKMDKVPSWMKSVFSHSSISGILNNLSACSLTSDMVKLFREL  1185

Query  712   LNSGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEH  825
                 YL  EQ+ +L+ +FQ CR+ +Y++   E   EE+
Sbjct  1186  RVRKYLNKEQVDALHNLFQVCRKQVYKDISREEVVEEN  1223



>gb|AFW87709.1| hypothetical protein ZEAMMB73_320319 [Zea mays]
Length=1057

 Score =   218 bits (555),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 183/297 (62%), Gaps = 7/297 (2%)
 Frame = +1

Query  1    ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
            AC KGP+L  H++ T  GE L+ VL L+FF+ RS ++IL   +D Q  L +S   Q    
Sbjct  691  ACVKGPSLFQHNQETTFGEFLILVLLLVFFSLRSLHSILEVSIDWQDFLQHSDDVQSFSV  750

Query  181  TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              I CHDLC+L+HFGS  IKL+AS  L+E+ +R+S+  +     L+   GYL S  AV E
Sbjct  751  LGIPCHDLCRLMHFGSPSIKLIASQCLLELLTRISDQRSCNNAELRCSVGYLKSIIAVTE  810

Query  361  GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
            GL+FS D +V+ NCS CLS+++GW+    Q     R+S WFRLI+EE  V+L  P L SK
Sbjct  811  GLVFSEDSKVAGNCSACLSVILGWEKFGSQEKVAVRESKWFRLIMEEFVVALTAPGLTSK  870

Query  538  SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
            SFS   K A ++AVSLLR+ Q P W++S+FD   I GI+ N+SA N++ E++ LF +L+ 
Sbjct  871  SFSSQQKFAANMAVSLLRLSQVPDWLTSLFDGHLISGIVANLSARNVTAEIINLFSELMA  930

Query  718  SGYLKDEQISSLNRVFQECRRCMY----RENIGEVRTEEHAK--NKVAAAILGDLRN  870
              YL  E I  L+ + Q CR  +Y    +  + E R E+ A+  N V A++ G + N
Sbjct  931  RKYLSQEHIVDLHNLLQVCRSQVYEGSSKAPLPEQRVEKVARSTNDVLASLFGLMVN  987



>ref|XP_002438828.1| hypothetical protein SORBIDRAFT_10g026800 [Sorghum bicolor]
 gb|EER90195.1| hypothetical protein SORBIDRAFT_10g026800 [Sorghum bicolor]
Length=1312

 Score =   218 bits (554),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 128/293 (44%), Positives = 178/293 (61%), Gaps = 7/293 (2%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC KGP+L  H++ T  GE L+ VL L FF+ RS + IL   +D Q  L +S   Q    
Sbjct  943   ACVKGPSLFQHNQETTFGEFLILVLLLAFFSLRSLHTILEASIDWQDFLQHSDDVQSFSV  1002

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFGS  IKL+AS  L+E+  R+S+  +     L+    YL S  AV E
Sbjct  1003  LGIPCHDLCRLMHFGSPSIKLIASQCLLELLKRISDQRSCIDAELRCSTKYLKSIIAVTE  1062

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
             GL+FS D +V+ NCS CLS+++GW+    Q     R+S WFRLI+EE  V+L  P L SK
Sbjct  1063  GLLFSEDSKVAGNCSACLSVILGWEKFGSQEKVAVRESKWFRLIMEEFVVALTAPGLTSK  1122

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SF+   K A  +AVSLLR+ Q P W++S+FD   I GI+ N+SA N++ E+V+LF +L+ 
Sbjct  1123  SFTSQQKFAAIIAVSLLRLSQVPDWLTSLFDGHLISGIVANLSARNVTAEIVILFSELMA  1182

Query  718   SGYLKDEQISSLNRVFQECRRCMY----RENIGEVRTEEHAK--NKVAAAILG  858
               YL  E I  L+ +FQ CRR +Y    +  + E R E+ A+  N V A++  
Sbjct  1183  RKYLSQEHIVDLHNLFQVCRRQVYEGSSKAALPEQRVEKVARSTNDVLASLFA  1235



>ref|XP_008659889.1| PREDICTED: LOW QUALITY PROTEIN: protein PRD1 [Zea mays]
Length=1330

 Score =   217 bits (553),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 183/297 (62%), Gaps = 7/297 (2%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC KGP+L  H++ T  GE L+ VL L+FF+ RS ++IL   +D Q  L +S   Q    
Sbjct  964   ACVKGPSLFQHNQETTFGEFLILVLLLVFFSLRSLHSILEVSIDWQDFLQHSDDVQSFSV  1023

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFGS  IKL+AS  L+E+ +R+S+  +     L+   GYL S  AV E
Sbjct  1024  LGIPCHDLCRLMHFGSPSIKLIASQCLLELLTRISDQRSCNNAELRCSVGYLKSIIAVTE  1083

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
             GL+FS D +V+ NCS CLS+++GW+    Q     R+S WFRLI+EE  V+L  P L SK
Sbjct  1084  GLVFSEDSKVAGNCSACLSVILGWEKFGSQEKVAVRESKWFRLIMEEFVVALTAPGLTSK  1143

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SFS   K A ++AVSLLR+ Q P W++S+FD   I GI+ N+SA N++ E++ LF +L+ 
Sbjct  1144  SFSSQQKFAANMAVSLLRLSQVPDWLTSLFDGHLISGIVANLSARNVTAEIINLFSELMA  1203

Query  718   SGYLKDEQISSLNRVFQECRRCMY----RENIGEVRTEEHAK--NKVAAAILGDLRN  870
               YL  E I  L+ + Q CR  +Y    +  + E R E+ A+  N V A++ G + N
Sbjct  1204  RKYLSQEHIVDLHNLLQVCRSQVYEGSSKAPLPEQRVEKVARSTNDVLASLFGLMVN  1260



