BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17444_g1_i2 len=1471 path=[257:0-156 3526:157-487 745:488-513
3880:514-685 943:686-726 25:727-829 128:830-1470]

Length=1471
                                                                      Score     E

gb|ABW89460.1|  glutamine synthetase                                    612   0.0      Gossypium herbaceum [Arabian cotton]
gb|KHG00636.1|  Glutamine synthetase cytosolic isozyme 1                610   0.0      
gb|ABW89461.1|  glutamine synthetase                                    609   0.0      Gossypium hirsutum [American cotton]
gb|KDP25795.1|  hypothetical protein JCGZ_22517                         608   0.0      
gb|ABW89462.1|  glutamine synthetase                                    608   0.0      Gossypium hirsutum [American cotton]
gb|ABW89463.1|  glutamine synthetase                                    607   0.0      Gossypium raimondii
ref|XP_010926111.1|  PREDICTED: glutamine synthetase cytosolic is...    607   0.0      
ref|XP_009772493.1|  PREDICTED: glutamine synthetase cytosolic is...    605   0.0      
ref|XP_006482120.1|  PREDICTED: glutamine synthetase nodule isozy...    605   0.0      
gb|ABW89464.1|  glutamine synthetase                                    604   0.0      Gossypium hirsutum [American cotton]
ref|XP_006430603.1|  hypothetical protein CICLE_v10011785mg             607   0.0      
gb|AAR86718.1|  glutamine synthetase GS56                               604   0.0      Nicotiana attenuata
ref|XP_006647853.1|  PREDICTED: glutamine synthetase cytosolic is...    603   0.0      
ref|XP_010250142.1|  PREDICTED: glutamine synthetase nodule isozyme     603   0.0      
ref|XP_008812466.1|  PREDICTED: glutamine synthetase nodule isozyme     603   0.0      
ref|XP_010271347.1|  PREDICTED: glutamine synthetase cytosolic is...    602   0.0      
ref|XP_003544980.1|  PREDICTED: glutamine synthetase cytosolic is...    602   0.0      
ref|XP_010909363.1|  PREDICTED: glutamine synthetase nodule isozyme     602   0.0      
ref|XP_009614064.1|  PREDICTED: glutamine synthetase cytosolic is...    602   0.0      
gb|AAB61597.1|  glutamine synthetase                                    602   0.0      Hevea brasiliensis [jebe]
ref|NP_001048045.1|  Os02g0735200                                       601   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010932552.1|  PREDICTED: glutamine synthetase nodule isozyme     601   0.0      
ref|NP_001268175.1|  glutamine synthetase cytosolic isozyme 1           601   0.0      
gb|AAK08103.1|AF338444_1  glutamine synthetase                          601   0.0      Avicennia marina
ref|XP_011085871.1|  PREDICTED: glutamine synthetase cytosolic is...    600   0.0      
ref|XP_003519325.1|  PREDICTED: glutamine synthetase cytosolic is...    600   0.0      
gb|AIK03054.1|  glutamine synthetase                                    600   0.0      
ref|XP_007036933.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    599   0.0      
emb|CBI33470.3|  unnamed protein product                                599   0.0      
ref|XP_008775534.1|  PREDICTED: glutamine synthetase nodule isozy...    599   0.0      
ref|NP_001267644.1|  glutamine synthetase cytosolic isozyme-like        599   0.0      
ref|XP_007032111.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    599   0.0      
emb|CAN68162.1|  hypothetical protein VITISV_015673                     599   0.0      Vitis vinifera
ref|XP_007141923.1|  hypothetical protein PHAVU_008G237400g             599   0.0      
gb|AAW21273.1|  glutamine synthetase                                    598   0.0      Saccharum officinarum [noble cane]
gb|KDP43303.1|  hypothetical protein JCGZ_24224                         598   0.0      
ref|XP_004162638.1|  PREDICTED: glutamine synthetase nodule isozy...    598   0.0      
ref|XP_011003750.1|  PREDICTED: glutamine synthetase nodule isozyme     598   0.0      
emb|CDP01645.1|  unnamed protein product                                597   0.0      
gb|KGN51032.1|  Glutamine synthetase                                    597   0.0      
ref|XP_004953842.1|  PREDICTED: glutamine synthetase cytosolic is...    597   0.0      
gb|ABK94916.1|  unknown                                                 597   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002305885.1|  glutamate-ammonia ligase family protein            597   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002318305.1|  glutamine synthetase family protein                597   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011002191.1|  PREDICTED: glutamine synthetase cytosolic is...    597   0.0      
ref|XP_010062276.1|  PREDICTED: glutamine synthetase nodule isozy...    597   0.0      
ref|XP_004512771.1|  PREDICTED: glutamine synthetase nodule isozy...    597   0.0      
ref|XP_010271383.1|  PREDICTED: glutamine synthetase cytosolic is...    596   0.0      
ref|NP_001284433.1|  glutamine synthetase cytosolic isozyme             596   0.0      
ref|NP_001268054.1|  glutamine synthetase cytosolic isozyme 2           596   0.0      
ref|XP_006405853.1|  hypothetical protein EUTSA_v10027817mg             596   0.0      
ref|XP_006387591.1|  hypothetical protein POPTR_0799s00200g             595   0.0      
ref|XP_004288594.1|  PREDICTED: glutamine synthetase nodule isozy...    595   0.0      
ref|XP_007215605.1|  hypothetical protein PRUPE_ppa007772mg             595   0.0      
gb|AJD14835.1|  glutamine synthetase                                    595   0.0      
sp|P32289.1|GLNA_VIGAC  RecName: Full=Glutamine synthetase nodule...    595   0.0      Vigna aconitifolia [moth-bean]
emb|CAA65173.1|  glutamine synthetase                                   595   0.0      Nicotiana tabacum [American tobacco]
ref|XP_010528561.1|  PREDICTED: glutamine synthetase nodule isozy...    595   0.0      
gb|AAK49029.1|  cytosolic glutamine synthetase                          595   0.0      Populus tremula x Populus alba [gray poplar]
gb|KHG29839.1|  Glutamine synthetase cytosolic isozyme 1-1              595   0.0      
ref|XP_011035558.1|  PREDICTED: glutamine synthetase cytosolic is...    594   0.0      
ref|XP_006374208.1|  glutamine synthetase family protein                594   0.0      
ref|XP_010916212.1|  PREDICTED: glutamine synthetase nodule isozy...    594   0.0      
ref|XP_010103463.1|  Glutamine synthetase nodule isozyme                594   0.0      
ref|XP_009385541.1|  PREDICTED: glutamine synthetase nodule isozy...    593   0.0      
ref|XP_010553887.1|  PREDICTED: glutamine synthetase nodule isozyme     593   0.0      
ref|XP_010036983.1|  PREDICTED: glutamine synthetase cytosolic is...    593   0.0      
ref|XP_011083120.1|  PREDICTED: glutamine synthetase cytosolic is...    593   0.0      
gb|ACJ11724.1|  glutamine synthase                                      593   0.0      Gossypium hirsutum [American cotton]
ref|XP_006649656.1|  PREDICTED: glutamine synthetase cytosolic is...    593   0.0      
gb|ACU19484.1|  unknown                                                 593   0.0      Glycine max [soybeans]
ref|XP_002310666.1|  glutamine synthetase family protein                593   0.0      Populus trichocarpa [western balsam poplar]
gb|ABK95973.1|  unknown                                                 593   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009370554.1|  PREDICTED: glutamine synthetase cytosolic is...    593   0.0      
sp|Q42899.2|GLNA1_LOTJA  RecName: Full=Glutamine synthetase cytos...    593   0.0      Lotus japonicus
ref|XP_003619869.1|  Glutamine synthetase                               593   0.0      
dbj|BAK01909.1|  predicted protein                                      592   0.0      
ref|XP_009393673.1|  PREDICTED: glutamine synthetase nodule isozyme     592   0.0      
emb|CAA73366.1|  glutamine synthetase                                   592   0.0      Lotus japonicus
pdb|4IS4|A  Chain A, The Glutamine Synthetase From The Dicotyledo...    593   0.0      
ref|XP_006372556.1|  glutamate-ammonia ligase family protein            592   0.0      
ref|XP_009391413.1|  PREDICTED: glutamine synthetase nodule isozy...    592   0.0      
dbj|BAD99525.1|  glutamine synthetase                                   592   0.0      Camellia sinensis [black tea]
gb|EYU30859.1|  hypothetical protein MIMGU_mgv1a008986mg                592   0.0      
ref|XP_011001555.1|  PREDICTED: glutamine synthetase cytosolic is...    592   0.0      
ref|XP_008460506.1|  PREDICTED: glutamine synthetase nodule isozy...    592   0.0      
ref|NP_001105296.1|  glutamine synthetase root isozyme 3                592   0.0      Zea mays [maize]
ref|XP_011007210.1|  PREDICTED: glutamine synthetase cytosolic is...    592   0.0      
ref|XP_002465624.1|  hypothetical protein SORBIDRAFT_01g042450          592   0.0      Sorghum bicolor [broomcorn]
pdb|2D3A|A  Chain A, Crystal Structure Of The Maize Glutamine Syn...    592   0.0      
gb|AFN42876.1|  glutamine synthetase                                    592   0.0      
ref|XP_011073176.1|  PREDICTED: glutamine synthetase nodule isozy...    593   0.0      
ref|XP_002870545.1|  ATGSR1                                             591   0.0      
ref|XP_003528974.1|  PREDICTED: glutamine synthetase PR-2               591   0.0      
ref|XP_007043312.1|  Glutamine synthetase 1,4                           591   0.0      
ref|NP_001239821.1|  cytosolic glutamine synthetase alpha               591   0.0      
ref|XP_010940335.1|  PREDICTED: glutamine synthetase nodule isozy...    591   0.0      
gb|ACB06727.1|  glutamine synthetase                                    590   0.0      Zea mays [maize]
gb|KFK33302.1|  hypothetical protein AALP_AA6G357500                    590   0.0      
emb|CAA54151.1|  glutamine                                              590   0.0      Brassica napus [oilseed rape]
emb|CAA58118.1|  glutamate--ammonia ligase                              590   0.0      Brassica napus [oilseed rape]
ref|XP_008803403.1|  PREDICTED: glutamine synthetase nodule isozy...    590   0.0      
emb|CAA63963.1|  glutamate synthetase                                   590   0.0      Lotus japonicus
gb|AAR29057.1|  glutamine synthetase 1                                  590   0.0      Datisca glomerata
gb|KHN07539.1|  Glutamine synthetase nodule isozyme                     590   0.0      
gb|ACD13217.1|  glutamine synthetase                                    590   0.0      Brassica rapa subsp. chinensis [bok-choy]
sp|Q43785.1|GLNA3_MEDSA  RecName: Full=Glutamine synthetase nodul...    590   0.0      Medicago sativa [alfalfa]
gb|ACA50923.1|  glutamine synthetase                                    590   0.0      Zea mays [maize]
ref|XP_009370058.1|  PREDICTED: glutamine synthetase cytosolic is...    590   0.0      
gb|AFB69879.1|  glutamine synthetase isoform 1-1                        589   0.0      
emb|CAA73063.1|  cytosolic glutamine synthetase                         589   0.0      Brassica napus [oilseed rape]
sp|P04078.1|GLNA1_MEDSA  RecName: Full=Glutamine synthetase cytos...    589   0.0      Medicago sativa [alfalfa]
gb|AJD14834.1|  glutamine synthetase                                    589   0.0      
gb|ABK51388.1|  cytosolic glutamine synthetase                          589   0.0      Camellia sinensis [black tea]
sp|P52782.1|GLNA_LUPLU  RecName: Full=Glutamine synthetase nodule...    589   0.0      Lupinus luteus
dbj|BAD99526.1|  glutamine synthetase                                   589   0.0      Camellia sinensis [black tea]
ref|XP_010935533.1|  PREDICTED: glutamine synthetase nodule isozy...    589   0.0      
emb|CDO98315.1|  unnamed protein product                                589   0.0      
ref|NP_198576.1|  glutamine synthetase 1;1                              588   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAA04995.1|  glutamine synthetase                                   588   0.0      Raphanus sativus
ref|XP_004985157.1|  PREDICTED: glutamine synthetase root isozyme...    588   0.0      
ref|XP_010032725.1|  PREDICTED: glutamine synthetase nodule isozyme     588   0.0      
gb|KHG29838.1|  Glutamine synthetase cytosolic isozyme 1-1              588   0.0      
ref|XP_006346760.1|  PREDICTED: glutamine synthetase cytosolic is...    588   0.0      
gb|EYU45782.1|  hypothetical protein MIMGU_mgv1a009017mg                588   0.0      
gb|EEC73954.1|  hypothetical protein OsI_08842                          588   0.0      Oryza sativa Indica Group [Indian rice]
gb|AAW21274.1|  glutamine synthetase                                    588   0.0      Saccharum officinarum [noble cane]
ref|XP_008353857.1|  PREDICTED: glutamine synthetase cytosolic is...    588   0.0      
ref|XP_009629012.1|  PREDICTED: glutamine synthetase-like               588   0.0      
ref|XP_009800983.1|  PREDICTED: glutamine synthetase-like               588   0.0      
gb|ACR38147.1|  unknown                                                 588   0.0      Zea mays [maize]
ref|XP_009127474.1|  PREDICTED: glutamine synthetase cytosolic is...    588   0.0      
ref|XP_008781316.1|  PREDICTED: glutamine synthetase cytosolic is...    588   0.0      
ref|XP_010652433.1|  PREDICTED: glutamine synthetase isoform X1         587   0.0      
ref|XP_004236686.1|  PREDICTED: glutamine synthetase cytosolic is...    587   0.0      
ref|NP_001242332.1|  cytosolic glutamine synthetase beta2               587   0.0      
emb|CCO25538.1|  glutamine synthetase                                   587   0.0      
ref|XP_006284008.1|  hypothetical protein CARUB_v10005130mg             587   0.0      
ref|XP_009631592.1|  PREDICTED: glutamine synthetase isoform X1         587   0.0      
sp|P38561.1|GLNA3_MAIZE  RecName: Full=Glutamine synthetase root ...    587   0.0      Zea mays [maize]
ref|NP_001241743.1|  glutamine synthetase root isozyme 3                587   0.0      
prf||1804333B  Gln synthetase                                           590   0.0   
ref|XP_010440874.1|  PREDICTED: glutamine synthetase cytosolic is...    587   0.0      
ref|XP_010415162.1|  PREDICTED: glutamine synthetase cytosolic is...    587   0.0      
ref|XP_008789283.1|  PREDICTED: glutamine synthetase nodule isozy...    587   0.0      
ref|XP_006300523.1|  hypothetical protein CARUB_v10020543mg             587   0.0      
ref|XP_003600702.1|  Glutamine synthetase                               587   0.0      
ref|XP_010470493.1|  PREDICTED: glutamine synthetase cytosolic is...    587   0.0      
ref|XP_007163376.1|  hypothetical protein PHAVU_001G229500g             587   0.0      
gb|ABX79672.1|  glutamine synthetase                                    587   0.0      Camellia sinensis [black tea]
gb|AAP33167.1|  cytosolic glutamine synthetase                          587   0.0      Securigera parviflora
ref|XP_010435595.1|  PREDICTED: glutamine synthetase cytosolic is...    586   0.0      
ref|XP_002888488.1|  ATGSR2                                             586   0.0      
sp|P07694.1|GLNA3_PEA  RecName: Full=Glutamine synthetase root is...    586   0.0      Pisum sativum [garden pea]
ref|XP_009785976.1|  PREDICTED: glutamine synthetase isoform X1         586   0.0      
ref|NP_001049424.1|  Os03g0223400                                       586   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009338856.1|  PREDICTED: glutamine synthetase cytosolic is...    586   0.0      
dbj|BAD11327.1|  glutamine synthetase                                   586   0.0      Camellia sinensis [black tea]
gb|ACF42116.1|  cytosolic glutamine synthetase                          586   0.0      Brassica oleracea var. italica [asparagus broccoli]
tpg|DAA44141.1|  TPA: glutamine synthetase6                             586   0.0      
ref|NP_001105538.1|  glutamine synthetase root isozyme 1                586   0.0      Zea mays [maize]
gb|AAK14401.1|AF343667_1  cytosolic glutamine synthetase                585   0.0      Beta vulgaris subsp. vulgaris [field beet]
sp|P38563.2|GLNA5_MAIZE  RecName: Full=Glutamine synthetase root ...    585   0.0      Zea mays [maize]
ref|XP_010511548.1|  PREDICTED: glutamine synthetase cytosolic is...    585   0.0      
ref|NP_001268104.1|  glutamine synthetase                               585   0.0      
gb|AID48673.1|  theanine synthetase                                     585   0.0      
ref|XP_010525077.1|  PREDICTED: glutamine synthetase nodule isozyme     585   0.0      
emb|CAA71317.1|  glutamine synthetase                                   585   0.0      Medicago truncatula
gb|AFP20991.1|  glutamine synthetase isozyme                            585   0.0      
ref|XP_004135959.1|  PREDICTED: glutamine synthetase nodule isozy...    585   0.0      
sp|Q43066.1|GLNA4_PEA  RecName: Full=Glutamine synthetase root is...    585   0.0      Pisum sativum [garden pea]
ref|XP_010450518.1|  PREDICTED: glutamine synthetase cytosolic is...    585   0.0      
sp|P12424.1|GLNA_NICPL  RecName: Full=Glutamine synthetase; AltNa...    585   0.0      Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010688706.1|  PREDICTED: glutamine synthetase nodule isozyme     584   0.0      
gb|AAZ30058.1|  glutamine synthetase isoform GS1b                       584   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|NP_001105297.1|  glutamine synthetase root isozyme 5                584   0.0      Zea mays [maize]
ref|XP_007152660.1|  hypothetical protein PHAVU_004G148300g             584   0.0      
ref|XP_009785977.1|  PREDICTED: glutamine synthetase isoform X2         584   0.0      
ref|XP_008365754.1|  PREDICTED: glutamine synthetase cytosolic is...    584   0.0      
ref|XP_008358170.1|  PREDICTED: glutamine synthetase cytosolic is...    583   0.0      
ref|XP_004250194.1|  PREDICTED: glutamine synthetase                    583   0.0      
ref|XP_006844043.1|  hypothetical protein AMTR_s00006p00241880          583   0.0      
gb|ABU45501.1|  cytosolic glutamine synthetase                          583   0.0      Spinacia oleracea
gb|AAG24873.1|AF301590_1  cytosolic glutamine synthetase GSbeta1        583   0.0      Glycine max [soybeans]
prf||1804333D  Gln synthetase                                           587   0.0   
gb|AAN05339.1|  Putative GLN1_ORYSA GLUTAMINE SYNTHETASE ROOT ISO...    583   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAZ30059.1|  glutamine synthetase isoform GS1c                       583   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_010236151.1|  PREDICTED: glutamine synthetase cytosolic is...    583   0.0      
gb|AAZ30057.1|  glutamine synthetase isoform GS1a                       583   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_009139734.1|  PREDICTED: glutamine synthetase cytosolic is...    583   0.0      
ref|XP_008461372.1|  PREDICTED: glutamine synthetase nodule isozy...    583   0.0      
prf||1804333C  Gln synthetase                                           586   0.0   
dbj|BAL14865.1|  putative cytosolic glutamine synthetase                583   0.0      
ref|XP_004503122.1|  PREDICTED: glutamine synthetase nodule isozy...    583   0.0      
sp|P38559.1|GLNA1_MAIZE  RecName: Full=Glutamine synthetase root ...    583   0.0      Zea mays [maize]
emb|CAJ87510.1|  putative glutamine synthetase                          583   0.0      Pisum sativum [garden pea]
gb|AEM42902.1|  cytosolic glutamine synthetase isoform                  583   0.0      
sp|P23712.2|GLNA_LACSA  RecName: Full=Glutamine synthetase; AltNa...    583   0.0      Lactuca sativa [cultivated lettuce]
ref|XP_010420354.1|  PREDICTED: glutamine synthetase cytosolic is...    582   0.0      
gb|AGV07415.1|  glutamine synthetase                                    582   0.0      
ref|XP_006288043.1|  hypothetical protein CARUB_v10001277mg             582   0.0      
gb|AAD52008.1|  cytosolic glutamine synthetase                          582   0.0      Canavalia lineata
ref|XP_006391364.1|  hypothetical protein EUTSA_v10018774mg             582   0.0      
gb|EYU24513.1|  hypothetical protein MIMGU_mgv1a008973mg                582   0.0      
gb|AAP33169.1|  cytosolic glutamine synthetase                          582   0.0      Securigera parviflora
ref|XP_004299511.1|  PREDICTED: glutamine synthetase cytosolic is...    582   0.0      
dbj|BAM84285.1|  glutamine synthetase                                   582   0.0      
ref|XP_009408415.1|  PREDICTED: glutamine synthetase nodule isozy...    582   0.0      
ref|XP_010066984.1|  PREDICTED: glutamine synthetase cytosolic is...    582   0.0      
sp|P04770.1|GLNA1_PHAVU  RecName: Full=Glutamine synthetase PR-1;...    582   0.0      Phaseolus vulgaris [French bean]
ref|XP_009360053.1|  PREDICTED: glutamine synthetase nodule isozy...    582   0.0      
ref|NP_001105444.1|  glutamine synthetase root isozyme 4                582   0.0      Zea mays [maize]
pir||S18603  glutamate-ammonia ligase (EC 6.3.1.2), cytosolic (cl...    583   0.0   
ref|NP_188409.1|  glutamine synthetase cytosolic isozyme 1-3            582   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_176794.1|  glutamine synthetase                                  582   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AGC24239.1|  glutamine synthetase 1                                  582   0.0      
ref|XP_006352444.1|  PREDICTED: glutamine synthetase-like               582   0.0      
ref|XP_010492569.1|  PREDICTED: glutamine synthetase cytosolic is...    582   0.0      
gb|AAD31899.1|AF145481_1  cytosolic glutamine synthetase                581   0.0      Mesembryanthemum crystallinum
gb|AGI78873.1|  glutamine synthetase                                    581   0.0      
sp|O04867.1|GLNA1_ALNGL  RecName: Full=Glutamine synthetase; AltN...    581   0.0      Alnus glutinosa
gb|ACG47508.1|  glutamine synthetase root isozyme 5                     581   0.0      Zea mays [maize]
emb|CDY38104.1|  BnaC02g06690D                                          580   0.0      
dbj|BAA04996.1|  glutamine synthetase                                   580   0.0      Raphanus sativus
ref|XP_007141924.1|  hypothetical protein PHAVU_008G237500g             580   0.0      
ref|XP_006484548.1|  PREDICTED: glutamine synthetase nodule isozy...    580   0.0      
ref|XP_007209293.1|  hypothetical protein PRUPE_ppa007728mg             580   0.0      
gb|AGZ15411.1|  glutamine synthetase PR-2                               580   0.0      
dbj|BAE98486.1|  glutamine synthetase like protein                      580   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126124.1|  PREDICTED: glutamine synthetase cytosolic is...    580   0.0      
gb|AGI78872.1|  glutamine synthetase                                    580   0.0      
emb|CDY49656.1|  BnaC09g41340D                                          580   0.0      
gb|KFK41041.1|  hypothetical protein AALP_AA2G077900                    580   0.0      
ref|XP_009414782.1|  PREDICTED: glutamine synthetase cytosolic is...    580   0.0      
ref|XP_002527139.1|  glutamine synthetase plant, putative               580   0.0      Ricinus communis
ref|XP_010453820.1|  PREDICTED: glutamine synthetase cytosolic is...    579   0.0      
tpg|DAA44139.1|  TPA: glutamine synthetase6                             580   0.0      
dbj|BAM84282.1|  glutamine synthetase                                   579   0.0      
emb|CDX69442.1|  BnaA10g17910D                                          579   0.0      
ref|XP_006437563.1|  hypothetical protein CICLE_v10031939mg             579   0.0      
gb|AAM63710.1|  glutamine synthetase, putative                          579   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAO42253.1|  putative glutamine synthetase                           579   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002306385.1|  glutamine synthetase family protein                579   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009401139.1|  PREDICTED: glutamine synthetase nodule isozy...    579   0.0      
ref|XP_009121474.1|  PREDICTED: glutamine synthetase cytosolic is...    579   0.0      
gb|AEM42903.1|  cytosolic glutamine synthetase isoform                  578   0.0      
gb|KFK25875.1|  hypothetical protein AALP_AA8G173600                    578   0.0      
ref|XP_002883089.1|  ATGSKB6                                            578   0.0      
ref|NP_568335.1|  glutamine synthetase 1;4                              578   0.0      Arabidopsis thaliana [mouse-ear cress]
sp|P08282.2|GLNA1_PEA  RecName: Full=Glutamine synthetase nodule ...    578   0.0      Pisum sativum [garden pea]
emb|CAA73064.1|  cytosolic glutamine synthetase                         578   0.0      Brassica napus [oilseed rape]
gb|AGV54248.1|  glutamine synthetase                                    578   0.0      
gb|ACR45959.1|  glutamine synthetase 1a                                 577   0.0      Lolium perenne [perennial ryegrass]
ref|XP_011022058.1|  PREDICTED: glutamine synthetase cytosolic is...    577   0.0      
ref|XP_004490827.1|  PREDICTED: glutamine synthetase nodule isozy...    577   0.0      
ref|XP_004240034.1|  PREDICTED: glutamine synthetase-like               577   0.0      
ref|XP_010551131.1|  PREDICTED: glutamine synthetase nodule isozy...    577   0.0      
gb|AGC24238.1|  glutamine synthetase 1                                  577   0.0      
ref|XP_004981993.1|  PREDICTED: glutamine synthetase cytosolic is...    577   0.0      
ref|XP_006828438.1|  hypothetical protein AMTR_s00060p00109730          577   0.0      
gb|AFK48742.1|  unknown                                                 576   0.0      
ref|XP_007222176.1|  hypothetical protein PRUPE_ppa007771mg             576   0.0      
ref|XP_008221045.1|  PREDICTED: glutamine synthetase nodule isozy...    576   0.0      
ref|XP_006298020.1|  hypothetical protein CARUB_v10014064mg             575   0.0      
gb|AFB69880.1|  glutamine synthetase isoform 1r                         575   0.0      
ref|XP_004140309.1|  PREDICTED: glutamine synthetase nodule isozy...    575   0.0      
ref|XP_006590377.1|  PREDICTED: glutamine synthetase cytosolic is...    575   0.0      
gb|KCW52167.1|  hypothetical protein EUGRSUZ_J01606                     575   0.0      
gb|AAW21275.1|  glutamine synthetase                                    575   0.0      Saccharum officinarum [noble cane]
ref|XP_008240120.1|  PREDICTED: glutamine synthetase nodule isozyme     575   0.0      
ref|XP_006360384.1|  PREDICTED: glutamine synthetase nodule isozy...    575   0.0      
gb|KHG00904.1|  Glutamine synthetase nodule isozyme                     574   0.0      
gb|AAR84347.1|  glutamine synthetase isoform GSr1                       574   0.0      Triticum aestivum [Canadian hard winter wheat]
pir||S30569  glutamate-ammonia ligase (EC 6.3.1.2), cytosolic - b...    575   0.0   
gb|AHJ10959.1|  cytosolic glutamine synthetase 1 isoform 1              574   0.0      
gb|KCW69394.1|  hypothetical protein EUGRSUZ_F02872                     573   0.0      
gb|AFX60876.1|  glutamine synthetase isoform GS1_2                      573   0.0      
ref|XP_006400196.1|  hypothetical protein EUTSA_v10013948mg             573   0.0      
sp|Q06378.1|GLNA3_HORVU  RecName: Full=Glutamine synthetase; AltN...    573   0.0      Hordeum vulgare [barley]
gb|AGG19203.1|  glutamine synthetase                                    573   0.0      
ref|NP_001185327.1|  glutamine synthetase                               573   0.0      
ref|XP_009351711.1|  PREDICTED: glutamine synthetase nodule isozy...    573   0.0      
ref|XP_003558466.1|  PREDICTED: glutamine synthetase cytosolic is...    573   0.0      
ref|XP_002873784.1|  GLN1_4                                             573   0.0      
ref|XP_008340445.1|  PREDICTED: glutamine synthetase PR-2               573   0.0      
ref|XP_010465841.1|  PREDICTED: glutamine synthetase cytosolic is...    573   0.0      
ref|XP_004297747.1|  PREDICTED: glutamine synthetase nodule isozy...    572   0.0      
gb|AAT39510.1|  glutamine synthetase                                    572   0.0      
gb|AAG40237.2|  glutamine synthetase GS1                                572   0.0      
gb|ABK23723.1|  unknown                                                 572   0.0      
gb|AAR84349.1|  glutamine synthetase isoform GSe1                       572   0.0      
gb|KDP24824.1|  hypothetical protein JCGZ_25308                         572   0.0      
gb|AAR84348.1|  glutamine synthetase isoform GSr2                       572   0.0      
gb|ACL54769.1|  unknown                                                 572   0.0      
gb|ABF06665.1|  glutamine synthetase                                    572   0.0      
gb|AHJ10960.1|  cytosolic glutamine synthetase 1 isoform 2              571   0.0      
ref|XP_010505938.1|  PREDICTED: glutamine synthetase cytosolic is...    571   0.0      
gb|KFK39112.1|  hypothetical protein AALP_AA3G202500                    571   0.0      
gb|EMT08718.1|  Glutamine synthetase cytosolic isozyme 1-3              571   0.0      
gb|AGT16433.1|  glutamine synthetase                                    571   0.0      
ref|XP_008350820.1|  PREDICTED: glutamine synthetase nodule isozy...    570   0.0      
ref|NP_001051067.1|  Os03g0712800                                       570   0.0      
gb|AEH16645.1|  glutamine synthetase                                    569   0.0      
gb|AFX60877.1|  glutamine synthetase isoform GS1_3                      569   0.0      
ref|XP_006406687.1|  hypothetical protein EUTSA_v10021026mg             569   0.0      
ref|XP_003616263.1|  Glutamine synthetase                               568   0.0      
emb|CAA65174.1|  glutamine synthetase                                   568   0.0      
gb|ACN40288.1|  unknown                                                 568   0.0      
gb|AGC24234.1|  glutamine synthetase 1                                  567   0.0      
gb|EEC76061.1|  hypothetical protein OsI_13264                          568   0.0      
dbj|BAK03130.1|  predicted protein                                      567   0.0      
gb|EMT12639.1|  Glutamine synthetase                                    566   0.0      
gb|AAR84350.1|  glutamine synthetase isoform GSe2                       566   0.0      
ref|XP_010528562.1|  PREDICTED: glutamine synthetase cytosolic is...    565   0.0      
ref|XP_009145973.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    565   0.0      
emb|CDY01727.1|  BnaC04g30250D                                          565   0.0      
ref|XP_006405854.1|  hypothetical protein EUTSA_v10027817mg             564   0.0      
ref|XP_006651743.1|  PREDICTED: glutamine synthetase cytosolic is...    565   0.0      
gb|AEM42901.1|  cytosolic glutamine synthetase isoform                  565   0.0      
ref|XP_009135551.1|  PREDICTED: glutamine synthetase cytosolic is...    565   0.0      
ref|XP_010549036.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    566   0.0      
ref|XP_006828441.1|  hypothetical protein AMTR_s00060p00116070          565   0.0      
dbj|BAA04994.1|  glutamine synthetase                                   564   0.0      
ref|XP_009370556.1|  PREDICTED: glutamine synthetase cytosolic is...    563   0.0      
gb|KCW48619.1|  hypothetical protein EUGRSUZ_K02283                     563   0.0      
ref|NP_001238531.1|  glutamine synthetase cytosolic isozyme 1           563   0.0      
ref|XP_010231134.1|  PREDICTED: glutamine synthetase cytosolic is...    563   0.0      
gb|AGW24651.1|  cytosolic glutamine synthetase                          563   0.0      
gb|ACR45960.1|  glutamine synthetase 1b                                 562   0.0      
ref|XP_002964238.1|  hypothetical protein SELMODRAFT_82032              564   0.0      
gb|AGW24652.1|  cytosolic glutamine synthetase                          562   0.0      
gb|EMS45858.1|  Glutamine synthetase cytosolic isozyme 1-3              561   0.0      
ref|XP_008229355.1|  PREDICTED: glutamine synthetase cytosolic is...    560   0.0      
gb|AIR07817.1|  cytosolic glutamine synthetase 1-2                      559   0.0      
emb|CDY68590.1|  BnaAnng27730D                                          560   0.0      
sp|O22504.1|GLNA1_DAUCA  RecName: Full=Glutamine synthetase cytos...    560   0.0      
gb|KHG01188.1|  Glutamine synthetase nodule isozyme                     560   0.0      
sp|P52783.1|GLNA_PINSY  RecName: Full=Glutamine synthetase cytoso...    559   0.0      
emb|CAA06383.1|  glutamine synthetase                                   559   0.0      
gb|AAG40238.2|AF302115_1  glutamine synthetase GS1                      558   0.0      
gb|AIR07816.1|  cytosolic glutamine synthetase 1-1                      557   0.0      
gb|ABK21449.1|  unknown                                                 558   0.0      
emb|CAA57346.1|  glutamate--ammonia ligase                              558   0.0      
ref|XP_002989575.1|  hypothetical protein SELMODRAFT_184683             557   0.0      
ref|XP_009113719.1|  PREDICTED: glutamine synthetase cytosolic is...    556   0.0      
ref|XP_001782920.1|  predicted protein                                  556   0.0      
emb|CAA52448.1|  glutamate--ammonia ligase                              556   0.0      
gb|ACF78695.1|  unknown                                                 556   0.0      
ref|NP_001105443.1|  glutamine synthetase root isozyme 2                554   0.0      
emb|CAA57216.1|  glutamate--ammonia ligase                              553   0.0      
ref|XP_001755833.1|  predicted protein                                  553   0.0      
ref|XP_001782914.1|  predicted protein                                  552   0.0      
ref|XP_006437564.1|  hypothetical protein CICLE_v10031939mg             550   0.0      
gb|AAM62764.1|  glutamine synthetase, putative                          549   0.0      
ref|XP_002891436.1|  hypothetical protein ARALYDRAFT_891668             548   0.0      
ref|XP_009145971.1|  PREDICTED: glutamine synthetase cytosolic is...    547   0.0      
ref|NP_175280.1|  glutamine synthetase cytosolic isozyme 1-5            547   0.0      
ref|XP_006393403.1|  hypothetical protein EUTSA_v10011613mg             546   0.0      
ref|XP_011071523.1|  PREDICTED: glutamine synthetase leaf isozyme...    549   0.0      
gb|ACN26845.1|  unknown                                                 545   0.0      
ref|XP_002977477.1|  hypothetical protein SELMODRAFT_151817             546   0.0      
ref|XP_010255852.1|  PREDICTED: glutamine synthetase leaf isozyme...    548   0.0      
ref|XP_009147968.1|  PREDICTED: glutamine synthetase cytosolic is...    545   0.0      
emb|CDY49672.1|  BnaC06g02010D                                          545   0.0      
ref|XP_010557680.1|  PREDICTED: glutamine synthetase, chloroplast...    548   0.0      
ref|XP_002972155.1|  hypothetical protein SELMODRAFT_270944             545   0.0      
ref|XP_010666333.1|  PREDICTED: glutamine synthetase leaf isozyme...    547   0.0      
gb|KDO50819.1|  hypothetical protein CISIN_1g018434mg                   543   0.0      
gb|KFK36091.1|  hypothetical protein AALP_AA4G076200                    543   0.0      
ref|XP_006306121.1|  hypothetical protein CARUB_v10011565mg             543   0.0      
ref|XP_010542001.1|  PREDICTED: glutamine synthetase, chloroplast...    546   0.0      
ref|XP_011090823.1|  PREDICTED: glutamine synthetase leaf isozyme...    544   0.0      
gb|AAF17703.1|AF031082_1  glutamine synthetase                          543   0.0      
ref|XP_006391363.1|  hypothetical protein EUTSA_v10018774mg             540   0.0      
emb|CDO98975.1|  unnamed protein product                                542   0.0      
ref|XP_004134161.1|  PREDICTED: glutamine synthetase leaf isozyme...    541   0.0      
ref|NP_001284439.1|  glutamine synthetase leaf isozyme, chloropla...    541   0.0      
ref|XP_010066985.1|  PREDICTED: glutamine synthetase cytosolic is...    537   0.0      
gb|ADK27329.1|  plastid glutamine synthetase                            541   0.0      
ref|XP_009124267.1|  PREDICTED: glutamine synthetase, chloroplastic     541   0.0      
gb|ABY87178.1|  chloroplast glutamine synthetase                        540   0.0      
ref|XP_007147796.1|  hypothetical protein PHAVU_006G155800g             540   0.0      
ref|XP_006593484.1|  PREDICTED: glutamine synthetase precursor is...    540   0.0      
ref|XP_008438737.1|  PREDICTED: glutamine synthetase leaf isozyme...    540   0.0      
ref|XP_006653841.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    539   0.0      
ref|XP_010500377.1|  PREDICTED: glutamine synthetase cytosolic is...    536   0.0      
dbj|BAF62340.1|  glutamine synthetase                                   539   0.0      
gb|KDO52770.1|  hypothetical protein CISIN_1g018391mg                   535   0.0      
ref|XP_006395952.1|  hypothetical protein EUTSA_v10004280mg             538   0.0      
gb|AAB03492.1|  cytosolic glutamine synthetase                          535   0.0      
gb|KHG04493.1|  Glutamine synthetase leaf isozyme, chloroplastic        538   0.0      
gb|ABL89188.2|  plastid glutamine synthetase 2                          538   0.0      
ref|XP_004486102.1|  PREDICTED: glutamine synthetase leaf isozyme...    538   0.0      
gb|EYU45601.1|  hypothetical protein MIMGU_mgv1a007136mg                537   0.0      
emb|CDY33684.1|  BnaC04g29670D                                          540   0.0      
ref|XP_003546121.1|  PREDICTED: glutamine synthetase leaf isozyme...    538   0.0      
gb|AAD31898.1|AF145480_1  glutamine synthetase leaf isozyme precu...    538   0.0      
gb|AHJ10961.1|  chloroplast glutamine synthetase 2 isoform 1            537   0.0      
gb|EMT23121.1|  Glutamine synthetase cytosolic isozyme 1-2              535   0.0      
ref|XP_002868428.1|  hypothetical protein ARALYDRAFT_493621             537   0.0      
gb|AFH88076.1|  chloroplast glutamine synthetase protein                537   0.0      
ref|XP_010041422.1|  PREDICTED: glutamine synthetase leaf isozyme...    537   0.0      
ref|XP_010035896.1|  PREDICTED: glutamine synthetase leaf isozyme...    537   0.0      
emb|CAN61808.1|  hypothetical protein VITISV_014295                     537   0.0      
ref|XP_002279497.1|  PREDICTED: glutamine synthetase leaf isozyme...    537   0.0      
ref|XP_002274139.1|  PREDICTED: glutamine synthetase leaf isozyme...    537   0.0      
ref|NP_198413.1|  glutamine synthetase 2                                536   0.0      
dbj|BAD12057.1|  plastidic glutamine synthetase                         536   0.0      
gb|AAN84563.1|  glutamine synthetase                                    536   0.0      
ref|XP_010035905.1|  PREDICTED: glutamine synthetase leaf isozyme...    536   0.0      
gb|KDP40083.1|  hypothetical protein JCGZ_02081                         536   0.0      
prf||1601519A  Gln synthetase                                           536   0.0   
gb|AHJ10962.1|  chloroplast glutamine synthetase 2 isoform 2            536   0.0      
ref|NP_001054133.1|  Os04g0659100                                       536   0.0      
ref|XP_010089044.1|  Glutamine synthetase nodule isozyme                532   0.0      
gb|AJD14836.1|  plastid glutamine synthetase                            536   0.0      
gb|ACU24520.1|  unknown                                                 536   0.0      
gb|AAD49734.1|AF169795_1  glutamine synthetase precursor                536   0.0      
ref|XP_010435452.1|  PREDICTED: glutamine synthetase, chloroplast...    535   0.0      
ref|XP_010450396.1|  PREDICTED: glutamine synthetase, chloroplast...    536   0.0      
ref|XP_010435449.1|  PREDICTED: glutamine synthetase, chloroplast...    535   0.0      
emb|CAB72423.1|  glutamine synthetase                                   535   0.0      
ref|XP_009108017.1|  PREDICTED: glutamine synthetase, chloroplast...    535   0.0      
emb|CAA73062.1|  plastidic glutamine synthetase precursor               535   0.0      
ref|XP_011006593.1|  PREDICTED: glutamine synthetase leaf isozyme...    535   0.0      
ref|XP_009339932.1|  PREDICTED: glutamine synthetase leaf isozyme...    535   0.0      
ref|XP_004229461.1|  PREDICTED: glutamine synthetase, chloroplastic     535   0.0      
ref|XP_010435447.1|  PREDICTED: glutamine synthetase, chloroplast...    535   0.0      
gb|KDO74872.1|  hypothetical protein CISIN_1g013478mg                   535   0.0      
ref|XP_006282617.1|  hypothetical protein CARUB_v10004865mg             535   0.0      
ref|XP_002516801.1|  glutamine synthetase plant, putative               535   0.0      
ref|XP_004296981.1|  PREDICTED: glutamine synthetase leaf isozyme...    535   0.0      
gb|AAN84537.1|  putative plastidic glutamine synthetase                 535   0.0      
gb|AAO85218.1|  glutamine synthetase PR2 mutant                         534   0.0      
gb|ACF17656.1|  putative glutamine synthase 2                           534   0.0      
ref|XP_010105702.1|  Glutamine synthetase leaf isozyme                  534   0.0      
ref|XP_009629915.1|  PREDICTED: glutamine synthetase, chloroplastic     534   0.0      
gb|ACG35376.1|  glutamine synthetase                                    534   0.0      
ref|XP_010938796.1|  PREDICTED: glutamine synthetase leaf isozyme...    534   0.0      
ref|XP_003580719.1|  PREDICTED: glutamine synthetase, chloroplastic     533   0.0      
gb|AAO85217.1|  glutamine synthetase PR1 mutant                         533   0.0      
ref|XP_008662331.1|  PREDICTED: glutamine synthetase, chloroplast...    533   0.0      
ref|XP_004960149.1|  PREDICTED: glutamine synthetase, chloroplast...    533   0.0      
ref|XP_002314425.1|  glutamine synthetase family protein                533   0.0      
ref|XP_009773609.1|  PREDICTED: glutamine synthetase, chloroplastic     533   0.0      
ref|XP_008353244.1|  PREDICTED: glutamine synthetase leaf isozyme...    533   0.0      
sp|O22506.1|GLNA2_DAUCA  RecName: Full=Glutamine synthetase, chlo...    533   0.0      
sp|Q9XQ94.1|GLNA2_MEDSA  RecName: Full=Glutamine synthetase leaf ...    533   0.0      
ref|XP_009417914.1|  PREDICTED: glutamine synthetase leaf isozyme...    533   0.0      
gb|AAO37651.1|  glutamine synthetase                                    532   0.0      
gb|EMS46544.1|  Glutamine synthetase cytosolic isozyme 1-2              531   0.0      
emb|CDX75942.1|  BnaC03g40250D                                          530   0.0      
gb|AAL67439.1|  glutamine synthetase precursor                          532   0.0      
dbj|BAD12059.1|  plastidic glutamine synthetase                         532   0.0      
ref|XP_006419778.1|  hypothetical protein CICLE_v10005007mg             532   0.0      
gb|AAN84538.1|  putative plastidic glutamine synthetase                 532   0.0      
gb|ACU18743.1|  unknown                                                 531   0.0      
ref|XP_009352136.1|  PREDICTED: glutamine synthetase leaf isozyme...    532   0.0      
gb|ACG31728.1|  hypothetical protein                                    530   0.0      
ref|XP_008390805.1|  PREDICTED: glutamine synthetase leaf isozyme...    532   0.0      
gb|AAF79695.1|AC020889_3  T1N15.8                                       528   0.0      
ref|XP_007034566.1|  Glutamine synthetase 2                             536   0.0      
ref|NP_001105725.1|  glutamine synthetase, chloroplastic precursor      531   0.0      
ref|XP_008662330.1|  PREDICTED: glutamine synthetase, chloroplast...    534   0.0      
ref|NP_001237784.1|  glutamine synthetase precursor                     531   0.0      
ref|XP_002312733.1|  glutamine synthetase family protein                531   0.0      
ref|XP_008223033.1|  PREDICTED: glutamine synthetase leaf isozyme...    530   0.0      
ref|XP_007222384.1|  hypothetical protein PRUPE_ppa006025mg             530   0.0      
ref|XP_011009035.1|  PREDICTED: glutamine synthetase leaf isozyme...    530   0.0      
ref|XP_009391592.1|  PREDICTED: glutamine synthetase leaf isozyme...    530   0.0      
dbj|BAJ91545.1|  predicted protein                                      529   0.0      
gb|AGV54414.1|  glutamine synthetase                                    528   0.0      
ref|XP_006850815.1|  hypothetical protein AMTR_s00025p00120730          528   0.0      
emb|CAA34131.1|  unnamed protein product                                528   0.0      
sp|P08281.2|GLNA2_PEA  RecName: Full=Glutamine synthetase leaf is...    528   0.0      
emb|CAA29057.1|  gluthamine synthetase                                  526   0.0      
gb|AFB69878.1|  chloroplast glutamine synthetase isoform 2-1            528   0.0      
sp|P13564.2|GLNA2_HORVU  RecName: Full=Glutamine synthetase leaf ...    528   0.0      
gb|ACT22496.1|  plastid glutamine synthetase 2                          528   0.0      
gb|ACT22500.1|  plastid glutamine synthetase 2                          527   0.0      
gb|AAZ30062.1|  plastid glutamine synthetase isoform GS2c               527   0.0      
emb|CDX82343.1|  BnaA03g34780D                                          523   1e-180   
dbj|BAJ95492.1|  predicted protein                                      524   4e-180   
gb|KDO74871.1|  hypothetical protein CISIN_1g013478mg                   524   4e-180   
gb|EMS53309.1|  Glutamine synthetase leaf isozyme, chloroplastic        528   6e-180   
ref|NP_001275177.1|  glutamine synthetase, chloroplastic-like           523   2e-179   
gb|KHN37551.1|  Glutamine synthetase leaf isozyme, chloroplastic        522   2e-179   
gb|KDO74875.1|  hypothetical protein CISIN_1g013478mg                   523   3e-179   
gb|AAZ30061.1|  plastid glutamine synthetase isoform GS2b               522   3e-179   
ref|XP_006346638.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    519   4e-179   
gb|ADM45299.1|  chloroplast GS2b-alpha precursor                        520   3e-178   
gb|KDO50820.1|  hypothetical protein CISIN_1g018434mg                   514   4e-178   
sp|P14636.1|GLNA3_LUPAN  RecName: Full=Glutamine synthetase nodul...    514   5e-178   
ref|XP_004252277.1|  PREDICTED: glutamine synthetase cytosolic is...    515   1e-177   
gb|AAZ30060.1|  plastid glutamine synthetase isoform GS2a               517   2e-177   
ref|XP_010041423.1|  PREDICTED: glutamine synthetase leaf isozyme...    514   5e-177   
gb|ACR38893.1|  glutamine synthetase                                    513   8e-177   
gb|EYU43846.1|  hypothetical protein MIMGU_mgv1a010285mg                509   5e-176   
emb|CDY49365.1|  BnaA08g29950D                                          507   6e-174   
gb|KCW52168.1|  hypothetical protein EUGRSUZ_J01606                     503   5e-173   



