BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17463_g4_i1 len=524 path=[3008:0-523]

Length=524
                                                                      Score     E

ref|XP_002524480.1|  oligopeptide transporter, putative               86.3    2e-16   Ricinus communis
ref|XP_011093557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     84.3    1e-15   
ref|XP_009608738.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  83.6    2e-15   
ref|XP_009781779.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     83.6    2e-15   
ref|XP_009608737.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  83.2    2e-15   
ref|XP_010656420.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  82.8    4e-15   
ref|XP_002281975.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  82.4    5e-15   Vitis vinifera
ref|XP_004230062.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     80.9    2e-14   
ref|XP_006347704.1|  PREDICTED: nitrate transporter 1.4-like          79.0    8e-14   
ref|XP_006475799.1|  PREDICTED: nitrate transporter 1.4-like isof...  77.0    4e-13   
ref|XP_006475798.1|  PREDICTED: nitrate transporter 1.4-like isof...  76.6    4e-13   
ref|XP_006475796.1|  PREDICTED: nitrate transporter 1.4-like isof...  76.3    6e-13   
ref|XP_006450986.1|  hypothetical protein CICLE_v10007850mg           76.3    6e-13   
gb|EYU29790.1|  hypothetical protein MIMGU_mgv1a003653mg              76.3    6e-13   
ref|XP_007154995.1|  hypothetical protein PHAVU_003G164000g           76.3    6e-13   
ref|XP_007204809.1|  hypothetical protein PRUPE_ppa021603mg           74.7    2e-12   
ref|XP_007013425.1|  Major facilitator superfamily protein isoform 1  74.3    3e-12   
ref|XP_004288806.1|  PREDICTED: nitrate transporter 1.4-like          74.3    3e-12   
ref|XP_007013426.1|  Major facilitator superfamily protein isoform 2  73.9    3e-12   
ref|XP_008444009.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     73.9    4e-12   
gb|KDP32393.1|  hypothetical protein JCGZ_13318                       73.9    4e-12   
ref|XP_004150978.1|  PREDICTED: nitrate transporter 1.4-like          73.6    5e-12   
ref|XP_010093242.1|  Nitrate transporter 1.4                          73.6    6e-12   
gb|AGA60121.1|  nitrate transporter NRT1.4B                           73.2    7e-12   
ref|XP_007011887.1|  Major facilitator superfamily protein isoform 2  72.8    1e-11   
ref|XP_007011886.1|  Major facilitator superfamily protein, putat...  72.4    1e-11   
ref|XP_008457678.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2          72.4    1e-11   
ref|XP_010670640.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  72.0    2e-11   
ref|XP_010670639.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  72.0    2e-11   
gb|KHN47160.1|  Nitrate transporter 1.4                               72.0    2e-11   
ref|XP_008352261.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     72.0    2e-11   
ref|XP_008337300.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     72.0    2e-11   
gb|KHG05036.1|  Nitrate transporter 1.4 -like protein                 71.6    2e-11   
ref|XP_010541927.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2          71.6    2e-11   
ref|XP_009368838.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     71.2    3e-11   
ref|XP_010049997.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     71.2    3e-11   
gb|KCW82843.1|  hypothetical protein EUGRSUZ_C04214                   70.9    4e-11   
ref|XP_009778211.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     70.9    4e-11   
gb|KHN34550.1|  Nitrate transporter 1.4                               68.6    5e-11   
emb|CDP10398.1|  unnamed protein product                              70.9    5e-11   
ref|XP_004159415.1|  PREDICTED: nitrate transporter 1.4-like          70.9    5e-11   
ref|XP_004139418.1|  PREDICTED: nitrate transporter 1.4-like          70.9    5e-11   
ref|XP_010049998.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  70.5    5e-11   
gb|KGN60671.1|  hypothetical protein Csa_2G006170                     70.5    6e-11   
ref|XP_010050000.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  70.5    6e-11   
gb|AFR11354.1|  nitrate transporter                                   70.5    6e-11   
ref|XP_008784904.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     69.3    1e-10   
ref|XP_008792049.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  68.9    2e-10   
emb|CDY30787.1|  BnaC07g16870D                                        68.9    2e-10   
ref|XP_008792048.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  68.9    2e-10   
gb|KFK32490.1|  hypothetical protein AALP_AA6G249500                  68.9    2e-10   
ref|XP_009591623.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  68.6    2e-10   
ref|XP_009591624.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  68.6    2e-10   
ref|XP_004243154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     68.6    3e-10   
ref|XP_010254380.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...  68.6    3e-10   
ref|XP_010254379.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...  68.6    3e-10   
ref|XP_009103552.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2          68.2    3e-10   
emb|CDY45207.1|  BnaA07g12830D                                        68.2    3e-10   
gb|KHN15097.1|  Nitrate transporter 1.4                               67.8    4e-10   
ref|XP_006408723.1|  hypothetical protein EUTSA_v10001943mg           67.4    5e-10   
ref|XP_006356754.1|  PREDICTED: nitrate transporter 1.4-like          67.4    6e-10   
ref|XP_006408724.1|  hypothetical protein EUTSA_v10001943mg           67.4    6e-10   
emb|CAD33927.1|  nitrate transporter                                  63.9    1e-09   Cicer arietinum [garbanzo]
ref|XP_006600752.1|  PREDICTED: nitrate transporter 1.4-like          66.6    1e-09   
ref|XP_009397479.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     66.2    2e-09   
ref|XP_006483349.1|  PREDICTED: nitrate transporter 1.4-like isof...  65.9    2e-09   
emb|CDX71495.1|  BnaC04g17300D                                        65.9    2e-09   
gb|KDO61703.1|  hypothetical protein CISIN_1g008020mg                 65.9    2e-09   
ref|XP_006483348.1|  PREDICTED: nitrate transporter 1.4-like isof...  65.9    2e-09   
ref|XP_010533169.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2          65.5    2e-09   
ref|XP_010925226.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     65.5    3e-09   
ref|XP_004508509.1|  PREDICTED: nitrate transporter 1.4-like          64.3    6e-09   
ref|XP_006450457.1|  hypothetical protein CICLE_v10008198mg           63.5    9e-09   
ref|XP_002880817.1|  nitrate transporter                              63.5    1e-08   
ref|XP_010688014.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2          63.5    1e-08   
ref|NP_850084.1|  nitrate transporter 1.4                             63.5    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20651.1|  putative nitrate transporter                          63.5    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAB95302.1|  putative nitrate transporter                          63.5    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006837800.1|  hypothetical protein AMTR_s00104p00113760        63.2    2e-08   
ref|XP_010510873.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...  62.0    3e-08   
ref|XP_003609313.1|  Nitrate transporter                              62.0    4e-08   
ref|XP_006293915.1|  hypothetical protein CARUB_v10022906mg           61.2    5e-08   
ref|XP_010914872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     60.8    8e-08   
ref|XP_010473052.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     58.9    3e-07   
ref|XP_010417814.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     58.9    3e-07   
ref|XP_010510874.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...  58.9    3e-07   
ref|XP_010324989.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  58.2    6e-07   
ref|XP_004245323.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...  57.8    8e-07   
ref|XP_011093558.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     57.0    1e-06   
gb|EPS59108.1|  hypothetical protein M569_15702                       57.0    1e-06   
ref|XP_008794846.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     57.0    1e-06   
ref|XP_008807862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    57.0    2e-06   
ref|XP_010933675.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    56.2    3e-06   
ref|XP_009407665.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     55.8    4e-06   
ref|XP_010678901.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    55.8    4e-06   
ref|XP_002303512.2|  nitrate transporter family protein               55.5    4e-06   Populus trichocarpa [western balsam poplar]
ref|XP_008807861.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    55.5    4e-06   
ref|XP_004490642.1|  PREDICTED: peptide transporter PTR1-like         55.5    4e-06   
gb|KDP25643.1|  hypothetical protein JCGZ_20799                       55.5    4e-06   
ref|XP_002461612.1|  hypothetical protein SORBIDRAFT_02g005420        55.5    5e-06   Sorghum bicolor [broomcorn]
ref|XP_002517463.1|  nitrate transporter, putative                    55.1    5e-06   Ricinus communis
ref|XP_006361731.1|  PREDICTED: nitrate transporter 1.4-like          55.1    5e-06   
ref|XP_006848110.1|  hypothetical protein AMTR_s00029p00215100        55.1    6e-06   
ref|XP_002517444.1|  nitrate transporter, putative                    55.1    7e-06   Ricinus communis
ref|XP_009413298.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    54.7    7e-06   
gb|EMT14752.1|  Peptide transporter PTR2                              54.7    7e-06   
ref|XP_009374282.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...  54.7    9e-06   
ref|XP_009374278.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     54.7    9e-06   
emb|CCN27382.1|  low affinity nitrate transporter                     52.0    9e-06   
dbj|BAJ86984.1|  predicted protein                                    54.3    1e-05   
ref|XP_010923294.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    54.3    1e-05   
ref|XP_011033951.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     54.3    1e-05   
ref|XP_009374284.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...  54.3    1e-05   
ref|XP_002978415.1|  hypothetical protein SELMODRAFT_233150           53.9    1e-05   
ref|XP_004959036.1|  PREDICTED: LOW QUALITY PROTEIN: probable pep...  53.9    1e-05   
dbj|BAJ94405.1|  predicted protein                                    53.9    1e-05   
dbj|BAJ96711.1|  predicted protein                                    53.9    1e-05   
dbj|BAJ91141.1|  predicted protein                                    53.9    1e-05   
gb|AFW80908.1|  hypothetical protein ZEAMMB73_061861                  53.9    1e-05   
ref|NP_001169613.1|  uncharacterized protein LOC100383494             53.9    1e-05   Zea mays [maize]
ref|XP_011033950.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     53.9    1e-05   
ref|XP_003568460.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     53.9    1e-05   
ref|XP_003561175.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    53.9    2e-05   
dbj|BAK08097.1|  predicted protein                                    53.9    2e-05   
ref|XP_002276806.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11         53.5    2e-05   Vitis vinifera
ref|XP_004972811.1|  PREDICTED: nitrate transporter 1.1-like isof...  53.5    2e-05   
ref|XP_004972812.1|  PREDICTED: nitrate transporter 1.1-like isof...  53.5    2e-05   
ref|XP_008808100.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2          53.5    2e-05   
ref|XP_008670500.1|  PREDICTED: uncharacterized protein LOC100191...  53.1    2e-05   
dbj|BAK03852.1|  predicted protein                                    53.1    2e-05   
ref|XP_009591017.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     53.1    2e-05   
ref|XP_006848107.1|  hypothetical protein AMTR_s00029p00214340        53.1    2e-05   
ref|XP_006350821.1|  PREDICTED: peptide transporter PTR1-like         53.1    3e-05   
ref|XP_009408470.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like    53.1    3e-05   
ref|XP_006643742.1|  PREDICTED: peptide transporter PTR1-like         53.1    3e-05   
ref|XP_004241180.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     53.1    3e-05   
ref|XP_002459192.1|  hypothetical protein SORBIDRAFT_02g000260        53.1    3e-05   Sorghum bicolor [broomcorn]
gb|KDO46677.1|  hypothetical protein CISIN_1g006712mg                 52.8    3e-05   
gb|KDO46676.1|  hypothetical protein CISIN_1g006712mg                 52.8    3e-05   
ref|XP_006487564.1|  PREDICTED: probable peptide/nitrate transpor...  52.8    3e-05   
ref|XP_006420818.1|  hypothetical protein CICLE_v10004541mg           52.8    3e-05   
gb|KDO46674.1|  hypothetical protein CISIN_1g006712mg                 52.8    3e-05   
ref|XP_002970257.1|  hypothetical protein SELMODRAFT_231569           52.8    3e-05   
ref|XP_006420817.1|  hypothetical protein CICLE_v10004541mg           52.8    3e-05   
ref|XP_004972110.1|  PREDICTED: peptide transporter PTR1-like         52.8    4e-05   
ref|XP_010933709.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like     52.8    4e-05   
gb|AFN53657.1|  putative peptide transporter                          52.8    4e-05   
ref|XP_010676154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     52.8    4e-05   
ref|XP_002986344.1|  hypothetical protein SELMODRAFT_425373           52.8    4e-05   
ref|XP_008448872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     52.8    4e-05   
ref|NP_001275529.1|  nitrate transporter 1.1-like                     52.8    4e-05   
ref|XP_004968169.1|  PREDICTED: peptide transporter PTR1-like iso...  52.8    4e-05   
ref|XP_006838787.1|  hypothetical protein AMTR_s00002p00259170        52.8    4e-05   
ref|XP_008345515.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     52.8    4e-05   
ref|XP_002979108.1|  hypothetical protein SELMODRAFT_444106           52.8    4e-05   
ref|XP_004968920.1|  PREDICTED: nitrate transporter 1.4-like isof...  52.4    4e-05   
dbj|BAJ95903.1|  predicted protein                                    52.4    4e-05   
gb|KDO46675.1|  hypothetical protein CISIN_1g006712mg                 52.4    4e-05   
gb|EMT23542.1|  Nitrate/chlorate transporter                          52.4    4e-05   
gb|EPS69660.1|  hypothetical protein M569_05105                       52.4    4e-05   
ref|XP_008355414.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     52.4    4e-05   
ref|XP_009779291.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     52.4    4e-05   
ref|XP_008355088.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...  52.4    5e-05   
gb|AAC32034.1|  peptide transporter                                   52.4    5e-05   Hordeum vulgare [barley]
ref|XP_006420815.1|  hypothetical protein CICLE_v10004541mg           52.0    5e-05   
dbj|BAJ91595.1|  predicted protein                                    52.0    6e-05   
emb|CDM81075.1|  unnamed protein product                              52.0    6e-05   
ref|XP_009400863.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    52.0    6e-05   
gb|KDO46686.1|  hypothetical protein CISIN_1g006712mg                 52.0    6e-05   
dbj|BAJ90833.1|  predicted protein                                    52.0    6e-05   
ref|XP_006658355.1|  PREDICTED: probable peptide/nitrate transpor...  51.6    7e-05   
gb|AHV83614.1|  nitrate transporter                                   52.0    7e-05   
ref|XP_008675518.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like     52.0    7e-05   
ref|XP_008388132.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     52.0    7e-05   
ref|XP_008775060.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     52.0    7e-05   
emb|CBI30424.3|  unnamed protein product                              52.0    7e-05   
gb|KDD76324.1|  proton-dependent oligopeptide transporter             51.6    7e-05   
ref|XP_009358875.1|  PREDICTED: uncharacterized protein LOC103949485  52.0    8e-05   
ref|NP_001130360.1|  uncharacterized protein LOC100191455             51.6    8e-05   Zea mays [maize]
ref|XP_002463917.1|  hypothetical protein SORBIDRAFT_01g008885        51.6    8e-05   Sorghum bicolor [broomcorn]
ref|XP_003566777.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.2          51.6    9e-05   
ref|XP_002443879.1|  hypothetical protein SORBIDRAFT_07g003690        51.6    9e-05   Sorghum bicolor [broomcorn]
ref|XP_009405229.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     51.6    9e-05   
gb|ACN27476.1|  unknown                                               51.6    9e-05   Zea mays [maize]
ref|XP_002517462.1|  nitrate transporter, putative                    51.6    9e-05   Ricinus communis
ref|XP_009388204.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     51.6    9e-05   
ref|XP_002464068.1|  hypothetical protein SORBIDRAFT_01g011700        51.2    1e-04   Sorghum bicolor [broomcorn]
ref|XP_009397037.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-lik...  51.2    1e-04   
ref|XP_002972518.1|  hypothetical protein SELMODRAFT_97812            51.2    1e-04   
ref|XP_011081220.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     51.2    1e-04   