>ref|XP_004975309.1| PREDICTED: protein PRD1-like [Setaria italica]
Length=1082

 Score =   216 bits (549),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 125/314 (40%), Positives = 184/314 (59%), Gaps = 6/314 (2%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC+KGP+L  H++ T  GE ++ VL ++FF+ RS + IL   +D Q  L +    Q    
Sbjct  754   ACAKGPSLFQHNQETDFGEFMILVLLMVFFSLRSLHTILEASIDWQDFLQHPDDAQSFSV  813

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFG   +KL+AS  L+E+ +R+S+        L+    YL S  AV E
Sbjct  814   LGIPCHDLCRLMHFGPPSVKLIASQCLLELLTRISDQRTCTQAELRCSVKYLKSIIAVTE  873

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
             GL+FS D +V+ NC  CLS+++GW+    Q     R+S WFRLI+EE AV+L  P L SK
Sbjct  874   GLVFSEDCKVAGNCGACLSVILGWEKFGSQEKVATRESKWFRLIMEEFAVALTAPGLTSK  933

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SF+   K A ++AVSLLR+ Q P W++S+FD   I GI+ N+SA N++ E+V LF +L+ 
Sbjct  934   SFTNQQKFAANLAVSLLRLSQVPDWLTSLFDSHLISGIVTNLSARNVTAEIVNLFTELMA  993

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDLRNASVLFDGKE  897
               YL  E I +L+ +FQ CR  +Y E   + +  E    KVA +      +   L  G  
Sbjct  994   RKYLSQEHIVALHNLFQVCRSHVY-EGSSKAQMLEQNVKKVARST----DDVLALLFGLM  1048

Query  898   INQIQQYKILSPSE  939
             +NQ  +  ++ P +
Sbjct  1049  LNQCTESGVVQPEQ  1062



>gb|EMT02906.1| hypothetical protein F775_04500 [Aegilops tauschii]
Length=1157

 Score =   215 bits (547),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/283 (42%), Positives = 181/283 (64%), Gaps = 2/283 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC+KGP+L+ +++ T  G  ++ +L L+FF+ RS +AIL   +D Q  L +S + Q    
Sbjct  817   ACAKGPSLLQYNQETDFGGFMILILQLVFFSLRSLHAILDPSIDWQEFLQHSDNTQFFSV  876

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFG Y +KL+AS  L+E+ +R+S+  +     L+    Y+ S  AV+E
Sbjct  877   VGIPCHDLCRLMHFGPYPVKLIASQCLLELLTRISDQRSYLNAELRCSAQYMKSIIAVIE  936

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
             GL+ S D +V+ NC  CLSM++GW+    Q   + R+S W RLI+EE AV+L  P L SK
Sbjct  937   GLVLSQDSRVAENCGSCLSMILGWEKFGSQENMVGRESKWSRLIMEEFAVALTAPGLTSK  996

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SFS   K A ++AVSLL++ Q P W++S+FD S I G++ N+SA N++ ++V LF +L+ 
Sbjct  997   SFSNQQKIASNIAVSLLKLSQVPEWLTSLFDSSLISGVVGNLSARNVTADIVKLFSELMT  1056

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVR-TEEHAKNKVA  843
               YL  E + SL+ +FQ CRR +Y  +  +   +E+ A+  VA
Sbjct  1057  KKYLTQEHVVSLHNLFQVCRRQVYEGSCSKSELSEQKAEETVA  1099



>ref|XP_006652185.1| PREDICTED: protein PRD1-like [Oryza brachyantha]
Length=419

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 168/264 (64%), Gaps = 1/264 (0%)
 Frame = +1

Query  1    ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
            AC+KGP+L  H++ T  GE+LV +L L+ F+ RS + IL   +D Q  L  S   Q   +
Sbjct  77   ACAKGPSLFQHNQETAFGELLVLILLLILFSLRSLHVILEASIDWQDFLQYSDDTQSCSF  136

Query  181  TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              I CHDLC+L+HFG   IKL+AS  L+E+ +R+S   +     L+    YL S  AV E
Sbjct  137  VGIPCHDLCRLMHFGPSPIKLLASQCLLELLNRISFQRSCLNAELRCSAKYLKSIIAVTE  196

Query  361  GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
            G++FS D +V+ NC  CLS+++GW+    +   + R+S W RLI+EE+AV+L  P L SK
Sbjct  197  GMVFSQDSRVAENCGACLSVILGWERYGNKEKVVIRESKWSRLILEELAVALTAPGLTSK  256

Query  538  SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
            SF+   K A ++AVSLL++ Q P W++S+F+ S + GI+ N+SA N++ E+V LF +L+ 
Sbjct  257  SFTNQQKIAANIAVSLLQLSQVPEWLTSLFNGSLVSGIVANLSARNVTAEIVNLFSELMT  316

Query  718  SGYLKDEQISSLNRVFQECRRCMY  789
              YL  E I+ L+ +FQ CRR  Y
Sbjct  317  KNYLNQEDIAGLHDLFQVCRRQAY  340



>gb|KCW59905.1| hypothetical protein EUGRSUZ_H02630 [Eucalyptus grandis]
Length=1322

 Score =   210 bits (534),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/279 (44%), Positives = 187/279 (67%), Gaps = 4/279 (1%)
 Frame = +1

Query  13    GPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPYTSIK  192
             GPA+ + DE T  G+ L+ VL L +FAF+S +A+LP   D  +L+  S+  +  P+ SIK
Sbjct  990   GPAMYNIDEGTEAGKTLIHVLLLHYFAFKSMHAVLPSAGDWDNLIGQSTCIESPPFLSIK  1049

Query  193   CHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLEGLIF  372
             CHDLC+L+HFG  ++KL+ASY L+E+F R+SE    + +  K    Y +S  A+LEGL+ 
Sbjct  1050  CHDLCRLMHFGPPLVKLIASYCLLELFIRLSEQKESEHEDRKCMNKYWMSLMALLEGLLL  1109

Query  373   SSDIQVSMNCSLCLSMMIGWQDLQKQVPSI--ERDSWFRLIVEEVAVSLAVPCLASKSFS  546
              +D +V++N SLCL+M++ W+   ++V  I   R  W RLI+EE+ +SLA P L+SKS +
Sbjct  1110  YNDTRVAINSSLCLAMILKWE--MQEVAEIFNRRSMWCRLILEELVISLAAPSLSSKSST  1167