>gb|ABW89460.1| glutamine synthetase [Gossypium herbaceum]
 gb|ABW89466.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/342 (92%), Positives = 329/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTDKIIAEYIW+GGSGMDLRSKART+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR  A+KIFSHPDVA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWPLGGYPGPQGPYYCGVG DKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPLGGYPGPQGPYYCGVGVDKAYGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+IKKAIAKL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGYEVIKKAIAKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>gb|KHG00636.1| Glutamine synthetase cytosolic isozyme 1 [Gossypium arboreum]
Length=356

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/342 (92%), Positives = 329/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTDKIIAEYIW+GGSGMDLRSKART+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR  A+KIFSHPDVA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWPLGGYPGPQGPYYCGVG DKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPLGGYPGPQGPYYCGVGVDKAYGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+IKKAIAKL LRHKEHIAAYGEGNERRLTGRHETADINT+ WGVA+RGA
Sbjct  254   TKSMRSDGGYEVIKKAIAKLGLRHKEHIAAYGEGNERRLTGRHETADINTYLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>gb|ABW89461.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/342 (92%), Positives = 328/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTDKIIAEYIW+GGSGMDLRSKART+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR  A+KIFSHPDVA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWPLGGYPGPQGPYYCGVG DKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPLGGYPGPQGPYYCGVGVDKAYGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+IKKAIAKL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGYEVIKKAIAKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRD EK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDIEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>gb|KDP25795.1| hypothetical protein JCGZ_22517 [Jatropha curcas]
Length=356

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/342 (91%), Positives = 329/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIW+GGSGMDLRSKART+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILV+CD YTPAGE IPTNKR+ A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWP+GG+PGPQGPYYCGVGADK++GRDIVD+HYKACLYAG+NISGINGEV
Sbjct  134   LLQKDIKWPIGWPIGGFPGPQGPYYCGVGADKSFGRDIVDAHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYE+IKKAI KL LRHK+HIAAYGEGNERRLTGRHETADINTFKWGVADRGA
Sbjct  254   TKSMRNDGGYEVIKKAIEKLGLRHKKHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>gb|ABW89462.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/339 (92%), Positives = 327/339 (96%), Gaps = 0/339 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTDKIIAEYIW+GGSGMDLRSKART+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR  A+KIFSHPDVA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWPLGGYPGPQGPYYCGVG DKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPLGGYPGPQGPYYCGVGVDKAYGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+IKKAIAKL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGYEVIKKAIAKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTI  1172
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTI
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTI  352



>gb|ABW89463.1| glutamine synthetase [Gossypium raimondii]
Length=356

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/342 (92%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTDKIIAEYIW+GGSGMDLRSKART+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR  A+KIFSHPDVA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWPLGGYPGPQGPYYCGVG DKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPLGGYPGPQGPYYCGVGVDKAYGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITE AGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITETAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_010926111.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Elaeis guineensis]
Length=357

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/342 (90%), Positives = 332/342 (97%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CT+K+IAEYIWVGGSGMD+RSKART+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTEKVIAEYIWVGGSGMDIRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRG+NILVMCDCYTPAG  IPTNKRY A+KIFSHPDVA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGDNILVMCDCYTPAGGPIPTNKRYNAAKIFSHPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GGYPGPQGPYYCG+GA+K++GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPVGGYPGPQGPYYCGIGAEKSFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISAAD+LWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAADQLWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MR+DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKTMRSDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFVWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_009772493.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Nicotiana 
sylvestris]
Length=356

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/342 (90%), Positives = 329/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMD+RSKART+SGPV DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTQKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CDCYTPAGE IPTNKR++A+KIFSHPDV  EEPWYG+EQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRHSAAKIFSHPDVVVEEPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWPLGG+PGPQGPYYCG+GA KA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPLGGFPGPQGPYYCGIGAGKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISAADELW ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAADELWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMRNEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILFK  355



>ref|XP_006482120.1| PREDICTED: glutamine synthetase nodule isozyme-like [Citrus sinensis]
 gb|KDO50818.1| hypothetical protein CISIN_1g018434mg [Citrus sinensis]
Length=356

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/342 (90%), Positives = 326/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIW+GGSGMD+RSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ESTDKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSH DV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHSDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPIGGYPGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA D+LWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPAVGISAGDQLWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHANYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG+E+IKKAI KL LRH EHIAAYGEGNERRLTG+HETADINTFKWGVA+RGA
Sbjct  254   TKSMRNDGGFEVIKKAIEKLGLRHSEHIAAYGEGNERRLTGKHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>gb|ABW89464.1| glutamine synthetase [Gossypium hirsutum]
 gb|ABW89465.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/342 (91%), Positives = 326/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTDKIIAEYIW+GGSGMDLRSKART+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR  A+KIFSHP VA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPGVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWPLGGYPGPQGPYYCGVG DKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPLGGYPGPQGPYYCGVGVDKAYGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITE AGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITETAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_006430603.1| hypothetical protein CICLE_v10011785mg [Citrus clementina]
 gb|ESR43843.1| hypothetical protein CICLE_v10011785mg [Citrus clementina]
Length=429

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/342 (90%), Positives = 326/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIW+GGSGMD+RSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  87    ESTDKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  146

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSH DV  EEPWYGIEQEYT
Sbjct  147   PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHSDVVAEEPWYGIEQEYT  206

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV
Sbjct  207   LLQKDVKWPLGWPIGGYPGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  266

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA D+LWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAH NYS
Sbjct  267   MPGQWEFQVGPAVGISAGDQLWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHANYS  326

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG+E+IKKAI KL LRH EHIAAYGEGNERRLTG+HETADINTFKWGVA+RGA
Sbjct  327   TKSMRNDGGFEVIKKAIEKLGLRHSEHIAAYGEGNERRLTGKHETADINTFKWGVANRGA  386

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  387   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  428



>gb|AAR86718.1| glutamine synthetase GS56 [Nicotiana attenuata]
Length=356

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/342 (90%), Positives = 328/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMD+RSKARTISGPV DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTQKIIAEYIWIGGSGMDVRSKARTISGPVDDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CDCYTPAGE IPTNKR+ A+KIFSHPDV  EEPWYG+EQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRHNAAKIFSHPDVVVEEPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWPLGG+PGPQGPYYCG+GA KA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPLGGFPGPQGPYYCGIGAGKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISAADELW ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAADELWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMRNEGGYEVIKKAIDKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILFK  355



>ref|XP_006647853.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Oryza 
brachyantha]
Length=356

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/342 (89%), Positives = 330/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKRY A+KIFS+PDVA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYNAAKIFSNPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GG+PGPQGPYYCG+GADK++GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPVGGFPGPQGPYYCGIGADKSFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ D+LWVARYILERITEIAGVV++FDPKPI GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPSVGISSGDQLWVARYILERITEIAGVVVTFDPKPIPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYEIIK AI KL+LRHKEHIAAYGEGNERRLTGRHETA+INTF WGVA+RGA
Sbjct  254   TKSMRNDGGYEIIKSAIEKLKLRHKEHIAAYGEGNERRLTGRHETAEINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTIIWK  355



>ref|XP_010250142.1| PREDICTED: glutamine synthetase nodule isozyme [Nelumbo nucifera]
Length=356

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/340 (91%), Positives = 325/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIW+GGSGMDLRSKART+SGPVTDP KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPQKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILVMCD YTPAGE IPTNKRY A+KIFSHPDV+ EEPWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVMCDAYTPAGEPIPTNKRYNAAKIFSHPDVSAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV+WP+GWP+GG+PGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVHWPIGWPVGGFPGPQGPYYCGAGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG ++IKKAI KL LRHKEHIA YGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGIDVIKKAIEKLGLRHKEHIAGYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTIL  353



>ref|XP_008812466.1| PREDICTED: glutamine synthetase nodule isozyme [Phoenix dactylifera]
Length=356

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/342 (91%), Positives = 326/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIW+GGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTDKIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKR+ A+KIFSHPDVA EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRFNAAKIFSHPDVAAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYC  GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVQWPLGWPVGGYPGPQGPYYCAAGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+ GGYEIIKKAI KL LRHKEHI+AYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRSHGGYEIIKKAIEKLGLRHKEHISAYGEGNERRLTGRHETADINTFVWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGR+TEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRETEKNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_010271347.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 [Nelumbo 
nucifera]
Length=356

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/342 (90%), Positives = 326/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIWVGGSGMD+RSKA+T+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWVGGSGMDMRSKAKTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILVMCD YTPAGE IPTNKR  A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVMCDTYTPAGEPIPTNKRCNAAKIFSHPDVLAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GG+PGPQGPYYCGVGADKAWGRDIVDSHYKACLYAG+NISGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGFPGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPS+GISA DELW+ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTN+S
Sbjct  194   MPGQWEFQVGPSIGISAGDELWIARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNFS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKS RN+GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSTRNEGGYEVIKKAIKKLGLRHKEHIAAYGEGNERRLTGRHETADINTFAWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTE+ GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTERAGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_003544980.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Glycine 
max]
 sp|O82560.1|GLNA2_SOYBN RecName: Full=Glutamine synthetase cytosolic isozyme 2; AltName: 
Full=GS1-2; AltName: Full=Glutamate--ammonia ligase [Glycine 
max]
 gb|AAC97935.1| nodule-specific glutamine synthetase [Glycine max]
 gb|KHN39471.1| Glutamine synthetase cytosolic isozyme 2 [Glycine soja]
Length=356

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/342 (90%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDK+IAEYIWVGGSGMD+RSKART+SGPV DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DITDKVIAEYIWVGGSGMDMRSKARTLSGPVKDPSKLPKWNYDGSSTGQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRG+NILVMCD YTPAGE IPTNKR  A+KIF HPDVA EEPWYG+EQEYT
Sbjct  74    PQAIFKDPFRRGSNILVMCDAYTPAGEPIPTNKRNNAAKIFGHPDVAAEEPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWPLGG+PGPQGPYYCG GA+KA+GRDIVDSHYKAC+YAGINISGINGEV
Sbjct  134   LLQKDVQWPLGWPLGGFPGPQGPYYCGTGANKAFGRDIVDSHYKACIYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPS+GISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSIGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYE+IKKAIAKL+ RHKEHIAAYGEGNERRLTGRHETAD+NTF WGVA+RGA
Sbjct  254   TKSMRNDGGYEVIKKAIAKLEKRHKEHIAAYGEGNERRLTGRHETADMNTFVWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_010909363.1| PREDICTED: glutamine synthetase nodule isozyme [Elaeis guineensis]
Length=356

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/342 (90%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIW+GGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTDKIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKR+ A+KIFSHP+VA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRFNAAKIFSHPNVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYC  GADKA+GRDIV+SHYKACLYAG+NISGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGYPGPQGPYYCAAGADKAFGRDIVNSHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELW+ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWIARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+IKKAI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGYEVIKKAIEKLGKRHKEHIAAYGEGNERRLTGRHETADINTFVWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGR+TEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRETEKNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_009614064.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Nicotiana 
tomentosiformis]
Length=356

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/342 (89%), Positives = 329/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMD+RSKART+SGPV DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTQKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CDCYTP GE IPTNKR++A+KIFSHPDV  EEPWYG+EQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDCYTPTGEPIPTNKRHSAAKIFSHPDVVVEEPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWPLGG+PGPQGPYYCG+GA KA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPLGGFPGPQGPYYCGIGAGKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISAADELW ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAADELWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMRNEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTE++GKGYFEDRRPASNMDPY VTSMIAETTIL++
Sbjct  314   SIRVGRDTEREGKGYFEDRRPASNMDPYVVTSMIAETTILYE  355



>gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis]
Length=356

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/342 (89%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSGMD+RSKART+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTDKIIAEYIWIGGSGMDMRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQ+DV WP+GWPLGGYPGPQGPYYC +GADK++GRD+VDSHYK+CLYAGINISGINGEV
Sbjct  134   LLQRDVKWPIGWPLGGYPGPQGPYYCSIGADKSFGRDVVDSHYKSCLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRHDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKQGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|NP_001048045.1| Os02g0735200 [Oryza sativa Japonica Group]
 sp|P14656.1|GLN11_ORYSJ RecName: Full=Glutamine synthetase cytosolic isozyme 1-1; AltName: 
Full=Glutamate--ammonia ligase GLN1;1; Short=OsGLN1;1; 
AltName: Full=Glutamine synthetase shoot isozyme; AltName: 
Full=OsGS1;1 [Oryza sativa Japonica Group]
 emb|CAA32461.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAA95679.1| cytosolic glutamine synthethase 1;1 [Oryza sativa Japonica Group]
 dbj|BAA95678.1| cytosolic glutamine synthetase 1;1 [Oryza sativa Japonica Group]
 dbj|BAD15892.1| glutamine synthetase shoot isozyme [Oryza sativa Japonica Group]
 dbj|BAF09959.1| Os02g0735200 [Oryza sativa Japonica Group]
 gb|EAZ24534.1| hypothetical protein OsJ_08295 [Oryza sativa Japonica Group]
 dbj|BAG87764.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97064.1| unnamed protein product [Oryza sativa Japonica Group]
Length=356

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/342 (89%), Positives = 330/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+SGPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCDCYTPAGE IPTNKR+ A+KIFS P+VA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDCYTPAGEPIPTNKRHNAAKIFSSPEVASEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GG+PGPQGPYYCG+GADK++GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPVGGFPGPQGPYYCGIGADKSFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA D++WVARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDQVWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYEIIK AI KL+LRHKEHI+AYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGYEIIKSAIEKLKLRHKEHISAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SVRVGRETEQNGKGYFEDRRPASNMDPYIVTSMIAETTIIWK  355



>ref|XP_010932552.1| PREDICTED: glutamine synthetase nodule isozyme [Elaeis guineensis]
Length=356

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/342 (90%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIW+GGSGMD+RSKART+ GPVTD SKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTEKIIAEYIWIGGSGMDIRSKARTLPGPVTDSSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKR+ A+KIFSHPDVA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRFNAAKIFSHPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV+WPLGWP+GGYPGPQGPYYC  GADK++GRDIVDSHYKACLYAG+NISGINGEV
Sbjct  134   LLQKDVHWPLGWPVGGYPGPQGPYYCSAGADKSFGRDIVDSHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELW+ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWIARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+IKKAI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGYEVIKKAIGKLGKRHKEHIAAYGEGNERRLTGRHETADINTFVWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGR+TEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRETEKNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|NP_001268175.1| glutamine synthetase cytosolic isozyme 1 [Vitis vinifera]
 sp|P51118.1|GLNA1_VITVI RecName: Full=Glutamine synthetase cytosolic isozyme 1; AltName: 
Full=Glutamate--ammonia ligase [Vitis vinifera]
 emb|CAA63981.1| glutamine synthetase [Vitis vinifera]
 emb|CBI15615.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/342 (89%), Positives = 326/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+K+I EYIWVGGSGMDLRSKART+SGPV+DP+KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTEKVIVEYIWVGGSGMDLRSKARTLSGPVSDPAKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR  A+KIFSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRCNAAKIFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+V WP+GWP+GG+PGPQGPYYCG+GADKAWGRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKEVKWPIGWPVGGFPGPQGPYYCGIGADKAWGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWE+QVGPSVGISA DELWV+RYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEYQVGPSVGISAGDELWVSRYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG+E+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGFEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>gb|AAK08103.1|AF338444_1 glutamine synthetase [Avicennia marina]
Length=356