gb|EYU46414.1|  hypothetical protein MIMGU_mgv11b021679mg             51.2    1e-04   
ref|XP_010228489.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1          51.2    1e-04   
ref|XP_009346885.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...  51.2    1e-04   
ref|XP_010258991.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     51.2    1e-04   
ref|XP_009411045.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     51.2    1e-04   
ref|XP_006429306.1|  hypothetical protein CICLE_v10011381mg           50.8    1e-04   
ref|XP_002970311.1|  hypothetical protein SELMODRAFT_411211           50.8    1e-04   
ref|XP_002981698.1|  hypothetical protein SELMODRAFT_444972           50.8    1e-04   
emb|CCN27377.1|  low affinity nitrate transporter                     48.9    1e-04   
gb|KHN42706.1|  Nitrate transporter 1.1                               50.8    1e-04   
gb|EYU41851.1|  hypothetical protein MIMGU_mgv1a020985mg              50.8    1e-04   
ref|XP_009346886.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like...  50.8    2e-04   
ref|XP_002436826.1|  hypothetical protein SORBIDRAFT_10g009530        50.8    2e-04   Sorghum bicolor [broomcorn]
dbj|BAC83856.1|  putative nitrate transporter NRT1-5                  50.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|KHN34951.1|  Nitrate transporter 1.1                               50.8    2e-04   
gb|AAL16907.1|AF420016_1  putative low-affinity nitrate transporter   48.1    2e-04   Narcissus pseudonarcissus
ref|XP_003517427.1|  PREDICTED: nitrate transporter 1.1-like          50.8    2e-04   
ref|XP_003538742.1|  PREDICTED: nitrate transporter 1.1               50.8    2e-04   
ref|XP_002967819.1|  hypothetical protein SELMODRAFT_88337            50.8    2e-04   
ref|XP_009397036.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-lik...  50.8    2e-04   
gb|AEW09082.1|  hypothetical protein CL3654Contig1_01                 47.8    2e-04   
ref|XP_004504618.1|  PREDICTED: peptide transporter PTR2-like         50.8    2e-04   
gb|KDP24486.1|  hypothetical protein JCGZ_25050                       50.4    2e-04   
gb|EAZ38982.1|  hypothetical protein OsJ_23400                        50.8    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051098.1|  Os03g0719900                                     50.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007157339.1|  hypothetical protein PHAVU_002G061900g           50.4    2e-04   
gb|EEE59822.1|  hypothetical protein OsJ_12376                        50.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CAD32549.1|  dicarboxylate transporter                            50.4    2e-04   Alnus glutinosa
ref|XP_010519721.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1          50.4    2e-04   
ref|XP_010262762.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     50.4    2e-04   
gb|AFG66612.1|  hypothetical protein CL3654Contig1_01                 47.4    2e-04   
ref|XP_003562233.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.3          50.4    2e-04   
gb|EMS66817.1|  Peptide transporter PTR5                              50.4    2e-04   
ref|XP_003602970.1|  Peptide transporter PTR3-A                       50.4    2e-04   
ref|XP_010906610.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...  50.4    2e-04   
gb|EAZ02458.1|  hypothetical protein OsI_24563                        50.1    2e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_006658184.1|  PREDICTED: peptide transporter PTR5-like         50.1    2e-04   
ref|XP_001774033.1|  predicted protein                                50.1    2e-04   
gb|ACF22756.1|  nitrate transporter                                   50.1    2e-04   Brachypodium distachyon [annual false brome]
ref|XP_004511669.1|  PREDICTED: nitrate transporter 1.1-like isof...  50.1    2e-04   
ref|NP_001058672.1|  Os07g0100600                                     50.1    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AIU49688.1|  major facilitator superfamily protein                 50.1    2e-04   
dbj|BAD31819.1|  putative peptide transport protein                   50.1    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AFK49547.1|  unknown                                               47.8    2e-04   
emb|CCN27378.1|  low affinity nitrate transporter                     48.5    2e-04   
ref|XP_004983703.1|  PREDICTED: nitrate transporter 1.1-like          50.1    3e-04   
ref|XP_006440344.1|  hypothetical protein CICLE_v10019412mg           50.1    3e-04   
gb|KDO61483.1|  hypothetical protein CISIN_1g007736mg                 50.1    3e-04   
ref|XP_002511509.1|  nitrate transporter, putative                    50.1    3e-04   Ricinus communis
ref|XP_009421313.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     50.1    3e-04   
ref|XP_002992551.1|  hypothetical protein SELMODRAFT_448814           50.1    3e-04   
ref|XP_006477230.1|  PREDICTED: nitrate transporter 1.1-like          50.1    3e-04   
gb|KEH34180.1|  proton-dependent oligopeptide transport family pr...  50.1    3e-04   
ref|XP_004296302.1|  PREDICTED: putative peptide/nitrate transpor...  50.1    3e-04   
ref|XP_010109642.1|  hypothetical protein L484_015597                 49.7    3e-04   
ref|XP_010906609.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...  50.1    3e-04   
gb|KEH35736.1|  peptide/nitrate transporter                           50.1    3e-04   
ref|XP_010514894.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.3          50.1    3e-04   
gb|EMT28633.1|  Peptide transporter PTR5                              49.7    3e-04   
ref|XP_011077583.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     50.1    3e-04   
ref|XP_010093702.1|  Nitrate transporter 1.1                          49.3    3e-04   
ref|XP_002978475.1|  hypothetical protein SELMODRAFT_418377           50.1    3e-04   
gb|KDO53228.1|  hypothetical protein CISIN_1g0083672mg                49.7    3e-04   
gb|KDO53230.1|  hypothetical protein CISIN_1g0083672mg                49.7    3e-04   
gb|KDP30601.1|  hypothetical protein JCGZ_16932                       49.7    3e-04   
gb|KEH34179.1|  proton-dependent oligopeptide transport family pr...  49.7    3e-04   
gb|ACN26865.1|  unknown                                               49.7    3e-04   Zea mays [maize]
ref|XP_002283281.3|  PREDICTED: protein NRT1/ PTR FAMILY 7.1 isof...  49.7    3e-04   Vitis vinifera
emb|CBI16454.3|  unnamed protein product                              49.7    3e-04   
gb|AEX11045.1|  hypothetical protein 0_1143_01                        46.6    3e-04   
ref|XP_010651313.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1 isof...  49.7    3e-04   
ref|NP_001131161.1|  uncharacterized protein LOC100192469             49.7    3e-04   Zea mays [maize]
ref|XP_002978476.1|  hypothetical protein SELMODRAFT_443914           49.7    4e-04   
gb|EEC76434.1|  hypothetical protein OsI_14122                        49.7    4e-04   Oryza sativa Indica Group [Indian rice]
emb|CAN77230.1|  hypothetical protein VITISV_005961                   49.7    4e-04   Vitis vinifera
ref|XP_002301861.1|  peptide transporter 2 family protein             49.7    4e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006373301.1|  hypothetical protein POPTR_0017s11320g           49.7    4e-04   
ref|XP_010104684.1|  Peptide transporter                              49.7    4e-04   
gb|ADQ43190.1|  peptide transporter                                   49.7    4e-04   
dbj|BAG91734.1|  unnamed protein product                              49.7    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006586602.1|  PREDICTED: putative peptide/nitrate transpor...  49.7    4e-04   
ref|NP_001041994.1|  Os01g0142800                                     49.7    4e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EMS53820.1|  Nitrate transporter 1.4                               49.3    4e-04   
dbj|BAJ91042.1|  predicted protein                                    49.3    4e-04   
ref|XP_010676153.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     49.3    4e-04   
ref|XP_010235838.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.2-like     49.3    4e-04   
ref|XP_002970312.1|  hypothetical protein SELMODRAFT_411213           49.3    4e-04   
ref|XP_009407160.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     49.3    4e-04   
gb|AEX11044.1|  hypothetical protein 0_1143_01                        46.2    5e-04   
gb|KCW85010.1|  hypothetical protein EUGRSUZ_B01831                   49.3    5e-04   
emb|CDY17619.1|  BnaA06g34380D                                        49.3    5e-04   
ref|XP_007026785.1|  Peptide transporter 1 isoform 1                  49.3    5e-04   
gb|EEE55833.1|  hypothetical protein OsJ_04443                        49.3    5e-04   
ref|XP_002282012.3|  PREDICTED: protein NRT1/ PTR FAMILY 6.2          49.3    5e-04   
ref|XP_002323559.2|  proton-dependent oligopeptide transport fami...  49.3    5e-04   
gb|KCW51438.1|  hypothetical protein EUGRSUZ_J00963                   49.3    5e-04   
ref|XP_011003660.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...  49.3    5e-04   
dbj|BAJ97409.1|  predicted protein                                    49.3    5e-04   
ref|XP_002533893.1|  peptide transporter, putative                    49.3    5e-04   
gb|KHN18518.1|  Putative peptide/nitrate transporter                  49.3    5e-04   
ref|XP_010683278.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.12         49.3    5e-04   
ref|XP_003574312.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     49.3    5e-04   
ref|XP_002517461.1|  nitrate transporter, putative                    49.3    5e-04   
ref|XP_002972318.1|  hypothetical protein SELMODRAFT_441824           49.3    5e-04   
ref|XP_006395818.1|  hypothetical protein EUTSA_v10003893mg           49.3    5e-04   
tpg|DAA50699.1|  TPA: hypothetical protein ZEAMMB73_457708            49.3    5e-04   
ref|XP_010032053.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.7-like...  49.3    5e-04   
emb|CBI28188.3|  unnamed protein product                              49.3    5e-04   
ref|XP_011003661.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like...  49.3    5e-04   
ref|XP_002978416.1|  hypothetical protein SELMODRAFT_418286           49.3    5e-04   
gb|KHN24967.1|  Putative peptide/nitrate transporter                  49.3    5e-04   
dbj|BAJ95092.1|  predicted protein                                    49.3    5e-04   
ref|XP_010654192.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     49.3    5e-04   
ref|XP_003572060.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     49.3    5e-04   
ref|XP_002970258.1|  hypothetical protein SELMODRAFT_231570           49.3    5e-04   
ref|XP_008796822.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     49.3    5e-04   
ref|XP_006480388.1|  PREDICTED: probable peptide/nitrate transpor...  49.3    5e-04   
ref|XP_002489312.1|  hypothetical protein SORBIDRAFT_0010s013040      48.9    6e-04   
ref|XP_002529778.1|  oligopeptide transporter, putative               48.9    6e-04   
ref|XP_009101283.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3          48.9    6e-04   
ref|XP_009799219.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    48.9    6e-04   
ref|XP_010502212.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     48.9    6e-04   
ref|XP_003550765.1|  PREDICTED: probable peptide/nitrate transpor...  48.9    6e-04   
gb|EMT27348.1|  Nitrate/chlorate transporter                          48.9    6e-04   
gb|AEX11041.1|  hypothetical protein 0_1143_01                        45.8    6e-04   
ref|XP_010424976.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like     48.9    6e-04   
ref|XP_010042512.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like     48.9    6e-04   
ref|XP_009400862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    48.9    6e-04   
ref|XP_010932898.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.11-like    48.9    6e-04   
ref|XP_003611284.1|  Nitrate transporter                              48.9    6e-04   
ref|XP_010242330.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.9-like     48.9    6e-04   
ref|XP_010513957.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3          48.9    6e-04   
ref|NP_001130581.1|  uncharacterized protein LOC100191680             48.9    6e-04   
gb|EYU26644.1|  hypothetical protein MIMGU_mgv1a003683mg              48.9    6e-04   
ref|XP_010941437.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     48.9    6e-04   
gb|KHN48655.1|  Putative peptide/nitrate transporter                  48.9    6e-04   
ref|XP_003525480.1|  PREDICTED: probable peptide/nitrate transpor...  48.9    6e-04   
ref|XP_011081130.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like     48.9    6e-04   
ref|XP_008338492.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like     48.9    6e-04   
gb|AAM47310.1|AF377946_12  putative peptide transporter protein       48.9    6e-04   
ref|XP_008356408.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     48.9    7e-04   
dbj|BAB90538.1|  putative peptide transport protein                   48.9    7e-04   
ref|XP_006365764.1|  PREDICTED: nitrate excretion transporter 1-like  48.9    7e-04   
ref|XP_008658431.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     48.9    7e-04   
gb|EMS68423.1|  Peptide transporter PTR2                              48.9    7e-04   
ref|XP_010558361.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     48.9    7e-04   
gb|EYU45753.1|  hypothetical protein MIMGU_mgv1a003661mg              48.9    7e-04   
gb|KDP31196.1|  hypothetical protein JCGZ_11572                       48.5    7e-04   
gb|EAZ16929.1|  hypothetical protein OsJ_32411                        48.9    7e-04   
ref|XP_008375317.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     48.5    8e-04   
gb|EYU35891.1|  hypothetical protein MIMGU_mgv1a021530mg              48.5    8e-04   
ref|XP_011013862.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.10-like    48.5    8e-04   
ref|XP_004980444.1|  PREDICTED: probable peptide transporter At1g...  48.5    8e-04   
ref|XP_010926624.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.13-like    48.5    8e-04   
ref|XP_009364152.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like     48.5    8e-04   
ref|XP_008448722.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.3-like     48.5    8e-04   
gb|EEC71979.1|  hypothetical protein OsI_04820                        48.5    8e-04   
ref|XP_004150179.1|  PREDICTED: nitrate transporter 1.5-like          48.5    8e-04   
ref|XP_006445924.1|  hypothetical protein CICLE_v10018037mg           48.5    8e-04   
ref|XP_002442576.1|  hypothetical protein SORBIDRAFT_08g022290        48.5    8e-04   
gb|AIU49689.1|  major facilitator superfamily protein                 48.5    8e-04   
gb|KDP46548.1|  hypothetical protein JCGZ_08520                       48.5    8e-04   
ref|XP_008352702.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like     48.5    8e-04   
ref|XP_008243685.1|  PREDICTED: protein NRT1/ PTR FAMILY 7.1-like     48.5    8e-04   
emb|CCN27390.1|  low affinity nitrate transporter                     47.0    8e-04   
ref|XP_007139336.1|  hypothetical protein PHAVU_008G020800g           48.5    8e-04   
ref|XP_003611286.1|  Nitrate transporter                              48.5    8e-04   
gb|KDP46546.1|  hypothetical protein JCGZ_08518                       48.5    8e-04   
ref|XP_004163981.1|  PREDICTED: nitrate transporter 1.5-like          48.5    8e-04   
gb|EPS57551.1|  hypothetical protein M569_17266                       48.1    9e-04   
ref|XP_006385089.1|  proton-dependent oligopeptide transport fami...  48.5    9e-04   
ref|XP_002992575.1|  hypothetical protein SELMODRAFT_135536           48.5    9e-04   
ref|XP_007142617.1|  hypothetical protein PHAVU_007G002800g           48.5    9e-04   
ref|XP_009337310.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     48.5    0.001   
ref|XP_008670698.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like     48.5    0.001   
ref|XP_007207539.1|  hypothetical protein PRUPE_ppa015854mg           48.5    0.001   
ref|XP_008808741.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like     48.5    0.001   
ref|XP_010253843.1|  PREDICTED: protein NRT1/ PTR FAMILY 2.7-like     48.5    0.001   
ref|XP_004501602.1|  PREDICTED: probable peptide/nitrate transpor...  48.5    0.001   
ref|XP_010112576.1|  putative peptide/nitrate transporter             48.5    0.001   
gb|KHG08248.1|  Peptide transporter PTR1 -like protein                48.5    0.001   
gb|EMT27347.1|  Nitrate/chlorate transporter                          48.5    0.001   
ref|XP_009361962.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like     48.5    0.001   
gb|AEX11039.1|  hypothetical protein 0_1143_01                        45.4    0.001   
emb|CDP14878.1|  unnamed protein product                              48.5    0.001   
gb|EPS73609.1|  proton-dependent oligopeptide transport family pr...  48.5    0.001   
ref|XP_010554363.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3 isof...  48.5    0.001   
ref|XP_010087388.1|  Putative peptide/nitrate transporter             48.5    0.001   
gb|AEK82130.1|  dicarboxylate transporter                             48.1    0.001   
gb|ABB47972.1|  Nitrate/chlorate transporter, putative, expressed     48.5    0.001   
ref|XP_009624729.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like     48.5    0.001   