Query  547   IHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNSGY  726
              HHK A+ VAV+LL++ + P WM SVF ++ + G++ N++ SNLS E+ LL R+LLNS  
Sbjct  1168  NHHKAAVIVAVALLKLPKVPEWMRSVFSDTFLTGMLGNLTGSNLSAEIFLLLRELLNSQL  1227

Query  727   LKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVA  843
             L  + +++LNR+ QE R  +YREN+ +   E+  K  +A
Sbjct  1228  LGADHVANLNRLLQESRTHVYRENMKDESKEKCPKKVIA  1266



>gb|EEC77052.1| hypothetical protein OsI_15436 [Oryza sativa Indica Group]
Length=1778

 Score =   211 bits (536),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/290 (41%), Positives = 178/290 (61%), Gaps = 2/290 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC+KGP+L  H++ T  GE+L+ +L L+FF+ RS  AIL   +D Q  L  S   +    
Sbjct  1444  ACAKGPSLFQHNQETTFGELLILMLLLIFFSVRSLQAILEASIDWQEFLQYSDDTESSSV  1503

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFG   +KL+AS  L+E+ +R+S+  +     L+    YL S  AV E
Sbjct  1504  LGIPCHDLCRLMHFGPSPVKLIASQCLLELLNRISDQRSCLNAELRCSAKYLKSMIAVTE  1563

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
             G++F  D +V+ NC  CL++++GW+    +  ++ R+S W RLI+EE AV+L  P L SK
Sbjct  1564  GMVFDQDSRVAENCGACLTVILGWERFGSREKAVIRESKWSRLILEEFAVALTAPGLTSK  1623

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SFS   K A ++A+SLL++ Q P W++S+F +S I GI+ N+SA N++ E+V LF +L+ 
Sbjct  1624  SFSNQQKIAANIALSLLQLSQVPDWLTSLFSDSLISGIVANLSARNVTAEIVTLFSELMA  1683

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDLR  867
               YL  E I+ L+ +FQ CRR  Y E  G  + +   +   AA    D+R
Sbjct  1684  KNYLNQEHIAGLHNLFQVCRRQAY-EGGGGSKAQPSEQKAAAARCADDVR  1732



>emb|CAE02100.2| OSJNBa0020I02.9 [Oryza sativa Japonica Group]
Length=1176

 Score =   209 bits (533),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/290 (41%), Positives = 178/290 (61%), Gaps = 2/290 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC+KGP+L  H++ T  GE+L+ +L L+FF+ RS  AIL   +D Q  L  S   +    
Sbjct  842   ACAKGPSLFQHNQETTFGELLILMLLLIFFSVRSLQAILEASIDWQEFLQYSDDTESSSV  901

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFG   +KL+AS  L+E+ +R+S+  +     L+    YL S  AV E
Sbjct  902   LGIPCHDLCRLMHFGPSPVKLIASQCLLELLNRISDQRSCLNAELRCSAKYLKSMIAVTE  961

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
             G++F  D +V+ NC  CL++++GW+    +  ++ R+S W RLI+EE AV+L  P L SK
Sbjct  962   GMVFDQDSRVAENCGACLTVILGWERFGSREKAVIRESKWSRLILEEFAVALTAPGLTSK  1021

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SFS   K A ++A+SLL++ Q P W++S+F +S I GI+ N+SA N++ E+V LF +L+ 
Sbjct  1022  SFSNQQKIAANIALSLLQLSQVPDWLTSLFSDSLISGIVANLSARNVTAEIVTLFSELMA  1081

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDLR  867
               YL  E I+ L+ +FQ CRR  Y E  G  + +   +   AA    D+R
Sbjct  1082  KNYLNQEHIAGLHNLFQVCRRQAY-EGGGGSKAQPSEQKAAAARCADDVR  1130



>gb|EEE60780.1| hypothetical protein OsJ_14358 [Oryza sativa Japonica Group]
Length=1617

 Score =   210 bits (535),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/290 (41%), Positives = 178/290 (61%), Gaps = 2/290 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC+KGP+L  H++ T  GE+L+ +L L+FF+ RS  AIL   +D Q  L  S   +    
Sbjct  1283  ACAKGPSLFQHNQETTFGELLILMLLLIFFSVRSLQAILEASIDWQEFLQYSDDTESSSV  1342

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFG   +KL+AS  L+E+ +R+S+  +     L+    YL S  AV E
Sbjct  1343  LGIPCHDLCRLMHFGPSPVKLIASQCLLELLNRISDQRSCLNAELRCSAKYLKSMIAVTE  1402

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
             G++F  D +V+ NC  CL++++GW+    +  ++ R+S W RLI+EE AV+L  P L SK
Sbjct  1403  GMVFDQDSRVAENCGACLTVILGWERFGSREKAVIRESKWSRLILEEFAVALTAPGLTSK  1462

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SFS   K A ++A+SLL++ Q P W++S+F +S I GI+ N+SA N++ E+V LF +L+ 
Sbjct  1463  SFSNQQKIAANIALSLLQLSQVPDWLTSLFSDSLISGIVANLSARNVTAEIVTLFSELMA  1522

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDLR  867
               YL  E I+ L+ +FQ CRR  Y E  G  + +   +   AA    D+R
Sbjct  1523  KNYLNQEHIAGLHNLFQVCRRQAY-EGGGGSKAQPSEQKAAAARCADDVR  1571



>ref|XP_010026681.1| PREDICTED: LOW QUALITY PROTEIN: protein PRD1 [Eucalyptus grandis]
Length=1260

 Score =   209 bits (533),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/279 (44%), Positives = 187/279 (67%), Gaps = 4/279 (1%)
 Frame = +1

Query  13    GPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPYTSIK  192
             GPA+ + DE T  G+ L+ VL L +FAF+S +A+LP   D  +L+  S+  +  P+ SIK
Sbjct  928   GPAMYNIDEGTEAGKTLIHVLLLHYFAFKSMHAVLPSAGDWDNLIGQSTCIESPPFLSIK  987