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/342 (90%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEY+WVGGSGMDLRSKARTISGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTEKIIAEYVWVGGSGMDLRSKARTISGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRG NILVMCD YTPAGE IPTNKR+ A+KIFSHPDVA EEPWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGKNILVMCDTYTPAGEPIPTNKRHAAAKIFSHPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+V WP+GWP GGYPGPQGPYYCGVGADKA+GRDIVD+HYK+CLYAGINISGINGEV
Sbjct  134   LLQKNVKWPMGWPTGGYPGPQGPYYCGVGADKAFGRDIVDAHYKSCLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELW+ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWMARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GG+E+IKKAI KL  RHKEHIAAYGEGNERRLTGRHETADIN+FKWGVA+RGA
Sbjct  254   TKSMRKEGGFEVIKKAIEKLGHRHKEHIAAYGEGNERRLTGRHETADINSFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTE++GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEREGKGYFEDRRPASNMDPYIVTSMIAETTILGK  355



>ref|XP_011085871.1| PREDICTED: glutamine synthetase cytosolic isozyme [Sesamum indicum]
Length=356

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/342 (89%), Positives = 328/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEY+W+GGSGMDLRSKART++GPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ESTDKIIAEYVWIGGSGMDLRSKARTLAGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILVMCD YTPAGEAIPTN R+ A+KIFSHPDVA EEPWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVMCDAYTPAGEAIPTNNRHRAAKIFSHPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LL+KDV WPLGWP GG+PGPQGPYYCG+GADKA+GRDIVD+HYKACLYAG+NISGINGEV
Sbjct  134   LLKKDVKWPLGWPTGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W+ARYILERITEIAGVV+SFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWIARYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYEIIKKAI KL  RHKEHIAAYGEGNERRLTG+HETA+INTFKWGVA+RGA
Sbjct  254   TKSMRKEGGYEIIKKAIEKLGHRHKEHIAAYGEGNERRLTGKHETANINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_003519325.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 isoform 1 
[Glycine max]
 gb|KHN41060.1| Glutamine synthetase cytosolic isozyme 2 [Glycine soja]
Length=356

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/342 (91%), Positives = 326/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDK+IAEYIWVGGSGMD+RSKART+SG V DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DITDKVIAEYIWVGGSGMDMRSKARTLSGLVNDPSKLPKWNYDGSSTGQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILVMCD YTPAGE IPTNKR  A+KIFS+PDVA EEPWYG+EQEYT
Sbjct  74    PQAIFRDPFRRGNNILVMCDAYTPAGEPIPTNKRNKAAKIFSNPDVAAEEPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWPLGG+PGPQGPYYCG GA+KA+GRDIVDSHYKAC+YAGINISGINGEV
Sbjct  134   LLQKDVQWPLGWPLGGFPGPQGPYYCGTGANKAFGRDIVDSHYKACIYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK MRNDGGYEIIKKAIAKL+ RHKEHIAAYGEGNERRLTGRHETAD+NTF WGVA+RGA
Sbjct  254   TKLMRNDGGYEIIKKAIAKLEKRHKEHIAAYGEGNERRLTGRHETADMNTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>gb|AIK03054.1| glutamine synthetase [Eichhornia crassipes]
Length=356

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/342 (89%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+IAEYIW+GGSGMD+RSKART+ GPVTDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKVIAEYIWIGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTN RY A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNNRYNAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYC  GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGYPGPQGPYYCSAGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGR+TEK+GKGYFEDRRPASNMDPY VTSM+AETTIL K
Sbjct  314   SIRVGRETEKNGKGYFEDRRPASNMDPYVVTSMVAETTILWK  355



>ref|XP_007036933.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
 gb|EOY21434.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
Length=356

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/342 (90%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+K+IAEYIW+GGSGMDLRSKART+  PV+DP KLP WNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTEKVIAEYIWIGGSGMDLRSKARTLPAPVSDPQKLPTWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKRY A+KIFSHP V  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRYNAAKIFSHPKVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+V WP+GWP GGYPGPQGPYYCGVGADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKEVKWPIGWPTGGYPGPQGPYYCGVGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARY+LERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYLLERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYEIIKKAI  L+LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGYEIIKKAIENLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEKCGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>emb|CBI33470.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/342 (90%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+SGPV+DP KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DVTEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPHKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDV  EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHNAAKIFSHPDVLAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQ  V WP+GWP+GGYPGPQGPYYCG+GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQNSVKWPIGWPVGGYPGPQGPYYCGIGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVV+SFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_008775534.1| PREDICTED: glutamine synthetase nodule isozyme-like [Phoenix 
dactylifera]
Length=359

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/340 (91%), Positives = 326/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIWVGGSGMD+RSKART+  PV+DPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  19    TEKIIAEYIWVGGSGMDIRSKARTLPEPVSDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  78

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCDCYTPAGE IPTNKRY A+KIFS PDVA EE WYGIEQEYTLL
Sbjct  79    AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYNAAKIFSRPDVAAEETWYGIEQEYTLL  138

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDVNWPLGWP GGYPGPQGPYYCGVGADK++GRDIVDSHYKACLYAGI+ISGINGEVMP
Sbjct  139   QKDVNWPLGWPTGGYPGPQGPYYCGVGADKSFGRDIVDSHYKACLYAGIDISGINGEVMP  198

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGISA D+LWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK
Sbjct  199   GQWEFQVGPAVGISAGDQLWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  258

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR+DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADIN F+WGVA+RGAS+
Sbjct  259   SMRSDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINNFQWGVANRGASI  318

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  319   RVGRDTEKNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  358



>ref|NP_001267644.1| glutamine synthetase cytosolic isozyme-like [Cucumis sativus]
 gb|AEZ56958.1| glutamine synthetase [Cucumis sativus]
 gb|KGN57792.1| hypothetical protein Csa_3G304140 [Cucumis sativus]
Length=356

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/342 (89%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILV+CD YTPAGE IPTNKR+ A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVVCDTYTPAGEPIPTNKRHAAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GG+PGPQGPYYCGVG DKA+GRDIVD+HYKACLYAG+NISGINGEV
Sbjct  134   LLQKDVKWPIGWPIGGFPGPQGPYYCGVGVDKAFGRDIVDAHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL+LRHKEHIAAYGEGNERRLTGRHETADI+TF WGVA+RGA
Sbjct  254   TKSMREEGGYEVIKKAIEKLKLRHKEHIAAYGEGNERRLTGRHETADIHTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK+GKGYFEDRRPASNMDPY VTSM+AETTIL K
Sbjct  314   SVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMVAETTILWK  355



>ref|XP_007032111.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
 gb|EOY03037.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
Length=356

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/342 (90%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CT+KIIAEYIW+GGSGMDLRSKART+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR  A+KIF HPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCAAAKIFRHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWPLGGYPGPQGPYYCGVG DKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPLGGYPGPQGPYYCGVGVDKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELW+ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWIARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRCDGGYEVIKKAIQKLGQRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTIVWK  355



>emb|CAN68162.1| hypothetical protein VITISV_015673 [Vitis vinifera]
Length=356

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/342 (90%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSGMDLRSKART+SGPV+DP KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DATDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPHKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSHP+V  EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHNAAKIFSHPEVLAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQ  V WP+GWP+GGYPGPQGPYYCG+GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQNSVKWPIGWPVGGYPGPQGPYYCGIGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVV+SFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAE+TIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAESTILWK  355



>ref|XP_007141923.1| hypothetical protein PHAVU_008G237400g [Phaseolus vulgaris]
 sp|P00965.2|GLNA3_PHAVU RecName: Full=Glutamine synthetase N-1; AltName: Full=Gln isozyme 
gamma; AltName: Full=Glutamate--ammonia ligase [Phaseolus 
vulgaris]
 emb|CAA32759.1| unnamed protein product [Phaseolus vulgaris]
 gb|ESW13917.1| hypothetical protein PHAVU_008G237400g [Phaseolus vulgaris]
 prf||1713434A Gln synthetase:SUBUNIT=gamma
Length=356

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/342 (89%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+++IAEYIWVGGSGMD+RSKART+SGPV DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTERVIAEYIWVGGSGMDMRSKARTLSGPVKDPSKLPKWNYDGSSTGQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQ IFRDPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS+P+V  EEPWYGIEQEYT
Sbjct  74    PQTIFRDPFRRGNNILVMCDAYTPAGEPIPTNKRHNAAKIFSNPEVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWPLGG+PGPQGPYYCG+GA+KA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVQWPVGWPLGGFPGPQGPYYCGIGANKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYE+IKKAI KL+ RHKEHIAAYGEGNERRLTG+HETAD+NTF WGVA+RGA
Sbjct  254   TKSMRNDGGYEVIKKAITKLEKRHKEHIAAYGEGNERRLTGKHETADMNTFIWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTLLWK  355



>gb|AAW21273.1| glutamine synthetase [Saccharum officinarum]
Length=356

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/342 (88%), Positives = 330/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+SGPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKR+ A+KIFS+P+VA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRHNAAKIFSNPEVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWPLGWP+GG+PGPQGPYYCG+GADK++GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDTNWPLGWPIGGFPGPQGPYYCGIGADKSFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ D++WVARYILERITEIAGVVL+FDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISSGDQVWVARYILERITEIAGVVLTFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GGYE+IK AI KL+LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNEGGYEVIKAAIEKLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TE++GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>gb|KDP43303.1| hypothetical protein JCGZ_24224 [Jatropha curcas]
Length=356

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/342 (90%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIW+GGSG+DLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG DSEVILY
Sbjct  14    ETTDKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFR+GNNILVMCD YTPAGE IPTNKR  A+KIFSHPDV  EE WYGIEQEYT
Sbjct  74    PQAIFRDPFRKGNNILVMCDAYTPAGEPIPTNKRSNAAKIFSHPDVVAEECWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP GWP+GG+PGPQGPYYCGVGADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPTGWPVGGFPGPQGPYYCGVGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG  +IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADI+TF WGVA+RGA
Sbjct  254   TKSMRNDGGLAVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADIHTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKSGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_004162638.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
sativus]
Length=356

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/340 (90%), Positives = 327/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIWVGGSG D+RSKARTISGP++DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DFTDKIIAEYIWVGGSGKDVRSKARTISGPISDPSKLPKWNYDGSSTGQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILV+CD YTP+GEAIPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVICDSYTPSGEAIPTNKRHGAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWP+GWP+GG+PGPQGPYYCG GADK +GRDIVD+HYKACLYAG+NISGINGEV
Sbjct  134   LLQKDVNWPIGWPIGGFPGPQGPYYCGAGADKTFGRDIVDAHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISAADELWVARYILERITE+AGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAADELWVARYILERITEMAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL +RHKEHIAAYG+GNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRGEGGYEVIKKAIEKLGVRHKEHIAAYGDGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK GKGYFEDRRPASNMDPYTVTSMIAETTIL
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYTVTSMIAETTIL  353



>ref|XP_011003750.1| PREDICTED: glutamine synthetase nodule isozyme [Populus euphratica]
Length=356

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/342 (89%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSGMDLRSKART++G V+DP KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTDKIIAEYIWIGGSGMDLRSKARTLNGVVSDPHKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKRY A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRYNAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWP+GGYPGPQGPYYCG GADKA+GRD+VDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDLKWPIGWPVGGYPGPQGPYYCGAGADKAFGRDVVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIAGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG+E+IKKAI  L+LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGFEVIKKAIGNLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>emb|CDP01645.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/342 (89%), Positives = 326/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+I EYIWVGGSGMDLRSKARTISGPV DP KLPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    DSTEKVIVEYIWVGGSGMDLRSKARTISGPVDDPKKLPKWNYDGSSTGQAPGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKR+ A+KIFSHPDVA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRHNAAKIFSHPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GG+PGPQGPYYC +GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPVGGFPGPQGPYYCAIGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKS R++GGY +IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADIN F WGVA+RGA
Sbjct  254   TKSTRSEGGYGVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINNFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPYTVTSMIA+TTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYTVTSMIADTTILWK  355



>gb|KGN51032.1| Glutamine synthetase [Cucumis sativus]
Length=356

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/340 (90%), Positives = 326/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIWVGGSG D+RSKARTISGP++DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DFTDKIIAEYIWVGGSGKDVRSKARTISGPISDPSKLPKWNYDGSSTGQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILV+CD YTP GEAIPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVICDSYTPGGEAIPTNKRHGAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWP+GWP+GG+PGPQGPYYCG GADK +GRDIVD+HYKACLYAG+NISGINGEV
Sbjct  134   LLQKDVNWPIGWPIGGFPGPQGPYYCGAGADKTFGRDIVDAHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISAADELWVARYILERITE+AGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAADELWVARYILERITEMAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL +RHKEHIAAYG+GNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRGEGGYEVIKKAIEKLGVRHKEHIAAYGDGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK GKGYFEDRRPASNMDPYTVTSMIAETTIL
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYTVTSMIAETTIL  353



>ref|XP_004953842.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Setaria 
italica]
Length=356

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/342 (88%), Positives = 330/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+SGPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCDCYTPAGE IPTNKR+ A+KIFS+P+V+ EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDCYTPAGEPIPTNKRHNAAKIFSNPEVSAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWPLGWP+GG+PGPQGPYYCG+GADK++GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDTNWPLGWPVGGFPGPQGPYYCGIGADKSFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA D++WVARYILERITEIAGVV++FDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDQVWVARYILERITEIAGVVVTFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYE+IK AI KL+LRHKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGYEVIKAAIEKLKLRHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTIIWK  355



>gb|ABK94916.1| unknown [Populus trichocarpa]
Length=356

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/342 (90%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSGMDLRSKART+ G V+DP KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTDKIIAEYIWIGGSGMDLRSKARTLDGAVSDPQKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR++A+KIFSHPDV  E PWYG+EQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHSAAKIFSHPDVVAEVPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WPLGWP+GGYPGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDLKWPLGWPVGGYPGPQGPYYCGAGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG+EIIKKAI KLQLRHKEHIAAYGEGNERRLTGRHETADI+TF WGVA+RGA
Sbjct  254   TKSMRNDGGFEIIKKAIGKLQLRHKEHIAAYGEGNERRLTGRHETADIHTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTILWK  355



>ref|XP_002305885.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
 gb|EEE86396.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
Length=356

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/342 (89%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEY+W+GGSG+D+RSKART+SGPV+DP+KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYLWIGGSGLDIRSKARTLSGPVSDPAKLPKWNYDGSSTGQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILV+CD YTPAGE IPTNKR  A+KIFSHPDV  E+PWYG+EQEYT
Sbjct  74    PQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRCDAAKIFSHPDVVAEKPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYCG+G DKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPIGGYPGPQGPYYCGIGVDKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELW ARYILERITE+AGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWAARYILERITEVAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             T+SMRN+GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA
Sbjct  254   TESMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_002318305.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEE96525.1| glutamine synthetase family protein [Populus trichocarpa]
Length=356

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/342 (89%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSGMDLRSKART++G V+DP KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTDKIIAEYIWIGGSGMDLRSKARTLNGVVSDPHKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKRY A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRYNAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWP+GGYPGPQGPYYCG GADKA+GRD+VDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDLKWPIGWPVGGYPGPQGPYYCGAGADKAFGRDVVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIAGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG+E+IKKAI KLQL+HKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGFEVIKKAIGKLQLKHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>ref|XP_011002191.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 [Populus 
euphratica]
Length=356

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/342 (89%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEY+W+GGSGMD+RSKART+SGPV+DP+KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYLWIGGSGMDIRSKARTLSGPVSDPAKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILV+CD YTPAGE IPTNKR  A+KIFSHPDV  E+PWYG+EQEYT
Sbjct  74    PQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRCDAAKIFSHPDVVAEKPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYCGVG DKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPIGGYPGPQGPYYCGVGVDKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPS+GISA DELW ARYILERITE+AGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSIGISAGDELWAARYILERITEVAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             T+SMRN+GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TESMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_010062276.1| PREDICTED: glutamine synthetase nodule isozyme-like [Eucalyptus 
grandis]
 gb|KCW69392.1| hypothetical protein EUGRSUZ_F02872 [Eucalyptus grandis]
Length=356

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/342 (89%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CT+KIIAEYIW+GGSGMD+RSKART  GPV DPSKLPKWNYDGSST QAPG+DSEVILY
Sbjct  14    DCTEKIIAEYIWIGGSGMDMRSKARTFPGPVNDPSKLPKWNYDGSSTNQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR GNNILVMCD YTP G+ IPTNKR  A+KIFSHP+V  EEPWYG+EQEYT
Sbjct  74    PQAIFKDPFRGGNNILVMCDAYTPGGQPIPTNKRCAAAKIFSHPNVVVEEPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GG+PGPQGPYYCG GADKA+GRDIVD+HYKACLYAGIN+SGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGFPGPQGPYYCGAGADKAFGRDIVDAHYKACLYAGINVSGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA+DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISASDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MRN+GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKTMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_004512771.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cicer arietinum]
Length=356

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/342 (89%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIWVGGSGMDLRSKART+ GPV+DPSKLPKWNYDGSST QAPGKDSEVILY
Sbjct  14    DSTEKIIAEYIWVGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTNQAPGKDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE +PTNKR+ A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDVYTPAGEPLPTNKRHNAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GG+PGPQGPYYCG+GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPIGGFPGPQGPYYCGIGADKAYGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVADRG+
Sbjct  254   TKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVADRGS  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKDGKGYFEDRRPASNMDPYIVTSMIAETTILWK  355



>ref|XP_010271383.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-like [Nelumbo 
nucifera]
Length=356

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/342 (89%), Positives = 326/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+IAEYIWVGGSG+D+RSKART+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKVIAEYIWVGGSGLDMRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILVMCD YTP+GE IPTNKR  A+KIF+HPDV  EE W+GIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVMCDTYTPSGEPIPTNKRCNAAKIFNHPDVLAEELWFGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GG+PGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPVGWPVGGFPGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELW+ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWIARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR++GGYE+IKKAI KL LRHKEHI+AYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRSEGGYEVIKKAIEKLGLRHKEHISAYGEGNERRLTGRHETADINTFVWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTE+ GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTERAGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|NP_001284433.1| glutamine synthetase cytosolic isozyme [Cucumis melo]
 gb|ABI30732.1| cytosolic glutamine synthetase [Cucumis melo]
Length=356

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/342 (89%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+SGPV+DP KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPPKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNN LV+CD YTPAGE IPTNKR+ A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNTLVICDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GG+PGPQGPYYCGVG DKA+GRDIVD+HYKACLYAG+NISGINGEV
Sbjct  134   LLQKDVKWPIGWPIGGFPGPQGPYYCGVGVDKAFGRDIVDAHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL+LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMREEGGYEVIKKAIEKLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK+GKGYFEDRRPASNM PY VTSM+AETTIL K
Sbjct  314   SVRVGRDTEKEGKGYFEDRRPASNMGPYVVTSMVAETTILWK  355



>ref|NP_001268054.1| glutamine synthetase cytosolic isozyme 2 [Vitis vinifera]
 sp|P51119.1|GLNA2_VITVI RecName: Full=Glutamine synthetase cytosolic isozyme 2; AltName: 
Full=Glutamate--ammonia ligase [Vitis vinifera]
 emb|CAA63982.1| glutamine synthetase [Vitis vinifera]
Length=356

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/342 (89%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+SGPV+DP KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DVTEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPHKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSHP+V  EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHNAAKIFSHPEVLAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQ  V WP+GWP+GGYPGPQGPYYCG+GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQNSVKWPIGWPVGGYPGPQGPYYCGIGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVV+SFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVVSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAE+TIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAESTILWK  355



>ref|XP_006405853.1| hypothetical protein EUTSA_v10027817mg [Eutrema salsugineum]
 gb|ESQ47306.1| hypothetical protein EUTSA_v10027817mg [Eutrema salsugineum]
Length=356

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/340 (89%), Positives = 324/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIWVGGSGMD+RSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+VNWP+GWP+GG+PGPQGPYYCGVGADK++GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKEVNWPVGWPIGGFPGPQGPYYCGVGADKSFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP++GISAADE+WVARYILERITEIAGVV+SFDPKPI GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPAIGISAADEIWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SIRVGRDTEKDGKGYFEDRRPASNMDPYIVTSMIAETTIL  353



>ref|XP_006387591.1| hypothetical protein POPTR_0799s00200g [Populus trichocarpa]
 gb|ERP46505.1| hypothetical protein POPTR_0799s00200g [Populus trichocarpa]
Length=356

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/342 (88%), Positives = 326/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSGMDLRSKART+ GPVTDP+KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTDKIIAEYIWIGGSGMDLRSKARTLPGPVTDPAKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCD YTPAGE IPTNKR+ A+KIFS+P +A EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRFNAAKIFSNPAIAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GG+PGPQGPYYCGVGADK++GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPVGGFPGPQGPYYCGVGADKSFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP++GISA DE+WVARYILERI EIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAIGISAGDEVWVARYILERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG+ +IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGFAVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEKDGKGYFEDRRPASNMDPY VTSM+AETTI+ K
Sbjct  314   SVRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMVAETTIIWK  355



>ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozyme-like [Fragaria 
vesca subsp. vesca]
Length=356

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/342 (89%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSGMDLRSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTDKIIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR  A+KIFSHP V  E PWYG+EQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRNAAAKIFSHPGVVAEVPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GG+PGPQGPYYC  GADKA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPIGGFPGPQGPYYCAAGADKAFGRDIVDAHYKACIYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVVLSFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVLSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG+HETADINTFKWGVA+RGA
Sbjct  254   TKSMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTIVWK  355



>ref|XP_007215605.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
 gb|EMJ16804.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
Length=356

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/342 (89%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+IAEYIW+GGSGMDLRSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE IPTNKR  A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDAYTPAGEPIPTNKRAAAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV+WPLGWP+GGYPGPQGPYYC  GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVHWPLGWPVGGYPGPQGPYYCAAGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELW ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG+HETADINTFKWGVA+RGA
Sbjct  254   TKSMRANGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTS+IAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSLIAETTILRK  355



>gb|AJD14835.1| glutamine synthetase [Boehmeria nivea]
Length=356

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/342 (89%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSGMD+RSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTDKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILV+CD YTPAGE IPTNKR+ A+KIFS PDVA EE WYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRHAAAKIFSQPDVAAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GG+PGPQGPYYC  GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGFPGPQGPYYCSAGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELW ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSM+AETTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMVAETTILWK  355



>sp|P32289.1|GLNA_VIGAC RecName: Full=Glutamine synthetase nodule isozyme; Short=GS; 
AltName: Full=Glutamate--ammonia ligase [Vigna aconitifolia]
 gb|AAA34239.1| glutamine synthetase [Vigna aconitifolia]
 prf||2106409A Gln synthetase
Length=356

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/342 (89%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSG+DLRSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    DTTEKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHNAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GG+PGPQGPYYCG GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPVGGFPGPQGPYYCGAGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MRNDGGYE+IK AI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKTMRNDGGYEVIKSAIEKLGKRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>emb|CAA65173.1| glutamine synthetase [Nicotiana tabacum]
Length=356

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/340 (89%), Positives = 325/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMD+RSKART+SGPV DPSKLPKWNYDGSSTGQAPG+DSE ILY
Sbjct  14    DSTQKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQAPGEDSEEILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CDCYTPAGE IPTNKR++A+KIFSHPDV  EEPWYG+EQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRHSAAKIFSHPDVVVEEPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWPLGG+PGPQGPYYCG+GA K +GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPLGGFPGPQGPYYCGIGAGKVFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISAADELW ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAADELWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GGYE+IKKAI  L LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMRNEGGYEVIKKAIENLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTE++GKGYFEDRRPASNMDP+ VTSMIAETTIL
Sbjct  314   SIRVGRDTEREGKGYFEDRRPASNMDPFVVTSMIAETTIL  353



>ref|XP_010528561.1| PREDICTED: glutamine synthetase nodule isozyme-like isoform X1 
[Tarenaya hassleriana]
Length=356

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/340 (90%), Positives = 324/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIWVGGSGMD+RSKART+SGPVTDPSKLPKWNYDGSST QAPG+DSEVILY
Sbjct  14    DSTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTRQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILVMCD YTP GE IPTNKR++A+KIFSHPDV  EE WYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVMCDTYTPQGEPIPTNKRHSAAKIFSHPDVVAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GGYPGPQGPYYC VGADK++GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPVGGYPGPQGPYYCAVGADKSFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELW+ARYILERITEIAGVVLSFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWIARYILERITEIAGVVLSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL++RHK+HIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMREEGGYEVIKKAIKKLEMRHKDHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTIL  353



>gb|AAK49029.1| cytosolic glutamine synthetase [Populus tremula x Populus alba]
Length=356

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/342 (88%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSGMD+RSKART+SGPVTDP++LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DITDKIIAEYIWIGGSGMDMRSKARTLSGPVTDPAQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTP GE IPTNKRY A+KIFS P+VA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPQGEPIPTNKRYAAAKIFSSPEVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQ+DVNWP+GWP+GGYPGPQGPYYCG+GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQRDVNWPIGWPVGGYPGPQGPYYCGIGADKAYGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA D +W ARYILERITE AGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDHIWAARYILERITEQAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL LRHKEHI+AYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEVIKKAIEKLGLRHKEHISAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>gb|KHG29839.1| Glutamine synthetase cytosolic isozyme 1-1 [Gossypium arboreum]
Length=356

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/342 (88%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSST QAPG DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTNQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRFNAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD  WPLGWP+GG+PGPQGPYYCGVGADK++GRDIVDSHYKACLYAG+NISGINGEV
Sbjct  134   LLQKDTKWPLGWPVGGFPGPQGPYYCGVGADKSFGRDIVDSHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA D++W+ARYILERITEIAGVVLSFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDQIWIARYILERITEIAGVVLSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG ++IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADIN+F WGVA+RGA
Sbjct  254   TKSMRNDGGIDVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINSFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_011035558.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Populus 
euphratica]
Length=356

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/342 (89%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSGMDLRSKART++G V+DP KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTDKIIAEYIWIGGSGMDLRSKARTLTGAVSDPKKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHNAAKIFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WPLGWP+GGYPGPQGPYYC  GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDLKWPLGWPVGGYPGPQGPYYCAAGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERI EIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERIAEIAGVVVSFDPKPIAGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG+EIIKKAI  LQLRHKEHIAAYGEGNERRLTGRHETADI+TF WGVA+RGA
Sbjct  254   TKSMRNDGGFEIIKKAIGNLQLRHKEHIAAYGEGNERRLTGRHETADIHTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTE++GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEREGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_006374208.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|ERP52005.1| glutamine synthetase family protein [Populus trichocarpa]
Length=348

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/342 (87%), Positives = 314/342 (92%), Gaps = 8/342 (2%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSGMDLRSKART+ G V+DP KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTDKIIAEYIWIGGSGMDLRSKARTLDGAVSDPQKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR++A+KIFSHPDV  E PWYG+EQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHSAAKIFSHPDVVAEVPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WPLGWP   Y        CG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDLKWPLGWPGPYY--------CGAGADKAFGRDIVDSHYKACLYAGINISGINGEV  185

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  186   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  245

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG+EIIKKAI KLQLRHKEHIAAYGEGNERRLTGRHETADI+TF WGVA+RGA
Sbjct  246   TKSMRNDGGFEIIKKAIGKLQLRHKEHIAAYGEGNERRLTGRHETADIHTFSWGVANRGA  305

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  306   SVRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTILWK  347



>ref|XP_010916212.1| PREDICTED: glutamine synthetase nodule isozyme-like [Elaeis guineensis]
Length=357

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/340 (88%), Positives = 326/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+K+IAEYIW+GGSGMD+RSKART+ GPV+DPSKLPKWNYDGSSTGQAPGKDSEVILYPQ
Sbjct  16    TEKVIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCDCYTPAGE IPTN RY A+KIFSHPDVA EEPWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDCYTPAGEPIPTNTRYNAAKIFSHPDVAAEEPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDVNWPLGWP+GGYPGPQGPYYC  GADK++GRDIVDSHYKACLYAGINISG+NGEVMP
Sbjct  136   QKDVNWPLGWPIGGYPGPQGPYYCAAGADKSFGRDIVDSHYKACLYAGINISGVNGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGISA D++WVAR+ILERITEIAGVVLS DPKPIQGDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPAVGISAGDQVWVARFILERITEIAGVVLSLDPKPIQGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR+DGG+++IKKAI KL LRH+EHIAAYG GNERRLTG+HETADINTF+WGVA+RGAS+
Sbjct  256   SMRSDGGFDVIKKAIEKLGLRHEEHIAAYGAGNERRLTGKHETADINTFQWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  316   RVGRDTEKNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_010103463.1| Glutamine synthetase nodule isozyme [Morus notabilis]
 gb|EXB95908.1| Glutamine synthetase nodule isozyme [Morus notabilis]
Length=356

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/342 (89%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSG+D+RSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGLDVRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR GNNILV+CD YTPAGE IPTNKR+ A+KIFSHPDVA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHAAAKIFSHPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYCGVGADKA+GRDIVD+HYKACLYAG+NISGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGYPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGV +SFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVAVSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGY++IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGYDVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMI ETTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIVETTILWK  355



>ref|XP_009385541.1| PREDICTED: glutamine synthetase nodule isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/342 (88%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIW+GGSG+DLRSKART+ GPVTDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTDKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKRY A+K+FSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYNAAKVFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GG+PGPQGPYYC  GADK++GRDIVD+HYKACLYAGIN+SGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGFPGPQGPYYCSAGADKSFGRDIVDAHYKACLYAGINVSGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ D++WVARYILERITEIAGVVLS DPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISSGDQIWVARYILERITEIAGVVLSLDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYEIIK AI KL   HKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGYEIIKSAIEKLGKMHKEHIAAYGEGNERRLTGRHETADINTFIWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_010553887.1| PREDICTED: glutamine synthetase nodule isozyme [Tarenaya hassleriana]
Length=356

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/340 (90%), Positives = 322/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIWVGGSGMD+RSKART+ GPV+DPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILVMCD YTPAGE IPTNKR  A+KIFSHPDV  EE WYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVMCDTYTPAGEPIPTNKRNAAAKIFSHPDVVAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GG+PGPQGPYYC VGADK++GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPIGGFPGPQGPYYCAVGADKSFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVVLSFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVLSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL LRHK+HIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMREEGGYEVIKKAIEKLGLRHKDHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTIL  353



>ref|XP_010036983.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Eucalyptus 
grandis]
Length=356

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/339 (90%), Positives = 324/339 (96%), Gaps = 0/339 (0%)
 Frame = +3