>ref|XP_002524480.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF37920.1| oligopeptide transporter, putative [Ricinus communis]
Length=581

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR-RKTNKKGGMQMESM  241
            G QGWLADNINYGRLDCFYGLLA+LGVVNFV+Y+I A+W++ R + K   +QME++
Sbjct  516  GGQGWLADNINYGRLDCFYGLLAVLGVVNFVVYLICALWYKPRNSAKSAALQMENV  571



>ref|XP_011093557.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Sesamum indicum]
Length=583

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 2/59 (3%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR--RKTNKKGGMQMES  238
            +  G QGWLADNINYGRLDCFYGLLA+LG++N V+Y+I AVW++  +K   +  +QME+
Sbjct  515  SSNGGQGWLADNINYGRLDCFYGLLAVLGIINLVIYLICAVWYKPDQKPKPQPALQMEA  573



>ref|XP_009608738.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=533

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            G  GWLADNINY RLDCFYGLLAILGV+NF LY+I A+WF+ + +K   +QME++
Sbjct  470  GGDGWLADNINYARLDCFYGLLAILGVINFALYLICAIWFKPRKSKS-AIQMETV  523



>ref|XP_009781779.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=576

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            G  GWLADNINY RLDCFYGLLAILGV+NF LY+I+A+WF+ + +K   +QME++
Sbjct  513  GGDGWLADNINYARLDCFYGLLAILGVINFALYLIAAIWFKPRKSKS-AVQMETV  566



>ref|XP_009608737.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=578

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            G  GWLADNINY RLDCFYGLLAILGV+NF LY+I A+WF+ + +K   +QME++
Sbjct  515  GGDGWLADNINYARLDCFYGLLAILGVINFALYLICAIWFKPRKSKS-AIQMETV  568



>ref|XP_010656420.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 ref|XP_010656421.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 emb|CBI28187.3| unnamed protein product [Vitis vinifera]
Length=576

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 3/57 (5%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR-RKTNKKGGMQMESM  241
            R  QGWLADNINYGRLDCFYGLLAIL  +NF ++++ AVW++ +K N   GMQME+M
Sbjct  512  RDGQGWLADNINYGRLDCFYGLLAILSFINFAVFLVCAVWYKPQKPND--GMQMETM  566



>ref|XP_002281975.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Vitis 
vinifera]
Length=580

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 3/57 (5%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR-RKTNKKGGMQMESM  241
            R  QGWLADNINYGRLDCFYGLLAIL  +NF ++++ AVW++ +K N   GMQME+M
Sbjct  516  RDGQGWLADNINYGRLDCFYGLLAILSFINFAVFLVCAVWYKPQKPND--GMQMETM  570



>ref|XP_004230062.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=574

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            G   WLADNINYGRLDCFYGLLAILGV+NFVLY+I A WF+ + +K
Sbjct  514  GGHDWLADNINYGRLDCFYGLLAILGVINFVLYIICATWFKPRKDK  559



>ref|XP_006347704.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=575

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            G   WLADNINYGRLDCFYGLLAILGV+NFVLY+  A WF+ +   K  + ME++
Sbjct  512  GGHDWLADNINYGRLDCFYGLLAILGVINFVLYLFCATWFKPR-KAKSAINMETI  565



>ref|XP_006475799.1| PREDICTED: nitrate transporter 1.4-like isoform X4 [Citrus sinensis]
 ref|XP_006475800.1| PREDICTED: nitrate transporter 1.4-like isoform X5 [Citrus sinensis]
Length=560

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            +G  GWLADNIN GRLD FYGLLAIL ++N V+Y+I AVW++ K   K G+QME+
Sbjct  496  KGGGGWLADNINRGRLDLFYGLLAILSIINLVIYLICAVWYKPK-KPKAGIQMET  549



>ref|XP_006475798.1| PREDICTED: nitrate transporter 1.4-like isoform X3 [Citrus sinensis]
 gb|KDO80313.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=565

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            +G  GWLADNIN GRLD FYGLLAIL ++N V+Y+I AVW++ K   K G+QME+
Sbjct  501  KGGGGWLADNINRGRLDLFYGLLAILSIINLVIYLICAVWYKPK-KPKAGIQMET  554



>ref|XP_006475796.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
 ref|XP_006475797.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Citrus sinensis]
 gb|KDO80312.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=575

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            +G  GWLADNIN GRLD FYGLLAIL ++N V+Y+I AVW++ K   K G+QME+
Sbjct  511  KGGGGWLADNINRGRLDLFYGLLAILSIINLVIYLICAVWYKPK-KPKAGIQMET  564



>ref|XP_006450986.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
 gb|ESR64226.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
Length=575

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            +G  GWLADNIN GRLD FYGLLAIL ++N V+Y+I AVW++ K   K G+QME+
Sbjct  511  KGGGGWLADNINRGRLDLFYGLLAILSIINLVIYLICAVWYKPK-KPKAGIQMET  564



>gb|EYU29790.1| hypothetical protein MIMGU_mgv1a003653mg [Erythranthe guttata]
Length=571

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR  199
            T  G QGWLADNIN+GRLDCFYGLLA+LG VN ++Y+I A W++
Sbjct  516  TSNGGQGWLADNINHGRLDCFYGLLAVLGFVNLIIYLICAAWYK  559



>ref|XP_007154995.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
 gb|ESW26989.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
Length=581

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            R  QGWLADNIN GRLD FYGLL IL  VNFV +++ AVWF+ K  K+  MQM ++
Sbjct  517  RDGQGWLADNINQGRLDLFYGLLTILSFVNFVAFLVCAVWFKPKKPKQPAMQMGAI  572



>ref|XP_007204809.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
 gb|EMJ06008.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
Length=585

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            +  QGWL DNINYGRLDCFYGLL +L V+NFV+Y++ A W++        +QM S
Sbjct  517  KDEQGWLTDNINYGRLDCFYGLLTVLSVINFVVYLVCARWYKTHEPHPPALQMTS  571



>ref|XP_007013425.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31044.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=591

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            QGWLADNIN+GRLDCFYGL+A+L ++NFV+Y++ A W + +   K  +QME++
Sbjct  530  QGWLADNINHGRLDCFYGLVAVLDIINFVVYLVCAAWHKPR-KPKPALQMETI  581



>ref|XP_004288806.1| PREDICTED: nitrate transporter 1.4-like [Fragaria vesca subsp. 
vesca]
Length=617

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWF--RRKTNKKGGMQME  235
            +  QGWLADNINYGRLDCFYGLL++L V+NFV Y++ A W+  R+ T    G   E
Sbjct  559  KDGQGWLADNINYGRLDCFYGLLSVLSVINFVAYLVCARWYKPRKPTKPSNGSSAE  614



>ref|XP_007013426.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY31045.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=581

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            QGWLADNIN+GRLDCFYGL+A+L ++NFV+Y++ A W + +   K  +QME++
Sbjct  520  QGWLADNINHGRLDCFYGLVAVLDIINFVVYLVCAAWHKPR-KPKPALQMETI  571



>ref|XP_008444009.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Cucumis melo]
Length=580

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 3/56 (5%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWF---RRKTNKKGGM  226
            TG   +GWLADNINYGRLDCFYGLL IL ++NFV +++  +W+   +RK  +K G+
Sbjct  515  TGNDGEGWLADNINYGRLDCFYGLLTILSIINFVAFLVCVIWYMPQKRKDFQKNGI  570



>gb|KDP32393.1| hypothetical protein JCGZ_13318 [Jatropha curcas]
Length=586

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 6/59 (10%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR-RKTN-----KKGGMQMESM  241
            QGWL DNIN GRLDCFYGLLA L V+NF++Y++ A+W++ RK N     K  G+QME+M
Sbjct  518  QGWLGDNINNGRLDCFYGLLATLCVINFLVYLVCALWYKPRKKNTNNDHKSAGLQMENM  576



>ref|XP_004150978.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
 ref|XP_004168393.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=599

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 3/56 (5%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWF---RRKTNKKGGM  226
            TG   +GWLADN+NYGRLDCFYGLL IL ++NFV +++  +W+   +RK  +K G+
Sbjct  534  TGNDGEGWLADNVNYGRLDCFYGLLTILSIINFVAFLVCVIWYMPQKRKDFQKNGI  589



>ref|XP_010093242.1| Nitrate transporter 1.4 [Morus notabilis]
 gb|EXB53744.1| Nitrate transporter 1.4 [Morus notabilis]
Length=581

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            R  QGWLADNIN GRLDCFYGLL +LGV+NF  Y++ A W++ K   K  +QM  +
Sbjct  515  RDGQGWLADNINEGRLDCFYGLLTVLGVINFAAYIVCAKWYKPK-KAKPAVQMSGI  569



>gb|AGA60121.1| nitrate transporter NRT1.4B [Cucumis sativus]
 gb|KGN65321.1| hypothetical protein Csa_1G324370 [Cucumis sativus]
Length=580

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 3/56 (5%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWF---RRKTNKKGGM  226
            TG   +GWLADN+NYGRLDCFYGLL IL ++NFV +++  +W+   +RK  +K G+
Sbjct  515  TGNDGEGWLADNVNYGRLDCFYGLLTILSIINFVAFLVCVIWYMPQKRKDFQKNGI  570



>ref|XP_007011887.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY29506.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=553

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKK  217
            G QGW+ +NIN GRLDCFYGLLA L  +NF L+++ A W+R+KT K+
Sbjct  490  GKQGWVGENINEGRLDCFYGLLAALSFINFALFLVCAAWYRKKTVKR  536



>ref|XP_007011886.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY29505.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=668

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKK  217
            G QGW+ +NIN GRLDCFYGLLA L  +NF L+++ A W+R+KT K+
Sbjct  605  GKQGWVGENINEGRLDCFYGLLAALSFINFALFLVCAAWYRKKTVKR  651



>ref|XP_008457678.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Cucumis melo]
Length=581

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            QGWLADNINY RLDCFYGLLAIL  +NFV +++ AVW++ +  K+  ++ME+
Sbjct  520  QGWLADNINYARLDCFYGLLAILSAINFVAFLVCAVWYKPQKPKQ-LLEMET  570



>ref|XP_010670640.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=575

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQM  232
            G  GW+ DNIN GRLDCFYGLL+IL  +NF LY++SA W++R+   K  +Q+
Sbjct  513  GGDGWIGDNINKGRLDCFYGLLSILSFINFGLYLVSARWYKRQMPAKPTLQV  564



>ref|XP_010670639.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=599

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQM  232
            G  GW+ DNIN GRLDCFYGLL+IL  +NF LY++SA W++R+   K  +Q+
Sbjct  537  GGDGWIGDNINKGRLDCFYGLLSILSFINFGLYLVSARWYKRQMPAKPTLQV  588



>gb|KHN47160.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQM  232
            R  QGWLADNIN GRLD FY LL IL  +NFV + + A+WF+ K  K+  MQM
Sbjct  519  RDGQGWLADNINKGRLDLFYALLTILSFINFVAFAVCALWFKPKKPKQPAMQM  571



>ref|XP_008352261.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            QGWLA+NINYGRLDCFYGLL +L V+NFV Y++ A W+  KT+K+    +++
Sbjct  525  QGWLABNINYGRLDCFYGLLTVLSVINFVAYLVCARWY-HKTHKQHAFVLQT  575



>ref|XP_008337300.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            QGWLA+NINYGRLDCFYGLL +L V+NFV Y++ A W+  KT+K+    +++
Sbjct  525  QGWLABNINYGRLDCFYGLLTVLSVINFVAYLVCARWY-HKTHKQHAFVLQT  575



>gb|KHG05036.1| Nitrate transporter 1.4 -like protein [Gossypium arboreum]
Length=579

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKG  220
            QGWL ++IN GRLDCFYGLLA L  +NF L+++SAVWFR+KT K+ 
Sbjct  518  QGWLGEHINKGRLDCFYGLLAALSFLNFGLFLLSAVWFRKKTVKQA  563



>ref|XP_010541927.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 2/55 (4%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQM  232
            +G G QGWLADNIN+GRLDCFY LLA+L  +NFV+Y++ A+WF+ +   KG ++M
Sbjct  518  SGNG-QGWLADNINHGRLDCFYWLLAVLSGINFVVYMVCALWFKPRKG-KGALEM  570



>ref|XP_009368838.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Pyrus x bretschneideri]
Length=576

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 3/54 (6%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGG--MQMES  238
            QGWLADNINYGRLDCFYGLL +L V+NFV Y++ A W   KT+K+    +QM S
Sbjct  520  QGWLADNINYGRLDCFYGLLTVLSVINFVAYLVCARW-SHKTHKQHAFVLQMAS  572



>ref|XP_010049997.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Eucalyptus grandis]
Length=580

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            TG G QGWLADNINYGRLDCFYGLL +L +VNFV Y++ A W + +   K  MQ E +
Sbjct  515  TGAG-QGWLADNINYGRLDCFYGLLTLLSLVNFVAYLVCAAWCKPQ-KLKPTMQKEKI  570



>gb|KCW82843.1| hypothetical protein EUGRSUZ_C04214 [Eucalyptus grandis]
Length=576

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            TG G QGWLADNINYGRLDCFYGLL +L +VNFV Y++ A W + +   K  MQ E +
Sbjct  511  TGAG-QGWLADNINYGRLDCFYGLLTLLSLVNFVAYLVCAAWCKPQ-KLKPTMQKEKI  566



>ref|XP_009778211.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=587

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = +2

Query  80   NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            ++GWLADNIN GRLD FY LLA+LGV+NFV+Y+I A W++ +   K  +QME+
Sbjct  525  DEGWLADNINNGRLDLFYWLLAVLGVINFVIYLICATWYKPR-KAKSAIQMEN  576



>gb|KHN34550.1| Nitrate transporter 1.4, partial [Glycine soja]
Length=272

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR-RKTNKKGGMQM  232
            R  QGWLAD+IN GRLD FY LL IL  VNFV + + AVWF+ +K  +   MQM
Sbjct  207  RDGQGWLADSINKGRLDLFYALLTILSFVNFVAFAVCAVWFKPKKPKQPAAMQM  260