Query  193   CHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLEGLIF  372
             CHDLC+L+HFG  ++KL+ASY L+E+F R+SE    + +  K    Y +S  A+LEGL+ 
Sbjct  988   CHDLCRLMHFGPPLVKLIASYCLLELFIRLSEQKESEHEDRKCMNKYWMSLMALLEGLLL  1047

Query  373   SSDIQVSMNCSLCLSMMIGWQDLQKQVPSI--ERDSWFRLIVEEVAVSLAVPCLASKSFS  546
              +D +V++N SLCL+M++ W+   ++V  I   R  W RLI+EE+ +SLA P L+SKS +
Sbjct  1048  YNDTRVAINSSLCLAMILKWE--MQEVAEIFNRRSMWCRLILEELVISLAAPSLSSKSST  1105

Query  547   IHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNSGY  726
              HHK A+ VAV+LL++ + P WM SVF ++ + G++ N++ SNLS E+ LL R+LLNS  
Sbjct  1106  NHHKAAVIVAVALLKLPKVPEWMRSVFSDTFLTGMLGNLTGSNLSAEIFLLLRELLNSQL  1165

Query  727   LKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVA  843
             L  + +++LNR+ QE R  +YREN+ +   E+  K  +A
Sbjct  1166  LGADHVANLNRLLQESRTHVYRENMKDESKEKCPKKVIA  1204



>emb|CAH66368.1| OSIGBa0130K07.4 [Oryza sativa Indica Group]
Length=1176

 Score =   209 bits (532),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/290 (41%), Positives = 178/290 (61%), Gaps = 2/290 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC+KGP+L  H++ T  GE+L+ +L L+FF+ RS  AIL   +D Q  L  S   +    
Sbjct  842   ACAKGPSLFQHNQETTFGELLILMLLLIFFSLRSLQAILEASIDWQEFLQYSDDTESSSV  901

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFG   +KL+AS  L+E+ +R+S+  +     L+    YL S  AV E
Sbjct  902   LGIPCHDLCRLMHFGPSPVKLIASQCLLELLNRISDQRSCLNAELRCSAKYLKSIIAVTE  961

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
             G++F  D +V+ NC  CL++++GW+    +  ++ R+S W RLI+EE AV+L  P L SK
Sbjct  962   GMVFDQDSRVAENCGACLTVILGWERFGSREKAVIRESKWSRLILEEFAVALTAPGLTSK  1021

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SFS   K A ++A+SLL++ Q P W++S+F +S I GI+ N+SA N++ E+V LF +L+ 
Sbjct  1022  SFSNQQKIAANIALSLLQLSQVPDWLTSLFSDSLISGIVANLSARNVTAEIVTLFSELMA  1081

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDLR  867
               YL  E I+ L+ +FQ CRR  Y E  G  + +   +   AA    D+R
Sbjct  1082  KNYLNQEHIAGLHNLFQVCRRQAY-EGGGGSKAQPSEQKAAAARCADDVR  1130



>ref|XP_010673442.1| PREDICTED: protein PRD1 [Beta vulgaris subsp. vulgaris]
Length=1310

 Score =   207 bits (526),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 165/253 (65%), Gaps = 11/253 (4%)
 Frame = +1

Query  97    RSSYAILPGIVDCQHLLDNSSSEQPLPYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFS  276
             RS   +LPG +D Q+          LP   I C D+C+ +HFGS ++KLVASY L+E+ +
Sbjct  1016  RSLQVVLPGNMDWQNFFCLPEKTCTLPSIGILCQDVCRFLHFGSSLVKLVASYCLIELLN  1075

Query  277   RVSETNARKPDGLKFKRGYLLSASAVLEGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVP  456
              +++    + +G+    GYL S  A+LEGL+F  D++++MN  LCLSM+  W+     VP
Sbjct  1076  GITD----QQNGVNCSMGYLRSMVAILEGLVFHHDLRIAMNSGLCLSMIFSWE-----VP  1126

Query  457   S--IERDSWFRLIVEEVAVSLAVPCLASKSFSIHHKPAIHVAVSLLRMKQAPPWMSSVFD  630
             +  +  +SW R IVEE+A SLA PC  S SF  HH+PA+++ ++LLR K  PPWM+SV +
Sbjct  1127  TSLVRNNSWCRTIVEELAKSLAAPCSVSTSFMNHHRPAVYITIALLRSKTVPPWMNSVLN  1186

Query  631   ESCICGIIKNISASNLSPELVLLFRQLLNSGYLKDEQISSLNRVFQECRRCMYRENIGEV  810
             E+C+ GII+N+S +N+S E+VLLF+QLL S YLK +QI+ ++ + Q CRRC+  EN  + 
Sbjct  1187  EACVSGIIENLSPNNISVEVVLLFQQLLLSAYLKSDQIAKIDHLLQACRRCICMENNEDE  1246

Query  811   RTEEHAKNKVAAA  849
               EE+ +  V  +
Sbjct  1247  CIEENGRKVVTMS  1259



>gb|EMS50467.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Triticum 
urartu]
Length=1808

 Score =   206 bits (525),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/262 (42%), Positives = 167/262 (64%), Gaps = 1/262 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             AC+KGP+L+ +++ T  G  ++ +L L FF+ RS +AIL   +D Q  L +S + Q    
Sbjct  811   ACAKGPSLLQYNQETDFGGFMILILQLTFFSLRSLHAILDPSIDWQEFLQHSDNTQFFSV  870

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L+HFG Y +KL+AS  L+E+ +R+S+  +     L+    Y+ S  AV+E
Sbjct  871   VGIPCHDLCRLMHFGPYPVKLIASQCLLELLTRISDQRSYLNAELRCSAQYMKSIIAVIE  930

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
             GL+ S D +V+ NC  CLSM++GW+    Q   + R+S W RLI+EE AV+L  P L SK
Sbjct  931   GLVLSQDSRVAENCGSCLSMILGWEKFGSQENMVGRESKWSRLIMEEFAVALTAPGLTSK  990