Query  159   CTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYP  338
              T+KIIAEYIW+GGSGMDLRSKART++GPV+DP+KLP+WNYDGSSTGQAPG+DSEVILYP
Sbjct  15    TTEKIIAEYIWIGGSGMDLRSKARTLNGPVSDPAKLPRWNYDGSSTGQAPGEDSEVILYP  74

Query  339   QAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTL  518
             QAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS PDV  E PWYGIEQEYTL
Sbjct  75    QAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRFDAAKIFSQPDVVAEVPWYGIEQEYTL  134

Query  519   LQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVM  698
             LQK+V WPLGWP+GGYPGPQGPYYCGVGADKA GRDIVDSHYKACLYAGINISGINGEVM
Sbjct  135   LQKNVRWPLGWPVGGYPGPQGPYYCGVGADKALGRDIVDSHYKACLYAGINISGINGEVM  194

Query  699   PGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYST  878
             PGQWEFQVGP+VGISA DELWVARYILERITEIA VVLSFDPKPIQGDWNGAGAHTNYST
Sbjct  195   PGQWEFQVGPAVGISAGDELWVARYILERITEIADVVLSFDPKPIQGDWNGAGAHTNYST  254

Query  879   KSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGAS  1058
             KSMRN+GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGAS
Sbjct  255   KSMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGAS  314

Query  1059  VRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             +RVGRDTE++GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  315   IRVGRDTEREGKGYFEDRRPASNMDPYVVTSMIAETTIL  353



>ref|XP_011083120.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Sesamum 
indicum]
Length=356

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/342 (89%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K IAEYIW+GGSGMDLRSKART+S PV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DVTEKTIAEYIWIGGSGMDLRSKARTLSAPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF DPFRRGN+ILVMCD YTPAGE IPTNKRY A+KIFSHP+V  EEPWYGIEQEYT
Sbjct  74    PQAIFPDPFRRGNHILVMCDAYTPAGEPIPTNKRYDAAKIFSHPEVVSEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GG+PGPQGPYYCG+GADKA+GRDIVD+HYKACLYAGIN+SGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINVSGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA D+LWVARYILERITEIAGVV+SFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDQLWVARYILERITEIAGVVVSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYEIIKKAI KL LRHK HIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEIIKKAIEKLGLRHKHHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>gb|ACJ11724.1| glutamine synthase [Gossypium hirsutum]
Length=356

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/342 (88%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSST QAPG DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTNQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRFNAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD  WPLGWP+GG+PGPQGPYYCGVGADK++GRDIVDSHYKACLYAG+NISGINGEV
Sbjct  134   LLQKDTKWPLGWPVGGFPGPQGPYYCGVGADKSFGRDIVDSHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA D++W+ARYILERITEIAGVVLSFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDQIWIARYILERITEIAGVVLSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG  +IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADIN+F WGVA+RGA
Sbjct  254   TKSMRNDGGINVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINSFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTIIWK  355



>ref|XP_006649656.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like [Oryza 
brachyantha]
Length=356

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/343 (87%), Positives = 326/343 (95%), Gaps = 0/343 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +C+DKIIAEYIWVGGSG+DLRSKART+ GP+TD S+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCSDKIIAEYIWVGGSGIDLRSKARTVKGPITDVSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRG+NILVMCDCYTP GE IPTNKRY A+KIFSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGDNILVMCDCYTPQGEPIPTNKRYNAAKIFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GGYPGPQGPYYC  GADKA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPVGGYPGPQGPYYCSAGADKAFGRDIVDAHYKACIYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGI+AAD++WVARYILER+TE+AGVVLS DPKPIQGDWNGAGAHTN+S
Sbjct  194   MPGQWEFQVGPSVGIAAADQVWVARYILERVTEVAGVVLSLDPKPIQGDWNGAGAHTNFS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREPGGYEVIKKAIDKLALRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHKD  1184
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VT MIAETT+L K+
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTGMIAETTLLWKN  356



>gb|ACU19484.1| unknown [Glycine max]
Length=356

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/342 (90%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDK+IAEYIWVGGSGMD+RSKART+SG V DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DITDKVIAEYIWVGGSGMDMRSKARTLSGLVNDPSKLPKWNYDGSSTGQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILVMCD YTPAGE IPTNKR  A+KIFS+PDVA EEPWYG+EQEYT
Sbjct  74    PQAIFRDPFRRGNNILVMCDAYTPAGEPIPTNKRNKAAKIFSNPDVAAEEPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWPLGG+PGPQGPYYCG GA+KA+GRDIVDSHYKAC+YAGINISGINGEV
Sbjct  134   LLQKDVQWPLGWPLGGFPGPQGPYYCGTGANKAFGRDIVDSHYKACIYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK MRNDGGYEIIKKAIAKL+ RHKEHIAAYGEGNERRLTGRHE AD+NTF WGVA+RGA
Sbjct  254   TKLMRNDGGYEIIKKAIAKLEKRHKEHIAAYGEGNERRLTGRHEMADMNTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
              +RVGRDTEK GKGYFEDRRPA NMDPY VTSMIAETTIL K
Sbjct  314   FIRVGRDTEKAGKGYFEDRRPAFNMDPYVVTSMIAETTILWK  355



>ref|XP_002310666.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|ABK93563.1| unknown [Populus trichocarpa]
 gb|EEE91116.1| glutamine synthetase family protein [Populus trichocarpa]
Length=356

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/342 (87%), Positives = 326/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+ GPVTDP+KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPAKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCD YTPAGE IPTNKR+ A+KIFS+P +A EEPW+GIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRFNAAKIFSNPAIAAEEPWFGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GG+PGPQGPYYCGVGADK++GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPVGGFPGPQGPYYCGVGADKSFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP++GISA DE+WVARYILERI EIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAIGISAGDEVWVARYILERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG+ +IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGFAVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEKDGKGYFEDRRPASNMDPY VTSM+AETTI+ K
Sbjct  314   SVRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMVAETTIIWK  355



>gb|ABK95973.1| unknown [Populus trichocarpa]
Length=356

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/342 (89%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSGMDLRSKART++G V+DP KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTDKIIAEYIWIGGSGMDLRSKARTLNGVVSDPHKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVM D YTPAGE IPTNKRY A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMGDAYTPAGEPIPTNKRYNAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWP+GGYPGPQGPYYCG GADKA+GRD+VDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDLKWPIGWPVGGYPGPQGPYYCGAGADKAFGRDVVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG+E+IKKAI KLQL+HKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGFEVIKKAIGKLQLKHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>ref|XP_009370554.1| PREDICTED: glutamine synthetase cytosolic isozyme isoform X1 
[Pyrus x bretschneideri]
Length=356

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/342 (89%), Positives = 320/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T KIIAEYIW+GGSGMD+RSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ESTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTP GE IPTNKR  A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDTYTPGGEPIPTNKRAAAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYC  GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGYPGPQGPYYCAAGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELW ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG+HETADINTFKWGVA+RGA
Sbjct  254   TKSMREDGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGKHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTE+ GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEQAGKGYFEDRRPASNMDPYIVTSMIAETTILLK  355



>sp|Q42899.2|GLNA1_LOTJA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=GS1; AltName: Full=Glutamate--ammonia ligase [Lotus japonicus]
Length=356

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/342 (87%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIW+GGSG+D+RSKART+ GPV+DPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTDKIIAEYIWIGGSGLDMRSKARTLPGPVSDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRG+NILV+CD YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGSNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+VNWP+GWP+GG+PGPQGPYYCG+GADKA+GRDIVD+HYKACLYAG+NISGINGEV
Sbjct  134   LLQKEVNWPVGWPIGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITEIAGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWVARYILERITEIAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKTMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>ref|XP_003619869.1| Glutamine synthetase [Medicago truncatula]
 emb|CAA71316.1| glutamine synthetase [Medicago truncatula]
 gb|AES76087.1| glutamine synthetase domain protein [Medicago truncatula]
Length=356

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/342 (89%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E ++KIIAEYIWVGGSGMDLRSKART+ GPV+DPSKLPKWNYDGSST QAPG+DSEVILY
Sbjct  14    ESSEKIIAEYIWVGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTNQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILV+CD YTPAGE +PTNKRY A+KIFSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRQGNNILVICDVYTPAGEPLPTNKRYNAAKIFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWPLGWP+GGYPGPQGPYYCG+GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDTNWPLGWPIGGYPGPQGPYYCGIGADKAYGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMRENGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEKDGKGYFEDRRP+SNMDPY VTSMIAETT+L K
Sbjct  314   SVRVGRDTEKDGKGYFEDRRPSSNMDPYVVTSMIAETTLLWK  355



>dbj|BAK01909.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFX60875.1| glutamine synthetase isoform GS1_1 [Hordeum vulgare]
 gb|AHI17510.1| cytosolic glutamine synthetase 1 [Hordeum vulgare subsp. vulgare]
 gb|AHI17511.1| cytosolic glutamine synthetase 1 [Hordeum vulgare subsp. vulgare]
Length=356

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/340 (87%), Positives = 329/340 (97%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFR+GNNILVMCDCYTPAGE IPTNKRY A+KIFS+PDVAKEEPWYGIEQEYTLL
Sbjct  76    AIFKDPFRKGNNILVMCDCYTPAGEPIPTNKRYNAAKIFSNPDVAKEEPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD+NWPLGWP+GG+PGPQGPYYCG+GADK++GRDIVDSHYKACL+AG+NISGINGEVMP
Sbjct  136   QKDINWPLGWPVGGFPGPQGPYYCGIGADKSFGRDIVDSHYKACLFAGVNISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGISA D++WVARYILERITEIAGVV++FDPKPI GDWNGAGAHTNYST+
Sbjct  196   GQWEFQVGPTVGISAGDQVWVARYILERITEIAGVVVTFDPKPIPGDWNGAGAHTNYSTE  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMRNDGG+++I  A+ KL+L+HKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGASV
Sbjct  256   SMRNDGGFKVIVDAVEKLKLKHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGASV  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  316   RVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_009393673.1| PREDICTED: glutamine synthetase nodule isozyme [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/342 (88%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIW+GGSG+D+RSKART+ GPV+DPSKLP WNYDGSSTGQAPG DSEVILY
Sbjct  14    ETTEKIIAEYIWIGGSGLDIRSKARTLPGPVSDPSKLPTWNYDGSSTGQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKR+ A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRHNAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GG+PGPQGPYYC  GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGFPGPQGPYYCSAGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG+E+IK AI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGFEVIKSAIEKLGKRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGR+TEK+GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SIRVGRETEKNGKGYFEDRRPASNMDPYVVTSMIAETTIIGK  355



>emb|CAA73366.1| glutamine synthetase [Lotus japonicus]
Length=356

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/342 (87%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIW+GGSG+D+R+KART+ GPV+DPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTDKIIAEYIWIGGSGLDMRTKARTLPGPVSDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRG+NILV+CD YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGSNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+VNWP+GWP+GG+PGPQGPYYCG+GADKA+GRDIVD+HYKACLYAG+NISGINGEV
Sbjct  134   LLQKEVNWPVGWPIGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITEIAGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWVARYILERITEIAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKTMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>pdb|4IS4|A Chain A, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|B Chain B, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|C Chain C, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|D Chain D, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|E Chain E, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|F Chain F, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|G Chain G, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|H Chain H, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|I Chain I, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|J Chain J, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
Length=378

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/342 (89%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E ++KIIAEYIWVGGSGMDLRSKART+ GPV+DPSKLPKWNYDGSST QAPG+DSEVILY
Sbjct  36    ESSEKIIAEYIWVGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTNQAPGQDSEVILY  95

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILV+CD YTPAGE +PTNKRY A+KIFSHPDVA E PWYGIEQEYT
Sbjct  96    PQAIFKDPFRQGNNILVICDVYTPAGEPLPTNKRYNAAKIFSHPDVAAEVPWYGIEQEYT  155

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWPLGWP+GGYPGPQGPYYCG+GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  156   LLQKDTNWPLGWPIGGYPGPQGPYYCGIGADKAYGRDIVDAHYKACLYAGINISGINGEV  215

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  216   MPGQWEFQVGPSVGISAGDEIWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  275

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  276   TKSMRENGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGA  335

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEKDGKGYFEDRRP+SNMDPY VTSMIAETT+L K
Sbjct  336   SVRVGRDTEKDGKGYFEDRRPSSNMDPYVVTSMIAETTLLWK  377



>ref|XP_006372556.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
 gb|ABK94934.1| unknown [Populus trichocarpa]
 gb|ABK95264.1| unknown [Populus trichocarpa]
 gb|ERP50353.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
Length=356

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/342 (89%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIWVGGSGMD+RSK RT+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYIWVGGSGMDIRSKGRTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE IPTNKR  A+KIFSHPDV  E PWYG+EQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDTYTPAGEPIPTNKRCKAAKIFSHPDVVAEVPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYCG G DKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPIGGYPGPQGPYYCGAGVDKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ DELW ARYILERITE+AGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISSGDELWAARYILERITEVAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMRNEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_009391413.1| PREDICTED: glutamine synthetase nodule isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/338 (88%), Positives = 322/338 (95%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             TD IIAEYIW+GGSGMD+RSKART++GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TDNIIAEYIWIGGSGMDMRSKARTLTGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCDCYTPAGE IPTNKR+ A+KIFSHP V  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRFNAAKIFSHPAVTAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDV WPLGWP+GG+PGPQGPYYC  GADKA+GRDIVD+HYKACLYAG+NISGINGEVMP
Sbjct  136   QKDVKWPLGWPVGGFPGPQGPYYCAAGADKAFGRDIVDAHYKACLYAGVNISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGISA DELW+ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYST+
Sbjct  196   GQWEFQVGPAVGISAGDELWIARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTQ  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR+DGGYE+IKKAI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGAS+
Sbjct  256   SMRSDGGYEVIKKAIEKLGKRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  316   RVGRETERNGKGYFEDRRPASNMDPYIVTSMIAETTIL  353



>dbj|BAD99525.1| glutamine synthetase [Camellia sinensis]
 gb|AEM44626.1| theanine synthetase [Camellia sinensis]
Length=356

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/342 (88%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+IAEYIW+GGSGMDLRSKART+SGPV+DP KLPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    DTTEKVIAEYIWIGGSGMDLRSKARTLSGPVSDPKKLPKWNYDGSSTGQAPGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTP GE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDTYTPGGEPIPTNKRFNAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK V WPLGWPLGG+PGPQGPYYCG+G DKA+GRDIVDSHYKACLYAG+NISGINGEV
Sbjct  134   LLQKQVKWPLGWPLGGFPGPQGPYYCGIGVDKAYGRDIVDSHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVV+SFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKS R+DGG+E+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSTRSDGGFEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTLLWK  355



>gb|EYU30859.1| hypothetical protein MIMGU_mgv1a008986mg [Erythranthe guttata]
Length=356

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/342 (88%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T  IIAEYIW+GGSG+D+RSKART+ GPV+DPSKLP+WNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTKSIIAEYIWIGGSGIDIRSKARTLPGPVSDPSKLPRWNYDGSSTGQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAG+ IPTNKRY+A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGDPIPTNKRYSAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP GGYPGPQGPYYCG+GADKA+GRDIVD+HYKACLYAG+NISGINGEV
Sbjct  134   LLQKDVKWPLGWPTGGYPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISAADE+W+ARYILERITE+AGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAADEIWIARYILERITELAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTFKWGVADRGA
Sbjct  254   TKSMRAKGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGHHETADINTFKWGVADRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+G+GYFEDRRPASNMDPY VT MIAETTIL K
Sbjct  314   SIRVGRDTEKEGQGYFEDRRPASNMDPYIVTGMIAETTILGK  355



>ref|XP_011001555.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-like [Populus 
euphratica]
Length=356

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/342 (88%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIWVGGSGMD+RSK RT+SGPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYIWVGGSGMDIRSKGRTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE IPTNKR  A+KIFSHPDV  E PW+G+EQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDTYTPAGEPIPTNKRCKAAKIFSHPDVVAEVPWFGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYCG G DKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPIGGYPGPQGPYYCGAGVDKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ DELW ARYILERITE+AGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISSGDELWAARYILERITEVAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GGYE+IKKAI KL LRH+EHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMRNEGGYEVIKKAIEKLGLRHREHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_008460506.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
melo]
Length=356

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/340 (89%), Positives = 323/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIWVGGSG D+RSKARTISGP +DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DFTDKIIAEYIWVGGSGTDVRSKARTISGPTSDPSKLPKWNYDGSSTGQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFR+GNNILV+CD YTPAGEAIPTNKR+ A+KIF HPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFRDPFRKGNNILVICDSYTPAGEAIPTNKRHGAAKIFRHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GG+PGPQGPYYCG GADK +GRDIVD+HYKACLYAG+NISGIN EV
Sbjct  134   LLQKDVKWPLGWPIGGFPGPQGPYYCGAGADKTFGRDIVDAHYKACLYAGVNISGINAEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISAADELWVARYILERITE+AGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAADELWVARYILERITEMAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL +RHKEHIAAYGEGNERRLTGRHETADIN+F WGVA+RGA
Sbjct  254   TKSMRKEGGYEVIKKAIEKLGVRHKEHIAAYGEGNERRLTGRHETADINSFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK GKGYFEDRRPASNMDPYTVTSMIAETTIL
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYTVTSMIAETTIL  353



>ref|NP_001105296.1| glutamine synthetase root isozyme 3 [Zea mays]
 dbj|BAA03431.1| glutamine synthetase [Zea mays]
 gb|ACF88284.1| unknown [Zea mays]
 gb|ADO17336.1| glutamine synthetase [Zea mays]
 gb|ADO17337.1| glutamine synthetase [Zea mays]
 gb|ADO17338.1| glutamine synthetase [Zea mays]
 gb|ADO17339.1| glutamine synthetase [Zea mays]
 gb|AFW73299.1| glutamine synthetase4 [Zea mays]
Length=356

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/340 (88%), Positives = 327/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIW+GGSGMDLRSKART+SGPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCDCYTPAGE IPTNKRY A+KIFS P+VA EEPWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYNAAKIFSSPEVAAEEPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD NWPLGWP+GG+PGPQGPYYCG+GA+K++GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDTNWPLGWPIGGFPGPQGPYYCGIGAEKSFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGIS+ D++WVARYILERITEIAGVV++FDPKPI GDWNGAGAHTNYST+
Sbjct  196   GQWEFQVGPSVGISSGDQVWVARYILERITEIAGVVVTFDPKPIPGDWNGAGAHTNYSTE  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR +GGYE+IK AI KL+LRH+EHIAAYGEGNERRLTGRHETADINTF WGVA+RGASV
Sbjct  256   SMRKEGGYEVIKAAIEKLKLRHREHIAAYGEGNERRLTGRHETADINTFSWGVANRGASV  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  316   RVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTIIWK  355



>ref|XP_011007210.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Populus 
euphratica]
Length=356

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/342 (88%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+ GPVTDP+KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPAKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCD YTPAGE IPTNKR+ A+KIFS+P +A EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRFNAAKIFSNPAIAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWPLGWP+GG+PGPQGPYYCGVGADK++GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDTNWPLGWPVGGFPGPQGPYYCGVGADKSFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DE+WVARYILERI EIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDEVWVARYILERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG  +IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGLAVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTI  K
Sbjct  314   SVRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTITWK  355



>ref|XP_002465624.1| hypothetical protein SORBIDRAFT_01g042450 [Sorghum bicolor]
 emb|CAQ86599.1| glutamine synthetase [Sorghum bicolor]
 gb|EER92622.1| hypothetical protein SORBIDRAFT_01g042450 [Sorghum bicolor]
Length=357

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/340 (88%), Positives = 322/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTDKIIAEYIW+GGSG+DLRSKART+ GP+TDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDKIIAEYIWIGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+G+NILVMCDCYTP GE IPTNKRY A+K+FSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGDNILVMCDCYTPQGEPIPTNKRYNAAKVFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GGYPGPQGPYYC  GADKA+GRD+VD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPVGGYPGPQGPYYCAAGADKAFGRDVVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITEIAG+VLS DPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERITEIAGIVLSLDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IKKAI KL  RH EHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREAGGYEVIKKAIEKLGKRHTEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTE++GKGYFEDRRPASNMDPY VT MIAETTIL
Sbjct  314   SIRVGRDTEREGKGYFEDRRPASNMDPYVVTGMIAETTIL  353



>pdb|2D3A|A Chain A, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Methionine Sulfoximine Phosphate
 pdb|2D3A|B Chain B, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Methionine Sulfoximine Phosphate
 pdb|2D3A|C Chain C, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Methionine Sulfoximine Phosphate
 pdb|2D3A|D Chain D, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Methionine Sulfoximine Phosphate
 pdb|2D3A|E Chain E, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Methionine Sulfoximine Phosphate
 pdb|2D3A|F Chain F, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Methionine Sulfoximine Phosphate
 pdb|2D3A|G Chain G, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Methionine Sulfoximine Phosphate
 pdb|2D3A|H Chain H, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Methionine Sulfoximine Phosphate
 pdb|2D3A|I Chain I, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Methionine Sulfoximine Phosphate
 pdb|2D3A|J Chain J, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Methionine Sulfoximine Phosphate
 pdb|2D3B|A Chain A, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Amppnp And Methionine Sulfoximine
 pdb|2D3B|B Chain B, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Amppnp And Methionine Sulfoximine
 pdb|2D3B|C Chain C, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Amppnp And Methionine Sulfoximine
 pdb|2D3B|D Chain D, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Amppnp And Methionine Sulfoximine
 pdb|2D3B|E Chain E, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Amppnp And Methionine Sulfoximine
 pdb|2D3B|F Chain F, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Amppnp And Methionine Sulfoximine
 pdb|2D3B|G Chain G, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Amppnp And Methionine Sulfoximine
 pdb|2D3B|H Chain H, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Amppnp And Methionine Sulfoximine
 pdb|2D3B|I Chain I, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Amppnp And Methionine Sulfoximine
 pdb|2D3B|J Chain J, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Amppnp And Methionine Sulfoximine
 pdb|2D3C|A Chain A, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Phosphinothricin Phosphate
 pdb|2D3C|B Chain B, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Phosphinothricin Phosphate
 pdb|2D3C|C Chain C, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Phosphinothricin Phosphate
 pdb|2D3C|D Chain D, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Phosphinothricin Phosphate
 pdb|2D3C|E Chain E, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Phosphinothricin Phosphate
 pdb|2D3C|F Chain F, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Phosphinothricin Phosphate
 pdb|2D3C|G Chain G, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Phosphinothricin Phosphate
 pdb|2D3C|H Chain H, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Phosphinothricin Phosphate
 pdb|2D3C|I Chain I, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Phosphinothricin Phosphate
 pdb|2D3C|J Chain J, Crystal Structure Of The Maize Glutamine Synthetase 
Complexed With Adp And Phosphinothricin Phosphate
 dbj|BAA03430.1| glutamine synthetase [Zea mays]
Length=356

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/342 (87%), Positives = 328/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKRY+A+KIFS P+VA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYSAAKIFSSPEVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWPLGWP+GG+PGPQGPYYCG+GA+K++GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDTNWPLGWPIGGFPGPQGPYYCGIGAEKSFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ D++WVARYILERITEIAGVV++FDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISSGDQVWVARYILERITEIAGVVVTFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             T+SMR +GGYE+IK AI KL+LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TESMRKEGGYEVIKAAIEKLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTIVWK  355



>gb|AFN42876.1| glutamine synthetase [Camellia sinensis]
Length=356

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/342 (88%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+IAEYIW+GGSGMDLRSKART+SGPV+DP KLPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    DTTEKVIAEYIWIGGSGMDLRSKARTLSGPVSDPKKLPKWNYDGSSTGQAPGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTP GE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDTYTPGGEPIPTNKRFNAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK V WPLGWPLGG+PGPQGPYYCG+G DKA+GRDIVDSHYKACLYAG+NISGINGEV
Sbjct  134   LLQKQVKWPLGWPLGGFPGPQGPYYCGIGVDKAYGRDIVDSHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVV+SFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKS R+DGG+E+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSTRSDGGFEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTLLWK  355



>ref|XP_011073176.1| PREDICTED: glutamine synthetase nodule isozyme-like [Sesamum 
indicum]
Length=400

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/356 (89%), Positives = 337/356 (95%), Gaps = 0/356 (0%)
 Frame = +3

Query  114   KMsllsdlinlnlsECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSS  293
             KMSLLSDLINLNLSE T+K I EYIWVGGSGMDLRSKART+ GPVTDPS+LPKWNYDGSS
Sbjct  44    KMSLLSDLINLNLSEVTEKSIVEYIWVGGSGMDLRSKARTLPGPVTDPSQLPKWNYDGSS  103

Query  294   TGQAPGKDSEVILYPQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDV  473
             TGQAPG+DSEVILYPQAIF DPFRRGN+ILVMCD YTPAGE IPTNKRY A+KIF+HP+V
Sbjct  104   TGQAPGEDSEVILYPQAIFPDPFRRGNHILVMCDAYTPAGEPIPTNKRYNAAKIFNHPEV  163

Query  474   AKEEPWYGIEQEYTLLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKAC  653
               EEPWYGIEQEYTLLQKDV WPLGWP+GG+PGPQGPYYCG+GADKA+GRDIVD+HYKAC
Sbjct  164   VAEEPWYGIEQEYTLLQKDVKWPLGWPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKAC  223

Query  654   LYAGINISGINGEVMPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPI  833
             LYAGINISGINGEVMPGQWEFQVGPSVGISAAD++WVARYILERITEIAGVV+SFDPKPI
Sbjct  224   LYAGINISGINGEVMPGQWEFQVGPSVGISAADQVWVARYILERITEIAGVVVSFDPKPI  283

Query  834   QGDWNGAGAHTNYSTKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETA  1013
             QGDWNGAGAHTNYSTKSMR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETA
Sbjct  284   QGDWNGAGAHTNYSTKSMREDGGYEVIKKAIHKLGLRHKEHIAAYGEGNERRLTGRHETA  343

Query  1014  DINTFKWGVADRGASVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             DINTF W VA+RGAS+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  344   DINTFLWDVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWK  399



>ref|XP_002870545.1| ATGSR1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46804.1| ATGSR1 [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/340 (89%), Positives = 324/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIWVGGSGMD+RSKART+ GPVTDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DITDKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+K+FSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GGYPGPQGPYYCG+GADK++GRD+VDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPVGWPIGGYPGPQGPYYCGIGADKSFGRDVVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISAADE+WVARYILERITEIAGVV+SFDPKPI GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPAVGISAADEIWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKSMREEGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTIL  353



>ref|XP_003528974.1| PREDICTED: glutamine synthetase PR-2 [Glycine max]
 gb|KHN45263.1| Glutamine synthetase PR-2 [Glycine soja]
Length=356

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/342 (88%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIWVGGSGMDLRSKART+ GPV+DP+KLPKWNYDGSST QAPG DSEVILY
Sbjct  14    ESTEKIIAEYIWVGGSGMDLRSKARTLPGPVSDPAKLPKWNYDGSSTDQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE +PTNKRY A+KIFSHPDVA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDVYTPAGEPLPTNKRYGAAKIFSHPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWPLGG+PGPQGPYYCG+GADKA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPLGGFPGPQGPYYCGIGADKAYGRDIVDAHYKACIYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEIAG ++SFDPKPI GDWNGAGAH+NYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWAARYILERITEIAGAIVSFDPKPIPGDWNGAGAHSNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RG+
Sbjct  254   TKSMREEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGS  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_007043312.1| Glutamine synthetase 1,4 [Theobroma cacao]
 gb|EOX99143.1| Glutamine synthetase 1,4 [Theobroma cacao]
Length=356

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/341 (88%), Positives = 322/341 (94%), Gaps = 0/341 (0%)
 Frame = +3

Query  159   CTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYP  338
              T+KIIAEYIW+GGSGMDLRSKART+ GPVTDP+KLPKWNYDGSST QAPG DSEVILYP
Sbjct  15    TTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPAKLPKWNYDGSSTDQAPGDDSEVILYP  74

Query  339   QAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTL  518
             QA+F+DPFRRGNNILVMCD YTPAG+ IPTNKR+ A+KIF+HP VA EEPWYGIEQEYTL
Sbjct  75    QAVFKDPFRRGNNILVMCDAYTPAGDPIPTNKRFNAAKIFNHPAVAAEEPWYGIEQEYTL  134

Query  519   LQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVM  698
             LQKDV WPLGWP+GG+PGPQGPYYCGVGADK++GRDIVDSHYKACLYAGINISGINGEVM
Sbjct  135   LQKDVKWPLGWPVGGFPGPQGPYYCGVGADKSFGRDIVDSHYKACLYAGINISGINGEVM  194

Query  699   PGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYST  878
             PGQWEFQVGPSVGISA D+LWVARYILERITE+AGVVLSFDPKPIQGDWNGAGAHTNYST
Sbjct  195   PGQWEFQVGPSVGISAGDQLWVARYILERITEVAGVVLSFDPKPIQGDWNGAGAHTNYST  254

Query  879   KSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGAS  1058
             KSMRNDGG  +IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADIN+F WGVA+RGAS
Sbjct  255   KSMRNDGGIHVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINSFSWGVANRGAS  314

Query  1059  VRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             +RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  315   IRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTMLWK  355



>ref|NP_001239821.1| cytosolic glutamine synthetase alpha [Glycine max]
 gb|ACU18102.1| unknown [Glycine max]
 gb|KHN43648.1| Glutamine synthetase PR-2 [Glycine soja]
Length=356

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/342 (88%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KI+AEYIWVGGSGMDLRSKART+ GPV+DP+KLPKWNYDGSST QAPG DSEVILY
Sbjct  14    ESTEKIVAEYIWVGGSGMDLRSKARTLPGPVSDPAKLPKWNYDGSSTDQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE +PTNKRY A+KIFSHPDVA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDVYTPAGEPLPTNKRYDAAKIFSHPDVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWPLGG+PGPQGPYYCG GADKA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPLGGFPGPQGPYYCGTGADKAYGRDIVDAHYKACIYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITE+AGV++SFDPKPI GDWNGAGAH+NYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWAARYILERITEMAGVIVSFDPKPIPGDWNGAGAHSNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR++GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RG+
Sbjct  254   TKSMRDEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGS  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_010940335.1| PREDICTED: glutamine synthetase nodule isozyme-like [Elaeis guineensis]
Length=356

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/340 (89%), Positives = 323/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEY+W+GGSGMD+RSKART+SGPV+DPSKLPKWNYDGSSTGQAPG DSEVILY
Sbjct  14    DTTEKIIAEYVWIGGSGMDMRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGHDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDAYTPAGEPIPTNKRFNAAKIFSHPDVVTEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             L QKDV+WPLGWP+GGYPGPQGPYYCGVGADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LFQKDVHWPLGWPVGGYPGPQGPYYCGVGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVVLS DPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSLDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGG ++IKKAI KL L+HKEHIAAYGEGNERRLTG HETADINTF WGVA RGA
Sbjct  254   TKSMRSDGGIDVIKKAIEKLGLKHKEHIAAYGEGNERRLTGHHETADINTFSWGVAHRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             SVRVGR+TEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SVRVGRETEKNGKGYFEDRRPASNMDPYLVTSMIAETTIL  353