>emb|CDP10398.1| unnamed protein product [Coffea canephora]
Length=578

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            +GWLAD INYGRLD FY LLA+LGV+NFV+Y I AVW++ K
Sbjct  517  EGWLADKINYGRLDLFYALLAVLGVINFVVYSICAVWYKPK  557



>ref|XP_004159415.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=623

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            QGWLADNINY RLDCFYGLL IL  +NFV +++ A+W++ +  K+  ++ME+
Sbjct  562  QGWLADNINYARLDCFYGLLTILSAINFVAFLVCAIWYKPQKPKQ-LLEMET  612



>ref|XP_004139418.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=623

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            QGWLADNINY RLDCFYGLL IL  +NFV +++ A+W++ +  K+  ++ME+
Sbjct  562  QGWLADNINYARLDCFYGLLTILSTINFVAFLVCAIWYKPQKPKQ-LLEMET  612



>ref|XP_010049998.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Eucalyptus 
grandis]
Length=580

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            G QGWLAD+INYGRLD F+GLL IL +VNFV+Y++ A W++ +   K  +QME +
Sbjct  517  GRQGWLADHINYGRLDWFFGLLTILSLVNFVVYLVCAAWYKPQ-KPKPTLQMEKI  570



>gb|KGN60671.1| hypothetical protein Csa_2G006170 [Cucumis sativus]
Length=581

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            QGWLADNINY RLDCFYGLL IL  +NFV +++ A+W++ +  K+  ++ME+
Sbjct  520  QGWLADNINYARLDCFYGLLTILSTINFVAFLVCAIWYKPQKPKQ-LLEMET  570



>ref|XP_010050000.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW82844.1| hypothetical protein EUGRSUZ_C04215 [Eucalyptus grandis]
Length=535

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            G QGWLAD+INYGRLD F+GLL IL +VNFV+Y++ A W++ +   K  +QME +
Sbjct  472  GRQGWLADHINYGRLDWFFGLLTILSLVNFVVYLVCAAWYKPQ-KPKPTLQMEKI  525



>gb|AFR11354.1| nitrate transporter [Cucumis sativus]
Length=581

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            QGWLADNINY RLDCFYGLL IL  +NFV +++ A+W++ +  K+  ++ME+
Sbjct  520  QGWLADNINYARLDCFYGLLTILSAINFVAFLVCAIWYKPQKPKQ-LLEMET  570



>ref|XP_008784904.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Phoenix dactylifera]
Length=589

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            GR   GWLADNINYGRLDCFYGLLA+L  VN   +++ A   + +T  K G+QMES
Sbjct  522  GREGNGWLADNINYGRLDCFYGLLAVLSAVNLGAFLLCAARTKPQT-PKAGVQMES  576



>ref|XP_008792049.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Phoenix 
dactylifera]
Length=585

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            G+   GWLADNINYGRLDCFYGLLA+L  +N   +++ A W + +  K  G+Q ES
Sbjct  520  GKHGNGWLADNINYGRLDCFYGLLAVLSAINLGAFLVCAAWSKPQAAKP-GLQTES  574



>emb|CDY30787.1| BnaC07g16870D [Brassica napus]
Length=601

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +2

Query  80   NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            N GWLADNIN+GRLD FY LLAIL  +NFV+YVI A+WF + T  K   +ME
Sbjct  541  NGGWLADNINHGRLDLFYWLLAILSGINFVVYVICALWF-KPTKGKDSEEME  591



>ref|XP_008792048.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Phoenix 
dactylifera]
Length=589

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            G+   GWLADNINYGRLDCFYGLLA+L  +N   +++ A W + +  K  G+Q ES
Sbjct  524  GKHGNGWLADNINYGRLDCFYGLLAVLSAINLGAFLVCAAWSKPQAAKP-GLQTES  578



>gb|KFK32490.1| hypothetical protein AALP_AA6G249500 [Arabis alpina]
Length=577

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            GWLADNIN+GRLDCFY LL IL  VNFV+Y+I A+WF+    K
Sbjct  519  GWLADNINHGRLDCFYWLLVILSGVNFVVYIICALWFKPTKGK  561



>ref|XP_009591623.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=583

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +2

Query  80   NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            ++GWLADNIN GRLD FY LLA+LGV+N V+Y+I A W++ +   K  +QME+
Sbjct  521  DEGWLADNINNGRLDLFYWLLAVLGVINIVIYLICATWYKPR-KPKSAIQMEN  572



>ref|XP_009591624.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=576

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +2

Query  80   NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            ++GWLADNIN GRLD FY LLA+LGV+N V+Y+I A W++ +   K  +QME+
Sbjct  514  DEGWLADNINNGRLDLFYWLLAVLGVINIVIYLICATWYKPR-KPKSAIQMEN  565



>ref|XP_004243154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
 ref|XP_010323568.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=569

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            QGWLADNINYGRLD FY LLA LGV+NF +Y+ SA W++ +  K
Sbjct  513  QGWLADNINYGRLDLFYWLLAALGVINFAIYLNSATWYKPRKPK  556



>ref|XP_010254380.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Nelumbo nucifera]
Length=578

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            QGWLADNIN GRLDCFYGLLA+   +NF+L+++  VW++++  ++  +Q+E
Sbjct  517  QGWLADNINDGRLDCFYGLLAVSSFINFLLFLLCTVWYKKQKPQR-SLQIE  566



>ref|XP_010254379.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Nelumbo nucifera]
Length=582

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            QGWLADNIN GRLDCFYGLLA+   +NF+L+++  VW++++  ++  +Q+E
Sbjct  521  QGWLADNINDGRLDCFYGLLAVSSFINFLLFLLCTVWYKKQKPQR-SLQIE  570



>ref|XP_009103552.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brassica rapa]
Length=577

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +2

Query  80   NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            N GWLADNIN+GRLD FY LL IL  +NFV+YVI A+WF + T  K   +ME
Sbjct  517  NGGWLADNINHGRLDLFYWLLVILSGINFVVYVICALWF-KPTKSKDSEEME  567



>emb|CDY45207.1| BnaA07g12830D, partial [Brassica napus]
Length=587

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +2

Query  80   NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            N GWLADNIN+GRLD FY LL IL  +NFV+YVI A+WF + T  K   +ME
Sbjct  527  NGGWLADNINHGRLDLFYWLLVILSGINFVVYVICALWF-KPTKSKDSEEME  577



>gb|KHN15097.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR-RKTNKKGGMQM  232
            R  QGWLAD+IN GRLD FY LL IL  VNFV + + AVWF+ +K  +   MQM
Sbjct  516  RDGQGWLADSINKGRLDLFYALLTILSFVNFVAFAVCAVWFKPKKPKQPAAMQM  569



>ref|XP_006408723.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
 gb|ESQ50176.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
Length=533

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            GWLADNIN GRLD FY LL IL  +NFV+YVI A+WF+    K+  ++ME
Sbjct  474  GWLADNINQGRLDRFYWLLVILSGINFVVYVICALWFKPTKGKEDSVEME  523



>ref|XP_006356754.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=580

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            QGWLADNINYGRLD FY LLA LGV+NF +Y+  A W++ +   K  + ME++
Sbjct  519  QGWLADNINYGRLDFFYWLLAALGVINFAIYLNCATWYKPR-KPKSAIPMETL  570



>ref|XP_006408724.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
 dbj|BAJ33792.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50177.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
Length=578

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            GWLADNIN GRLD FY LL IL  +NFV+YVI A+WF+    K+  ++ME
Sbjct  519  GWLADNINQGRLDRFYWLLVILSGINFVVYVICALWFKPTKGKEDSVEME  568



>emb|CAD33927.1| nitrate transporter [Cicer arietinum]
Length=201

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQM  232
            R  QGWLADNIN GRLD F+ LL IL  +NFV +++ A W++ K   K  MQM
Sbjct  137  RDGQGWLADNINKGRLDLFFALLTILSFINFVAFLVCAFWYKPK-KAKPSMQM  188



>ref|XP_006600752.1| PREDICTED: nitrate transporter 1.4-like [Glycine max]
Length=585

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 36/54 (67%), Gaps = 1/54 (2%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR-RKTNKKGGMQM  232
            R  QGWLAD+IN GRLD FY LL IL  VNF  + + AVWF+ +K  +   MQM
Sbjct  520  RDGQGWLADSINKGRLDLFYALLTILSFVNFAAFAVCAVWFKPKKPKQPAAMQM  573



>ref|XP_009397479.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            G+  QGWLADNINYGRLD FYGLLA L  +N   +++ A+W +++ N   G+QM S
Sbjct  517  GKNGQGWLADNINYGRLDYFYGLLAALSTLNMGAFLVCAMWIKQE-NPNQGLQMGS  571



>ref|XP_006483349.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Citrus sinensis]
Length=536

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKK  217
            G  GW+ +NIN GRLDCFYGLLA L  +NF L+++ A W++RK  K+
Sbjct  473  GKHGWVGENINKGRLDCFYGLLAALSFINFGLFLLCASWYKRKKAKQ  519



>emb|CDX71495.1| BnaC04g17300D [Brassica napus]
Length=600

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +2

Query  80   NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            N GWLADNIN+GRLD FY LL IL  +NFV+Y+I A+WF + T  K   +ME
Sbjct  540  NGGWLADNINHGRLDLFYWLLVILSGINFVVYLICALWF-KPTKGKDSEEME  590



>gb|KDO61703.1| hypothetical protein CISIN_1g008020mg [Citrus sinensis]
Length=581

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKK  217
            G  GW+ +NIN GRLDCFYGLLA L  +NF L+++ A W++RK  K+
Sbjct  518  GKHGWVGENINKGRLDCFYGLLAALSFINFGLFLLCASWYKRKKAKQ  564



>ref|XP_006483348.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
Length=581

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKK  217
            G  GW+ +NIN GRLDCFYGLLA L  +NF L+++ A W++RK  K+
Sbjct  518  GKHGWVGENINKGRLDCFYGLLAALSFINFGLFLLCASWYKRKKAKQ  564



>ref|XP_010533169.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            +G G QGWLADNIN+GRLD FY LLA+L  +N V+Y+I A WF+ +   KG ++M S
Sbjct  518  SGNG-QGWLADNINHGRLDRFYWLLAVLSGINIVVYMICAFWFKPRKG-KGAVEMAS  572



>ref|XP_010925226.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=588

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            G+   GWLADNIN GRLDCFYGLLA+LG VN   +++ A   + +T  + G+QMES
Sbjct  522  GKHGNGWLADNINNGRLDCFYGLLAVLGAVNLGAFLLCAARTKPQT-PQAGLQMES  576



>ref|XP_004508509.1| PREDICTED: nitrate transporter 1.4-like [Cicer arietinum]
Length=581

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            R  QGWLADNIN GRLD F+ LL IL  +NFV +++ A W++ K   K  MQM ++
Sbjct  517  RDGQGWLADNINKGRLDLFFALLTILSFINFVAFLVCAFWYKPK-KAKPSMQMGAI  571



>ref|XP_006450457.1| hypothetical protein CICLE_v10008198mg [Citrus clementina]
 gb|ESR63697.1| hypothetical protein CICLE_v10008198mg [Citrus clementina]
Length=467

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKK  217
            G  GW+ +NIN GRLDCFYGLLA L  +NF L+++ A W++RK  K+
Sbjct  404  GKHGWVGENINKGRLDCFYGLLAALSFINFGLFLLCASWYKRKKAKQ  450



>ref|XP_002880817.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57076.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
Length=577

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            GWLADNIN+GRLD FY LL IL  +NFV+Y+I A+WF+    K
Sbjct  519  GWLADNINHGRLDYFYWLLVILSGINFVVYIICALWFKPTKGK  561



>ref|XP_010688014.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Beta vulgaris subsp. 
vulgaris]
Length=589

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR--RKTNKKGGMQMES  238
            R  +GWLAD+INYG+LD FY LL +L ++NFV +++ A+WF+  +K N    M++ +
Sbjct  520  RNTEGWLADDINYGKLDYFYWLLTLLSLINFVAFMVCAIWFKPPKKNNNSISMKVSN  576



>ref|NP_850084.1| nitrate transporter 1.4 [Arabidopsis thaliana]
 sp|Q9SZY4.1|PTR27_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 6.2; Short=AtNPF6.2; AltName: 
Full=Nitrate transporter 1.4 [Arabidopsis thaliana]
 emb|CAB38705.1| nitrate transporter [Arabidopsis thaliana]
 gb|AEC07875.1| nitrate transporter 1.4 [Arabidopsis thaliana]
Length=577

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            GWLADNIN+GRLD FY LL IL  +NFV+Y+I A+WF+    K
Sbjct  519  GWLADNINHGRLDYFYWLLVILSGINFVVYIICALWFKPTKGK  561



>gb|AAM20651.1| putative nitrate transporter [Arabidopsis thaliana]
Length=577

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            GWLADNIN+GRLD FY LL IL  +NFV+Y+I A+WF+    K
Sbjct  519  GWLADNINHGRLDYFYWLLVILSGINFVVYIICALWFKPTKGK  561



>gb|AAB95302.1| putative nitrate transporter [Arabidopsis thaliana]
Length=586

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            GWLADNIN+GRLD FY LL IL  +NFV+Y+I A+WF+    K
Sbjct  528  GWLADNINHGRLDYFYWLLVILSGINFVVYIICALWFKPTKGK  570



>ref|XP_006837800.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
 gb|ERN00369.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
Length=576

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            G G  GWLAD+IN GRLDCFY LL+ L +VNF +Y+  A WF+ +   +  M+ME
Sbjct  511  GSGKGGWLADDINKGRLDCFYWLLSGLSLVNFAVYLWCAAWFKPRPPPQ-DMEME  564



>ref|XP_010510873.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510875.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510876.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510877.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
Length=577

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            GWLADNIN+GRLD FY LL IL  +NFV+Y I A+WF+    K
Sbjct  519  GWLADNINHGRLDYFYWLLVILSGINFVVYFICALWFKPTKGK  561



>ref|XP_003609313.1| Nitrate transporter [Medicago truncatula]
 gb|AES91510.1| peptide/nitrate transporter [Medicago truncatula]
Length=577

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            R  QGWLAD+IN GRLD FY LL IL  +NFV +++ A W++ K  K
Sbjct  516  RDGQGWLADHINKGRLDLFYALLTILSFINFVAFLVCAFWYKPKKPK  562



>ref|XP_006293915.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
 gb|EOA26813.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
Length=570

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            GWLADNIN+GRLD FY LL IL  +NFV Y I A+WF+    K
Sbjct  512  GWLADNINHGRLDYFYWLLVILSGINFVAYFICALWFKPTKGK  554



>ref|XP_010914872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=582

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            G+   GWLAD+IN+GRLDCFY LLA+L  +N   +++SA W + +  K
Sbjct  523  GKHGNGWLADDINHGRLDCFYWLLAVLSAINLGAFIVSAAWTKPQAAK  570



>ref|XP_010473052.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            GWLADNIN+GRLD FY LL IL  +NF +Y I A+WF+    K
Sbjct  519  GWLADNINHGRLDYFYWLLVILSGINFGVYFICALWFKPTKGK  561



>ref|XP_010417814.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            GWLADNIN+GRLD FY LL IL  +NF +Y I A+WF+    K
Sbjct  519  GWLADNINHGRLDYFYWLLVILSGINFGVYFICALWFKPTKGK  561



>ref|XP_010510874.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Camelina 
sativa]
Length=577