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SF    K A ++AVSLL++ Q P W++S+FD S I G++ N+SA N++ ++V LF +L+ 
Sbjct  991   SFRNQQKIASNIAVSLLKLSQVPEWLTSLFDSSLISGVVGNLSARNVTADIVKLFSELMT  1050

Query  718   SGYLKDEQISSLNRVFQECRRC  783
               YL  E I SL+ +FQ+   C
Sbjct  1051  KKYLTQEHIVSLHNLFQDDLFC  1072



>ref|XP_010239548.1| PREDICTED: protein PRD1 [Brachypodium distachyon]
Length=1238

 Score =   198 bits (504),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/297 (40%), Positives = 182/297 (61%), Gaps = 10/297 (3%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             A +KGP+L+ H++ T  G  ++F+L L+       +AIL   +D Q  L +S + Q    
Sbjct  915   ARAKGPSLLQHNQETDFGGFMIFILQLVL------HAILDPNIDWQEFLQDSDNPQSFCV  968

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I CHDLC+L++FG   IKL+AS  L+E+ + +SE  +     L+    Y+ S  AV+E
Sbjct  969   VGISCHDLCRLMYFGPCPIKLIASQCLLELITSISEQRSYLNAELRCSAKYMKSIIAVVE  1028

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDS-WFRLIVEEVAVSLAVPCLASK  537
             GL+FS D +V+ NC   LSM++ W++   Q  ++ R S W RLI+EE  V+L  P L SK
Sbjct  1029  GLVFSQDSRVAENCGSSLSMILRWENFGSQENTLVRKSKWSRLIMEEFTVALTAPGLTSK  1088

Query  538   SFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLN  717
             SFS H K A  +AVSLL++   P W++S+FD S I G++ N+SA N++ E+V LF +L+ 
Sbjct  1089  SFSNHQKIAASIAVSLLKLSPVPDWLTSLFDNSLISGVVANLSARNITAEIVNLFSELMA  1148

Query  718   SGYLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAILGDLRNASVLFD  888
             + YL  E I +L+ +FQ CRR +Y  +     +E+ A+ +VA ++  D R  ++LFD
Sbjct  1149  TKYLTQEHIVALHNLFQVCRRQVYEGSSKACLSEKKAEERVARSV-DDER--ALLFD  1202



>gb|EPS70334.1| hypothetical protein M569_04422, partial [Genlisea aurea]
Length=1194

 Score =   194 bits (493),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/256 (43%), Positives = 165/256 (64%), Gaps = 2/256 (1%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             A SKGPAL D +E T TG  LVFVL L+FF+  S   ++PGIVD Q LLD+     PL +
Sbjct  940   ASSKGPALFDDNEGTITGRELVFVLFLVFFSLSSLRVVVPGIVDLQALLDDDEDVPPLRH  999

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
               I+CH LCKL+HFG   +KL++S  LVE+F+  S    ++   +KF+ GYLLS  +VLE
Sbjct  1000  VGIRCHVLCKLLHFGPPSVKLISSSCLVELFAWFSNYTDQESPEVKFEDGYLLSVKSVLE  1059

Query  361   GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
             GLIF  D +V+MNCS CLS ++  +  +  +      +W R++V+E+ + L  P +  + 
Sbjct  1060  GLIFYDDPRVAMNCSKCLSHLLSMEGGRLSISG--HGNWLRVMVDELVMYLCTPSVTWRY  1117

Query  541   FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNS  720
              S   KPA++VAV+LL++ + PPWM   FD+S I  II+N++   L+ E+V+LF +L++ 
Sbjct  1118  SSSSFKPALNVAVALLKLSEVPPWMVECFDDSRIGSIIENMNPRCLNAEMVVLFGRLMDV  1177

Query  721   GYLKDEQISSLNRVFQ  768
             G +    ++ LN+VFQ
Sbjct  1178  GVVNSAHVADLNKVFQ  1193



>emb|CAN80933.1| hypothetical protein VITISV_017363 [Vitis vinifera]
Length=928

 Score =   190 bits (483),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 135/201 (67%), Gaps = 6/201 (3%)
 Frame = +1

Query  259  LVEIFSRVSETNARKPDGL-----KFKRGYLLSASAVLEGLIFSSDIQVSMNCSLCLSMM  423
            LV + + V  T+  K   L     + + G  L+   +L      SDI+V+ NC+LCLSM+
Sbjct  682  LVSMINNVIHTSCSKGPALIEDDEETRNGETLTFVLLLHFFSCRSDIRVAXNCALCLSMI  741

Query  424  IGWQDLQKQ-VPSIERDSWFRLIVEEVAVSLAVPCLASKSFSIHHKPAIHVAVSLLRMKQ  600
            +GW+ L  Q    I R +W RLIVEE+A+SLAVP LASKSF  HHKPA+HVAV+LL++  
Sbjct  742  LGWEKLWMQDTKVIGRCNWCRLIVEELAMSLAVPSLASKSFMNHHKPAVHVAVALLKLHS  801

Query  601  APPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNSGYLKDEQISSLNRVFQECRR  780
             P WM SVFD+SCI GII+N+S SN+S E VLLFR+LLN  YLKDEQI+ LNRVFQ CR+
Sbjct  802  IPGWMKSVFDDSCISGIIENLSVSNVSMETVLLFRELLNHEYLKDEQIACLNRVFQACRK  861

Query  781  CMYRENIGEVRTEEHAKNKVA  843
             +Y  N  +   EE+ +  +A
Sbjct  862  HIYSGNTQDESREENIEKVIA  882



>ref|XP_007163798.1| hypothetical protein PHAVU_001G2650000g, partial [Phaseolus vulgaris]
 gb|ESW35792.1| hypothetical protein PHAVU_001G2650000g, partial [Phaseolus vulgaris]
Length=212

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 117/168 (70%), Gaps = 1/168 (1%)
 Frame = +1

Query  364  LIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKSF  543
            L+F +D++V+ NC  CLSM++GW++L K+   +E  SW RLI+EE+ VS A P LAS+SF
Sbjct  1    LVFYNDLRVATNCCFCLSMILGWENLTKETKLLEGSSWCRLIIEEMTVSFAAPALASQSF  60