>gb|ACB06727.1| glutamine synthetase [Zea mays]
Length=356

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/342 (87%), Positives = 328/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKRY+A+KIFS P+VA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYSAAKIFSSPEVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWPLGWP+GG+PGPQGPYYCG+GA+K++GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDTNWPLGWPIGGFPGPQGPYYCGIGAEKSFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGIS+ D++WVARYILERITEIAGVV++FDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGISSGDQVWVARYILERITEIAGVVVTFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             T+SMR +GGYE+IK AI KL+LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TESMRKEGGYEVIKAAIEKLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTIIWK  355



>gb|KFK33302.1| hypothetical protein AALP_AA6G357500 [Arabis alpina]
Length=356

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/342 (88%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIWVGGSGMD+RSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCD YTPAGE IPTNKR+ A+K+FSH DV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHADVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWP+GWP+GG+PGPQGPYYCGVGADK++GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVNWPVGWPIGGFPGPQGPYYCGVGADKSFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILER+TEIAGVV+SFDPKPI GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERVTEIAGVVVSFDPKPIPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKSMREEGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTILWK  355



>emb|CAA54151.1| glutamine [Brassica napus]
 gb|AAX35342.1| glutamine synthetase [Brassica rapa subsp. pekinensis]
 emb|CDY16439.1| BnaA02g12430D [Brassica napus]
Length=356

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/338 (89%), Positives = 325/338 (96%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIWVGGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A++IFS+PDV  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDVNWP+GWP+GG+PGPQGPYYC VGADK++GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDVNWPVGWPIGGFPGPQGPYYCSVGADKSFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISAADE+W+AR+ILERITEIAGVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAADEVWIARFILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR +GGYEIIKKAI KL LRHKEHI+AYGEGNERRLTG HETADINTFKWGVA+RGAS+
Sbjct  256   SMREEGGYEIIKKAIDKLGLRHKEHISAYGEGNERRLTGHHETADINTFKWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRPASNMDPYTVTSMIAETT+L
Sbjct  316   RVGRDTEKEGKGYFEDRRPASNMDPYTVTSMIAETTLL  353



>emb|CAA58118.1| glutamate--ammonia ligase [Brassica napus]
 emb|CDX74573.1| BnaA04g08160D [Brassica napus]
Length=356

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/342 (88%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIWVGGSGMD+RSKART+ GPV+DPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GG+PGPQGPYYC VGADK++GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPIGGFPGPQGPYYCSVGADKSFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DE+WVAR+ILERITEIAGVV+SFDPKPI GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPAVGISAGDEIWVARFILERITEIAGVVVSFDPKPIPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTILWK  355



>ref|XP_008803403.1| PREDICTED: glutamine synthetase nodule isozyme-like [Phoenix 
dactylifera]
Length=356

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/342 (88%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMD+RSKART+ GPV+DPS+LPKWNYDGSSTGQAPG DSEVILY
Sbjct  14    DSTEKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSRLPKWNYDGSSTGQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRFNAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYCG GADKA+GRDIV+SHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVQWPLGWPVGGYPGPQGPYYCGTGADKAFGRDIVNSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERI EIAGVVLSFDPKPIQGDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERIAEIAGVVLSFDPKPIQGDWNGAGAHANYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGG ++IKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGIDVIKKAIEKLGLRHKEHIAAYGEGNERRLTGHHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRETEKNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>emb|CAA63963.1| glutamate synthetase [Lotus japonicus]
Length=356

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/342 (87%), Positives = 326/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIW+GGSG+D+RSKART+ GPV+DPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTDKIIAEYIWIGGSGLDMRSKARTLPGPVSDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRG+NILV+CD YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGSNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+VNWP+GWP+GG+PGPQGPYYCG+GADKA+GRDIVD+HYKACLYAG+NISGINGEV
Sbjct  134   LLQKEVNWPVGWPIGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITEIAGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWVARYILERITEIAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKTMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPAS MDPY VTSMIA+TTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASYMDPYVVTSMIADTTILWK  355



>gb|AAR29057.1| glutamine synthetase 1 [Datisca glomerata]
Length=356

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/342 (88%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+IAEYIW+GGSG+D+RSKART+ GPV+DPSKLPKWNYDGSSTGQAPGKDSEVILY
Sbjct  14    DSTEKVIAEYIWIGGSGLDIRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGKDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILVMCD YTPAGE IPTNKR  A+KIFSHP+V  E PWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVMCDAYTPAGEPIPTNKRCAAAKIFSHPNVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GG+PGPQGPYYCGVGADKA+ RD+VD+HYKACLYAG+NISGINGEV
Sbjct  134   LLQKDVKWPIGWPVGGFPGPQGPYYCGVGADKAFARDVVDAHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINT  WGVA+RGA
Sbjct  254   TKSMREKGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTSLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLLWK  355



>gb|KHN07539.1| Glutamine synthetase nodule isozyme [Glycine soja]
Length=356

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/342 (88%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+IAEYIW+GGSGMDLRSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    DTTEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILV+CD YTPAGE IPTNKR+ A+K+FSHPDV  EE WYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRHDAAKVFSHPDVVAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WPLGWP+GG+PGPQGPYYCGVGADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDIQWPLGWPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEIAGVV+SFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWAARYILERITEIAGVVVSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYE+IK AI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGYEVIKTAIEKLGKRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>gb|ACD13217.1| glutamine synthetase [Brassica rapa subsp. chinensis]
Length=356

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/338 (88%), Positives = 325/338 (96%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIWVGGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A++IFS+PDV  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDVNWP+GWP+GG+PGPQGPYYC VGADK++GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDVNWPVGWPIGGFPGPQGPYYCSVGADKSFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISAADE+W+AR+ILERITEIAGV++SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAADEVWIARFILERITEIAGVIVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR +GGYEIIKKAI KL LRHKEHI+AYGEGNERRLTG HETADINTFKWGVA+RGAS+
Sbjct  256   SMREEGGYEIIKKAIDKLGLRHKEHISAYGEGNERRLTGHHETADINTFKWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRPASNMDPYTVTSMIAETT+L
Sbjct  316   RVGRDTEKEGKGYFEDRRPASNMDPYTVTSMIAETTLL  353



>sp|Q43785.1|GLNA3_MEDSA RecName: Full=Glutamine synthetase nodule isozyme; AltName: Full=Glutamate--ammonia 
ligase [Medicago sativa]
 gb|AAB41554.1| cytosolic glutamine synthetase [Medicago sativa]
Length=356

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/342 (88%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E ++KIIAEYIWVGGSGMDLRSKART+ GPV+DP+KLPKWNYDGSST QAPG+DSEVILY
Sbjct  14    ESSEKIIAEYIWVGGSGMDLRSKARTLPGPVSDPAKLPKWNYDGSSTNQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILV+CD YTPAGE +PTNKR+ A+KIFSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRQGNNILVICDVYTPAGEPLPTNKRHNAAKIFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWPLGWP+GG+PGPQGPYYCG+GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDTNWPLGWPIGGFPGPQGPYYCGIGADKAYGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG+HET DINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETTDINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEKDGKGYFEDRRP+SNMDPY VTSMIAETT+L K
Sbjct  314   SVRVGRDTEKDGKGYFEDRRPSSNMDPYVVTSMIAETTLLWK  355



>gb|ACA50923.1| glutamine synthetase [Zea mays]
Length=356

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/340 (87%), Positives = 326/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIW+GGSGMDLRSKART+SGPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCDCYTPAGE IPTNKRY A+KIFS P+VA EEPWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYDAAKIFSSPEVAAEEPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD NWPLGWP+GG+PGPQGPYYCG+GA+K++GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDTNWPLGWPIGGFPGPQGPYYCGIGAEKSFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGIS+ D++WVARYILERITEIAGVV++FDPKPI GDWN AGAHTNYST+
Sbjct  196   GQWEFQVGPSVGISSGDQVWVARYILERITEIAGVVVTFDPKPIPGDWNAAGAHTNYSTE  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR +GGYE+IK AI KL+LRH+EHIAAYGEGNERRLTGRHETADINTF WGVA+RGASV
Sbjct  256   SMRKEGGYEVIKAAIEKLKLRHREHIAAYGEGNERRLTGRHETADINTFSWGVANRGASV  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  316   RVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTIIWK  355



>ref|XP_009370058.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Pyrus 
x bretschneideri]
Length=356

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/342 (88%), Positives = 320/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMD+RSKART+ GPV+DPSKLPKWNYDGSST QAPG+DSEVILY
Sbjct  14    DSTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTNQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE IPTNKR  A+KIFSHPDV  E  WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDTYTPAGEPIPTNKRAAAAKIFSHPDVVAEVTWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GG+PGPQGPYYC  GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPVGGFPGPQGPYYCAAGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREDGGYEVIKKAINKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTLLLK  355



>gb|AFB69879.1| glutamine synthetase isoform 1-1 [Secale cereale]
Length=356

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/340 (86%), Positives = 328/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             TDKIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TDKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFR+GNNILVMCDCYTPAGE IPTNKR+ A+KIFS+PDVAKEEPWYGIEQEYTLL
Sbjct  76    AIFKDPFRKGNNILVMCDCYTPAGEPIPTNKRHNAAKIFSNPDVAKEEPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD+NWPLGWP+GG+PGPQGPYYCG+GADK++GRDIVDSHYKAC++AG+NISGINGEVMP
Sbjct  136   QKDINWPLGWPVGGFPGPQGPYYCGIGADKSFGRDIVDSHYKACMFAGVNISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGISA D++WVARYILERITEIAGVV++FDPKPI GDWNGAGAHTNYST+
Sbjct  196   GQWEFQVGPTVGISAGDQVWVARYILERITEIAGVVVTFDPKPIPGDWNGAGAHTNYSTE  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMRNDGG+++I  A+ KL+L+HKEHIAAYGEGNERRLTG+HETADINT  WGVA+RGASV
Sbjct  256   SMRNDGGFKVIVDAVEKLKLKHKEHIAAYGEGNERRLTGKHETADINTLSWGVANRGASV  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  316   RVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>emb|CAA73063.1| cytosolic glutamine synthetase [Brassica napus]
 gb|ACF42115.1| cytosolic glutamine synthetase [Brassica oleracea var. botrytis]
 emb|CDY52941.1| BnaCnng23850D [Brassica napus]
Length=356

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/338 (89%), Positives = 324/338 (96%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIWVGGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A++IFS+PDV  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDV WP+GWP+GG+PGPQGPYYC VGADK++GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDVKWPVGWPIGGFPGPQGPYYCSVGADKSFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISAADE+W+ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAADEVWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR +GGYEIIKKAI KL LRHKEHI+AYGEGNERRLTG HETADINTFKWGVA+RGAS+
Sbjct  256   SMREEGGYEIIKKAIDKLGLRHKEHISAYGEGNERRLTGHHETADINTFKWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRPASNMDPYTVTSMIAETT+L
Sbjct  316   RVGRDTEKEGKGYFEDRRPASNMDPYTVTSMIAETTLL  353



>sp|P04078.1|GLNA1_MEDSA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=Glutamate--ammonia ligase [Medicago sativa]
 emb|CAA27570.1| glutamine synthetase [Medicago sativa]
 prf||1211328A synthetase,Gln
Length=356

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/342 (88%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIW+GGSG+DLRSKART+ GPVTDPS+LPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    ETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQAPGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GG+PGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPVGGFPGPQGPYYCGAGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITE+AGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERITEVAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+I KAI KL  +HKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEVILKAIEKLGKKHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRP+SNMDPY VTSMIA+TTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPSSNMDPYVVTSMIADTTILWK  355



>gb|AJD14834.1| glutamine synthetase [Boehmeria nivea]
Length=356

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/342 (87%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART++GPV+DPSKLPKWNYDGSST QAPG DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLNGPVSDPSKLPKWNYDGSSTDQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQA+F+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAVFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHNAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GG+PGPQGPYYC  GADKA+GRDIV++HYKACLYAG+NISGINGEV
Sbjct  134   LLQKDVNWPLGWPVGGFPGPQGPYYCAAGADKAFGRDIVNAHYKACLYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ D++W+ARYILERITEIAGVVLSFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISSGDQVWIARYILERITEIAGVVLSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GG ++IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNEGGIDVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>gb|ABK51388.1| cytosolic glutamine synthetase [Camellia sinensis]
Length=356

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/342 (88%), Positives = 320/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GG+G+DLRSKART+SGPV DP KLPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    DSTEKIIAEYIWIGGTGLDLRSKARTLSGPVNDPKKLPKWNYDGSSTGQAPGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCD YTPAGE IPTNKRY A KIFSH DV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRYNAEKIFSHTDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP GGYPGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPKGGYPGPQGPYYCGAGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVV+SFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGY++IKKAI KL L+HKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRKDGGYQVIKKAIEKLGLKHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIA TTIL K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAATTILWK  355



>sp|P52782.1|GLNA_LUPLU RecName: Full=Glutamine synthetase nodule isozyme; Short=GS; 
AltName: Full=Glutamate--ammonia ligase [Lupinus luteus]
 emb|CAA50522.1| glutamate-ammonia ligase [Lupinus luteus]
 prf||2004276A Gln synthetase
Length=353

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/340 (89%), Positives = 322/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIWVGGSG+DLRSKART+SGPV DPSKLPKWNYDGSSTGQAPGKDSEVIL+
Sbjct  14    DTTEKIIAEYIWVGGSGVDLRSKARTLSGPVNDPSKLPKWNYDGSSTGQAPGKDSEVILW  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDV  EEPW+GIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAKIFSHPDVVAEEPWFGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD++WP+GWPLGG+PGPQGPYYCG GA+KA+GRDIVDSHYKACLYAGINISGIN EV
Sbjct  134   LLQKDIHWPIGWPLGGFPGPQGPYYCGTGAEKAFGRDIVDSHYKACLYAGINISGINAEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELWVARYILERITEIAGVVLS DPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYE+IKKAI KL  RH EHIAAYGEGNERRLTGRHETADI+TF WGVA+RGA
Sbjct  254   TKSMRNDGGYEVIKKAIEKLGKRHNEHIAAYGEGNERRLTGRHETADISTFFWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETT+L
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLL  353



>dbj|BAD99526.1| glutamine synthetase [Camellia sinensis]
 gb|ADK46866.1| cytosolic glutamine synthetase [Camellia sinensis]
Length=356

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/342 (88%), Positives = 320/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GG+G+DLRSKART+SGPV DP KLPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    DSTEKIIAEYIWIGGTGLDLRSKARTLSGPVNDPKKLPKWNYDGSSTGQAPGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCD YTPAGE IPTNKRY A KIFSH DV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRYNAEKIFSHTDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP GGYPGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPKGGYPGPQGPYYCGAGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVV+SFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGY++IKKAI KL L+HKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRKDGGYQVIKKAIEKLGLKHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIA TTIL K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAATTILWK  355



>ref|XP_010935533.1| PREDICTED: glutamine synthetase nodule isozyme-like [Elaeis guineensis]
Length=356

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/342 (88%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMD+RSKART+ GPV+DPSKLP WNYDGSSTGQAPG DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSKLPNWNYDGSSTGQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRFDAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV+WPLGWP+GGYPGPQGPYYCG GADKA+GRDIV+SHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVHWPLGWPVGGYPGPQGPYYCGAGADKAFGRDIVNSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGI A DELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGIFAGDELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGG ++IK+AI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGIDVIKRAIEKLGLRHKEHIAAYGEGNERRLTGHHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRETEKNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>emb|CDO98315.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/342 (87%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T KIIAEY+W+GGSGMD+RSK RT+ GPV DP+KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ESTQKIIAEYVWIGGSGMDIRSKGRTLPGPVNDPAKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKRY A+KIFS P+V  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRYNAAKIFSSPEVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+VNWP+GWP+GGYPGPQGPYYCG GADKA+GRDIV+SHYKACLYAGINISGINGEV
Sbjct  134   LLQKEVNWPIGWPVGGYPGPQGPYYCGAGADKAFGRDIVNSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DE+W+ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDEVWMARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGG+ +IKKAI KL+LRHK+HIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGFNVIKKAIEKLKLRHKDHIAAYGEGNERRLTGKHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTIVWK  355



>ref|NP_198576.1| glutamine synthetase 1;1 [Arabidopsis thaliana]
 sp|Q56WN1.2|GLN11_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-1; AltName: 
Full=Glutamate--ammonia ligase GLN1;1; Short=GLN1;1 [Arabidopsis 
thaliana]
 gb|AAL16154.1|AF428386_1 AT5g37600/K12B20_50 [Arabidopsis thaliana]
 gb|AAL31940.1|AF419608_1 AT5g37600/K12B20_50 [Arabidopsis thaliana]
 dbj|BAB08306.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAL84997.1| AT5g37600/K12B20_50 [Arabidopsis thaliana]
 gb|AAN31893.1| putative glutamate-ammonia ligase [Arabidopsis thaliana]
 gb|AED94209.1| glutamine synthetase 1;1 [Arabidopsis thaliana]
Length=356

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/340 (89%), Positives = 324/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIWVGGSGMD+RSKART+ GPVTDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTDKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+K+FS+PDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSNPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GGYPGPQGPYYCG+GADK++GRD+VDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPVGWPIGGYPGPQGPYYCGIGADKSFGRDVVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISAADE+WVARYILERITEIAGVV+SFDPKPI GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPAVGISAADEIWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKSMREEGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTIL  353



>dbj|BAA04995.1| glutamine synthetase [Raphanus sativus]
Length=356

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/338 (88%), Positives = 324/338 (96%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIWVGGSGMD+RSKART+SGPVTDPS+LPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSQLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGN+ILVMCD YTPAGE IPTNKR+ A++IFSHPDV  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNHILVMCDTYTPAGEPIPTNKRHAAAQIFSHPDVVAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDV WP+GWP+GG+PGPQGPYYC VGADK++GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDVKWPVGWPIGGFPGPQGPYYCSVGADKSFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISAADE+W+ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAADEVWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR +GGYEIIKKAI KL LRHKEHI+AYGEGNERRLTG HETADINTFKWGVA+RGAS+
Sbjct  256   SMREEGGYEIIKKAIDKLGLRHKEHISAYGEGNERRLTGHHETADINTFKWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRPASNMDPY VTSM+AETTIL
Sbjct  316   RVGRDTEKEGKGYFEDRRPASNMDPYIVTSMVAETTIL  353



>ref|XP_004985157.1| PREDICTED: glutamine synthetase root isozyme 5-like [Setaria 
italica]
Length=357

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/342 (87%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTDKIIAEYIWVGGSG+DLRSKART+ GP+T  S+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDKIIAEYIWVGGSGIDLRSKARTVKGPITSASQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRG+NILVMCDCYTP GE IPTNKRY A+K+FSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGDNILVMCDCYTPQGEPIPTNKRYHAAKVFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWP+GWP+GGYPGPQGPYYC  GADKA+GRD+VD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVNWPIGWPVGGYPGPQGPYYCAAGADKAFGRDVVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITE+AGVVLS DPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERITEMAGVVLSLDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IKKAI KL  RHKEHIAAYGEGNERRLTG HETADINTFKWGVA+RGA
Sbjct  254   TKSMREPGGYEVIKKAIEKLGKRHKEHIAAYGEGNERRLTGHHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VT MIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTGMIAETTILGK  355



>ref|XP_010032725.1| PREDICTED: glutamine synthetase nodule isozyme [Eucalyptus grandis]
 gb|KCW52166.1| hypothetical protein EUGRSUZ_J01606 [Eucalyptus grandis]
Length=356

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/341 (88%), Positives = 323/341 (95%), Gaps = 0/341 (0%)
 Frame = +3

Query  159   CTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYP  338
              T+K+IAEYIW+GGSGMDLRSKART++GPV+DPSKLPKWNYDGSST QAPG+DSEVILYP
Sbjct  15    TTEKVIAEYIWIGGSGMDLRSKARTLNGPVSDPSKLPKWNYDGSSTNQAPGEDSEVILYP  74

Query  339   QAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTL  518
             QAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYTL
Sbjct  75    QAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHPDVLAEEPWYGIEQEYTL  134

Query  519   LQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVM  698
             LQ+DV WP+GWPLGGYPGPQGPYYCG+G DKA+GRD+VDSHYKACLYAG+NISGINGEVM
Sbjct  135   LQRDVKWPIGWPLGGYPGPQGPYYCGIGGDKAFGRDVVDSHYKACLYAGVNISGINGEVM  194

Query  699   PGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYST  878
             PGQWEFQVGP+VGISA DELWVARYILERITEIAG+VLSFDPKPI GDWNGAGAHTNYST
Sbjct  195   PGQWEFQVGPAVGISAGDELWVARYILERITEIAGIVLSFDPKPIHGDWNGAGAHTNYST  254

Query  879   KSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGAS  1058
             KSMR+DGGYE+IKKAI KL L+HKEHIAAYGEGNERRLTGRHETADINTF W VA+RGAS
Sbjct  255   KSMRSDGGYEVIKKAIEKLGLKHKEHIAAYGEGNERRLTGRHETADINTFLWRVANRGAS  314

Query  1059  VRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             +RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  315   IRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTIIWK  355



>gb|KHG29838.1| Glutamine synthetase cytosolic isozyme 1-1 [Gossypium arboreum]
Length=360

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/346 (87%), Positives = 323/346 (93%), Gaps = 4/346 (1%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSST QAPG DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTNQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRFNAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD  WPLGWP+GG+PGPQGPYYCGVGADK++GRDIVDSHYKACLYAG+NISGINGEV
Sbjct  134   LLQKDTKWPLGWPVGGFPGPQGPYYCGVGADKSFGRDIVDSHYKACLYAGVNISGINGEV  193

Query  696   MPGQ----WEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAH  863
             MPGQ    WEFQVGPSVGISA D++W+ARYILERITEIAGVVLSFDPKPI GDWNGAGAH
Sbjct  194   MPGQVRYNWEFQVGPSVGISAGDQIWIARYILERITEIAGVVLSFDPKPIPGDWNGAGAH  253

Query  864   TNYSTKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA  1043
             TNYSTKSMRNDGG ++IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADIN+F WGVA
Sbjct  254   TNYSTKSMRNDGGIDVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINSFSWGVA  313

Query  1044  DRGASVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             +RGAS+RVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   NRGASIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILWK  359



>ref|XP_006346760.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Solanum 
tuberosum]
Length=356

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/340 (87%), Positives = 327/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + ++KIIAEYIW+GGSGMD+RSKART+SGPV DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSSEKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CDCYTPAGE IPTNKR+ A+KIFS+PDV  EEPWYG+EQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRHNAAKIFSNPDVVVEEPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK++NWPLGWP+GG+PGPQGPYYCG+G+ KA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKEINWPLGWPIGGFPGPQGPYYCGIGSGKAFGRDIVDAHYKACIYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGI++ DELW ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGIASGDELWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMRNEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETT+L
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTLL  353



>gb|EYU45782.1| hypothetical protein MIMGU_mgv1a009017mg [Erythranthe guttata]
Length=355

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/340 (88%), Positives = 321/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEY+W+GGSGMDLRSKART+ GP+TDPS+LPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  15    TEKIIAEYVWIGGSGMDLRSKARTLPGPITDPSQLPKWNYDGSSTGQAPGEDSEVILYPQ  74

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAG  IP N R+ A+K+FSHPDV  E PWYGIEQEYTLL
Sbjct  75    AIFKDPFRRGNNILVMCDAYTPAGVPIPGNNRHNAAKVFSHPDVVTEVPWYGIEQEYTLL  134

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDV WP+GWP GGYPGPQGPYYCGVGADKA+GRDIVD+HYKAC+YAGINISGINGEVMP
Sbjct  135   QKDVKWPVGWPKGGYPGPQGPYYCGVGADKAFGRDIVDAHYKACIYAGINISGINGEVMP  194

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGISA DE+W+ARYILERITEIAGVVLSFDPKPI+GDWNGAGAHTNYSTK
Sbjct  195   GQWEFQVGPAVGISAGDEVWIARYILERITEIAGVVLSFDPKPIEGDWNGAGAHTNYSTK  254

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR DGGYEII KAI KL LRHKEHIAAYGEGNERRLTG+HETADINTFKWGVA+RGAS+
Sbjct  255   SMREDGGYEIILKAIEKLSLRHKEHIAAYGEGNERRLTGKHETADINTFKWGVANRGASI  314

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  315   RVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTILGK  354



>gb|EEC73954.1| hypothetical protein OsI_08842 [Oryza sativa Indica Group]
Length=364

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/358 (82%), Positives = 319/358 (89%), Gaps = 24/358 (7%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+SGPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNIL----------------VMCDCYTPAGEAIPTNKRYTASKIFSHP  467
             PQAIF+DPFR+GNNIL                VMCDCYTPAGE IPTNKR+ A+KIFS P
Sbjct  74    PQAIFKDPFRKGNNILCTSISVHPDQHMSIKTVMCDCYTPAGEPIPTNKRHNAAKIFSSP  133

Query  468   DVAKEEPWYGIEQEYTLLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYK  647
             +VA EEPWYGIEQEYTLLQKD+NWPLGWP   Y        CG+GADK++GRDIVDSHYK
Sbjct  134   EVASEEPWYGIEQEYTLLQKDINWPLGWPGPYY--------CGIGADKSFGRDIVDSHYK  185

Query  648   ACLYAGINISGINGEVMPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPK  827
             ACLYAGINISGINGEVMPGQWEFQVGPSVGISA D++WVARYILERITEIAGVV+SFDPK
Sbjct  186   ACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDQVWVARYILERITEIAGVVVSFDPK  245

Query  828   PIQGDWNGAGAHTNYSTKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHE  1007
             PI GDWNGAGAHTNYSTKSMRNDGGYEIIK AI KL+LRHKEHI+AYGEGNERRLTGRHE
Sbjct  246   PIPGDWNGAGAHTNYSTKSMRNDGGYEIIKSAIEKLKLRHKEHISAYGEGNERRLTGRHE  305

Query  1008  TADINTFKWGVADRGASVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             TADINTF WGVA+RGASVRVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  306   TADINTFSWGVANRGASVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTIIWK  363



>gb|AAW21274.1| glutamine synthetase [Saccharum officinarum]
Length=357

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/342 (87%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTDKIIAEYIW+GGSG+DLRSKART+ GP+TDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDKIIAEYIWIGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+G+NILVMCDCYTP GE IPTNKRY A+K+FSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGDNILVMCDCYTPQGEPIPTNKRYNAAKVFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV+WPLGWP+GGYPGPQGPYYC  GADKA+GRD+VD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVSWPLGWPVGGYPGPQGPYYCAAGADKAFGRDVVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITEIAG+VLS DPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERITEIAGIVLSLDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IKKAI KL  RHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREPGGYEVIKKAIEKLGKRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTE++GKGY EDRRPA NMDPY VT MIAETTIL K
Sbjct  314   SIRVGRDTEREGKGYLEDRRPAFNMDPYVVTGMIAETTILWK  355



>ref|XP_008353857.1| PREDICTED: glutamine synthetase cytosolic isozyme [Malus domestica]
Length=356

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/341 (89%), Positives = 318/341 (93%), Gaps = 0/341 (0%)
 Frame = +3

Query  159   CTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYP  338
              T KIIAEYIW+GGSGMD+RSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVILYP
Sbjct  15    STKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILYP  74

Query  339   QAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTL  518
             QAIF+DPFRRGNNILV+CD YTP GE IPTNKR  A+KIFSHPDV  E PWYGIEQEYTL
Sbjct  75    QAIFKDPFRRGNNILVICDTYTPGGEPIPTNKRAAAAKIFSHPDVVAEVPWYGIEQEYTL  134

Query  519   LQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVM  698
             LQKDV WPLGWP+GGYPGPQGPYYC  GADKA+GRDIVDSHYKACLYAGINISGINGEVM
Sbjct  135   LQKDVXWPLGWPVGGYPGPQGPYYCAAGADKAFGRDIVDSHYKACLYAGINISGINGEVM  194

Query  699   PGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYST  878
             PGQWEFQVGPSVGISA DELW ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYST
Sbjct  195   PGQWEFQVGPSVGISAGDELWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYST  254

Query  879   KSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGAS  1058
             KSMR DGGYE IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGAS
Sbjct  255   KSMREDGGYEXIKKAIDKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGAS  314

Query  1059  VRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             +RVGR+TE+ GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  315   IRVGRETEQAGKGYFEDRRPASNMDPYVVTSMIAETTILLK  355



>ref|XP_009629012.1| PREDICTED: glutamine synthetase-like [Nicotiana tomentosiformis]
Length=356

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/342 (88%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIW+GGSGMDLRSKART+SGPV DPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ESTEKIIAEYIWIGGSGMDLRSKARTLSGPVKDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS PDV  EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHHAAKIFSKPDVVAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+VNWPLGWP+GG+PGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKEVNWPLGWPIGGFPGPQGPYYCGTGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DE+W ARYILERI EIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDEVWTARYILERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG+HETA+INTFKWGVA+RGA
Sbjct  254   TKSMRADGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETANINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTIIWK  355



>ref|XP_009800983.1| PREDICTED: glutamine synthetase-like [Nicotiana sylvestris]
Length=356

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/342 (88%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIW+GGSGMDLRSKAR++SGPV DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ESTDKIIAEYIWIGGSGMDLRSKARSLSGPVEDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS+PDV  EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHHAAKIFSNPDVVAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK++NWPLGWP+GG+PGPQGPYYCG GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKEINWPLGWPIGGFPGPQGPYYCGTGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DE+W ARYILERI EIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDEVWTARYILERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG+HETA+INTFKWGVA+RGA
Sbjct  254   TKSMRADGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETANINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTIIWK  355



>gb|ACR38147.1| unknown [Zea mays]
 gb|AFW63836.1| glutamine synthetase5 [Zea mays]
Length=356

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/342 (87%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKRY+A+KIFS  +VA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYSAAKIFSSLEVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWPLGWP+GG+PGPQGPYYCG+GA+K++GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDTNWPLGWPIGGFPGPQGPYYCGIGAEKSFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ D++WVARYILERITEIAGVV++FDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISSGDQVWVARYILERITEIAGVVVTFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             T+SMR +GGYE+IK AI KL+LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TESMRKEGGYEVIKAAIEKLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTIVWK  355



>ref|XP_009127474.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2 isoform 
X1 [Brassica rapa]
Length=356

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/338 (88%), Positives = 324/338 (96%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIW GGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWGGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A++IFS+PDV  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDVNWP+GWP+GG+PGPQGPYYC VGADK++GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDVNWPVGWPIGGFPGPQGPYYCSVGADKSFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISAADE+W+AR+ILERITEIAGVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAADEVWIARFILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR +GGYEIIKKAI KL LRHKEHI+AYGEGNERRLTG HETADINTFKWGVA+RGAS+
Sbjct  256   SMREEGGYEIIKKAIDKLGLRHKEHISAYGEGNERRLTGHHETADINTFKWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRPASNMDPYTVTSMIAETT+L
Sbjct  316   RVGRDTEKEGKGYFEDRRPASNMDPYTVTSMIAETTLL  353