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            GWLADNIN+GRLD FY LL IL  +NF +Y I A+WF+    K
Sbjct  519  GWLADNINHGRLDYFYWLLVILSGINFGVYFICALWFKPTKGK  561



>ref|XP_010324989.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Solanum 
lycopersicum]
Length=544

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWF  196
            T   N GW+ ++IN GRLDCFYGLLAIL  ++F  YV+ A W+
Sbjct  496  TANINNGWVGESINKGRLDCFYGLLAILIFIDFGFYVLCASWY  538



>ref|XP_004245323.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Solanum 
lycopersicum]
Length=564

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWF  196
            T   N GW+ ++IN GRLDCFYGLLAIL  ++F  YV+ A W+
Sbjct  516  TANINNGWVGESINKGRLDCFYGLLAILIFIDFGFYVLCASWY  558



>ref|XP_011093558.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Sesamum indicum]
Length=571

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKK  217
            G Q WL  N+N+GRLD FYGL+A+L  +N   Y++SA WF  K  ++
Sbjct  519  GRQNWLPANLNHGRLDLFYGLIALLSAINLGFYLLSAKWFLCKKTQR  565



>gb|EPS59108.1| hypothetical protein M569_15702, partial [Genlisea aurea]
Length=523

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            + RG  GWLA NI+ GRLDCFYGLLA LG +NF +Y++ A  ++ +  K
Sbjct  469  SSRG--GWLAGNIDRGRLDCFYGLLAALGGLNFAVYLVCAAKYKYQKPK  515



>ref|XP_008794846.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=606

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +2

Query  68   TGRGNQG-WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            TG G  G WL D++N G+L  FY LLA+L +VNF +Y++SA W+  K  +    ++ESM
Sbjct  534  TGEGGHGAWLTDDLNRGKLYNFYWLLAVLSLVNFGVYLVSAWWYVPKEGQAAAAEVESM  592



>ref|XP_008807862.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Phoenix dactylifera]
Length=595

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G + WLA ++N GRLD FY L+AI+GV+NF+++++ A W+R K
Sbjct  529  GKENWLAGDLNRGRLDYFYFLIAIIGVLNFMVFIVCAKWYRYK  571



>ref|XP_010933675.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Elaeis guineensis]
Length=580

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G + WLA+++N GRLD FY L+A++GVVNF L++  A W+R K
Sbjct  520  GKENWLAEDLNKGRLDLFYVLIAVIGVVNFFLFLAFAKWYRYK  562



>ref|XP_009407665.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=575

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVW  193
            WLADNINYGRLDCFYGLLA L  +N   +++ A W
Sbjct  523  WLADNINYGRLDCFYGLLAGLSTMNLGAFLVCAGW  557



>ref|XP_010678901.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Beta vulgaris 
subsp. vulgaris]
Length=596

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK--TNKKGGMQMES  238
            G Q WL+D++N GRLD FY LLA L  +NF  ++  ++W++ K  +N+K G  +ES
Sbjct  533  GKQNWLSDDLNKGRLDYFYYLLAALSTLNFAYFLTVSMWYKYKDSSNQKPGTDVES  588



>ref|XP_002303512.2| nitrate transporter family protein [Populus trichocarpa]
 gb|EEE78491.2| nitrate transporter family protein [Populus trichocarpa]
Length=583

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  80   NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            N+ WLADN+N GRL  FY LLAIL  +NFV+Y+I A W+  K  +
Sbjct  522  NKPWLADNLNQGRLHDFYWLLAILSALNFVIYLICARWYVYKDKR  566



>ref|XP_008807861.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Phoenix dactylifera]
Length=583

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G + WLA+++N GRLD FY L+A++GV+NF L++  A W+R K
Sbjct  523  GKENWLAEDLNKGRLDLFYILIAVIGVINFFLFLAFAKWYRYK  565



>ref|XP_004490642.1| PREDICTED: peptide transporter PTR1-like [Cicer arietinum]
Length=570

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G  GWL DN+NYGRLDCF+ LLA L VVNFV +++ + ++  K
Sbjct  521  GGPGWLPDNLNYGRLDCFFWLLAGLSVVNFVAFLVVSRFYTYK  563



>gb|KDP25643.1| hypothetical protein JCGZ_20799 [Jatropha curcas]
Length=583

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +2

Query  80   NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKG--GMQMESM  241
            N+ WLADN+N GRL  FY LLAIL  +NFV++  S+ W+  K  + G  G++ME +
Sbjct  522  NKPWLADNLNQGRLYDFYWLLAILSALNFVIFFASSKWYVYKDKRLGEVGIEMEEL  577



>ref|XP_002461612.1| hypothetical protein SORBIDRAFT_02g005420 [Sorghum bicolor]
 gb|EER98133.1| hypothetical protein SORBIDRAFT_02g005420 [Sorghum bicolor]
Length=651

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G+ GWLA+N+N G+LD FY L+A +G VNF +++  A W+R K
Sbjct  564  GDDGWLAENLNRGKLDWFYFLIAFIGAVNFFVFLACAKWYRYK  606



>ref|XP_002517463.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45005.1| nitrate transporter, putative [Ricinus communis]
Length=532

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQM  232
            G   + WLA+++N GRLD FY ++A+LGVVNFV +++ A W++ K N    +Q+
Sbjct  472  GSNGRDWLAEDLNKGRLDYFYYMIAVLGVVNFVYFLVVAKWYKYKGNNTDEIQV  525



>ref|XP_006361731.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=599

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  80   NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWF  196
            N GW+ ++IN  RLDCFYGLLAIL  ++F  YV+ A W+
Sbjct  521  NNGWVGESINKSRLDCFYGLLAILIFIDFGFYVLCASWY  559



>ref|XP_006848110.1| hypothetical protein AMTR_s00029p00215100 [Amborella trichopoda]
 gb|ERN09691.1| hypothetical protein AMTR_s00029p00215100 [Amborella trichopoda]
Length=600

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+NYG +D  + LLAIL ++NFV+Y+  A W++ K
Sbjct  548  TTNGKPGWIPDNLNYGHIDYLFWLLAILSLINFVVYLFIANWYKYK  593



>ref|XP_002517444.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF44986.1| nitrate transporter, putative [Ricinus communis]
Length=589

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +2

Query  68   TGRGNQG-WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            T R   G WLA+++N G+LDCFY ++A LG +NF  +++ A W+R K N        SM
Sbjct  520  TARSQHGDWLAEDLNKGKLDCFYYMIAALGFLNFCYFLVFAKWYRYKDNNIASTSEFSM  578



>ref|XP_009413298.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Musa acuminata 
subsp. malaccensis]
Length=568

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = +2

Query  68   TGRG-NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            TGRG ++ WLA+++N G+LD FY  +A+LGV+NF+ +   A W+R K
Sbjct  521  TGRGQSKNWLAEDLNKGKLDLFYFSIAVLGVLNFIYFAACAKWYRYK  567



>gb|EMT14752.1| Peptide transporter PTR2 [Aegilops tauschii]
Length=582

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            T  G Q WLA ++N GRLD FY ++A +GV NFV ++I A W+R K  +
Sbjct  532  TTGGGQNWLAQDLNKGRLDLFYWMIAGIGVFNFVYFMICARWYRFKGTR  580



>ref|XP_009374282.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009374283.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X1 [Pyrus 
x bretschneideri]
Length=582

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  GN GW+ DN+NYG LD F+ LLA+L V+N V+Y+  + W+  K
Sbjct  530  TKDGNPGWIPDNLNYGHLDYFFWLLAMLSVLNLVVYLFISKWYTYK  575



>ref|XP_009374278.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Pyrus x bretschneideri]
 ref|XP_009374279.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Pyrus x bretschneideri]
Length=582

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  GN GW+ DN+NYG LD F+ LLA+L V+N V+Y+  + W+  K
Sbjct  530  TKDGNPGWIPDNLNYGHLDYFFWLLAMLSVLNLVVYLFISKWYTYK  575



>emb|CCN27382.1| low affinity nitrate transporter, partial [Triticum aestivum]
Length=143

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKG  220
            RG   WL D IN+ RLD FY LLA+LG +N   Y++ A+W     + K 
Sbjct  82   RGATTWLGDTINHSRLDYFYWLLAVLGAINLAAYLLCAMWATPAASSKA  130



>dbj|BAJ86984.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=598

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G QGW+ DN+N G LD F+ LLA L +VNF +Y++ A W+  K
Sbjct  540  GKQGWIPDNLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTYK  582



>ref|XP_010923294.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Elaeis guineensis]
Length=597

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKG  220
            G   WLA ++N GRLD FY L+A++GVV+F+ +++ A W+R K  + G
Sbjct  530  GKDNWLASDLNQGRLDYFYYLIALMGVVDFLFFIVFANWYRYKGLEDG  577



>ref|XP_011033951.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like, partial [Populus 
euphratica]
Length=505

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  80   NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            N+ WLADN+N GRL  FY L+AIL  +NFV+Y+I A W+  K  +     +E
Sbjct  444  NKPWLADNLNQGRLHDFYWLVAILSALNFVIYLICARWYVSKDERLAAEGIE  495



>ref|XP_009374284.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X2 [Pyrus 
x bretschneideri]
Length=541

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  GN GW+ DN+NYG LD F+ LLA+L V+N V+Y+  + W+  K
Sbjct  489  TKDGNPGWIPDNLNYGHLDYFFWLLAMLSVLNLVVYLFISKWYTYK  534



>ref|XP_002978415.1| hypothetical protein SELMODRAFT_233150 [Selaginella moellendorffii]
 gb|EFJ20401.1| hypothetical protein SELMODRAFT_233150 [Selaginella moellendorffii]
Length=545

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQ  229
            +G +GWL DN+N  RL  FY LLA L   N + YV  A+W+RR+    G ++
Sbjct  479  KGGEGWLPDNLNRSRLRDFYWLLACLSTANLINYVFWALWYRRRELADGELR  530



>ref|XP_004959036.1| PREDICTED: LOW QUALITY PROTEIN: probable peptide/nitrate transporter 
At3g47960-like [Setaria italica]
Length=583

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQ  229
            G+ GWLA+++N G+LD FY L+  +G  NF+ +++ A W+R K    GG Q
Sbjct  505  GDDGWLAEDLNRGKLDSFYFLIGFVGAANFLAFLLCAKWYRYKGMDGGGEQ  555



>dbj|BAJ94405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            TG G Q WLA ++N GRLD FY ++A +GV NFV ++I A W+R K  +
Sbjct  552  TGAG-QNWLAQDLNKGRLDLFYWMIAGIGVFNFVYFMICARWYRFKGTR  599



>dbj|BAJ96711.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            TG G Q WLA ++N GRLD FY ++A +GV NFV ++I A W+R K  +
Sbjct  552  TGAG-QNWLAQDLNKGRLDLFYWMIAGIGVFNFVYFMICARWYRFKGTR  599



>dbj|BAJ91141.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            TG G Q WLA ++N GRLD FY ++A +GV NFV ++I A W+R K  +
Sbjct  552  TGAG-QNWLAQDLNKGRLDLFYWMIAGIGVFNFVYFMICARWYRFKGTR  599



>gb|AFW80908.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=587

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVW  193
            WL D IN+ RLD FY LLA+LGVVN V Y++ A+W
Sbjct  531  WLGDTINHSRLDYFYWLLAVLGVVNLVAYIVYAMW  565



>ref|NP_001169613.1| uncharacterized protein LOC100383494 [Zea mays]
 gb|ACN34269.1| unknown [Zea mays]
 gb|AFW80907.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=591

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVW  193
            WL D IN+ RLD FY LLA+LGVVN V Y++ A+W
Sbjct  535  WLGDTINHSRLDYFYWLLAVLGVVNLVAYIVYAMW  569



>ref|XP_011033950.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Populus euphratica]
Length=583

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  80   NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            N+ WLADN+N GRL  FY L+AIL  +NFV+Y+I A W+  K
Sbjct  522  NKPWLADNLNQGRLHDFYWLVAILSALNFVIYLICARWYVYK  563



>ref|XP_003568460.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Brachypodium distachyon]
 ref|XP_010230444.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Brachypodium distachyon]
Length=595

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/52 (46%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGG  223
            T  GN GW+ DN+N G LD F+ LLA L V NF +Y++ A W+  K   + G
Sbjct  526  TKGGNVGWIPDNLNVGHLDYFFWLLAALSVANFAVYLVIASWYTYKKTAEDG  577



>ref|XP_003561175.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Brachypodium distachyon]
Length=588

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            TG G Q WLA ++N GRLD FY ++A +GV NFV ++I A W+R K
Sbjct  540  TGAG-QNWLAQDLNKGRLDLFYWMIAGIGVFNFVYFMICARWYRFK  584



>dbj|BAK08097.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            TG G Q WLA ++N GRLD FY ++A +GV NFV ++I A W+R K  +
Sbjct  552  TGAG-QNWLAQDLNKGRLDLFYWMIAGIGVFNFVYFMICARWYRFKGTR  599



>ref|XP_002276806.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11 [Vitis vinifera]
 emb|CBI35037.3| unnamed protein product [Vitis vinifera]
Length=585

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMES  238
            WL +++N G+LDCFY ++A LG VNF  +++ + W+R K   +  + ME+
Sbjct  528  WLPEDLNKGKLDCFYYMIAALGAVNFAYFLVCSKWYRYKGGDRVEVAMET  577



>ref|XP_004972811.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Setaria italica]
Length=595

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGG  223
              W+AD++N GRLD FY LLA++ +VN ++Y+++A W++ K  + G 
Sbjct  537  HAWIADDLNKGRLDNFYWLLAVICLVNLLVYLVAARWYKYKAGRPGA  583



>ref|XP_004972812.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Setaria italica]
Length=582

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGG  223
              W+AD++N GRLD FY LLA++ +VN ++Y+++A W++ K  + G 
Sbjct  524  HAWIADDLNKGRLDNFYWLLAVICLVNLLVYLVAARWYKYKAGRPGA  570



>ref|XP_008808100.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 [Phoenix dactylifera]
 ref|XP_008808101.1| PREDICTED: protein NRT1/ PTR FAMILY 7.2 [Phoenix dactylifera]
Length=601

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR  199
            +G  N GW+  N+N+G LD FY LL IL  V+F+LYV+ A W++
Sbjct  541  SGDKNPGWIPGNLNHGHLDRFYFLLVILTAVDFILYVVCAKWYK  584



>ref|XP_008670500.1| PREDICTED: uncharacterized protein LOC100191680 isoform X1 [Zea 
mays]
 gb|ACN34612.1| unknown [Zea mays]
 gb|ACR36295.1| unknown [Zea mays]
 tpg|DAA50698.1| TPA: hypothetical protein ZEAMMB73_457708 [Zea mays]
Length=589

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            TG G Q WLA ++N GRLD FY  +A +GV NF+ +VI A W+R K
Sbjct  541  TGSG-QNWLAQDLNKGRLDLFYWTIAGIGVFNFIYFVICARWYRFK  585



>dbj|BAK03852.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=629

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G QGW+ DN+N G LD F+ LLA L +VNF +Y++ A W+  K
Sbjct  571  GKQGWIPDNLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTYK  613



>ref|XP_009591017.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana tomentosiformis]
Length=572

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+NYG LD FY LLA+L V+N  +Y++ A W+  K
Sbjct  520  TKNGKPGWIPDNLNYGHLDYFYYLLAVLSVLNLGVYLMIAKWYTYK  565