Query  544  SIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNSG  723
                 P + +A+++L++++ P WM SVFD S I GI+ N++ASNLS E+++LFR+LL S 
Sbjct  61   MNKQSPQVLIAIAVLKLRKIPQWMRSVFDSSSISGILDNLTASNLSSEILVLFRELLKSN  120

Query  724  YLKDEQISSLNRVFQECRRCMYRENIGEVRTEEHAKNKVAAAI-LGDL  864
            +L  EQI+++N++ QECR+C+Y  N  E    E  K  + A+   GD+
Sbjct  121  FLTTEQIATINQILQECRKCIYTNNAQEGLPNEAIKKVLTASYDTGDI  168



>ref|XP_007224853.1| hypothetical protein PRUPE_ppa022866mg [Prunus persica]
 gb|EMJ26052.1| hypothetical protein PRUPE_ppa022866mg [Prunus persica]
Length=590

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 139/227 (61%), Gaps = 38/227 (17%)
 Frame = +1

Query  1    ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
            AC KGPAL+DHDE T +GEVL+FV +  FF+ RS + +LPGIVD ++  D +   QP+ +
Sbjct  401  ACLKGPALVDHDEETSSGEVLIFVSSSYFFSLRSLHTVLPGIVDWKNFFDPADRVQPISF  460

Query  181  TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAVLE  360
              I CHDLC L+HFGS             + +R  E      D L+F         AVLE
Sbjct  461  FGIFCHDLCTLVHFGS------------PLRNRTGEELVCTMDYLRF-------VMAVLE  501

Query  361  GLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKS  540
            GLIFSSD+              G++ +        +++W R+IVEE+ +SLAVPCLASKS
Sbjct  502  GLIFSSDLS-------------GYEFVTT------KNNWSRMIVEELVMSLAVPCLASKS  542

Query  541  FSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLS  681
            F   HKPAIHVAV+LL+  + P WM S+FD+SCI GII+ ++A+NLS
Sbjct  543  FINLHKPAIHVAVTLLKRPKVPEWMRSMFDDSCISGIIQYLAANNLS  589



>ref|XP_006603081.1| PREDICTED: protein PRD1-like [Glycine max]
Length=163

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 110/150 (73%), Gaps = 0/150 (0%)
 Frame = +1

Query  364  LIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKSF  543
            ++F +D++V+ NCSLCLSM++GW+ L K+   +E  SW RLI+EE+ VSLA P LAS+SF
Sbjct  1    MVFYNDLRVAKNCSLCLSMILGWEKLTKETKVLEESSWCRLIIEEMTVSLAAPALASQSF  60

Query  544  SIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLLNSG  723
            + + +PA+   ++L+++ + P WM SVFD S I GI++N++ASNLS E++ LFR+LL   
Sbjct  61   TNNQRPAVLKGIALMKLHKIPQWMRSVFDNSSISGILENLAASNLSSEILALFRELLKFN  120

Query  724  YLKDEQISSLNRVFQECRRCMYRENIGEVR  813
            +L  EQI+++N++ QECR+  Y  N  E +
Sbjct  121  FLSTEQIATINQMLQECRKRRYSNNAQEAQ  150



>pir||C71403 hypothetical 15.1K protein - Arabidopsis thaliana
Length=1361

 Score =   167 bits (422),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 134/217 (62%), Gaps = 28/217 (13%)
 Frame = +1

Query  118   PGIVDCQHLLDNSSSEQPLPYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNA  297
             P +  CQ   D ++  + L +T         L+HFG+  IKL+ASY L+E+ + +SE   
Sbjct  953   PALTQCQ---DETNIGEALAFT---------LMHFGAPQIKLIASYCLLELLTGLSEQVD  1000

Query  298   RKPDGLKFKRGYLLSASAVLEGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSW  477
              K + L+    YL S  AVL GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW
Sbjct  1001  IKKEQLQCSSSYLKSMKAVLGGLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSW  1060

Query  478   FRLIVEEVAVSLAVPCLASKSFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIK  657
             +R I EE++VSLA+PC AS ++  HHKPA+++ V++LR+K  P W+ +VFDESCI  +I+
Sbjct  1061  YRFIAEEMSVSLAMPCSASSTYVNHHKPAVYLTVAMLRLKNKPVWLRTVFDESCISSMIQ  1120

Query  658   NISASNLSPELVLLFRQLLNSGYLKDEQISSLNRVFQ  768
             N++  N+S E+                Q++ L+R FQ
Sbjct  1121  NLNGINISREI----------------QVTKLDRAFQ  1141



>gb|KHN24038.1| Protein PRD1 [Glycine soja]
Length=750

 Score =   154 bits (390),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = +1

Query  355  LEGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLAS  534
            LEG++F +D++V+ NCSLCLSM++GW+ L K+   +E  SW RLI+EE+ VSLA P LAS
Sbjct  609  LEGMVFYNDLRVAKNCSLCLSMILGWEKLTKETKVLEESSWCRLIIEEMTVSLAAPALAS  668

Query  535  KSFSIHHKPAIHVAVSLLRMKQAPPWMSSVFDESCICGIIKNISASNLSPELVLLFRQLL  714
            +SF+ + +PA+   ++L+++ + P WM SVFD S I GI++N++ASNLS E++ LFR+LL
Sbjct  669  QSFTNNQRPAVLKGIALMKLHKIPQWMRSVFDNSSISGILENLAASNLSSEILALFRELL  728

Query  715  NSGYLKDEQISSLNRVFQ  768
               +L  EQI+++N++ Q
Sbjct  729  KFNFLSTEQIATINQMLQ  746



>gb|ACU28609.1| At4g14180-like protein [Arabidopsis lyrata subsp. petraea]
Length=134

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 93/134 (69%), Gaps = 0/134 (0%)
 Frame = +1

Query  175  PYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAV  354
            P   I CH+LC+L+HFG+  IKL+ASY L+E+ + +SE    K + L+    YL S  AV
Sbjct  1    PVVCIHCHNLCRLMHFGAPQIKLIASYCLLELLTGLSEQIDIKKEQLRCSSSYLKSMKAV  60