>ref|XP_008781316.1| PREDICTED: glutamine synthetase cytosolic isozyme 2-like [Phoenix 
dactylifera]
Length=357

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/341 (88%), Positives = 324/341 (95%), Gaps = 0/341 (0%)
 Frame = +3

Query  159   CTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYP  338
             C +K+IAEYIWVGGSGMD+RSKART+SG V+DPS+LP+WNYDGSSTGQAPG+DSEVIL P
Sbjct  15    CMEKVIAEYIWVGGSGMDIRSKARTLSGLVSDPSRLPRWNYDGSSTGQAPGEDSEVILCP  74

Query  339   QAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTL  518
             QAIF+DPFRRGNNILVMCDC TP GE IP+NKR  A+KIFSHPDV+ EEPWYGIEQEYTL
Sbjct  75    QAIFKDPFRRGNNILVMCDCRTPDGEPIPSNKRSNAAKIFSHPDVSAEEPWYGIEQEYTL  134

Query  519   LQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVM  698
             LQKDV WP+GWP+GGYPGPQGPYYCGVGA+K++GRDIVDSHYKACLYAGINISGINGEVM
Sbjct  135   LQKDVKWPIGWPVGGYPGPQGPYYCGVGAEKSFGRDIVDSHYKACLYAGINISGINGEVM  194

Query  699   PGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYST  878
             PGQWEFQVGP+VGISAAD+LWVARYILERI EIAGVVLSFDPKPIQGDWNGAGAHTNYST
Sbjct  195   PGQWEFQVGPAVGISAADQLWVARYILERIAEIAGVVLSFDPKPIQGDWNGAGAHTNYST  254

Query  879   KSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGAS  1058
             KSMR+DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGAS
Sbjct  255   KSMRSDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFVWGVANRGAS  314

Query  1059  VRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             +RVGRDTEK GKGYFEDRRP+SNMDPY VTSMIAETTIL K
Sbjct  315   IRVGRDTEKSGKGYFEDRRPSSNMDPYVVTSMIAETTILWK  355



>ref|XP_010652433.1| PREDICTED: glutamine synthetase isoform X1 [Vitis vinifera]
 emb|CAN62668.1| hypothetical protein VITISV_041911 [Vitis vinifera]
 emb|CBI27134.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/342 (87%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSG DLRSKART+SGPVT P++LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYIWIGGSGNDLRSKARTLSGPVTGPAQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR G+NILVMCD YTP GE IPTNKR+ A+KIFSHP+V  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRGGDNILVMCDAYTPGGEPIPTNKRFNAAKIFSHPEVTAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GG+PGPQGPYYCG+GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVV+SFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVVSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN GGY++IKKAI KL LRHKEHI+AYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNTGGYDVIKKAIEKLGLRHKEHISAYGEGNERRLTGRHETADINTFCWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_004236686.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Solanum 
lycopersicum]
Length=356

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/340 (87%), Positives = 326/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + ++KIIAEYIW+GGSGMD+RSKART+SGPV DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSSEKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CDCYTPAGE IPTNKR+ A+KIFS+P+V  EEPWYG+EQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRHNAAKIFSNPNVVVEEPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK++NWPLGWP+GG+PGPQGPYYCG+G  KA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKEINWPLGWPIGGFPGPQGPYYCGIGCGKAFGRDIVDAHYKACIYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGI++ DELW ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGIASGDELWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMRNEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTIL  353



>ref|NP_001242332.1| cytosolic glutamine synthetase beta2 [Glycine max]
 gb|ACU23125.1| unknown [Glycine max]
Length=356

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/342 (88%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+IAEYIW+GGSGMDLRSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    DTTEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILV+CD YTPAGE IPTNKR+ A+K+FSHPDV  EE WYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVICDTYTPAGEPIPTNKRHDAAKVFSHPDVVAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WPLGWP+GG+PGPQGPYYCGVGADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDIQWPLGWPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERI EIAGVV+SFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWAARYILERIIEIAGVVVSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYE+IK AI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGYEVIKTAIEKLGKRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>emb|CCO25538.1| glutamine synthetase [Pinus pinaster]
Length=355

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/342 (87%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMD+RSKART+S PVTDP  LPKWNYDGSSTGQAPGKDSEVILY
Sbjct  14    DVTEKIIAEYIWIGGSGMDIRSKARTLSHPVTDPKDLPKWNYDGSSTGQAPGKDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILV+CD YTPAGE IPTNKR  A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVICDTYTPAGEPIPTNKRANAAKIFSHPDVVVEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GGYPGPQGPYYCG GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPVGGYPGPQGPYYCGTGADKAYGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGIS+ D++W ARY+LERITE+AGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGISSGDQVWAARYLLERITEVAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GG ++IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMREEGGIKVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTE++GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEREGKGYFEDRRPASNMDPYIVTSMIAETTILLK  355



>ref|XP_006284008.1| hypothetical protein CARUB_v10005130mg [Capsella rubella]
 gb|EOA16906.1| hypothetical protein CARUB_v10005130mg [Capsella rubella]
Length=356

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/340 (88%), Positives = 323/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIWVGGSGMD+RSKART+ GPVTDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTDKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSELPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+V WP+GWP+GG+PGPQGPYYCG+GADK++GRD+VDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKEVKWPVGWPIGGFPGPQGPYYCGIGADKSFGRDVVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISAADE+WVARYILERITEIAGVV+SFDPKPI GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPAVGISAADEIWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MR +GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKTMREEGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTIL  353



>ref|XP_009631592.1| PREDICTED: glutamine synthetase isoform X1 [Nicotiana tomentosiformis]
Length=356

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/342 (87%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+SGPVTDP+KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPAKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS+PDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQ+D+NWPLGWP+GG+PGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQRDINWPLGWPIGGFPGPQGPYYCGTGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK MR DGGYE+I KAI KL L+HKEHIAAYGEGNERRLTG+HETA+I+TFKWGVA+RGA
Sbjct  254   TKLMREDGGYEVILKAIEKLGLKHKEHIAAYGEGNERRLTGKHETANIDTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VT+MIA+TTI+ K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTAMIADTTIIWK  355



>sp|P38561.1|GLNA3_MAIZE RecName: Full=Glutamine synthetase root isozyme 3; AltName: Full=GS112; 
AltName: Full=Glutamate--ammonia ligase [Zea mays]
 emb|CAA46721.1| glutamine synthetase [Zea mays]
Length=356

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/342 (87%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+SGPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKRY A+KIFS P+VA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYNAAKIFSSPEVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWPLGWP+GG+PGPQGPYYCG+GA+K++GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDTNWPLGWPIGGFPGPQGPYYCGIGAEKSFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ D++WVARYILERITEIAGVV++FDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISSGDQVWVARYILERITEIAGVVVTFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             T+SMR +GGYE+IK AI KL+LRH+EHIAAYGEGN+ RLTGRHETADINTF WGVA+RGA
Sbjct  254   TESMRKEGGYEVIKAAIEKLKLRHREHIAAYGEGNDGRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTIIWK  355



>ref|NP_001241743.1| glutamine synthetase root isozyme 3 [Zea mays]
 gb|ACG34436.1| glutamine synthetase root isozyme 3 [Zea mays]
Length=356

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/342 (87%), Positives = 327/342 (96%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+ SEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEYSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKRY+A+KIFS P++A EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYSAAKIFSSPELAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWPLGWP+GG+PGPQGPYYCG+GA+K++GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDTNWPLGWPIGGFPGPQGPYYCGIGAEKSFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ D++WVARYILERITEIAGVV++FDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISSGDQVWVARYILERITEIAGVVVTFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             T+SMR +GGYE+IK AI KL+LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TESMRKEGGYEVIKAAIEKLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTIVWK  355



>prf||1804333B Gln synthetase
Length=430

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/337 (89%), Positives = 322/337 (96%), Gaps = 0/337 (0%)
 Frame = +3

Query  165   DKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQA  344
             D+IIAEYIWVGGSGMD+RSKART+ GPVTDPS+LPKWNYDGSSTGQAPG+DSEVILYPQA
Sbjct  75    DRIIAEYIWVGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSSTGQAPGEDSEVILYPQA  134

Query  345   IFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLLQ  524
             IF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+K+FS+PDVA E PWYGIEQEYTLLQ
Sbjct  135   IFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSNPDVAAEVPWYGIEQEYTLLQ  194

Query  525   KDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMPG  704
             KDV WP+GWP+GGYPGPQGPYYCG+GADK++GRD+VDSHYKACLYAGINISGINGEVMPG
Sbjct  195   KDVKWPVGWPIGGYPGPQGPYYCGIGADKSFGRDVVDSHYKACLYAGINISGINGEVMPG  254

Query  705   QWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKS  884
             QWEFQVGP+VGISAADE+WVARYILERITEIAGVV+SFDPKPI GDWNGAGAH NYSTKS
Sbjct  255   QWEFQVGPAVGISAADEIWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHCNYSTKS  314

Query  885   MRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASVR  1064
             MR +GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGAS+R
Sbjct  315   MREEGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGASIR  374

Query  1065  VGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             VGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  375   VGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTIL  411



>ref|XP_010440874.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Camelina 
sativa]
Length=356

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/340 (88%), Positives = 323/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIWVGGSGMD+RSKART+SGPV DPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRG+NILVMCD YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGDNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GG+PGPQGPYYCG+GADK++GRD+VDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPVGWPIGGFPGPQGPYYCGIGADKSFGRDVVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISAADE+WVARYILERITEIAGVV+SFDPKPI GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPAVGISAADEIWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MR +GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKTMREEGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTIL  353



>ref|XP_010415162.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X1 [Camelina sativa]
 ref|XP_010415163.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X2 [Camelina sativa]
Length=356

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/338 (88%), Positives = 324/338 (96%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIWVGGSGMD+RSKART+SGPVTDPSKLPKWNYDGSSTGQAPG+DSEVIL+PQ
Sbjct  16    TEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGQDSEVILFPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A++IFS+PDV  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFSNPDVVAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDVNWPLGWP+GGYPGPQGPYYC +GADK++GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDVNWPLGWPIGGYPGPQGPYYCSIGADKSFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISAADE+W+ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAADEVWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             +MR +GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGAS+
Sbjct  256   TMREEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRP+SNMDPY VTSMIAETT+L
Sbjct  316   RVGRDTEKEGKGYFEDRRPSSNMDPYIVTSMIAETTLL  353



>ref|XP_008789283.1| PREDICTED: glutamine synthetase nodule isozyme-like [Phoenix 
dactylifera]
Length=356

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/342 (88%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIW+GGSGMD+RSKART+  PVTD SKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTEKIIAEYIWIGGSGMDIRSKARTLPRPVTDASKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILVMCDCYTPAGE IPTNKR+ A+KIF HP V  EEPWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVMCDCYTPAGEPIPTNKRFNAAKIFGHPHVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYC  G +KA+GRDIV+SHY+ACLYAGINISGINGEV
Sbjct  134   LLQKDVQWPLGWPVGGYPGPQGPYYCAAGTNKAFGRDIVNSHYRACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+IKKAI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGYEVIKKAIEKLGKRHKEHIAAYGEGNERRLTGRHETADINTFVWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGR+TEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRETEKNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_006300523.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
 gb|EOA33421.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
Length=356

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/338 (88%), Positives = 324/338 (96%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIWVGGSGMD+RSKART+SGPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGQDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A++IF++PDV  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFNNPDVVAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDVNWPLGWP+GGYPGPQGPYYC +GADK++GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDVNWPLGWPIGGYPGPQGPYYCSIGADKSFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISA+DE+W+ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISASDEIWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR +GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGAS+
Sbjct  256   SMREEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRP+SNMDPY VTSMIAETT+L
Sbjct  316   RVGRDTEKEGKGYFEDRRPSSNMDPYVVTSMIAETTLL  353



>ref|XP_003600702.1| Glutamine synthetase [Medicago truncatula]
 gb|AES70953.1| glutamine synthetase domain protein [Medicago truncatula]
Length=356

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/342 (87%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIW+GGSG+DLRSKART+ GPVTDPS+LPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    ETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQAPGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GG+PGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPVGGFPGPQGPYYCGAGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITEIA VVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERITEIADVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+I KAI KL  +HKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEVILKAIEKLGKKHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRP+SNMDPY VTSMIA+TTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPSSNMDPYVVTSMIADTTILWK  355



>ref|XP_010470493.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/338 (88%), Positives = 324/338 (96%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIWVGGSGMD+RSKART+SGPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGQDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A++IFS+PDV  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFSNPDVVAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDVNWPLGWP+GGYPGPQGPYYC +GADK++GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDVNWPLGWPIGGYPGPQGPYYCSIGADKSFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISAADE+W+ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAADEVWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             +MR +GGYE+IKKAI KL L+HKEHIAAYGEGNERRLTG HETADINTF WGVA+RGAS+
Sbjct  256   TMREEGGYEVIKKAIEKLGLKHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRP+SNMDPY VTSMIAETT+L
Sbjct  316   RVGRDTEKEGKGYFEDRRPSSNMDPYIVTSMIAETTLL  353



>ref|XP_007163376.1| hypothetical protein PHAVU_001G229500g [Phaseolus vulgaris]
 gb|ESW35370.1| hypothetical protein PHAVU_001G229500g [Phaseolus vulgaris]
Length=356

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/342 (87%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+IAEYIW+GGSG+DLRSKART+ GPVT+PS+LPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    DTTEKVIAEYIWIGGSGLDLRSKARTLPGPVTNPSQLPKWNYDGSSTGQAPGQDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS+PDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHNAAKIFSNPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+VNWP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKEVNWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACVYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITE+AGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEVAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MRNDGGYE IK AI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKTMRNDGGYEEIKSAIQKLGKRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>gb|ABX79672.1| glutamine synthetase [Camellia sinensis]
Length=356

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/342 (88%), Positives = 319/342 (93%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GG+G+DLRSKART+SGPV DP KLPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    DSTEKIIAEYIWIGGTGLDLRSKARTLSGPVNDPKKLPKWNYDGSSTGQAPGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCD YTPAGE IPTNKRY A KIFSH DV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRYNAEKIFSHTDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP GGYPGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPKGGYPGPQGPYYCGAGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELW ARYILERITEIAGVV+SFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWEARYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGY++IKKAI KL L+HKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRKDGGYQVIKKAIEKLGLKHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIA TTIL K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAATTILWK  355



>gb|AAP33167.1| cytosolic glutamine synthetase [Securigera parviflora]
Length=356

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/342 (87%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIW+GGSG+DLRSKART+ GPV+DPS+LPKWNYDGSSTG+APG+DSEVILY
Sbjct  14    ETTDKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDGSSTGRAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRG+NILV+CD YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGSNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+VNWPLGWPLGG+PGPQGPYYCG GADKA GRDIVD+HYKACLYAG++ISGINGEV
Sbjct  134   LLQKEVNWPLGWPLGGFPGPQGPYYCGTGADKALGRDIVDAHYKACLYAGVSISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARY+LERITEIAGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWVARYVLERITEIAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MR DGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKTMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>ref|XP_010435595.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/340 (88%), Positives = 322/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIWVGGSGMD+RSKART+SGPV DPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMC+ YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCNAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GG+PGPQGPYYCG+GADK++GRD+VDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPVGWPIGGFPGPQGPYYCGIGADKSFGRDVVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITEIAGVV+SFDPKPI GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MR +GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKTMREEGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTIL  353



>ref|XP_002888488.1| ATGSR2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64747.1| ATGSR2 [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/340 (88%), Positives = 324/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + ++KIIAEYIWVGGSGMD+RSKART+SGPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTSEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+ IFS+PDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAVIFSNPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GGYPGPQGPYYC +GADK++GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPIGGYPGPQGPYYCSIGADKSFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA+DE+W+ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISASDEVWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYEIIKKAI KL LRHKEHI+AYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKSMREEGGYEIIKKAIEKLGLRHKEHISAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETT+L
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTLL  353



>sp|P07694.1|GLNA3_PEA RecName: Full=Glutamine synthetase root isozyme A; AltName: Full=Cytosolic 
GS3 A; AltName: Full=Glutamate--ammonia ligase 
[Pisum sativum]
 emb|CAA28456.1| unnamed protein product [Pisum sativum]
Length=357

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/342 (87%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIWVGGSG+D+RSKART+ GPV+DP+KLPKWNYDGSST QAPGKDSEVILY
Sbjct  14    DSTEKIIAEYIWVGGSGIDIRSKARTLPGPVSDPAKLPKWNYDGSSTNQAPGKDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE +PTNKRY A+KIFSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDVYTPAGEPLPTNKRYNAAKIFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GGYPG QGPYYCG+GADKA+GRDIVD+HYKACL+AGINISGINGEV
Sbjct  134   LLQKDINWPLGWPIGGYPGKQGPYYCGIGADKAYGRDIVDAHYKACLFAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEIAGVV+SFDPKPI GDWNGAGAH N+S
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHANFS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG+HETADIN F WGVA+RG+
Sbjct  254   TKSMRENGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINVFSWGVANRGS  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_009785976.1| PREDICTED: glutamine synthetase isoform X1 [Nicotiana sylvestris]
Length=356

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/342 (87%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMDLRSKART+SGPVTDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTQKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSELPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS+PDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQ+D+NWPLGWP+GG+PGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQRDINWPLGWPIGGFPGPQGPYYCGTGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERI EIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWVARYILERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+I KAI KL L+HKEHIAAYGEGNERRLTG+HETA+I+TFKWGVA+RGA
Sbjct  254   TKSMREDGGYEVILKAIEKLGLKHKEHIAAYGEGNERRLTGKHETANISTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VT+MIA+TTI+ K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTAMIADTTIICK  355



>ref|NP_001049424.1| Os03g0223400 [Oryza sativa Japonica Group]
 sp|P14654.1|GLN12_ORYSJ RecName: Full=Glutamine synthetase cytosolic isozyme 1-2; AltName: 
Full=Glutamate--ammonia ligase GLN1;2; Short=OsGLN1;2; 
AltName: Full=Glutamine synthetase root isozyme; AltName: Full=OsGS1;2 
[Oryza sativa Japonica Group]
 emb|CAA32460.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAD77931.1| cytosolic glutamine synthetase 1;2 [Oryza sativa Japonica Group]
 gb|ABF94717.1| Glutamine synthetase root isozyme 5, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11338.1| Os03g0223400 [Oryza sativa Japonica Group]
 dbj|BAH01417.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74788.1| hypothetical protein OsI_10575 [Oryza sativa Indica Group]
 gb|EEE58620.1| hypothetical protein OsJ_09974 [Oryza sativa Japonica Group]
Length=357

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/342 (86%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +C+DKIIAEYIWVGGSG+DLRSKART+ GP+TD S+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCSDKIIAEYIWVGGSGIDLRSKARTVKGPITDVSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRG+NILVMCDCYTP GE IPTNKR++A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGDNILVMCDCYTPQGEPIPTNKRHSAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GG+PGPQGPYYC  GA+KA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPVGGFPGPQGPYYCAAGAEKAFGRDIVDAHYKACIYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGI+AAD++WVARYILER+TE+AGVVLS DPKPI GDWNGAGAHTN+S
Sbjct  194   MPGQWEFQVGPSVGIAAADQVWVARYILERVTEVAGVVLSLDPKPIPGDWNGAGAHTNFS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREPGGYEVIKKAIDKLALRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VT MIAETT+L K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTGMIAETTLLWK  355



>ref|XP_009338856.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Pyrus 
x bretschneideri]
Length=356

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/342 (88%), Positives = 319/342 (93%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMD+RSKART+ GPV+DPSKLPKWNYDGSST QAPG+DSEVILY
Sbjct  14    DSTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTNQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE IPTNKR  A+KIFSHPDV  E  WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDTYTPAGEPIPTNKRAAAAKIFSHPDVVAEVTWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GG+PGPQGPYYC  GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGFPGPQGPYYCAAGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREDGGYEVIKKAINKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTE+ GKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  314   SIRVGRDTEQAGKGYFEDRRPASNMDPYVVTSMIAETTLLLK  355



>dbj|BAD11327.1| glutamine synthetase [Camellia sinensis]
Length=356

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/342 (87%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIW+GGSGMDLRSKART++ PV+DPSKLP+WNYDGSSTGQAPG+DSEVILY
Sbjct  14    ESTEKIIAEYIWIGGSGMDLRSKARTLNAPVSDPSKLPQWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAI++DPFRRGNNILVMCD YTP GE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIYKDPFRRGNNILVMCDAYTPGGEPIPTNKRFDAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+V WP+GWP+GGYPGPQGPYYCG+GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKEVKWPIGWPVGGYPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ D+LW+ARYILERITEIAGVV+SFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISSGDQLWMARYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGG+E+IKKAI KL L+HKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGFEVIKKAIEKLGLKHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIA TTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIANTTILWK  355



>gb|ACF42116.1| cytosolic glutamine synthetase [Brassica oleracea var. italica]
Length=356

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/338 (88%), Positives = 323/338 (96%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIWVGGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A++IFS+PDV  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDV WP+GWP+GG+PGPQGPYYC VGADK++GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDVKWPVGWPIGGFPGPQGPYYCSVGADKSFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISAADE+W+ARYILERITEIAGVV+S DPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAADEVWIARYILERITEIAGVVVSSDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR +GGYEIIKKAI KL LRHKEHI+AYGEGNERRLTG HETADINTFKWGVA+RGAS+
Sbjct  256   SMREEGGYEIIKKAIDKLGLRHKEHISAYGEGNERRLTGHHETADINTFKWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRPASNMDPYTVTSMIAETT+L
Sbjct  316   RVGRDTEKEGKGYFEDRRPASNMDPYTVTSMIAETTLL  353



>tpg|DAA44141.1| TPA: glutamine synthetase6 [Zea mays]
Length=363

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/340 (86%), Positives = 323/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTD+IIAEYIW+GG+G+DLRSKART+ GP+TDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  20    DCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQAPGEDSEVILY  79

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GN+ILVMCDCYTP GE IPTNKRY+A+K+FSHPDVA E PWYGIEQEYT
Sbjct  80    PQAIFKDPFRKGNHILVMCDCYTPQGEPIPTNKRYSAAKVFSHPDVAAEVPWYGIEQEYT  139

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV+WPLGWP+GGYPGPQGPYYC  GADKA+GRD+VD+HYKACLYAGINISGINGEV
Sbjct  140   LLQKDVSWPLGWPVGGYPGPQGPYYCAAGADKAFGRDVVDAHYKACLYAGINISGINGEV  199

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITE+AG+VLS DPKPI+GDWNGAGAHTNYS
Sbjct  200   MPGQWEFQVGPSVGISAGDEIWVARYILERITEMAGIVLSLDPKPIKGDWNGAGAHTNYS  259

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IK AI KL  RHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  260   TKSMREAGGYEVIKAAIDKLGKRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  319

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTE++GKGYFEDRRPASNMDPY VT MIAETTIL
Sbjct  320   SIRVGRDTEREGKGYFEDRRPASNMDPYVVTGMIAETTIL  359



>ref|NP_001105538.1| glutamine synthetase root isozyme 1 [Zea mays]
 dbj|BAA03433.1| glutamine synthetase [Zea mays]
 gb|ACF84604.1| unknown [Zea mays]
 tpg|DAA44140.1| TPA: glutamine synthetase6 [Zea mays]
Length=357

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/340 (86%), Positives = 323/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTD+IIAEYIW+GG+G+DLRSKART+ GP+TDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GN+ILVMCDCYTP GE IPTNKRY+A+K+FSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNHILVMCDCYTPQGEPIPTNKRYSAAKVFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV+WPLGWP+GGYPGPQGPYYC  GADKA+GRD+VD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVSWPLGWPVGGYPGPQGPYYCAAGADKAFGRDVVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITE+AG+VLS DPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERITEMAGIVLSLDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IK AI KL  RHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREAGGYEVIKAAIDKLGKRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTE++GKGYFEDRRPASNMDPY VT MIAETTIL
Sbjct  314   SIRVGRDTEREGKGYFEDRRPASNMDPYVVTGMIAETTIL  353



>gb|AAK14401.1|AF343667_1 cytosolic glutamine synthetase [Beta vulgaris]
 gb|ABY75187.1| cytosolic glutamine synthetase [Beta vulgaris]
Length=356

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/342 (86%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E +DKIIAEYIW+GGSG+D+RSKART++GP++DP+KLPKWNYDGSST QAPG+DSEVILY
Sbjct  14    ETSDKIIAEYIWIGGSGLDMRSKARTLTGPISDPAKLPKWNYDGSSTNQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRG+NILVMCD YTPAGE IPTNKRY A KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGDNILVMCDAYTPAGEPIPTNKRYNAEKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP GG+PGPQGPYYCGVGADK++GRDIVD+HYKAC+YAG+NISGINGEV
Sbjct  134   LLQKDINWPLGWPTGGFPGPQGPYYCGVGADKSFGRDIVDAHYKACIYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGIS+ D++WVARYILERI EIAGVV+SFDPKP++GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGISSGDQVWVARYILERIAEIAGVVVSFDPKPVKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGG  +IK AI KL LRHKEHIAAYGEGNERRLTGRHETADI TF WGVA+RGA
Sbjct  254   TKSMREDGGINVIKAAIEKLSLRHKEHIAAYGEGNERRLTGRHETADITTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILGK  355



>sp|P38563.2|GLNA5_MAIZE RecName: Full=Glutamine synthetase root isozyme 5; AltName: Full=GS117; 
AltName: Full=Glutamate--ammonia ligase [Zea mays]
Length=357

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/342 (86%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTDKIIAEYIWVGGSG+DLRSKART+ GP+TDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDKIIAEYIWVGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCDCYTP GE IP+NKRY A+ +FSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDCYTPQGEPIPSNKRYKAATVFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD++WPLGWP+GGYPGPQGPYYC  GADKA+GRD+VD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDLSWPLGWPVGGYPGPQGPYYCAAGADKAFGRDVVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITE+AG+VLS DPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERITEMAGIVLSLDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IK+AI KL  RH+EHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREAGGYEVIKEAIEKLGRRHREHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VT MIA+TTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTGMIADTTILWK  355



>ref|XP_010511548.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2 [Camelina 
sativa]
Length=356

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/338 (88%), Positives = 323/338 (96%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIWVGGSGMD+RSKART+SGPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGQDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A++IF +PDV  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFCNPDVVAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDVNWPLGWP+GGYPGPQGPYYC +GADK++GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDVNWPLGWPIGGYPGPQGPYYCSIGADKSFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISAADE+W+ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAADEVWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             +MR +GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGAS+
Sbjct  256   TMREEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRP+SNMDPY VTSMIAETT+L
Sbjct  316   RVGRDTEKEGKGYFEDRRPSSNMDPYIVTSMIAETTLL  353



>ref|NP_001268104.1| glutamine synthetase [Vitis vinifera]
 emb|CAC39216.1| glutamine synthetase [Vitis vinifera]
Length=356

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/342 (87%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSG DLRSKART+SGPVT P++LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYIWIGGSGNDLRSKARTLSGPVTGPAQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR G+NILVMCD YTP GE IPTNKR+ A+KIFSHP+V  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRGGDNILVMCDAYTPGGEPIPTNKRFNAAKIFSHPEVTAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP+GG+PGPQG  YCG+GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPVGGFPGPQGIIYCGIGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITEIAGVV+SFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEIAGVVVSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN GGY++IKKAI KL LRHKEHI+AYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNTGGYDVIKKAIEKLGLRHKEHISAYGEGNERRLTGRHETADINTFCWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDP  VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPIVVTSMIAETTILWK  355



>gb|AID48673.1| theanine synthetase [Camellia oleifera]
Length=356

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/342 (87%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIW+GGSGMDLRSKART++ PV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ESTEKIIAEYIWIGGSGMDLRSKARTLNAPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAI++DPFRRGNNILVMCD YTP GE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIYKDPFRRGNNILVMCDAYTPGGEPIPTNKRFDAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+V WP+GWP+GGYPGPQGPYYCG+GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKEVKWPVGWPVGGYPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ D+LW+ARYILERITEIAGVV+SFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISSGDQLWMARYILERITEIAGVVVSFDPKPIEGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGG+E+IKKAI KL L+HKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGFEVIKKAIEKLGLKHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPA NMDPY VTSMIA TTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPAPNMDPYVVTSMIANTTILWK  355



>ref|XP_010525077.1| PREDICTED: glutamine synthetase nodule isozyme [Tarenaya hassleriana]
Length=356

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/342 (86%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+IAEYIW+GGSG+D+RSKART+ GPVTDPS+LPKWNYDGSSTGQAPG DSEVILY
Sbjct  14    DSTEKVIAEYIWIGGSGLDMRSKARTLPGPVTDPSELPKWNYDGSSTGQAPGNDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILVMCD YTPAGE IPTN R+ A+KIFSH DV  EEPWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVMCDAYTPAGEPIPTNNRHAAAKIFSHSDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVDSHYKACLYAGI++SGINGEV
Sbjct  134   LLQKDIKWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDSHYKACLYAGISVSGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWE+QVGP VGISA D+LWV+RYILERITEIAGV+LSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEYQVGPVVGISAGDQLWVSRYILERITEIAGVILSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GG EIIKKAI KL LRHKEHI+AYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMRNEGGMEIIKKAIEKLGLRHKEHISAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTILWK  355



>emb|CAA71317.1| glutamine synthetase [Medicago truncatula]
Length=356

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/342 (87%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIW+GGSG+DLRSKART+ GPVTDPS+LPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    ETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQAPGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNI VMCD YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNIFVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GG+PGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPVGGFPGPQGPYYCGAGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITEIA VVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERITEIADVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+I KAI KL  +HKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEVILKAIEKLGKKHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRP+SNMDPY VTSMIA+TTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPSSNMDPYVVTSMIADTTILWK  355



>gb|AFP20991.1| glutamine synthetase isozyme [Zea mays]
Length=356

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/342 (86%), Positives = 325/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K IAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKFIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKRY+A+KIFS P+VA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYSAAKIFSSPEVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWPLGWP+GG+PGPQGPYYCG+GA+K++GRD VD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDTNWPLGWPIGGFPGPQGPYYCGIGAEKSFGRDTVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ D++WVARY+LERITEIAGVV++FDPKPI G WNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISSGDQVWVARYVLERITEIAGVVVTFDPKPIPGGWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             T+SMR +GGYE+IK AI KL+LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TESMRKEGGYEVIKAAIEKLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTIVWK  355



>ref|XP_004135959.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
sativus]
 ref|XP_004158173.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
sativus]
 gb|KGN45076.1| hypothetical protein Csa_7G420690 [Cucumis sativus]
Length=356

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/341 (86%), Positives = 321/341 (94%), Gaps = 0/341 (0%)
 Frame = +3

Query  159   CTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYP  338
              T+KIIAEY+W+GGSG+DLRSKART+ GPVTDP+KLPKWNYDGSST QAPG DSEVI+YP
Sbjct  15    TTEKIIAEYVWIGGSGLDLRSKARTLPGPVTDPAKLPKWNYDGSSTNQAPGDDSEVIIYP  74

Query  339   QAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTL  518
             QA+F+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS+PDV  EEPWYGIEQEYTL
Sbjct  75    QAVFKDPFRRGNNILVMCDAYTPAGEPIPTNKRFNAAKIFSNPDVVAEEPWYGIEQEYTL  134