>ref|XP_006848107.1| hypothetical protein AMTR_s00029p00214340 [Amborella trichopoda]
 gb|ERN09688.1| hypothetical protein AMTR_s00029p00214340 [Amborella trichopoda]
Length=567

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G  GW+ DN+NYG +D F+ LLAIL V+NFV+Y+  A W+  K
Sbjct  518  GKPGWIPDNLNYGHVDYFFWLLAILSVINFVVYLGIANWYTYK  560



>ref|XP_006350821.1| PREDICTED: peptide transporter PTR1-like [Solanum tuberosum]
Length=574

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+NYG +D FY LLA+L V+N  +Y++ A W+  K
Sbjct  522  TKNGKPGWIPDNLNYGHIDYFYHLLAVLSVLNLGVYLVIAKWYTYK  567



>ref|XP_009408470.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like [Musa acuminata 
subsp. malaccensis]
Length=615

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G G  GWL DNIN GR+D FY ++A+LGV N + +++ A ++R K
Sbjct  548  GEGRTGWLDDNINVGRVDYFYYMVALLGVANLLYFLVCAHFYRYK  592



>ref|XP_006643742.1| PREDICTED: peptide transporter PTR1-like [Oryza brachyantha]
Length=582

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+N G LD F+ LLA+L ++NFV+Y++ A W+  K
Sbjct  520  TKNGAVGWIPDNLNRGHLDYFFWLLAVLSLINFVVYLVIASWYTYK  565



>ref|XP_004241180.2| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Solanum lycopersicum]
Length=655

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+NYG +D FY LLA+L V+N  +Y++ A W+  K
Sbjct  603  TKNGKPGWIPDNLNYGHIDYFYYLLAVLSVLNLGVYLVIAKWYTYK  648



>ref|XP_002459192.1| hypothetical protein SORBIDRAFT_02g000260 [Sorghum bicolor]
 gb|EER95713.1| hypothetical protein SORBIDRAFT_02g000260 [Sorghum bicolor]
Length=585

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+N G LD F+ LL++L V+NFV+Y+  A W+R K
Sbjct  529  TRNGGLGWIPDNLNRGHLDYFFWLLSVLSVINFVVYLWIAKWYRYK  574



>gb|KDO46677.1| hypothetical protein CISIN_1g006712mg [Citrus sinensis]
Length=540

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            +G   WLA NIN GR D  Y LLA+L V+NF  ++ SA  ++ ++ +K G   E M
Sbjct  476  KGQPNWLAQNINTGRFDYLYWLLAVLSVINFCAFLYSAYRYKYRSEQKHGNDYEVM  531



>gb|KDO46676.1| hypothetical protein CISIN_1g006712mg [Citrus sinensis]
Length=549

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            +G   WLA NIN GR D  Y LLA+L V+NF  ++ SA  ++ ++ +K G   E M
Sbjct  485  KGQPNWLAQNINTGRFDYLYWLLAVLSVINFCAFLYSAYRYKYRSEQKHGNDYEVM  540



>ref|XP_006487564.1| PREDICTED: probable peptide/nitrate transporter At5g13400-like 
isoform X1 [Citrus sinensis]
Length=634

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            +G   WLA NIN GR D  Y LLA+L V+NF  ++ SA  ++ ++ +K G   E M
Sbjct  570  KGQPNWLAQNINTGRFDYLYWLLAVLSVINFCAFLYSAYRYKYRSEQKHGNDYEVM  625



>ref|XP_006420818.1| hypothetical protein CICLE_v10004541mg [Citrus clementina]
 gb|ESR34058.1| hypothetical protein CICLE_v10004541mg [Citrus clementina]
 gb|KDO46672.1| hypothetical protein CISIN_1g006712mg [Citrus sinensis]
 gb|KDO46673.1| hypothetical protein CISIN_1g006712mg [Citrus sinensis]
Length=634

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            +G   WLA NIN GR D  Y LLA+L V+NF  ++ SA  ++ ++ +K G   E M
Sbjct  570  KGQPNWLAQNINTGRFDYLYWLLAVLSVINFCAFLYSAYRYKYRSEQKHGNDYEVM  625



>gb|KDO46674.1| hypothetical protein CISIN_1g006712mg [Citrus sinensis]
Length=605

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            +G   WLA NIN GR D  Y LLA+L V+NF  ++ SA  ++ ++ +K G   E M
Sbjct  541  KGQPNWLAQNINTGRFDYLYWLLAVLSVINFCAFLYSAYRYKYRSEQKHGNDYEVM  596



>ref|XP_002970257.1| hypothetical protein SELMODRAFT_231569 [Selaginella moellendorffii]
 gb|EFJ28387.1| hypothetical protein SELMODRAFT_231569 [Selaginella moellendorffii]
Length=545

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRR  202
            +G +GWL DN+N  RL  FY LLA L   N + YV  A+W+RR
Sbjct  479  KGGEGWLPDNLNRSRLRDFYWLLACLSTANLINYVFWALWYRR  521



>ref|XP_006420817.1| hypothetical protein CICLE_v10004541mg [Citrus clementina]
 gb|ESR34057.1| hypothetical protein CICLE_v10004541mg [Citrus clementina]
 gb|KDO46685.1| hypothetical protein CISIN_1g006712mg [Citrus sinensis]
Length=556

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            +G   WLA NIN GR D  Y LLA+L V+NF  ++ SA  ++ ++ +K G   E M
Sbjct  492  KGQPNWLAQNINTGRFDYLYWLLAVLSVINFCAFLYSAYRYKYRSEQKHGNDYEVM  547



>ref|XP_004972110.1| PREDICTED: peptide transporter PTR1-like [Setaria italica]
Length=584

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+N G LD F+ LL++L V+NF++Y++ A W++ K
Sbjct  529  TRNGGLGWIPDNLNRGHLDYFFWLLSLLSVINFLVYLLIAKWYKYK  574



>ref|XP_010933709.1| PREDICTED: protein NRT1/ PTR FAMILY 2.9-like [Elaeis guineensis]
Length=597

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKG  220
            G + WL  ++N GRL+ FY L+AI+GV+NF+++++ A W+R K  + G
Sbjct  531  GKENWLDGDLNKGRLEYFYYLIAIIGVLNFMVFIVCAKWYRYKGLEDG  578



>gb|AFN53657.1| putative peptide transporter [Linum usitatissimum]
Length=571

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+NYG +D F+ LLA+L VVN + Y++ A W+  K
Sbjct  519  TKGGKPGWIPDNLNYGHVDYFFWLLAVLSVVNLMAYMVIASWYTYK  564



>ref|XP_010676154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Beta vulgaris subsp. 
vulgaris]
Length=599

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            W+ADN+N GRLD FY LLA L VVNF++Y++ A W+  K  +
Sbjct  541  WIADNLNQGRLDYFYWLLAGLSVVNFLVYLVFAKWYIYKETR  582



>ref|XP_002986344.1| hypothetical protein SELMODRAFT_425373 [Selaginella moellendorffii]
 gb|EFJ12553.1| hypothetical protein SELMODRAFT_425373 [Selaginella moellendorffii]
Length=584

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G G+ GW+A+N+N  RLD FY LLA++   N VLY+I A W++ +
Sbjct  527  GGGSGGWIANNLNRSRLDDFYWLLAVVSSANLVLYLICARWYKYR  571



>ref|XP_008448872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Cucumis melo]
Length=593

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            GN+ WLADN+N G+L  FY LLAIL  +NF +Y++ A W+  K  +
Sbjct  531  GNKPWLADNLNQGKLYNFYWLLAILSTLNFGIYLVCAKWYVYKDKR  576



>ref|NP_001275529.1| nitrate transporter 1.1-like [Cucumis sativus]
 ref|XP_004163647.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 gb|ADQ74763.1| nitrate transporter 1.1 [Cucumis sativus]
 gb|KGN55889.1| hypothetical protein Csa_3G027720 [Cucumis sativus]
Length=593

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            GN+ WLADN+N G+L  FY LLAIL  +NF +Y++ A W+  K  +
Sbjct  531  GNKPWLADNLNQGKLYDFYWLLAILSALNFGIYLVCAKWYVYKDKR  576



>ref|XP_004968169.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Setaria 
italica]
 ref|XP_004968170.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Setaria 
italica]
 ref|XP_004968171.1| PREDICTED: peptide transporter PTR1-like isoform X3 [Setaria 
italica]
 ref|XP_004968172.1| PREDICTED: peptide transporter PTR1-like isoform X4 [Setaria 
italica]
Length=578

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+N G LD F+ LLA+L ++NF++Y++ A W++ K
Sbjct  517  TRHGKLGWIPDNLNLGHLDYFFWLLAVLSLLNFLVYLVIASWYKYK  562



>ref|XP_006838787.1| hypothetical protein AMTR_s00002p00259170 [Amborella trichopoda]
 gb|ERN01356.1| hypothetical protein AMTR_s00002p00259170 [Amborella trichopoda]
Length=597

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +2

Query  68   TGR-GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            TG+ G+  WL +N+N GRLD FY  +A +GVVN V +++ A W+R K
Sbjct  521  TGKNGHPNWLENNLNLGRLDLFYYFIAGMGVVNLVYFMVCAKWYRYK  567



>ref|XP_008345515.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Malus domestica]
Length=568

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            GN GW+ DN+N G LD FY LLA+L V+NF++Y+  A WF  K
Sbjct  519  GNLGWIPDNLNRGHLDYFYWLLAVLSVINFLVYLWIAKWFTYK  561



>ref|XP_002979108.1| hypothetical protein SELMODRAFT_444106 [Selaginella moellendorffii]
 gb|EFJ20065.1| hypothetical protein SELMODRAFT_444106 [Selaginella moellendorffii]
Length=584

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G G+ GW+ +N+N  RLD FY LLA++  VN VLY+I A W++ +
Sbjct  527  GGGSGGWIVNNLNRSRLDDFYWLLAVVSSVNLVLYLICARWYKYR  571



>ref|XP_004968920.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Setaria italica]
Length=590

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVW  193
            +G   WL D IN+ RLD FY LLA+L VVN V Y++ A+W
Sbjct  529  KGCTTWLGDTINHSRLDYFYWLLAVLSVVNLVAYLVCAMW  568



>dbj|BAJ95903.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89261.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=579

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G QGW+ DN+N G LD F+ LLA L +VNF +Y++ A W+  K
Sbjct  521  GKQGWIPDNLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTYK  563



>gb|KDO46675.1| hypothetical protein CISIN_1g006712mg [Citrus sinensis]
Length=597

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            +G   WLA NIN GR D  Y LLA+L V+NF  ++ SA  ++ ++ +K G   E M
Sbjct  533  KGQPNWLAQNINTGRFDYLYWLLAVLSVINFCAFLYSAYRYKYRSEQKHGNDYEVM  588



>gb|EMT23542.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=630

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVW  193
            RG   WL D IN+ RLD FY LLA+LG +N   Y++ A+W
Sbjct  569  RGATTWLGDTINHSRLDYFYWLLAVLGAINLAAYLLCAMW  608



>gb|EPS69660.1| hypothetical protein M569_05105, partial [Genlisea aurea]
Length=578

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            TG G  GW+ DN+N G LD FY L+A L  +NFV+YV  A W++ K
Sbjct  526  TGEGKLGWIPDNLNRGHLDYFYWLVAGLSSLNFVVYVAIARWYKYK  571



>ref|XP_008355414.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Malus domestica]
Length=582

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  GN GW+ DN+NYG LD F+ LLA+L  +N V+Y+  + W+  K
Sbjct  530  TKDGNPGWIPDNLNYGHLDYFFWLLAMLSFLNLVVYLFISKWYTYK  575



>ref|XP_009779291.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
 ref|XP_009779292.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nicotiana sylvestris]
Length=572

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+NYG LD FY LLA+L V+N   Y++ A W+  K
Sbjct  520  TKNGKPGWIPDNLNYGHLDYFYYLLAVLSVLNLGAYLMIAKWYTYK  565



>ref|XP_008355088.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 8.2-like 
[Malus domestica]
Length=582

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  GN GW+ DN+NYG LD F+ LLA+L  +N V+Y+  + W+  K
Sbjct  530  TKDGNPGWIPDNLNYGHLDYFFWLLAMLSFLNLVVYLFISKWYTYK  575



>gb|AAC32034.1| peptide transporter [Hordeum vulgare subsp. vulgare]
Length=579

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G QGW+ DN+N G LD F+ LLA L +VNF +Y++ A W+  K
Sbjct  521  GKQGWIPDNLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTYK  563



>ref|XP_006420815.1| hypothetical protein CICLE_v10004541mg [Citrus clementina]
 ref|XP_006420816.1| hypothetical protein CICLE_v10004541mg [Citrus clementina]
 gb|ESR34055.1| hypothetical protein CICLE_v10004541mg [Citrus clementina]
 gb|ESR34056.1| hypothetical protein CICLE_v10004541mg [Citrus clementina]
 gb|KDO46688.1| hypothetical protein CISIN_1g006712mg [Citrus sinensis]
Length=476

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            +G   WLA NIN GR D  Y LLA+L V+NF  ++ SA  ++ ++ +K G   E M
Sbjct  412  KGQPNWLAQNINTGRFDYLYWLLAVLSVINFCAFLYSAYRYKYRSEQKHGNDYEVM  467



>dbj|BAJ91595.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=402

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKK  217
            G QGW+ DN+N G LD F+ LLA L +VNF +Y++ A W+  K   +
Sbjct  344  GKQGWIPDNLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTYKKTAE  390



>emb|CDM81075.1| unnamed protein product [Triticum aestivum]
Length=545

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G QGW+ DN+N G LD F+ LLA L ++NF +Y++ A W+  K
Sbjct  485  GKQGWIPDNLNVGHLDYFFWLLAALSLLNFAVYLLIASWYTYK  527



>ref|XP_009400863.1| PREDICTED: protein NRT1/ PTR FAMILY 2.11-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/49 (43%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKK  217
            G     WLA+++N GRLD  Y  +A +  VNFV +++ A W+R KT+ K
Sbjct  524  GHQKSNWLAEDLNQGRLDLLYFSIASISAVNFVFFIVCAKWYRYKTSDK  572



>gb|KDO46686.1| hypothetical protein CISIN_1g006712mg [Citrus sinensis]
Length=499

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            +G   WLA NIN GR D  Y LLA+L V+NF  ++ SA  ++ ++ +K G   E M
Sbjct  435  KGQPNWLAQNINTGRFDYLYWLLAVLSVINFCAFLYSAYRYKYRSEQKHGNDYEVM  490



>dbj|BAJ90833.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 29/52 (56%), Gaps = 0/52 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQ  229
            RG   WL D IN+ RLD FY LLA+LG +N   Y++ A+W       K   Q
Sbjct  516  RGATTWLGDTINHSRLDYFYWLLAVLGALNLAAYLLCAMWATPAAGSKAEQQ  567



>ref|XP_006658355.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like, 
partial [Oryza brachyantha]
Length=439

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            WLAD++N GRLDCFY L+A +G  NF+ ++  A W+R K
Sbjct  377  WLADDLNRGRLDCFYLLIAAIGAANFLAFLACAKWYRYK  415



>gb|AHV83614.1| nitrate transporter [Camellia sinensis]
Length=605

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            G  GWL +++N GRLD FY L+AILG +N   +++ ++W+R K      + +E
Sbjct  531  GTGGWLTEDLNKGRLDYFYYLVAILGAINLGYFLVCSMWYRYKGTTDSTVMVE  583