Query  355  LEGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLAS  534
            L GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS
Sbjct  61   LGGLVFYDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEEMSVSLAMPCSAS  120

Query  535  KSFSIHHKPAIHVA  576
             ++  HHKPA ++ 
Sbjct  121  SAYVNHHKPAXYLT  134



>gb|ACU28611.1| At4g14180-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ACU28612.1| At4g14180-like protein [Arabidopsis lyrata subsp. petraea]
Length=134

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 92/134 (69%), Gaps = 0/134 (0%)
 Frame = +1

Query  175  PYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAV  354
            P   I CH+LC+L+ FG+  IKL+ASY L+E+ + +SE    K + L+    YL S  A+
Sbjct  1    PVVCIHCHNLCRLMLFGAPQIKLIASYCLLELLTGLSEQIDIKKEQLRCSSSYLKSMKAI  60

Query  355  LEGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLAS  534
            L GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS
Sbjct  61   LGGLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEELSVSLAMPCSAS  120

Query  535  KSFSIHHKPAIHVA  576
             ++  HHKPA ++ 
Sbjct  121  SAYVNHHKPAXYLT  134



>gb|ACU28617.1| At4g14180-like protein [Arabidopsis lyrata subsp. petraea]
Length=134

 Score =   130 bits (326),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = +1

Query  175  PYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAV  354
            P   I CH+LC+L+HFG+  IKL+ASY L+E+ + +SE    K +  +    YL S   V
Sbjct  1    PVVCIHCHNLCRLMHFGAPKIKLIASYCLLELLTGLSEQIDIKKEQPRCSSSYLKSIKTV  60

Query  355  LEGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLAS  534
            L GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS
Sbjct  61   LGGLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEEMSVSLAMPCSAS  120

Query  535  KSFSIHHKPAIHVA  576
             ++  HHKPA ++ 
Sbjct  121  SAYVNHHKPAXYLT  134



>gb|ACU28614.1| At4g14180-like protein [Arabidopsis lyrata subsp. petraea]
Length=134

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = +1

Query  175  PYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAV  354
            P   I CH+LC+L+ FG+  IKL+ASY L+E+ + +SE    K + L+    YL S  A 
Sbjct  1    PVVCIHCHNLCRLMLFGAPQIKLIASYCLLELLTGLSEQIDIKKEQLRCSSSYLKSMKAX  60

Query  355  LEGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLAS  534
            L GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS
Sbjct  61   LGGLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEELSVSLAMPCSAS  120

Query  535  KSFSIHHKPAIHVA  576
             ++  HHKPA ++ 
Sbjct  121  SAYVNHHKPAXYLT  134



>gb|ACU28616.1| At4g14180-like protein [Arabidopsis lyrata subsp. petraea]
Length=134

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = +1

Query  175  PYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAV  354
            P   I CH+LC+L+ FG+  IKL+ASY L+E+ + +SE    K +  +    YL S   V
Sbjct  1    PVVCIHCHNLCRLMXFGAPXIKLIASYCLLELLTGLSEQIDIKKEQXRCSSSYLKSMKXV  60

Query  355  LEGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLAS  534
            L GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS
Sbjct  61   LGGLVFXDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEEMSVSLAMPCSAS  120

Query  535  KSFSIHHKPAIHVA  576
             ++  HHKPA ++ 
Sbjct  121  SAYVNHHKPAXYLT  134



>gb|ACU28608.1| At4g14180-like protein [Arabidopsis lyrata subsp. petraea]
Length=134

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = +1

Query  175  PYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAV  354
            P   I CH+LC+L+ FG+  IKL+ASY L+E+ + +SE    K +  +    YL S   V
Sbjct  1    PVVCIHCHNLCRLMXFGAPXIKLIASYCLLELLTGLSEQIDIKKEQXRCSSSYLKSMKXV  60

Query  355  LEGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLAS  534
            L GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS
Sbjct  61   LGGLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEEMSVSLAMPCSAS  120

Query  535  KSFSIHHKPAIHVA  576
             ++  HHKPA ++ 
Sbjct  121  SAYVNHHKPAXYLT  134



>gb|ACU28615.1| At4g14180-like protein [Arabidopsis lyrata subsp. petraea]
Length=134

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 90/134 (67%), Gaps = 0/134 (0%)
 Frame = +1

Query  175  PYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAV  354
            P   I CH+LC+L+ FG+  IKL+ASY L+E+ + +SE    K +  +    YL S   V
Sbjct  1    PVVCIHCHNLCRLMXFGAPXIKLIASYCLLELLTGLSEQIDIKKEQXRCSSSYLKSMKXV  60

Query  355  LEGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLAS  534
            L GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS
Sbjct  61   LGGLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKXSSWYRFIAEEMSVSLAMPCSAS  120

Query  535  KSFSIHHKPAIHVA  576
             ++  HHKPA ++ 
Sbjct  121  SAYVNHHKPAXYLT  134



>gb|ACU28613.1| At4g14180-like protein [Arabidopsis lyrata subsp. petraea]
Length=134

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = +1

Query  175  PYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAV  354
            P   I CH+LC+L+ FG+  IKL+ASY L+E+ + +SE    K + L+    YL S  AV
Sbjct  1    PVVCIHCHNLCRLMLFGAPQIKLIASYCLLELLTGLSEQIDIKKEQLRCSSSYLKSMKAV  60

Query  355  LEGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLAS  534
            L GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS
Sbjct  61   LGGLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEELSVSLAMPCSAS  120

Query  535  KSFSIHHKPAIHVA  576
             ++  H KPA ++ 
Sbjct  121  SAYVNHXKPAXYLT  134



>ref|XP_010440518.1| PREDICTED: protein PRD1-like [Camelina sativa]
Length=218

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +1

Query  439  LQKQVPSIERDSWFRLIVEEVAVSLAVPCLASKSFSIHHKPAIHVAVSLLRMKQAPPWMS  618
            ++ +   ++  SW+R I EE++VSLA+PC AS +F  HHKPA++V V++LR+K  P W+ 
Sbjct  1    MEGRTEMLKTSSWYRFIAEEMSVSLAMPCSASNTFVNHHKPAVYVTVAMLRLKNKPAWLR  60