Query  519   LQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVM  698
             LQKD++WPLGWP GG+PGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEVM
Sbjct  135   LQKDIHWPLGWPTGGFPGPQGPYYCGTGADKAFGRDIVDSHYKACLYAGINISGINGEVM  194

Query  699   PGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYST  878
             PGQWE+QVGP+VGI++ D+LW++RYILERITEIAGVV++FDPKPIQGDWNGAGAHTNYST
Sbjct  195   PGQWEYQVGPTVGIASGDQLWMSRYILERITEIAGVVVTFDPKPIQGDWNGAGAHTNYST  254

Query  879   KSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGAS  1058
             KSMRNDGG  +IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGAS
Sbjct  255   KSMRNDGGINVIKKAIEKLSLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGAS  314

Query  1059  VRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             VRVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  315   VRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILGK  355



>sp|Q43066.1|GLNA4_PEA RecName: Full=Glutamine synthetase root isozyme B; AltName: Full=Cytosolic 
GS3 B; AltName: Full=Glutamate--ammonia ligase 
[Pisum sativum]
 gb|AAB03493.1| cytosolic glutamine synthetase [Pisum sativum]
Length=357

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/342 (86%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIWVGGSG+D+RSKART+ GPV+DP+KLPKWNYDGSST QAPGKDSEVILY
Sbjct  14    DSTEKIIAEYIWVGGSGIDIRSKARTLPGPVSDPAKLPKWNYDGSSTDQAPGKDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE +PTNKRY A+KIFSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDVYTPAGEPLPTNKRYNAAKIFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GGYPG QGPYYCG+GADKA+GRDIVD+HYKACL+AGINISGINGEV
Sbjct  134   LLQKDINWPLGWPIGGYPGKQGPYYCGIGADKAYGRDIVDAHYKACLFAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEI+GVV+SFDPKPI GDWNGAGAH N+S
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWAARYILERITEISGVVVSFDPKPIPGDWNGAGAHANFS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG+HETADIN F WGVA+RG+
Sbjct  254   TKSMRENGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINVFSWGVANRGS  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_010450518.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/340 (88%), Positives = 321/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIWVGGSGMD+RSKART+SG V DPS LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTDKIIAEYIWVGGSGMDMRSKARTLSGSVKDPSDLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GG+PGPQGPYYCG+GADK++GRD+VDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPVGWPIGGFPGPQGPYYCGIGADKSFGRDVVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISAADE+WVARYILERITEIAGVV+SFDPKPI GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPAVGISAADEIWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MR +GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKTMREEGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTIL  353



>sp|P12424.1|GLNA_NICPL RecName: Full=Glutamine synthetase; AltName: Full=Glutamate--ammonia 
ligase [Nicotiana plumbaginifolia]
 gb|AAA34066.1| glutamine synthetase (EC 6.3.1.2) [Nicotiana plumbaginifolia]
Length=356

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/342 (87%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+SGPVTDP+KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPAKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS+PDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQ+D+NWPLGWP+GG+PGPQGPYYCG GADKA+GRDIVDSHYKA LYAGINISGINGEV
Sbjct  134   LLQRDINWPLGWPIGGFPGPQGPYYCGTGADKAFGRDIVDSHYKAYLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERI EIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWVARYILERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+I KAI KL L+HKEHIAAYGEGNERRLTG+HETA+I+TFKWGVA+RGA
Sbjct  254   TKSMREDGGYEVILKAIEKLGLKHKEHIAAYGEGNERRLTGKHETANISTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VT+MIA+TTI+ K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTAMIADTTIIGK  355



>ref|XP_010688706.1| PREDICTED: glutamine synthetase nodule isozyme [Beta vulgaris 
subsp. vulgaris]
Length=356

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/342 (86%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E +DKIIAEYIW+GGSG+D+RSKART++GP++DP+KLPKWNYDGSST QAPG+DSEVILY
Sbjct  14    ETSDKIIAEYIWIGGSGLDMRSKARTLTGPISDPAKLPKWNYDGSSTNQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRG+NILVMCD YTPAGE IPTNKRY A KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGDNILVMCDAYTPAGEPIPTNKRYNAEKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP GG+PGPQGPYYCGVGADK++GRDIVD+HYKAC+YAG+NISGINGEV
Sbjct  134   LLQKDINWPLGWPTGGFPGPQGPYYCGVGADKSFGRDIVDAHYKACIYAGVNISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGIS+ D++WVARYILERI EIAGVV+SFDPKP++GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGISSGDQVWVARYILERIAEIAGVVVSFDPKPVKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGG  +IK AI KL LRHKEHIAAYGEGNERRLTGRHETADI TF WGVA+RGA
Sbjct  254   TKSMREDGGINVIKAAIEKLGLRHKEHIAAYGEGNERRLTGRHETADITTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILGK  355



>gb|AAZ30058.1| glutamine synthetase isoform GS1b [Triticum aestivum]
Length=356

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/340 (86%), Positives = 326/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFR+GNNILVMCDCYTPAG  IPTNKRY A+KIFS+PDVAKEEPWYGIEQEYTLL
Sbjct  76    AIFKDPFRKGNNILVMCDCYTPAGVPIPTNKRYNAAKIFSNPDVAKEEPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD+NWPLGWP+GG+PGPQGPYYC +GADK++GRDIVDSHYKACL+AG+NISGINGEVMP
Sbjct  136   QKDINWPLGWPVGGFPGPQGPYYCSIGADKSFGRDIVDSHYKACLFAGVNISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGISA D++WVARY+LERITEIAGVV++FDPKPI GDWNGAGAHTNYST+
Sbjct  196   GQWEFQVGPTVGISAGDQVWVARYLLERITEIAGVVVTFDPKPIPGDWNGAGAHTNYSTE  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR DGG+++I  A+ KL+L+HKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGASV
Sbjct  256   SMRKDGGFKVIVDAVEKLKLKHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGASV  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  316   RVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|NP_001105297.1| glutamine synthetase root isozyme 5 [Zea mays]
 dbj|BAA03432.1| glutamine synthetase [Zea mays]
Length=357

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/342 (86%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTD+IIAEYIWVGGSG+DLRSKART+ GP+TDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDRIIAEYIWVGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCDCYTP GE IP+NKRY A+ +FSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDCYTPQGEPIPSNKRYKAATVFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD++WPLGWP+GGYPGPQGPYYC  GADKA+GRD+VD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDLSWPLGWPVGGYPGPQGPYYCAAGADKAFGRDVVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITE+AG+VLS DPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERITEMAGIVLSLDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IK+AI KL  RH+EHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREAGGYEVIKEAIEKLGRRHREHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VT MIA+TTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTGMIADTTILWK  355



>ref|XP_007152660.1| hypothetical protein PHAVU_004G148300g [Phaseolus vulgaris]
 sp|P04771.1|GLNA2_PHAVU RecName: Full=Glutamine synthetase PR-2; AltName: Full=Gln isozyme 
alpha; AltName: Full=Glutamate--ammonia ligase [Phaseolus 
vulgaris]
 emb|CAA27632.1| unnamed protein product [Phaseolus vulgaris]
 gb|ESW24654.1| hypothetical protein PHAVU_004G148300g [Phaseolus vulgaris]
 prf||1208270B synthetase R2,Gln
Length=356

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/342 (88%), Positives = 320/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIWVGGSGMDLRSKART+ GPV DP+KLPKWNYDGSST QAPG DSEVILY
Sbjct  14    ESTEKIIAEYIWVGGSGMDLRSKARTLPGPVDDPAKLPKWNYDGSSTDQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE +PTNKRY A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDVYTPAGEPLPTNKRYDAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWPLGGYPGPQGPYYCGVGADKA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPLGGYPGPQGPYYCGVGADKAYGRDIVDAHYKACVYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITE+AG V+SFDPKPI GDWNGAGAH+NYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWAARYILERITELAGAVVSFDPKPIPGDWNGAGAHSNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL LRHKEHIAAYG+GNERRLTGRHETADINTF WGVA+RG+
Sbjct  254   TKSMREEGGYEVIKKAIEKLGLRHKEHIAAYGKGNERRLTGRHETADINTFSWGVANRGS  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEKQGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_009785977.1| PREDICTED: glutamine synthetase isoform X2 [Nicotiana sylvestris]
Length=356

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/342 (87%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMDLRSKART+SGPVTDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTQKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSELPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS+PDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQ+D+NWPLGWP+GG+PGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQRDINWPLGWPIGGFPGPQGPYYCGTGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERI EIAGVV+SFDPKPI GDWNGAGAHTNY 
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWVARYILERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYI  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+I KAI KL L+HKEHIAAYGEGNERRLTG+HETA+I+TFKWGVA+RGA
Sbjct  254   TKSMREDGGYEVILKAIEKLGLKHKEHIAAYGEGNERRLTGKHETANISTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VT+MIA+TTI+ K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTAMIADTTIICK  355



>ref|XP_008365754.1| PREDICTED: glutamine synthetase cytosolic isozyme [Malus domestica]
Length=356

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/342 (88%), Positives = 318/342 (93%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMD+RSKART+ G V+DPSKLPKWNYDGSST QAPG+DSEVILY
Sbjct  14    DSTKKIIAEYIWIGGSGMDIRSKARTLPGXVSDPSKLPKWNYDGSSTNQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE IPTNKR  A+KIFSHPDV  E  WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDAYTPAGEPIPTNKRAAAAKIFSHPDVVAEVTWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GG+PGPQGPYYC  GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGFPGPQGPYYCAAGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELW ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTE+ GKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  314   SIRVGRDTEQAGKGYFEDRRPASNMDPYIVTSMIAETTLLLK  355



>ref|XP_008358170.1| PREDICTED: glutamine synthetase cytosolic isozyme [Malus domestica]
Length=356

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/342 (88%), Positives = 318/342 (93%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMD+RSKART+ G V+DPSKLPKWNYDGSST QAPG+DSEVILY
Sbjct  14    DSTKKIIAEYIWIGGSGMDIRSKARTLPGXVSDPSKLPKWNYDGSSTNQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE IPTNKR  A+KIFSHPDV  E  WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDAYTPAGEPIPTNKRAAAAKIFSHPDVVAEVTWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GG+PGPQGPYYC  GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGFPGPQGPYYCAAGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELW ARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWAARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTE+ GKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  314   SIRVGRDTEQAGKGYFEDRRPASNMDPYXVTSMIAETTLLLK  355



>ref|XP_004250194.1| PREDICTED: glutamine synthetase [Solanum lycopersicum]
Length=354

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/338 (88%), Positives = 320/338 (95%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T KIIAEYIW+GGSGMD+RSKART+ GPVT P++LPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TQKIIAEYIWIGGSGMDMRSKARTLPGPVTSPAELPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+K+FSHPDVA EE WYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVAAEETWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             Q++VNWPLGWP+GG+PGPQGPYYCG GADKA+GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QREVNWPLGWPIGGFPGPQGPYYCGTGADKAFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISA DE+WVARYILERI EIAGVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAGDEVWVARYILERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR DGGYEII KAI KL L+HKEHIAAYGEGNERRLTG+HETA+INTFKWGVA+RGASV
Sbjct  256   SMREDGGYEIILKAIEKLGLKHKEHIAAYGEGNERRLTGKHETANINTFKWGVANRGASV  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTI+
Sbjct  316   RVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTII  353



>ref|XP_006844043.1| hypothetical protein AMTR_s00006p00241880 [Amborella trichopoda]
 gb|ERN05718.1| hypothetical protein AMTR_s00006p00241880 [Amborella trichopoda]
Length=356

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/342 (87%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSG+D+RSKART+SGPV+D  KLPKWNYDGSSTGQAPG DSEVILY
Sbjct  14    DSTEKIIAEYIWIGGSGLDMRSKARTLSGPVSDSRKLPKWNYDGSSTGQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQA+F+DPFRRGNNILVMCD YTP G  IPTNKR+ A+KIFSHPDVA E PWYGIEQEYT
Sbjct  74    PQAVFKDPFRRGNNILVMCDAYTPGGGPIPTNKRFNAAKIFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LL+KDVNWPLGWP+GG+PGPQGPYYCGVGADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLRKDVNWPLGWPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DE+WVARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDEIWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGG ++IKKAI KL LRHKEHI+AYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGIDVIKKAIEKLGLRHKEHISAYGEGNERRLTGHHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>gb|ABU45501.1| cytosolic glutamine synthetase [Spinacia oleracea]
Length=356

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/342 (87%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMD+RSKART++GPV+DP +LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYIWIGGSGMDMRSKARTLNGPVSDPKELPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTP GE IPTNKR  A KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPQGEPIPTNKRCNAEKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWP+GWP+GGYPGPQGPYYCG+GADKA+GRDIVDSHYKAC+YAGINISGINGEV
Sbjct  134   LLQKDVNWPVGWPVGGYPGPQGPYYCGIGADKAFGRDIVDSHYKACIYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISAADE+WVARYILERITEIAGV LSFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAADEVWVARYILERITEIAGVALSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYEIIK+AI KL LRH EHIAAYGEGNERRLTG+HETA I+TF WGVA+RGA
Sbjct  254   TKSMREDGGYEIIKQAIEKLGLRHNEHIAAYGEGNERRLTGKHETASISTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  314   SVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLLWK  355



>gb|AAG24873.1|AF301590_1 cytosolic glutamine synthetase GSbeta1 [Glycine max]
 gb|ACU23091.1| unknown [Glycine max]
 gb|KHN17957.1| Glutamine synthetase cytosolic isozyme 1 [Glycine soja]
Length=356

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/342 (87%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+IAEYIW+GGSGMDLRSKART+ GPV+DPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSELPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILV+CD YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WPLGWP+GG+PGPQGPYYCGVGADKA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKDIQWPLGWPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACIYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEIAGVV+SFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWAARYILERITEIAGVVVSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IK AI KL  +HKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEVIKAAIDKLGKKHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>prf||1804333D Gln synthetase
Length=430

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/337 (87%), Positives = 321/337 (95%), Gaps = 0/337 (0%)
 Frame = +3

Query  165   DKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQA  344
             D+IIAEYIW+GGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQA G+DSEVILYPQA
Sbjct  75    DRIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSSTGQAAGEDSEVILYPQA  134

Query  345   IFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLLQ  524
             IF+DPFR+GNNILVMCD YTPAG+ IPTNKR+ A+KIFSHPDVAKEEPWYGIEQEYTL+Q
Sbjct  135   IFKDPFRKGNNILVMCDAYTPAGDPIPTNKRHNAAKIFSHPDVAKEEPWYGIEQEYTLMQ  194

Query  525   KDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMPG  704
             KDVNWP+GWP+GGYPGPQGPYYCGVGADKA GRDIVD+HYKACLYAGI ISGINGEVMPG
Sbjct  195   KDVNWPIGWPVGGYPGPQGPYYCGVGADKAIGRDIVDAHYKACLYAGIGISGINGEVMPG  254

Query  705   QWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKS  884
             QWEFQVGP  GIS+ D++WVARY+LERITEI+GV++SFDPKP+ GDWNGAGAH NYSTK+
Sbjct  255   QWEFQVGPVEGISSGDQVWVARYLLERITEISGVIVSFDPKPVPGDWNGAGAHCNYSTKT  314

Query  885   MRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASVR  1064
             MRNDGG E+IKKAI KLQL+HKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGASVR
Sbjct  315   MRNDGGLEVIKKAIGKLQLKHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGASVR  374

Query  1065  VGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             VGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  375   VGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTIL  411



>gb|AAN05339.1| Putative GLN1_ORYSA GLUTAMINE SYNTHETASE ROOT ISOZYME (GLUTAMATE--AMMONIA 
LIGASE) [Oryza sativa Japonica Group]
Length=349

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/342 (84%), Positives = 313/342 (92%), Gaps = 8/342 (2%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +C+DKIIAEYIWVGGSG+DLRSKART+ GP+TD S+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCSDKIIAEYIWVGGSGIDLRSKARTVKGPITDVSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRG+NILVMCDCYTP GE IPTNKR++A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGDNILVMCDCYTPQGEPIPTNKRHSAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWP   Y        C  GA+KA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPGPYY--------CAAGAEKAFGRDIVDAHYKACIYAGINISGINGEV  185

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGI+AAD++WVARYILER+TE+AGVVLS DPKPI GDWNGAGAHTN+S
Sbjct  186   MPGQWEFQVGPSVGIAAADQVWVARYILERVTEVAGVVLSLDPKPIPGDWNGAGAHTNFS  245

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  246   TKSMREPGGYEVIKKAIDKLALRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  305

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VT MIAETT+L K
Sbjct  306   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTGMIAETTLLWK  347



>gb|AAZ30059.1| glutamine synthetase isoform GS1c [Triticum aestivum]
Length=356

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/340 (86%), Positives = 325/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFR+GNNILVMCDCYTPAG  IPTNKRY A KIFS+PDVAKEEPWYGIEQEYTLL
Sbjct  76    AIFKDPFRKGNNILVMCDCYTPAGVPIPTNKRYNAVKIFSNPDVAKEEPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD+NWPLGWP+GG+PGPQGPYYC +GADK++GRDIVDSHYKACL+AG+NISGINGEVMP
Sbjct  136   QKDINWPLGWPVGGFPGPQGPYYCSIGADKSFGRDIVDSHYKACLFAGVNISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGISA D++WVARY+LERITEIAGVV++FDPKPI GDWNGAGAHTNYST+
Sbjct  196   GQWEFQVGPTVGISAGDQVWVARYLLERITEIAGVVVTFDPKPIPGDWNGAGAHTNYSTE  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR DGG+++I  A+ KL+L+HKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGASV
Sbjct  256   SMRKDGGFKVIVDAVEKLKLKHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGASV  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  316   RVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_010236151.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Brachypodium 
distachyon]
Length=356

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/340 (86%), Positives = 326/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIW+GGSGMDLRSKART+SGPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCDCYTPAGE IPTNKR+ A+KIFS+P V+ EEPWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRHAAAKIFSNPAVSAEEPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD+NWPLGWP+GG+PGPQGPYYC +GADK++GRDIVDSHYKACLYAGINISGINGEVMP
Sbjct  136   QKDINWPLGWPVGGFPGPQGPYYCSIGADKSFGRDIVDSHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISA D++WVARY+LERITEIAGVV+SFDPKPI GDWNGAGAHTNYST+
Sbjct  196   GQWEFQVGPSVGISAGDQVWVARYLLERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTE  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR DGG+++I  A+ KL+LRHKEHIAAYGEGNERRLTG+HETADI+TF WGVA+RGASV
Sbjct  256   SMRKDGGFQVIVAAVEKLKLRHKEHIAAYGEGNERRLTGKHETADIHTFSWGVANRGASV  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGR+TE++GKGYFEDRRPASNMDPY VT+MIA+TTIL K
Sbjct  316   RVGRETEQNGKGYFEDRRPASNMDPYVVTAMIADTTILWK  355



>gb|AAZ30057.1| glutamine synthetase isoform GS1a [Triticum aestivum]
 gb|ADW94625.1| glutamine synthetase isoform GS1 [Triticum aestivum]
 gb|EMS48337.1| Glutamine synthetase cytosolic isozyme 1-1 [Triticum urartu]
Length=356

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/340 (86%), Positives = 326/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFR+GNNILVMCDCYTPAG  IPTNKRY A+KIFS+PDVAKEEPWYGIEQEYTLL
Sbjct  76    AIFKDPFRKGNNILVMCDCYTPAGVPIPTNKRYNAAKIFSNPDVAKEEPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD+NWPLGWP+GG+PGPQGPYYC +GADK++GRDIVD+HYKACL+AG+NISGINGEVMP
Sbjct  136   QKDINWPLGWPVGGFPGPQGPYYCSIGADKSFGRDIVDAHYKACLFAGVNISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGISA D++WVARY+LERITEIAGVV++FDPKPI GDWNGAGAHTNYST+
Sbjct  196   GQWEFQVGPTVGISAGDQVWVARYLLERITEIAGVVVTFDPKPIPGDWNGAGAHTNYSTE  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR DGG+++I  A+ KL+L+HKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGASV
Sbjct  256   SMRKDGGFKVIVDAVEKLKLKHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGASV  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  316   RVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_009139734.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Brassica 
rapa]
Length=356

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/340 (88%), Positives = 321/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDK+IAEYIWVGGSGMD+RSKART+ GPV+DPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTDKVIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+K+FSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWPLGG+PGPQGPYYC VGADK++GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPLGGFPGPQGPYYCSVGADKSFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DE+ VAR+ILERITEIAGVV+SFDPKPI GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPAVGISAGDEILVARFILERITEIAGVVVSFDPKPIPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIA+TTIL
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIADTTIL  353



>ref|XP_008461372.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
melo]
Length=356

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/342 (86%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEY+W+GGSG+DLRSKART+ GPVTDP+KLPKWNYDGSST QAPG +SEVI+Y
Sbjct  14    DTTEKIIAEYVWIGGSGLDLRSKARTLPGPVTDPAKLPKWNYDGSSTNQAPGDNSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQA+F+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS+PDV  EEPWYGIEQEYT
Sbjct  74    PQAVFKDPFRRGNNILVMCDAYTPAGEPIPTNKRFNAAKIFSNPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD++WPLGWP+GG+PGPQGPYYCG GADKA+GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDIHWPLGWPVGGFPGPQGPYYCGTGADKAFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWE+QVGP+VGI++ D+LW++RYILERITEIAGVV++FDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEYQVGPAVGIASGDQLWMSRYILERITEIAGVVVTFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG ++IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGIDVIKKAIDKLSLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>prf||1804333C Gln synthetase
Length=430

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/337 (88%), Positives = 321/337 (95%), Gaps = 0/337 (0%)
 Frame = +3

Query  165   DKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQA  344
             D+IIAEYIWVGGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQA
Sbjct  75    DRIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGQDSEVILYPQA  134

Query  345   IFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLLQ  524
             IF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A++IF++PDV  E PWYGIEQEYTLLQ
Sbjct  135   IFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVIAEVPWYGIEQEYTLLQ  194

Query  525   KDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMPG  704
             KDVNWPLGWP+GG+PGPQGPYYC +GADK++GRDIVD+HYKA LYAGINISGINGEVMPG
Sbjct  195   KDVNWPLGWPIGGFPGPQGPYYCSIGADKSFGRDIVDAHYKASLYAGINISGINGEVMPG  254

Query  705   QWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKS  884
             QWEFQVGPSVGISAADE+W+ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYSTKS
Sbjct  255   QWEFQVGPSVGISAADEIWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKS  314

Query  885   MRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASVR  1064
             MR +GGYEIIKKAI KL LRHKEHI+AYGEGNERRLTG HETADINTF WGVA+RGAS+R
Sbjct  315   MREEGGYEIIKKAIEKLGLRHKEHISAYGEGNERRLTGHHETADINTFLWGVANRGASIR  374

Query  1065  VGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             VGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETT+L
Sbjct  375   VGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLL  411



>dbj|BAL14865.1| putative cytosolic glutamine synthetase [Tulipa gesneriana]
 dbj|BAM84283.1| glutamine synthetase [Tulipa gesneriana]
 dbj|BAM84284.1| glutamine synthetase [Tulipa gesneriana]
Length=353

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/340 (87%), Positives = 321/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMDLRSKART+ GPVTDPS+LPKWN+DGSSTGQAPG+DSEVILY
Sbjct  14    DSTPKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSELPKWNFDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CDCYTPAGE IPTNKRY A+K+FS+P V+ E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRYNAAKVFSNPAVSAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GGYPGPQGPYYC  GADKA+GRD+VD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPIGGYPGPQGPYYCSAGADKAFGRDVVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITE+AGVVLS DPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWAARYILERITELAGVVLSLDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+I KAI KL L+HKEHI+AYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMRSDGGYEVILKAIEKLGLKHKEHISAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETT+L
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTLL  353



>ref|XP_004503122.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cicer arietinum]
Length=355

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/340 (87%), Positives = 321/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E ++KIIAEYIW+GGSG+DLRSKART+ GPV+DPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ESSEKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDGSSTGQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWP+GWP+GGYPGPQGPYYCG+GADKA+ RD+VD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDNNWPVGWPVGGYPGPQGPYYCGIGADKAFCRDVVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPS+GISA DE+WVARYILERITEIAGVVLS DPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSIGISAGDEVWVARYILERITEIAGVVLSLDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGGYE+IKKAI KL  +H EHIAAYGEGNERRLTGRHETADI TF WGVA+RGA
Sbjct  254   TKSMRNDGGYEVIKKAIEKLGKKHVEHIAAYGEGNERRLTGRHETADIKTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIA+TTIL
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTIL  353



>sp|P38559.1|GLNA1_MAIZE RecName: Full=Glutamine synthetase root isozyme 1; AltName: Full=GS122; 
AltName: Full=Glutamate--ammonia ligase [Zea mays]
 emb|CAA46719.1| glutamine synthetase [Zea mays]
Length=357

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/340 (86%), Positives = 322/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTD+IIAEYIW+GG+G+DLRSKART+ GP+TDP +LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPIQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GN+ILVMCDCYTP GE IPTNKRY+A+K+FSHPDVA E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNHILVMCDCYTPQGEPIPTNKRYSAAKVFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV+WPLGWP+GGYPGPQGPYYC  GADKA+GRD+VD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVSWPLGWPVGGYPGPQGPYYCAAGADKAFGRDVVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITE+AG+VLS DPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERITEMAGIVLSLDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IK AI KL  RHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREAGGYEVIKAAIDKLGKRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTE++GKGYFEDRRPASNMDPY VT MIAETTIL
Sbjct  314   SIRVGRDTEREGKGYFEDRRPASNMDPYVVTGMIAETTIL  353



>emb|CAJ87510.1| putative glutamine synthetase [Pisum sativum]
Length=356

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/340 (87%), Positives = 321/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIW+GGSG+DLR KART+ GPVTDPS+LPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWIGGSGLDLRCKARTLPGPVTDPSELPKWNYDGSSTGQAPGQDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGN+ILVMCD Y+PAGE IPTNKR+ A+K+FSHPDV  EE WYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNHILVMCDAYSPAGEPIPTNKRHAAAKVFSHPDVVAEETWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD+NWPLGWP GGYPGPQGPYYC VGADKA+GRD+V++HYKACL+AGINISGINGEVMP
Sbjct  136   QKDINWPLGWPAGGYPGPQGPYYCSVGADKAFGRDVVEAHYKACLFAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISA DE+WVARYILERITE+AGVVL+FDPKPI+GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAGDEIWVARYILERITEVAGVVLTFDPKPIKGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR DGGYEIIKKAI KL  RH EHI+AYGEGNERRLTG+HETADINTF WGVA+RGASV
Sbjct  256   SMREDGGYEIIKKAIEKLGKRHAEHISAYGEGNERRLTGKHETADINTFSWGVANRGASV  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  316   RVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILLK  355



>gb|AEM42902.1| cytosolic glutamine synthetase isoform [Secale cereale x Triticum 
turgidum subsp. durum]
Length=356

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/340 (86%), Positives = 325/340 (96%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFR+GNNILVMCDCYTPAG  IPTNKRY A+KIFS+PDVAKEEPWYGIEQEYTLL
Sbjct  76    AIFKDPFRKGNNILVMCDCYTPAGVPIPTNKRYNAAKIFSNPDVAKEEPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD+NWPLGWP+GG+PGPQGPYYC +GADK++GRDIVDSHYKACL+AG+NISGINGEVMP
Sbjct  136   QKDINWPLGWPVGGFPGPQGPYYCSIGADKSFGRDIVDSHYKACLFAGVNISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGISA D++WVARY+LERITEIAGVV++FDPKPI GDWNGAGAHTNYST+
Sbjct  196   GQWEFQVGPTVGISAGDQVWVARYLLERITEIAGVVVTFDPKPIPGDWNGAGAHTNYSTE  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR DGG+++I  A+ KL+L+HKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGASV
Sbjct  256   SMRKDGGFKVIVDAVEKLKLKHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGASV  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETT L K
Sbjct  316   RVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTTLWK  355



>sp|P23712.2|GLNA_LACSA RecName: Full=Glutamine synthetase; AltName: Full=GS(1); AltName: 
Full=Glutamate--ammonia ligase [Lactuca sativa]
 emb|CAA42689.1| glutamine synthetase [Lactuca sativa]
Length=358

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/338 (88%), Positives = 323/338 (96%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             TDKIIAEYIW+GGSGMDLRSKART+SGPV+DPS+LPKWNYDGSSTGQAPG+DSEVI+YPQ
Sbjct  16    TDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSELPKWNYDGSSTGQAPGEDSEVIIYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGN+ILVMCD YTPAGE IPTNKR  A+KIFS+P+V KE  WYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNHILVMCDAYTPAGEPIPTNKRAAAAKIFSNPEVEKEVTWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD NWPLGWPLGG+PGPQGPYYCG+GADKA+GRDIVD+HYKACLYAG+NISGINGEVMP
Sbjct  136   QKDTNWPLGWPLGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGVNISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGI+AAD++WVARYILERITEI GVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGIAAADQIWVARYILERITEIYGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             +MR +GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGAS+
Sbjct  256   TMREEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  316   RVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTIL  353



>ref|XP_010420354.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 isoform 
X1 [Camelina sativa]
Length=356

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/342 (86%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TD+IIAEYIW+GGSG+D+RSKART+SGPV DPS+LPKWNYDGSSTGQAPG DSEVILY
Sbjct  14    DSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSSTGQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS P+V  E  WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVVAEVTWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVDSHYKACLYAGIN+SG NGEV
Sbjct  134   LLQKDIKWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDSHYKACLYAGINVSGTNGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGI+AAD++WVARYILERITE+AGVVLS DPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAE+TIL K
Sbjct  314   SIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAESTILWK  355



>gb|AGV07415.1| glutamine synthetase [Abies nordmanniana]
Length=355

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/342 (87%), Positives = 320/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSGMD+RSKART+S  VTDP  LPKWNYDGSSTGQAPGKDSEVI+Y
Sbjct  14    DVTDKIIAEYIWIGGSGMDIRSKARTLSHEVTDPKHLPKWNYDGSSTGQAPGKDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRG NILVMCD YTPAGE IPTNKR  A+KIFSHPDVA EEPW+GIEQEYT
Sbjct  74    PQAIFRDPFRRGKNILVMCDAYTPAGEPIPTNKRANAAKIFSHPDVAAEEPWFGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GG+PGPQGPYYCG GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPIGGFPGPQGPYYCGTGADKAYGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGIS+ D++WVARY+LERITE+AGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGISSGDQVWVARYLLERITEMAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GG  +IKKAI KL LRHK+HIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRKEGGIAVIKKAIEKLGLRHKQHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTE++GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEQEGKGYFEDRRPASNMDPYIVTSMIAETTILLK  355



>ref|XP_006288043.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
 gb|EOA20941.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
Length=356