>ref|XP_008675518.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Zea mays]
 tpg|DAA59044.1| TPA: hypothetical protein ZEAMMB73_584071 [Zea mays]
Length=591

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            WL D IN+ RLD FY LLA+L VVN V Y++ A+W    T+ +      +M
Sbjct  535  WLGDTINHSRLDYFYWLLAVLSVVNLVAYLVCAMWATAPTSSQAEQPQPAM  585



>ref|XP_008388132.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like [Malus domestica]
Length=568

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            GN GW+ DN+N G LD FY LLAIL V+NF++Y+  A W+  K
Sbjct  519  GNLGWIPDNLNRGHLDYFYWLLAILSVINFLVYLWIAKWYTYK  561



>ref|XP_008775060.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Phoenix dactylifera]
Length=576

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 2/56 (4%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            T  G  GW+ DN+N G LD F+ LLAIL VVNF++Y++ A W+  K  K  G   E
Sbjct  521  TRNGKLGWIPDNLNRGHLDYFFWLLAILSVVNFLVYLLIAKWYSYK--KTAGDDTE  574



>emb|CBI30424.3| unnamed protein product [Vitis vinifera]
Length=1454

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  68    TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
             T  G  GW+ DN+N G LD FY LLAIL ++NF++Y+  A W+  K
Sbjct  1150  TRNGKMGWIPDNMNRGHLDYFYWLLAILSLLNFLVYLWIAKWYTYK  1195



>gb|KDD76324.1| proton-dependent oligopeptide transporter [Helicosporidium sp. 
ATCC 50920]
Length=632

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLY-VISAVWFRRKT  208
            TG G  GW+ADN+N G LD F+ LLA+LG +   +Y V  A W+  +T
Sbjct  500  TGGGAPGWVADNLNQGHLDYFFALLAVLGAITLCIYAVFVAPWYTYRT  547



>ref|XP_009358875.1| PREDICTED: uncharacterized protein LOC103949485 [Pyrus x bretschneideri]
Length=1143

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  77    GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
             GN GW+ DN+N G LD FY LLAIL V+NF++Y+  A W+  K
Sbjct  1094  GNLGWIPDNLNRGHLDYFYWLLAILSVINFLVYLWIAKWYTYK  1136



>ref|NP_001130360.1| uncharacterized protein LOC100191455 [Zea mays]
 gb|ACF78551.1| unknown [Zea mays]
Length=591

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            TG G Q WLA ++N GRLD FY  +A +GV N + +VI A W+R K
Sbjct  543  TGSG-QNWLAQDLNKGRLDLFYWTIAGIGVFNLIYFVICARWYRFK  587



>ref|XP_002463917.1| hypothetical protein SORBIDRAFT_01g008885 [Sorghum bicolor]
 gb|EER90915.1| hypothetical protein SORBIDRAFT_01g008885 [Sorghum bicolor]
Length=568

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            R + GW++D+IN GRLD FY  +A+LG VNFV +++ + ++R K  +
Sbjct  500  RRHGGWVSDDINAGRLDYFYYAMAVLGAVNFVYFLVCSHFYRYKAEQ  546



>ref|XP_003566777.2| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brachypodium distachyon]
Length=627

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVW  193
            +G   WL D IN+ RLD FY LLA+LG VN   Y++ A+W
Sbjct  567  KGATTWLGDTINHSRLDYFYWLLAVLGAVNLAAYLLCAMW  606



>ref|XP_002443879.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
 gb|EES13374.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
Length=601

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGG  223
            W+AD++N GRLD FY LLA++ + N ++Y+++A W++ K  + G 
Sbjct  541  WIADDLNKGRLDNFYWLLAVICLANLLVYLVAARWYKYKAGRPGA  585



>ref|XP_009405229.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
Length=577

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ D+++ G LD F+GLLA+L +VNF +Y++ A W+  K
Sbjct  517  TKNGKPGWIPDDLDRGHLDYFFGLLAVLSLVNFGVYLVMAKWYTYK  562



>gb|ACN27476.1| unknown [Zea mays]
 gb|ACN27986.1| unknown [Zea mays]
 gb|AFW67959.1| hypothetical protein ZEAMMB73_231055 [Zea mays]
Length=591

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            TG G Q WLA ++N GRLD FY  +A +GV N + +VI A W+R K
Sbjct  543  TGSG-QNWLAQDLNKGRLDLFYWTIAGIGVFNLIYFVICARWYRFK  587



>ref|XP_002517462.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF45004.1| nitrate transporter, putative [Ricinus communis]
Length=625

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            WLA+++N GRLD FY ++A+LGV+NF  +++ A W+R K
Sbjct  571  WLAEDLNKGRLDLFYYMIAVLGVINFGYFLVFAKWYRYK  609



>ref|XP_009388204.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=608

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +2

Query  68   TGRGNQG-WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            TG+   G WLADN+N+G+L+ FY LLA L +VN ++Y+++A W+  K  +
Sbjct  538  TGQSGHGAWLADNLNHGKLNNFYWLLAALCLVNLMVYLVAAKWYVYKDQR  587



>ref|XP_002464068.1| hypothetical protein SORBIDRAFT_01g011700 [Sorghum bicolor]
 gb|EER91066.1| hypothetical protein SORBIDRAFT_01g011700 [Sorghum bicolor]
Length=593

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            TG G Q WLA ++N GRLD FY  +A +GV N + +VI A W+R K
Sbjct  545  TGSG-QNWLAQDLNKGRLDLFYWTIAGIGVFNLIYFVICARWYRFK  589



>ref|XP_009397037.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=564

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 35/60 (58%), Gaps = 3/60 (5%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTN---KKGGMQMESM  241
            G G   WL DNIN GR+D FY L+A+LG  N + +V+ A ++R K     K+    ME +
Sbjct  504  GPGQASWLEDNINVGRVDYFYYLIAVLGAGNLLYFVVCAHFYRYKGTGELKEASKDMEGI  563



>ref|XP_002972518.1| hypothetical protein SELMODRAFT_97812, partial [Selaginella moellendorffii]
 gb|EFJ26604.1| hypothetical protein SELMODRAFT_97812, partial [Selaginella moellendorffii]
Length=569

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            G  GW+ADN+N+G +D F+ LLA L VVNF+ Y+  A  F+ K  K
Sbjct  524  GKPGWIADNLNHGHIDYFFWLLAALSVVNFLFYLPFAYRFKYKATK  569



>ref|XP_011081220.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Sesamum indicum]
Length=594

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            WLADN+N GRL  FY LL IL ++N  ++++SA W+  K N+
Sbjct  537  WLADNLNEGRLYNFYWLLTILSILNLAVFLVSARWYVYKENR  578



>gb|EYU46414.1| hypothetical protein MIMGU_mgv11b021679mg [Erythranthe guttata]
Length=589

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGG  223
            T R  +GW+ DN+N  RLD +Y   A+L  VNF+ ++  A  F   T KKG 
Sbjct  520  TKRNGRGWILDNLNKSRLDYYYAFYAVLSFVNFLFFIFVAKMFVYNTEKKGA  571



>ref|XP_010228489.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1 [Brachypodium distachyon]
Length=559

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            T  G  GW+ DN+N G LD F+ LLA L V+NFV+Y+  A W++ K  K
Sbjct  497  TRNGGIGWIPDNLNKGHLDYFFWLLAALSVLNFVVYLWIAKWYKYKVYK  545



>ref|XP_009346885.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X1 [Pyrus 
x bretschneideri]
Length=615

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            GN GW+ +N+NYG LD F+ LLA+L V+N  +Y+  A W+  K
Sbjct  566  GNPGWIPNNLNYGHLDYFFWLLAVLSVLNLGVYLFIAKWYTYK  608



>ref|XP_010258991.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nelumbo nucifera]
Length=592

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/49 (47%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            TG     WL+DN+N G+L  FY LLA+L V+NF LY++ A W+  K ++
Sbjct  528  TGERRPPWLSDNLNQGKLYNFYWLLAVLSVLNFGLYLVCARWYVYKESR  576



>ref|XP_009411045.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=605

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            G+ GWL DN+N G+L  FY L+A+L  VN VLY+++A W+  K  +
Sbjct  539  GHGGWLTDNLNRGKLYNFYWLVAVLSSVNLVLYLVAAKWYVYKEQR  584



>ref|XP_006429306.1| hypothetical protein CICLE_v10011381mg [Citrus clementina]
 ref|XP_006429307.1| hypothetical protein CICLE_v10011381mg [Citrus clementina]
 ref|XP_006480967.1| PREDICTED: peptide transporter PTR1-like isoform X1 [Citrus sinensis]
 ref|XP_006480968.1| PREDICTED: peptide transporter PTR1-like isoform X2 [Citrus sinensis]
 ref|XP_006480969.1| PREDICTED: peptide transporter PTR1-like isoform X3 [Citrus sinensis]
 gb|ESR42546.1| hypothetical protein CICLE_v10011381mg [Citrus clementina]
 gb|ESR42547.1| hypothetical protein CICLE_v10011381mg [Citrus clementina]
Length=568

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+N G LD FY LLAIL V+NF++Y+  A WF  K
Sbjct  516  TRNGKLGWIPDNLNRGHLDYFYWLLAILSVLNFLVYLWIAKWFTYK  561



>ref|XP_002970311.1| hypothetical protein SELMODRAFT_411211 [Selaginella moellendorffii]
 gb|EFJ28441.1| hypothetical protein SELMODRAFT_411211 [Selaginella moellendorffii]
Length=578

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            T  G  GWL  NIN G +  FY LLA +  VNFV+YV  A W+R + +    + ++
Sbjct  498  TKGGGLGWLPSNINRGNISNFYLLLASISAVNFVVYVACARWYRYRNHGDADLALD  553



>ref|XP_002981698.1| hypothetical protein SELMODRAFT_444972 [Selaginella moellendorffii]
 gb|EFJ17180.1| hypothetical protein SELMODRAFT_444972 [Selaginella moellendorffii]
Length=615

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +2

Query  68   TGRGNQ-GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKT  208
            T RG +  WL++N+N G LD FY L A+L  VNFV+++  A W+R K+
Sbjct  540  TSRGGRVSWLSNNLNKGHLDYFYWLQAVLFAVNFVIFLFCARWYRYKS  587



>emb|CCN27377.1| low affinity nitrate transporter, partial [Triticum aestivum]
Length=161

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISA  187
            RG  GWLADN++ GRLD FY LLA++  +N V + I+A
Sbjct  97   RGTGGWLADNLDQGRLDYFYWLLAVMSAINIVFFTIAA  134



>gb|KHN42706.1| Nitrate transporter 1.1 [Glycine soja]
Length=575

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            WLADN+N GRL  FY LLAIL  +N VLY++ A W+  K  +
Sbjct  515  WLADNLNQGRLYDFYWLLAILSAINVVLYLVCAKWYVYKEKR  556



>gb|EYU41851.1| hypothetical protein MIMGU_mgv1a020985mg [Erythranthe guttata]
Length=576

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+NYGRLD F+ LLA+L V N  +Y++ A W+  K
Sbjct  524  TRNGGPGWIPDNLNYGRLDYFFWLLAVLSVFNLGVYLLVAKWYTYK  569



>ref|XP_009346886.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009346887.1| PREDICTED: protein NRT1/ PTR FAMILY 8.2-like isoform X2 [Pyrus 
x bretschneideri]
Length=582

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            GN GW+ +N+NYG LD F+ LLA+L V+N  +Y+  A W+  K
Sbjct  533  GNPGWIPNNLNYGHLDYFFWLLAVLSVLNLGVYLFIAKWYTYK  575



>ref|XP_002436826.1| hypothetical protein SORBIDRAFT_10g009530 [Sorghum bicolor]
 gb|EER88193.1| hypothetical protein SORBIDRAFT_10g009530 [Sorghum bicolor]
Length=595

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G G   WL DNIN+GRLD FY ++ +L V+N + Y I A  FR K
Sbjct  528  GPGGANWLPDNINHGRLDYFYWVVTMLQVMNLIYYAICAKRFRYK  572



>dbj|BAC83856.1| putative nitrate transporter NRT1-5 [Oryza sativa Japonica Group]
 gb|EAZ03071.1| hypothetical protein OsI_25216 [Oryza sativa Indica Group]
Length=618

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            GWLA+++N GRLD FY L+A +G  NF+ +V  A W+R K
Sbjct  553  GWLAEDLNKGRLDWFYLLIAAIGAANFLAFVACAKWYRYK  592



>gb|KHN34951.1| Nitrate transporter 1.1 [Glycine soja]
Length=586

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            WLADN+N GRL  FY LLAIL  +N VLY++ A W+  K  +
Sbjct  526  WLADNLNQGRLYDFYWLLAILSAINVVLYLVCAKWYVYKEKR  567



>gb|AAL16907.1|AF420016_1 putative low-affinity nitrate transporter [Narcissus pseudonarcissus]
Length=123

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +2

Query  68   TGRGNQG-WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            TG   QG WL D++N G+L  FY LLA+L  VN V +++SA W+  K N+
Sbjct  68   TGESGQGAWLPDDLNRGKLYDFYWLLAVLSAVNLVAFLVSARWYVYKENR  117



>ref|XP_003517427.1| PREDICTED: nitrate transporter 1.1-like [Glycine max]
Length=586

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            WLADN+N GRL  FY LLAIL  +N VLY++ A W+  K  +
Sbjct  526  WLADNLNQGRLYDFYWLLAILSAINVVLYLVCAKWYVYKEKR  567



>ref|XP_003538742.1| PREDICTED: nitrate transporter 1.1 [Glycine max]
Length=586

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            WLADN+N GRL  FY LLAIL  +N VLY++ A W+  K  +
Sbjct  526  WLADNLNQGRLYDFYWLLAILSAINVVLYLVCAKWYVYKEKR  567



>ref|XP_002967819.1| hypothetical protein SELMODRAFT_88337 [Selaginella moellendorffii]
 gb|EFJ31166.1| hypothetical protein SELMODRAFT_88337 [Selaginella moellendorffii]
Length=615

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +2

Query  68   TGRGNQ-GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKT  208
            T RG +  WL++N+N G LD FY L A+L  VNFV+++  A W+R K+
Sbjct  540  TSRGGRVSWLSNNLNKGHLDYFYWLQAVLFAVNFVIFLFCARWYRYKS  587



>ref|XP_009397036.1| PREDICTED: protein NRT1/ PTR FAMILY 2.13-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=587

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G G   WL DNIN GR+D FY L+A+LG  N + +V+ A ++R K
Sbjct  527  GPGQASWLEDNINVGRVDYFYYLIAVLGAGNLLYFVVCAHFYRYK  571



>gb|AEW09082.1| hypothetical protein CL3654Contig1_01, partial [Pinus radiata]
 gb|AFG66605.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
 gb|AFG66606.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
 gb|AFG66607.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
 gb|AFG66608.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
 gb|AFG66609.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
 gb|AFG66610.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
 gb|AFG66611.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
 gb|AFG66613.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
 gb|AFG66614.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
 gb|AFG66615.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
 gb|AFG66616.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
 gb|AFG66617.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
 gb|AFG66619.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
Length=85

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 1/59 (2%)
 Frame = +2

Query  68   TGRGNQ-GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQMESM  241
            T R NQ GW+  N+N G +D FY LLA L  V+FV YV+ A W+R     K   + E +
Sbjct  27   TKRENQPGWIPGNLNRGHMDRFYYLLAALTAVDFVAYVMCARWYRCIVVSKDTEEGEEL  85