Query  619  SVFDESCICGIIKNISASNLSPELVLLFRQLLNSGYLKDEQISSLNRVFQECRRCMYR  792
            +VFDESCI  +I+N+S  N+S E+V+LFR+L+ +  L  EQ++ L R FQE ++ M+R
Sbjct  61   TVFDESCISSMIQNLSGMNISREIVILFRELMLAELLNSEQVTKLIRAFQEFKKQMHR  118



>gb|ACU28610.1| At4g14180-like protein [Arabidopsis lyrata subsp. petraea]
Length=134

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = +1

Query  175  PYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAV  354
            P   I CH+LC+L+ FG+  IKL+ASY L+E+ + +SE    K +  +    YL S   V
Sbjct  1    PVVCIHCHNLCRLMXFGAPXIKLIASYCLLELLTGLSEQIDIKKEQPRCSSSYLKSMKXV  60

Query  355  LEGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLAS  534
            L GL+F  DI+V+ N +LCLSM++GW+D++ +   ++  SW+R I EE++VSLA+PC AS
Sbjct  61   LGGLVFCDDIRVATNSALCLSMILGWEDMEGRTEMLKTSSWYRFIAEEMSVSLAMPCSAS  120

Query  535  KSFSIHHKPAIHVA  576
             ++  HH PA ++ 
Sbjct  121  SAYVNHHXPAXYLT  134



>gb|ACU28618.1| At4g14180-like protein [Arabidopsis lyrata subsp. petraea]
Length=134

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = +1

Query  175  PYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNARKPDGLKFKRGYLLSASAV  354
            P   I CH+LC+L+ FG+  IKL+ASY L+E+ + +SE    K +  +    YL S   V
Sbjct  1    PVVCIHCHNLCRLMXFGAPXIKLIASYCLLELLTGLSEQIDIKKEQXRCSSSYLKSXKXV  60

Query  355  LEGLIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCLAS  534
            L GL+F  DI+V+ N +LCLSM++ W+D++ +   ++  SW+R I EE++VSLA+PC AS
Sbjct  61   LGGLVFXDDIRVATNSALCLSMILXWEDMEGRTEMLKTSSWYRFIAEEMSVSLAMPCSAS  120

Query  535  KSFSIHHKPAIHVA  576
             ++  HHKPA ++ 
Sbjct  121  SAYVNHHKPAXYLT  134



>ref|XP_007163797.1| hypothetical protein PHAVU_001G2650001g, partial [Phaseolus vulgaris]
 gb|ESW35791.1| hypothetical protein PHAVU_001G2650001g, partial [Phaseolus vulgaris]
Length=1074

 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  1     ACSKGPALIDHDETTRTGEvlvfvlallffafRSSYAILPGIVDCQHLLDNSSSEQPLPY  180
             A  KGPAL++HDE T TGE L+FVL L +FA +S +AILPG VD Q  L +    +PL +
Sbjct  969   ASLKGPALVEHDEGTSTGETLIFVLLLHYFAVKSLHAILPGFVDWQSFLVSLKPSEPLAF  1028

Query  181   TSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSE  288
               I+CHDLC+L+HFGS +IK+ ASY L+E+F+R+S+
Sbjct  1029  IGIRCHDLCRLLHFGSPVIKIAASYSLLELFNRISD  1064



>ref|XP_001768570.1| predicted protein [Physcomitrella patens]
 gb|EDQ66508.1| predicted protein [Physcomitrella patens]
Length=1374

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 99/198 (50%), Gaps = 9/198 (5%)
 Frame = +1

Query  187   IKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSETNAR-KPDGLKFKRGYLLSASAVLEG  363
             I C  LC+L+ F +  ++++ S  LVE+ S     N +   D  +    +L S + +L+G
Sbjct  1069  ISCQQLCQLLCFCTTPLQILTSSCLVELLSYARANNGKMHGDLAECSLNHLRSVTLILQG  1128

Query  364   LIFSSDIQVSMNCSLCLSMMIGWQDLQKQVPSIERDSWFRLIVEEVAVSLAVPCL-ASKS  540
                  D  +  N  +CL  ++    L  +  ++ R  W++++ +E+ + LA   +   K+
Sbjct  1129  TASGGDGLLRKNACICLMRLLEMTSLNMKQKAVRRSPWYKVVAQELLLPLANGQVDVVKT  1188

Query  541   FSIHHKPAIHVAVSLLRMKQAPP--WMSSVFDESCICGIIKNISASN-LSPELVLLFRQL  711
               I++ P I   +    +  +PP  W+ SVF    +  +I+N   +  ++ E V LF +L
Sbjct  1189  EEIYYSPPILTTI----LCVSPPNKWLPSVFSSKVLGAVIQNFKNTQYITVETVELFLEL  1244

Query  712   LNSGYLKDEQISSLNRVF  765
             L  G+L+ EQ+ +L  ++
Sbjct  1245  LKRGFLEHEQVETLRALY  1262



>ref|XP_006285776.1| hypothetical protein CARUB_v10007250mg, partial [Capsella rubella]
 gb|EOA18674.1| hypothetical protein CARUB_v10007250mg, partial [Capsella rubella]
Length=870

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 54/96 (56%), Gaps = 0/96 (0%)
 Frame = +1

Query  112  ILPGIVDCQHLLDNSSSEQPLPYTSIKCHDLCKLIHFGSYIIKLVASYHLVEIFSRVSET  291
            +L G VD Q     SS    L    I+ H+  +L+HFG+  IKL+AS  L+E+F+ +S+ 
Sbjct  773  VLSGAVDWQTFFGPSSKLDTLSVGCIRWHNFSRLMHFGTPQIKLMASCCLLELFTGLSQQ  832

Query  292  NARKPDGLKFKRGYLLSASAVLEGLIFSSDIQVSMN  399
               K + L+    YL S  AVL GL+F  DI+V  N
Sbjct  833  IDIKKEQLRCSSSYLKSMKAVLGGLVFCDDIRVPTN  868



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2448657046752