>ref|XP_004504618.1| PREDICTED: peptide transporter PTR2-like [Cicer arietinum]
Length=584

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  GN GW+ DN+N GRLD F+ LLA L  +N +LY+++A  +++K
Sbjct  536  TQGGNPGWIPDNLNKGRLDNFFWLLAGLSFLNMLLYIVAAKRYKQK  581



>gb|KDP24486.1| hypothetical protein JCGZ_25050 [Jatropha curcas]
Length=568

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G  GW+ DN+N G LD FY LLAIL V+NF +Y+  A W+  K
Sbjct  519  GKLGWIPDNLNRGHLDYFYWLLAILSVLNFFVYLWIAKWYTYK  561



>gb|EAZ38982.1| hypothetical protein OsJ_23400 [Oryza sativa Japonica Group]
Length=760

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  86   GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            GWLA+++N GRLD FY L+A +G  NF+ +V  A W+R K
Sbjct  553  GWLAEDLNKGRLDWFYLLIAAIGAANFLAFVACAKWYRYK  592


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = +2

Query  77   GNQG-WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G+ G WLA+++N GRLD FY L+A +G  NF+ +V  A W+R K
Sbjct  647  GDDGRWLAEDLNKGRLDWFYLLIAAIGAANFLAFVACAKWYRYK  690



>ref|NP_001051098.1| Os03g0719900 [Oryza sativa Japonica Group]
 dbj|BAB62326.1| peptide transporter [Oryza sativa Japonica Group]
 dbj|BAB62327.1| peptide transporter [Oryza sativa Japonica Group]
 gb|AAT77837.1| putative peptide transporter 1 [Oryza sativa Japonica Group]
 gb|ABF98582.1| Peptide transporter PTR2, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13012.1| Os03g0719900 [Oryza sativa Japonica Group]
 dbj|BAG93866.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76085.1| hypothetical protein OsI_13317 [Oryza sativa Indica Group]
Length=593

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            GN GW+ DN+N G LD F+ LLA L  +NFV+YVI A  ++ K
Sbjct  548  GNPGWIPDNLNQGHLDYFFWLLAGLSFLNFVIYVICANKYKSK  590



>ref|XP_007157339.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
 gb|ESW29333.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
Length=586

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK--KGGMQME  235
            WLADN+N GRL  FY LLAIL  +N +LY++ A W+  K  +  + G+++E
Sbjct  526  WLADNLNKGRLYDFYWLLAILSAINVMLYLVCAKWYVYKEKRLAEEGIELE  576



>gb|EEE59822.1| hypothetical protein OsJ_12376 [Oryza sativa Japonica Group]
Length=593

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            GN GW+ DN+N G LD F+ LLA L  +NFV+YVI A  ++ K
Sbjct  548  GNPGWIPDNLNQGHLDYFFWLLAGLSFLNFVIYVICANKYKSK  590



>emb|CAD32549.1| dicarboxylate transporter [Alnus glutinosa]
Length=583

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +2

Query  83   QGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR  199
             GWL   IN  RLD FY LLA+LG +N V Y++ A W++
Sbjct  527  HGWLLSRINDSRLDFFYALLAVLGFINLVFYLVLASWYK  565



>ref|XP_010519721.1| PREDICTED: protein NRT1/ PTR FAMILY 7.1 [Tarenaya hassleriana]
Length=609

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR  199
            GN GW+ +N+N G +D FY L+A L  V+FV Y++ A W+R
Sbjct  541  GNDGWIPENLNEGHMDRFYFLIAALAAVDFVFYLVLAKWYR  581



>ref|XP_010262762.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262763.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
 ref|XP_010262764.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Nelumbo nucifera]
Length=568

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+N G LD FY LLA+L V+NFV+Y+  A  F+ K
Sbjct  516  TRNGKVGWIPDNLNRGHLDYFYWLLAVLSVINFVVYLWIANGFKYK  561



>gb|AFG66612.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
 gb|AFG66618.1| hypothetical protein CL3654Contig1_01, partial [Pinus taeda]
Length=85

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = +2

Query  68   TGRGNQ-GWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR  199
            T R NQ GW+  N+N G +D FY LLA L  V+FV YV+ A W+R
Sbjct  27   TKRENQPGWIPGNLNRGHMDRFYYLLAALTAVDFVAYVMCARWYR  71



>ref|XP_003562233.2| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Brachypodium distachyon]
Length=551

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISA  187
            TG G + WLAD+I+ GRLD FY LLA+L V+N  ++V +A
Sbjct  485  TGSGGRPWLADDIDQGRLDYFYWLLAVLSVLNLAVFVAAA  524



>gb|EMS66817.1| Peptide transporter PTR5 [Triticum urartu]
Length=482

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKK  217
            G QGW+ DN+N G LD F+ LLA L ++NF +Y++ A W+  K   +
Sbjct  423  GKQGWIPDNLNVGHLDYFFWLLAALSLLNFAVYLLIASWYTYKKTAE  469



>ref|XP_003602970.1| Peptide transporter PTR3-A [Medicago truncatula]
 gb|AES73221.1| peptide/nitrate transporter [Medicago truncatula]
Length=568

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  86   GWLA-DNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKT  208
            GWLA +N+N  +L+ FY LL+I+ V+NFV Y++ A W+R KT
Sbjct  510  GWLASNNLNRDKLNYFYWLLSIISVINFVFYLVCASWYRYKT  551



>ref|XP_010906610.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Elaeis 
guineensis]
Length=539

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +2

Query  68   TGRGNQG-WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            TG+   G WLADN+N G+L  FY LLA+L +VN  LY+++A W+  K  +
Sbjct  469  TGKSGHGAWLADNLNRGKLYNFYWLLAVLCLVNLGLYLVAAKWYVYKEGR  518



>gb|EAZ02458.1| hypothetical protein OsI_24563 [Oryza sativa Indica Group]
Length=561

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKT  208
            G  GW+ DN+N G LD F+ LLA L  VNF++Y+  A W+R KT
Sbjct  508  GGLGWIPDNLNRGHLDYFFWLLAALSAVNFLVYLWIANWYRCKT  551



>ref|XP_006658184.1| PREDICTED: peptide transporter PTR5-like [Oryza brachyantha]
Length=580

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G  GW+ DN+N G LD F+ LLA+L  VNF++Y+  A W+R K
Sbjct  521  GGVGWIPDNLNRGHLDYFFWLLAVLSTVNFLVYLWIAKWYRCK  563



>ref|XP_001774033.1| predicted protein [Physcomitrella patens]
 gb|EDQ61085.1| predicted protein [Physcomitrella patens]
Length=580

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G  GW+ADN+N G LD F+ LLA +  VN V YV+ A W+  K
Sbjct  522  GAPGWIADNLNRGHLDYFFWLLAGMSTVNLVFYVVCARWYTTK  564



>gb|ACF22756.1| nitrate transporter [Brachypodium distachyon]
Length=609

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISA  187
            TG G + WLAD+I+ GRLD FY LLA+L V+N  ++V +A
Sbjct  543  TGSGGRPWLADDIDQGRLDYFYWLLAVLSVLNLAVFVAAA  582



>ref|XP_004511669.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Cicer arietinum]
 ref|XP_004511670.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Cicer arietinum]
Length=593

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +2

Query  80   NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK--KGGMQMESM  241
            N+ W+A+N+N GRL  FY LLA+L  +N V+Y+  A W+  K N+  + G+++E +
Sbjct  531  NKPWIANNLNQGRLYDFYWLLAMLSAINVVIYLACAKWYVYKENRLAEEGIELEEI  586



>ref|NP_001058672.1| Os07g0100600 [Oryza sativa Japonica Group]
 dbj|BAF20586.1| Os07g0100600, partial [Oryza sativa Japonica Group]
Length=582

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKT  208
            G  GW+ DN+N G LD F+ LLA L  VNF++Y+  A W+R KT
Sbjct  529  GGLGWIPDNLNRGHLDYFFWLLAALSAVNFLVYLWIANWYRCKT  572



>gb|AIU49688.1| major facilitator superfamily protein, partial [Ceratophyllum 
demersum]
Length=564

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  71   GRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G+G Q WL+ NIN G+ D  Y LL ILGV+NFV+++ +A  ++ +
Sbjct  520  GKGKQSWLSQNINTGKFDNLYWLLTILGVINFVVFLYAARTYKYR  564



>dbj|BAD31819.1| putative peptide transport protein [Oryza sativa Japonica Group]
 gb|EAZ38386.1| hypothetical protein OsJ_22763 [Oryza sativa Japonica Group]
Length=572

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKT  208
            G  GW+ DN+N G LD F+ LLA L  VNF++Y+  A W+R KT
Sbjct  519  GGLGWIPDNLNRGHLDYFFWLLAALSAVNFLVYLWIANWYRCKT  562



>gb|AFK49547.1| unknown [Lotus japonicus]
Length=112

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK---TNKKGGMQM  232
              +QGW+ DN+N  RLD +Y  + IL  +NF+ ++++A +F      T++K G ++
Sbjct  34   HSHQGWILDNLNISRLDYYYAFMVILSFLNFLCFLVTAKFFDYNVDVTHEKSGSEL  89



>emb|CCN27378.1| low affinity nitrate transporter, partial [Triticum aestivum]
Length=161

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 3/58 (5%)
 Frame = +2

Query  68   TGRG-NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISA--VWFRRKTNKKGGMQM  232
            TG G N GWLA+NI+ GRLD FY LLA++  +N V + I+A    ++ K     G+++
Sbjct  94   TGHGSNDGWLANNIDQGRLDYFYWLLAVMSAINIVFFTIAARGYVYKEKRMADAGIEL  151



>ref|XP_004983703.1| PREDICTED: nitrate transporter 1.1-like [Setaria italica]
Length=590

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISA  187
            G+ GWLADN+N GRLD FY LLA++  +N VL+ ++A
Sbjct  527  GHGGWLADNLNDGRLDYFYWLLAVISAINLVLFTLAA  563



>ref|XP_006440344.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
 gb|ESR53584.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
Length=591

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            WLADN+N GRL  FY LLAIL  +NFV+Y+  A W+  K  +
Sbjct  534  WLADNLNQGRLYDFYWLLAILSALNFVIYLAFARWYVYKDKR  575



>gb|KDO61483.1| hypothetical protein CISIN_1g007736mg [Citrus sinensis]
Length=591

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            WLADN+N GRL  FY LLAIL  +NFV+Y+  A W+  K  +
Sbjct  534  WLADNLNQGRLYDFYWLLAILSALNFVIYLAFARWYVYKDKR  575



>ref|XP_002511509.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF52111.1| nitrate transporter, putative [Ricinus communis]
Length=602

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQM  232
            T  GN  WLA+++N GRLD +Y L+A LGV+NF  ++I A W++ K      ++M
Sbjct  538  TATGN--WLAEDLNKGRLDYYYYLIAALGVLNFGYFLICAKWYKYKGGNAVTIEM  590



>ref|XP_009421313.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421314.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421315.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421316.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Musa acuminata 
subsp. malaccensis]
Length=580

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            T  G  GW+ DN+N G LD F+ LLA+L +VNFV Y++ A W+  K
Sbjct  516  TRNGKLGWIPDNLNRGHLDYFFWLLAVLSLVNFVAYLLIAKWYTYK  561



>ref|XP_002992551.1| hypothetical protein SELMODRAFT_448814 [Selaginella moellendorffii]
 gb|EFJ06357.1| hypothetical protein SELMODRAFT_448814 [Selaginella moellendorffii]
Length=589

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            G  GW+ADN+N+G +D F+ LL  L VVNF+ Y+  A  F+ K  K
Sbjct  544  GKPGWIADNLNHGHIDYFFWLLVALSVVNFLFYLPFAYRFKYKATK  589



>ref|XP_006477230.1| PREDICTED: nitrate transporter 1.1-like [Citrus sinensis]
Length=591

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  89   WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            WLADN+N GRL  FY LLAIL  +NFV+Y+  A W+  K  +
Sbjct  534  WLADNLNQGRLYDFYWLLAILSALNFVIYLAFARWYVYKDKR  575



>gb|KEH34180.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=461

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = +2

Query  68   TGRGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKK  217
            T  G+ GW+ DN+NYG +D F+ LLA+L V+N ++YV+ A   R  T KK
Sbjct  409  TKNGSPGWIPDNLNYGHIDYFFWLLAVLSVLNLIVYVLVA---RLYTYKK  455



>ref|XP_004296302.1| PREDICTED: putative peptide/nitrate transporter At5g19640-like 
[Fragaria vesca subsp. vesca]
Length=606

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +2

Query  68   TGRG-NQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFR  199
            T RG N GW+ D++N G +D FY LLA+L   +FV+YV  A W++
Sbjct  536  TARGKNPGWIPDDLNTGHMDRFYFLLAVLAAFDFVIYVYLAKWYK  580



>ref|XP_010109642.1| hypothetical protein L484_015597 [Morus notabilis]
 gb|EXC23687.1| hypothetical protein L484_015597 [Morus notabilis]
Length=450

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            GN  W+ D +N  RLD +Y +LA L   N VLY++ AVW+ RK
Sbjct  386  GNPSWVQDTLNMSRLDKYYWVLAALTAANLVLYILVAVWYDRK  428



>ref|XP_010906609.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Elaeis 
guineensis]
Length=603

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +2

Query  68   TGRGNQG-WLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNK  214
            TG+   G WLADN+N G+L  FY LLA+L +VN  LY+++A W+  K  +
Sbjct  533  TGKSGHGAWLADNLNRGKLYNFYWLLAVLCLVNLGLYLVAAKWYVYKEGR  582



>gb|KEH35736.1| peptide/nitrate transporter [Medicago truncatula]
Length=596

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +2

Query  86   GWLA-DNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKT  208
            GWLA +N+N  +L+ FY LL+I+ V+NFV Y++ A W+R KT
Sbjct  538  GWLASNNLNRDKLNYFYWLLSIISVINFVFYLVCASWYRYKT  579



>ref|XP_010514894.1| PREDICTED: protein NRT1/ PTR FAMILY 2.3 [Camelina sativa]
Length=548

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRKTNKKGGMQME  235
            R   GWL D+IN+GR+D  Y +L ILGV+NF  +++ + WF R  N K   Q +
Sbjct  489  RRTTGWLPDDINHGRVDNVYWVLVILGVLNFGYFLVCS-WFYRYRNLKDSDQKQ  541



>gb|EMT28633.1| Peptide transporter PTR5 [Aegilops tauschii]
Length=488

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  77   GNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
            G QGW+ DN+N G LD F+ LLA L ++NF +Y++ A W+  K
Sbjct  425  GKQGWIPDNLNVGHLDYFFWLLAALSLLNFAVYLLIASWYTYK  467



>ref|XP_011077583.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
 ref|XP_011077584.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
 ref|XP_011077585.1| PREDICTED: protein NRT1/ PTR FAMILY 8.1-like [Sesamum indicum]
Length=575

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  74   RGNQGWLADNINYGRLDCFYGLLAILGVVNFVLYVISAVWFRRK  205
             G  GW+ DN+N G LD FY LLA+L  +NF+ YV+ A W+  K
Sbjct  518  HGKLGWIPDNLNKGHLDYFYWLLAVLSFINFLAYVLIAKWYTYK  561



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519518671360