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/342 (86%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TD+IIAEYIW+GGSG+D+RSKART+SGPV DPS+LPKWNYDGSSTGQAPG DSEVILY
Sbjct  14    DSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSSTGQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS P+V  EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVVAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVDSHYKACLYAGIN+SG NGEV
Sbjct  134   LLQKDIKWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDSHYKACLYAGINVSGTNGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGI+AAD++WVARYILERITE+AGVVLS DPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPYTVTSMIAE+TIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYTVTSMIAESTILWK  355



>gb|AAD52008.1| cytosolic glutamine synthetase [Canavalia lineata]
Length=355

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/342 (88%), Positives = 323/342 (94%), Gaps = 1/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIWVGGSGMDLRSKART+ GPV+DPSKLPKWNYDGSST QAPG DSEVILY
Sbjct  14    ESTEKIIAEYIWVGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTDQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE +PTNKR+ A+KIF+HPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDVYTPAGEPLPTNKRHDAAKIFTHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWPLGGYPGPQGPYYCGVGADKA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPLGGYPGPQGPYYCGVGADKAYGRDIVDAHYKACVYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DELW ARYILERITEIAG V+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDELWAARYILERITEIAGAVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR++GGYE+IKKAI KL L+HKEHIAAYG+GN RRLTGRHETADINTF WGVA+RG+
Sbjct  254   TKSMRDEGGYEVIKKAIEKLGLKHKEHIAAYGKGN-RRLTGRHETADINTFSWGVANRGS  312

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  313   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  354



>ref|XP_006391364.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
 gb|ESQ28650.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
Length=356

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/340 (87%), Positives = 322/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIWVGGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCD YTPAGE IPTNKR+ A++IFS+P V  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRHAAAQIFSNPAVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GG+PGPQGPYYC VGADK++GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPVGWPIGGFPGPQGPYYCSVGADKSFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISAADE+W+ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAADEVWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL LRHKEHI+AYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKSMREEGGYEVIKKAIDKLGLRHKEHISAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETT+L
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTLL  353



>gb|EYU24513.1| hypothetical protein MIMGU_mgv1a008973mg [Erythranthe guttata]
Length=356

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/342 (87%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K IAEYIW+GGSGMDLRSKART SGP+  PS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKTIAEYIWIGGSGMDLRSKARTFSGPIKHPSELPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF DPFRRGN+ILVMCD YTPAGE IPTNKRY A++IFS+P+VA E PWYGIEQEYT
Sbjct  74    PQAIFPDPFRRGNHILVMCDTYTPAGEPIPTNKRYGAAQIFSNPEVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GG+PGPQGPYYCG+GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITEIAGV++SFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWVARYILERITEIAGVIVSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL L+HK+HIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREEGGYEVIKKAIDKLGLKHKQHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGR+TE+ GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRETEQAGKGYFEDRRPASNMDPYIVTSMIAETTILSK  355



>gb|AAP33169.1| cytosolic glutamine synthetase [Securigera parviflora]
Length=356

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/342 (86%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIWVGGSG+D+RSKART+ GPV+DP+KLPKWNYDGSST QAPG+DSEVILY
Sbjct  14    ESTEKIIAEYIWVGGSGLDIRSKARTLPGPVSDPAKLPKWNYDGSSTDQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRG+NILV+CD YTPAGE +P++ RY A+KIFSHP+VA EEPWYGIEQEYT
Sbjct  74    PQAIFRDPFRRGSNILVICDVYTPAGEPLPSSYRYNAAKIFSHPEVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GG+PG QGPYYCG+GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPVGGFPGQQGPYYCGIGADKAYGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEIAG V+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWAARYILERITEIAGAVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGG+EIIKKAI KL L+HKEHIAAYG+GNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGFEIIKKAIEKLGLKHKEHIAAYGKGNERRLTGKHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRETEKEGKGYFEDRRPASNMDPYIVTSMIAETTILWK  355



>ref|XP_004299511.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Fragaria 
vesca subsp. vesca]
Length=356

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/342 (87%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIWVGGSGMD+RSKART+ GPV+DPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DITDKIIAEYIWVGGSGMDVRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILV+CD YTPAGE IPTNKR  A+KIF+HPDV  E PWYG+EQEYT
Sbjct  74    PQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRAKAAKIFNHPDVVAEVPWYGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWPLGGYPG QGPYYCG GADKA+GRDIVDSHYKACLYAGI+ISGINGEV
Sbjct  134   LLQKDVQWPIGWPLGGYPGAQGPYYCGAGADKAFGRDIVDSHYKACLYAGIDISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA D+LW ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTN+S
Sbjct  194   MPGQWEFQVGPTVGISAGDQLWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNFS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG+HETADI+TF WGVA+RGA
Sbjct  254   TKSMRKEGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADIDTFIWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLLWK  355



>dbj|BAM84285.1| glutamine synthetase [Tulipa fosteriana]
Length=353

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/340 (87%), Positives = 320/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMDLRSKART+ GPVTDPS+LPKWN+DGSSTGQAPG+DSEVILY
Sbjct  14    DSTPKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSELPKWNFDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CDCYTPAGE IPTNKRY A+KIFS+P V+ E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRYNAAKIFSNPAVSAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GGYPGPQGPYYC  GADKA+GRD+VD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPIGGYPGPQGPYYCSAGADKAFGRDVVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITE AGVVLS DPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWAARYILERITETAGVVLSLDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+I KAI KL L+HKEHI+AYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMRSDGGYEVILKAIEKLGLKHKEHISAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETT+L
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYIVTSMIAETTLL  353



>ref|XP_009408415.1| PREDICTED: glutamine synthetase nodule isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=357

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/340 (87%), Positives = 323/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CT+KI+AEYIWVGGSGMD+RSKART+SGPV DPS+LP+WNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTEKIVAEYIWVGGSGMDIRSKARTLSGPVGDPSQLPRWNYDGSSTGQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAI+RDPFRRGN+ILVMCDCYTP GE IPTNKR+ A+KIFS+P VA EE W+GIEQEYT
Sbjct  74    PQAIYRDPFRRGNDILVMCDCYTPQGEPIPTNKRHNAAKIFSNPAVAAEETWFGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LL+KDV WPLGWP+GG+PGPQGPYYC  GADKA+GRDIVD+HYKACLYAGI+ISGINGEV
Sbjct  134   LLRKDVKWPLGWPIGGFPGPQGPYYCSAGADKAFGRDIVDAHYKACLYAGIDISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP VGISA D+LWVARY+LERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPCVGISAGDQLWVARYLLERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR++GGYE+IK+AI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRSNGGYEVIKEAIQKLGLRHKEHIAAYGEGNERRLTGRHETADINTFVWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SIRVGRDTEKSGKGYFEDRRPASNMDPYVVTSMIAETTIL  353



>ref|XP_010066984.1| PREDICTED: glutamine synthetase cytosolic isozyme-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW65046.1| hypothetical protein EUGRSUZ_G02570 [Eucalyptus grandis]
Length=356

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/340 (87%), Positives = 319/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             TDKIIAEYIW+GGSG+D+RSKART+ GPVTDP+KLPKWNYDGSST QAPG DSEVILYPQ
Sbjct  16    TDKIIAEYIWIGGSGIDMRSKARTLRGPVTDPAKLPKWNYDGSSTDQAPGHDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             A+FRDPFRRG+NILVMCD YTPAGE IPTNKR+ A+K+FS P V  EEPWYGIEQEYTLL
Sbjct  76    AVFRDPFRRGSNILVMCDAYTPAGEPIPTNKRFNAAKVFSDPHVVAEEPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDV WP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDVQWPIGWPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGISAAD++WVARYILERITEIAGVVL+FDPKPI+GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPAVGISAADQVWVARYILERITEIAGVVLTFDPKPIKGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR  GG  +IKKAI KL LRHK HIAAYGEGNERRLTGRHETADINTF WGVA+RGAS+
Sbjct  256   SMREHGGLNVIKKAIEKLGLRHKHHIAAYGEGNERRLTGRHETADINTFSWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  316   RVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILLK  355



>sp|P04770.1|GLNA1_PHAVU RecName: Full=Glutamine synthetase PR-1; AltName: Full=Gln isozyme 
beta; AltName: Full=Glutamate--ammonia ligase [Phaseolus 
vulgaris]
 emb|CAA27631.1| unnamed protein product [Phaseolus vulgaris]
 prf||1208270A synthetase R1,Gln
Length=356

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/342 (86%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+IAEYIW+GGSG+DLRSKART+ GPV +PS+LPKWNYDGSSTGQAPG+DSEVI+Y
Sbjct  14    DTTEKVIAEYIWIGGSGLDLRSKARTLPGPVKNPSELPKWNYDGSSTGQAPGQDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE IPTNKR+ A+KIFS+PDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDAYTPAGEPIPTNKRHNAAKIFSNPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+VNWP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKEVNWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACVYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITE+AGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEVAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MRNDGGYE IK AI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKTMRNDGGYEEIKSAIQKLGKRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>ref|XP_009360053.1| PREDICTED: glutamine synthetase nodule isozyme-like [Pyrus x 
bretschneideri]
Length=356

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/342 (86%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSG+D+RSKART+ GPV+DPSKLPKWNYDGSSTGQAPGKDSEVILY
Sbjct  14    DSTEKIIAEYIWIGGSGIDIRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGKDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILV+CD YTP+GE IPTNKR  A+KIFSHPDV  EEPW+G+EQEYT
Sbjct  74    PQAIFRDPFRRGNNILVICDTYTPSGEPIPTNKRANAAKIFSHPDVVAEEPWFGLEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWPLGG+PGPQGPYYCGVGA+K++GRDIVDSHYKACLYAGI+ISGIN EV
Sbjct  134   LLQKDLKWPIGWPLGGFPGPQGPYYCGVGAEKSFGRDIVDSHYKACLYAGIDISGINAEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQ+GP+VGI+A D+LW AR+ILERITEIAGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQIGPTVGIAAGDQLWAARHILERITEIAGVVLSFDPKPIEGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+IKKAI KL LRHKEHIAAYG+GNERRLTGRHETADIN F WGVA+RGA
Sbjct  254   TKSMRSDGGYEVIKKAIEKLGLRHKEHIAAYGDGNERRLTGRHETADINRFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|NP_001105444.1| glutamine synthetase root isozyme 4 [Zea mays]
 sp|P38562.1|GLNA4_MAIZE RecName: Full=Glutamine synthetase root isozyme 4; AltName: Full=GS107; 
AltName: Full=Glutamate--ammonia ligase [Zea mays]
 emb|CAA46722.1| glutamine synthetase [Zea mays]
Length=355

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/342 (87%), Positives = 326/342 (95%), Gaps = 1/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCDCYTPAGE IPTNKRY+A+KIFS P+VA EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYSAAKIFSSPEVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD NWPLGWP+GG+PGPQGPYYCG+GA+K++GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDTNWPLGWPIGGFPGPQGPYYCGIGAEKSFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGIS+ D++WVARYILERITEIAGVV++FDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISSGDQVWVARYILERITEIAGVVVTFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             T+SMR +GGYE+IK AI KL+LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TESMRKEGGYEVIKAAIEKLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SV VG+ TE++GKGYFEDRRPASNMDPY VTSMIAETTI+ K
Sbjct  314   SVAVGQ-TEQNGKGYFEDRRPASNMDPYVVTSMIAETTIVWK  354



>pir||S18603 glutamate-ammonia ligase (EC 6.3.1.2), cytosolic (clone lambdaAtgskb6) 
- Arabidopsis thaliana
Length=374

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/337 (87%), Positives = 321/337 (95%), Gaps = 0/337 (0%)
 Frame = +3

Query  165   DKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQA  344
             D+IIAEYIW+GGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQA G+DSEVILYPQA
Sbjct  19    DRIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSSTGQAAGEDSEVILYPQA  78

Query  345   IFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLLQ  524
             IF+DPFR+GNNILVMCD YTPAG+ IPTNKR+ A+KIFSHPDVAKEEPWYGIEQEYTL+Q
Sbjct  79    IFKDPFRKGNNILVMCDAYTPAGDPIPTNKRHNAAKIFSHPDVAKEEPWYGIEQEYTLMQ  138

Query  525   KDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMPG  704
             KDVNWP+GWP+GGYPGPQGPYYCGVGADKA GRDIVD+HYKACLYAGI ISGINGEVMPG
Sbjct  139   KDVNWPIGWPVGGYPGPQGPYYCGVGADKAIGRDIVDAHYKACLYAGIGISGINGEVMPG  198

Query  705   QWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTKS  884
             QWEFQVGP  GIS+ D++WVARY+LERITEI+GV++SFDPKP+ GDWNGAGAH NYSTK+
Sbjct  199   QWEFQVGPVEGISSGDQVWVARYLLERITEISGVIVSFDPKPVPGDWNGAGAHCNYSTKT  258

Query  885   MRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASVR  1064
             MRNDGG E+IKKAI KLQL+HKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGASVR
Sbjct  259   MRNDGGLEVIKKAIGKLQLKHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGASVR  318

Query  1065  VGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             VGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  319   VGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTIL  355



>ref|NP_188409.1| glutamine synthetase cytosolic isozyme 1-3 [Arabidopsis thaliana]
 sp|Q9LVI8.1|GLN13_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-3; Short=GS1; 
AltName: Full=Glutamate--ammonia ligase GLN1;3; Short=GLN1;3 
[Arabidopsis thaliana]
 dbj|BAB02705.1| glutamine synthase [Arabidopsis thaliana]
 gb|AAM65851.1| glutamine synthetase, putative [Arabidopsis thaliana]
 gb|AAV85682.1| At3g17820 [Arabidopsis thaliana]
 gb|AAW28559.1| At3g17820 [Arabidopsis thaliana]
 gb|AEE76011.1| glutamine synthetase cytosolic isozyme 1-3 [Arabidopsis thaliana]
Length=354

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/340 (86%), Positives = 322/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQA G+DSEVILY
Sbjct  14    DATGKIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSSTGQAAGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+GNNILVMCD YTPAG+ IPTNKR+ A+KIFSHPDVAKEEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRKGNNILVMCDAYTPAGDPIPTNKRHNAAKIFSHPDVAKEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             L+QKDVNWP+GWP+GGYPGPQGPYYCGVGADKA GRDIVD+HYKACLYAGI ISGINGEV
Sbjct  134   LMQKDVNWPIGWPVGGYPGPQGPYYCGVGADKAIGRDIVDAHYKACLYAGIGISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP  GIS+ D++WVARY+LERITEI+GV++SFDPKP+ GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPVEGISSGDQVWVARYLLERITEISGVIVSFDPKPVPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MRNDGG E+IKKAI KLQL+HKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKTMRNDGGLEVIKKAIGKLQLKHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             SVRVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTIL  353



>ref|NP_176794.1| glutamine synthetase [Arabidopsis thaliana]
 sp|Q8LCE1.2|GLN12_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-2; AltName: 
Full=Glutamate--ammonia ligase GLN1;2; Short=GLN1;2 [Arabidopsis 
thaliana]
 gb|AAG51310.1|AC026480_17 glutamine synthetase, putative [Arabidopsis thaliana]
 gb|AAM14052.1| putative glutamine synthetase [Arabidopsis thaliana]
 gb|AAM67495.1| putative glutamine synthetase [Arabidopsis thaliana]
 gb|AEE34474.1| glutamine synthetase [Arabidopsis thaliana]
Length=356

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/338 (88%), Positives = 322/338 (95%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             ++KIIAEYIWVGGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    SEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGQDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A++IF++PDV  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVIAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDVNWPLGWP+GG+PGPQGPYYC +GADK++GRDIVD+HYKA LYAGINISGINGEVMP
Sbjct  136   QKDVNWPLGWPIGGFPGPQGPYYCSIGADKSFGRDIVDAHYKASLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISAADE+W+ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAADEIWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR +GGYEIIKKAI KL LRHKEHI+AYGEGNERRLTG HETADINTF WGVA+RGAS+
Sbjct  256   SMREEGGYEIIKKAIEKLGLRHKEHISAYGEGNERRLTGHHETADINTFLWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETT+L
Sbjct  316   RVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLL  353



>gb|AGC24239.1| glutamine synthetase 1 [Brassica napus]
 emb|CDX85499.1| BnaA02g03140D [Brassica napus]
Length=356

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/342 (86%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + ++KIIAEYIW+GGSG+D+RSKART+ GPV DPS+LPKWNYDGSSTGQAPG DSEVI+Y
Sbjct  14    DSSEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQAPGDDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS P VA EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPTVAAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD  WP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVD+HYKACLYAGIN+SG NGEV
Sbjct  134   LLQKDTKWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINVSGTNGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGI+AAD++WVARYILERITE+AGVVLS DPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEKDGKGYFEDRRPASNMDPYTVTSM+AETTIL K
Sbjct  314   SIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMVAETTILWK  355



>ref|XP_006352444.1| PREDICTED: glutamine synthetase-like [Solanum tuberosum]
Length=354

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/338 (88%), Positives = 320/338 (95%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T KIIAEYIW+GGSGMD+RSKART+ GPVT P++LPKWNYDGSSTGQAPG+DSEVI+YPQ
Sbjct  16    TQKIIAEYIWIGGSGMDMRSKARTLPGPVTTPAELPKWNYDGSSTGQAPGEDSEVIIYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+K+FSHPDVA EE WYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVAAEETWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QK+VNWPLGWP+GG+PGPQGPYYCG GADKA+GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKEVNWPLGWPIGGFPGPQGPYYCGTGADKAFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISA DE+WVARYILERI EIAGVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAGDEVWVARYILERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR DGGY+II KAI KL L+HKEHIAAYGEGNERRLTG+HETA+INTFKWGVA+RGASV
Sbjct  256   SMREDGGYKIILKAIEKLGLKHKEHIAAYGEGNERRLTGKHETANINTFKWGVANRGASV  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTI+
Sbjct  316   RVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTII  353



>ref|XP_010492569.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/342 (86%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TD+IIAEYIW+GGSG+D+RSKART+SGPV DPS+LPKWNYDGSSTGQAPG DSEVILY
Sbjct  14    DSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSSTGQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS P+V  E  WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVVAEVTWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVDSHYKACLYAGIN+SG NGEV
Sbjct  134   LLQKDIKWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDSHYKACLYAGINVSGTNGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGI+AAD++WVAR+ILERITE+AGVVLS DPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGIAAADQVWVARFILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAE+TIL K
Sbjct  314   SIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAESTILWK  355



>gb|AAD31899.1|AF145481_1 cytosolic glutamine synthetase [Mesembryanthemum crystallinum]
Length=349

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/342 (86%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E ++KIIAEYIW+GGSGMD+RSKART++GPV DP KLPKWNYDGSSTGQAPG+DSEVILY
Sbjct  7     EVSEKIIAEYIWIGGSGMDMRSKARTLNGPVDDPKKLPKWNYDGSSTGQAPGQDSEVILY  66

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIFRDPFRRGNNILVMCD YTP GE IPTNKRY A KIFS+P+VA EEPWYGIEQEYT
Sbjct  67    PQAIFRDPFRRGNNILVMCDAYTPQGEPIPTNKRYHAEKIFSNPEVAAEEPWYGIEQEYT  126

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQK+VNWPLGWP+GG+PGPQGPYYCGVGADKA+GRDIVD+HYKACLYAG+ ISG NGEV
Sbjct  127   LLQKEVNWPLGWPIGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGVTISGTNGEV  186

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W+ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  187   MPGQWEFQVGPSVGISAGDEIWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  246

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL +RHKEHIAAYGEGNERRLTG+HETA+I TF WGVA+RGA
Sbjct  247   TKSMREDGGYEVIKKAIEKLGMRHKEHIAAYGEGNERRLTGKHETANIETFLWGVANRGA  306

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK+GKGYFEDRRP+SNMDPY VT+MIA+TT+L K
Sbjct  307   SVRVGRDTEKEGKGYFEDRRPSSNMDPYVVTAMIADTTLLWK  348



>gb|AGI78873.1| glutamine synthetase [Vigna unguiculata]
 gb|AGI78874.1| glutamine synthetase [Vigna unguiculata]
 gb|AGI78875.1| glutamine synthetase [Vigna unguiculata]
Length=356

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/342 (87%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSG+DLRSKART+ GPV+DPS+LPKWNYDGSSTGQA G+DSEVI+Y
Sbjct  14    DTTEKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDGSSTGQASGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGN+ILVMCD YTPAGE IPTNKR+ A+KIFSH DV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNHILVMCDAYTPAGEPIPTNKRHNAAKIFSHADVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD++WPLGWP+GG+PGPQGPYYCGVGA+KA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDISWPLGWPVGGFPGPQGPYYCGVGAEKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITE+AGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEVAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MR DGGYE+IK AI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKTMREDGGYEVIKSAIEKLGKRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>sp|O04867.1|GLNA1_ALNGL RecName: Full=Glutamine synthetase; AltName: Full=GS(1); AltName: 
Full=Glutamate--ammonia ligase [Alnus glutinosa]
 emb|CAA69937.1| glutamate synthetase [Alnus glutinosa]
Length=356

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/342 (87%), Positives = 319/342 (93%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDK+IAEYIW+GGSG DLRSKART++GPV  PSKLPKWNYDGSSTGQAPG+DSEVI  
Sbjct  14    DATDKVIAEYIWIGGSGTDLRSKARTLTGPVNHPSKLPKWNYDGSSTGQAPGEDSEVIYI  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
              +  F+DPFRRGNNILV+CD YTPAGE IPTNKR+ A+KIFSHP+V  E PWYGIEQEYT
Sbjct  74    LRQFFKDPFRRGNNILVICDTYTPAGEPIPTNKRHGAAKIFSHPEVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WPLGWP+GGYPGPQGPYYCG+GADKAWGRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPLGWPVGGYPGPQGPYYCGIGADKAWGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEIAGVVLS DPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWAARYILERITEIAGVVLSLDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GGYEIIKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMRNNGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLLWK  355



>gb|ACG47508.1| glutamine synthetase root isozyme 5 [Zea mays]
Length=357

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/342 (86%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTD+IIAEYIWVGGSG+DLRSKART+ GP+TDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDRIIAEYIWVGGSGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQ IF+DPFR+ NNILVMCDCYTP GE IP+NKRY A+ +FSHPDVA E PWYGIEQEYT
Sbjct  74    PQVIFKDPFRKCNNILVMCDCYTPQGEPIPSNKRYKAATVFSHPDVAAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV+WPLGWP+GGYPGPQGPYYC  GADKA+GRD+VD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVSWPLGWPVGGYPGPQGPYYCAAGADKAFGRDVVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERITE+AG+VLS DPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEIWVARYILERITEMAGIVLSLDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR  GGYE+IK+AI KL  RH+EHIAAYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMREAGGYEVIKEAIEKLGRRHREHIAAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VT MIA+TTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTGMIADTTILWK  355



>emb|CDY38104.1| BnaC02g06690D [Brassica napus]
Length=356

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/342 (86%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + ++KIIAEYIW+GGSG+D+RSKART+ GPV DPS+LPKWNYDGSSTGQAPG DSEVI+Y
Sbjct  14    DSSEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQAPGDDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS P VA EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPTVAAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD  WP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVD+HYKACLYAGIN+SG NGEV
Sbjct  134   LLQKDTKWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINVSGTNGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGI+AAD++WVARYILERITE+AGVVLS DPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEKDGKGYFEDRRPASNMDPYTVTSM+AETTIL K
Sbjct  314   SIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMVAETTILWK  355



>dbj|BAA04996.1| glutamine synthetase [Raphanus sativus]
Length=356

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/340 (87%), Positives = 319/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E TDKIIAEYIWVGGSGMD+RSKART+ GPV+DPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    ETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRR NNILVMCD YTPAGE IPTNKR+ A+K+FS PDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRANNILVMCDAYTPAGEPIPTNKRHAAAKVFSQPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GG+PGPQGPYYCGVGADK++GRD+VD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPVGWPIGGFPGPQGPYYCGVGADKSFGRDVVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVG +VGISA DE+WVARYILERITEIAGVV+SFDPKPI GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGSAVGISAGDEIWVARYILERITEIAGVVVSFDPKPIPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNM+PY VTSMIAETTIL
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMEPYIVTSMIAETTIL  353



>ref|XP_007141924.1| hypothetical protein PHAVU_008G237500g [Phaseolus vulgaris]
 gb|ESW13918.1| hypothetical protein PHAVU_008G237500g [Phaseolus vulgaris]
Length=356

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/340 (86%), Positives = 320/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+K+IAEYIWVGGSGMD+RSKART+SGPV DPSKLPKWNYDGSSTGQAPG DSEV+LYPQ
Sbjct  16    TEKVIAEYIWVGGSGMDMRSKARTLSGPVNDPSKLPKWNYDGSSTGQAPGADSEVLLYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRG NILVMCD YT AGE IPTNKRY A+KIF+HPDV  EEPWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGKNILVMCDTYTAAGEPIPTNKRYNAAKIFNHPDVLAEEPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDV WPLGWP+GG+PGPQGPYYCG+GADKA+GRDIV+SH++ACLYAGINI+GINGEVMP
Sbjct  136   QKDVKWPLGWPIGGFPGPQGPYYCGIGADKAFGRDIVNSHFEACLYAGINITGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
              QWEFQ+GPS GISA D+LWVARYILERITEIAGVVLSFDP+PI+GDWN AGAHTN+STK
Sbjct  196   AQWEFQIGPSAGISACDDLWVARYILERITEIAGVVLSFDPRPIKGDWNCAGAHTNFSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMRNDGGYE+IKKAI KL+ RHKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGAS+
Sbjct  256   SMRNDGGYEVIKKAITKLEKRHKEHIAAYGEGNERRLTGKHETADINTFIWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  316   RVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTLLWK  355



>ref|XP_006484548.1| PREDICTED: glutamine synthetase nodule isozyme-like [Citrus sinensis]
 gb|KDO52769.1| hypothetical protein CISIN_1g018391mg [Citrus sinensis]
Length=356

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/342 (86%), Positives = 317/342 (93%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+K+IAEY+W+GGSGMDLRSKART+  P TDP+KLPKWNYDGSST QAPG DSEVILY
Sbjct  14    ESTEKVIAEYVWIGGSGMDLRSKARTLPAPTTDPTKLPKWNYDGSSTNQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQ +F+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+K+F HPDV  EEPWYGIEQEYT
Sbjct  74    PQTVFKDPFRRGNNILVMCDAYTPAGEPIPTNKRFNAAKVFGHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GGYPGPQGPYYCGVGADKA GRDIV+SHYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPVGGYPGPQGPYYCGVGADKALGRDIVNSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP VGIS+ D+LW+ARYILERITEIAGVVLSFDPKPI+GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPCVGISSGDQLWMARYILERITEIAGVVLSFDPKPIKGDWNGAGAHANYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG ++IKKAI KL  RH EHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGIDVIKKAIEKLGKRHGEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_007209293.1| hypothetical protein PRUPE_ppa007728mg [Prunus persica]
 gb|EMJ10492.1| hypothetical protein PRUPE_ppa007728mg [Prunus persica]
 gb|AHM02307.1| glutamine synthetase [Prunus persica]
Length=357

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/340 (87%), Positives = 320/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIW+GGSG+D+RSKART+  P++DPSKLPKWNYDGSSTGQAPGKDSEVILYPQ
Sbjct  17    TEKIIAEYIWIGGSGIDIRSKARTLPAPLSDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  76

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIFRDPFRRGNNILV+CD YTP GE IPTNKR  A+KIFSHPDV  EEPW+G+EQEYTLL
Sbjct  77    AIFRDPFRRGNNILVICDTYTPNGEPIPTNKRANAAKIFSHPDVVAEEPWFGLEQEYTLL  136

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDV WP+GWPLGGYPGPQGPYYCG GADKA+GRD+VDSHYKACLYAGI+ISGINGEVMP
Sbjct  137   QKDVKWPIGWPLGGYPGPQGPYYCGAGADKAFGRDVVDSHYKACLYAGIDISGINGEVMP  196

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGISA D+LW ARYILERITEIAGVVLSFDPKPI+GDWNGAGAHTNYSTK
Sbjct  197   GQWEFQVGPTVGISAGDQLWAARYILERITEIAGVVLSFDPKPIEGDWNGAGAHTNYSTK  256

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR+DGGYE+IKKAI KL LRHKEHIAAYG+GNERRLTGRHETADI  F WGVA+RGAS+
Sbjct  257   SMRSDGGYEVIKKAIEKLGLRHKEHIAAYGDGNERRLTGRHETADIQRFIWGVANRGASI  316

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGRDTEKDGKGYFEDRRPASNMDPY VTSMIAETT+L K
Sbjct  317   RVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIAETTVLWK  356



>gb|AGZ15411.1| glutamine synthetase PR-2 [Phaseolus vulgaris]
Length=356

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/342 (87%), Positives = 318/342 (93%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIWVGGSGMDLRSKART+ GPV DP+KLPKWNYDGSST QAPG DSEVILY
Sbjct  14    ESTEKIIAEYIWVGGSGMDLRSKARTLPGPVDDPAKLPKWNYDGSSTDQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAGE +PTNKRY A+KIFSHPDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDVYTPAGEPLPTNKRYDAAKIFSHPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDVNWPLGWPLGGYPGPQGPYYCG+GADKA+GRDIVD+HYKAC+YAGINISGINGEV
Sbjct  134   LLQKDVNWPLGWPLGGYPGPQGPYYCGIGADKAYGRDIVDAHYKACVYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGI A DE+W ARYILERITE+AG V+SFDPKPI GDWNGAGAH+NYS
Sbjct  194   MPGQWEFQVGPSVGIFAGDEVWAARYILERITELAGAVVSFDPKPIPGDWNGAGAHSNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL LRHKEHIAAYG+GNERRLTGRHETADINTF WGVA+RG+
Sbjct  254   TKSMREEGGYEVIKKAIEKLGLRHKEHIAAYGKGNERRLTGRHETADINTFSWGVANRGS  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTI  K
Sbjct  314   SVRVGRDTEKQGKGYFEDRRPASNMDPYVVTSMIAETTIFWK  355



>dbj|BAE98486.1| glutamine synthetase like protein [Arabidopsis thaliana]
Length=356

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/338 (87%), Positives = 321/338 (95%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             ++KIIAEYIWVGGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    SEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGQDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A++IF++PDV  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVIAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDVNWPLGWP+GG+PGPQGPYYC +GADK++GRDIVD+HYKA LYAGINISGINGEVMP
Sbjct  136   QKDVNWPLGWPIGGFPGPQGPYYCSIGADKSFGRDIVDAHYKASLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISAADE+W+ RYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAADEIWIPRYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR +GGYEIIKKAI KL LRHKEHI+AYGEGNERRLTG HETADINTF WGVA+RGAS+
Sbjct  256   SMREEGGYEIIKKAIEKLGLRHKEHISAYGEGNERRLTGHHETADINTFLWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETT+L
Sbjct  316   RVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLL  353



>ref|XP_009126124.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like [Brassica 
rapa]
Length=356

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/342 (86%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + ++KIIAEYIW+GGSG+D+RSKART+ GPV DPS+LPKWNYDGSSTGQAPG DSEVI+Y
Sbjct  14    DSSEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQAPGDDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS P VA EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPTVAAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD  WP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVD+HYKACLYAGIN+SG NGEV
Sbjct  134   LLQKDTKWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINVSGTNGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGI+AAD++WVARYILERITE+AGVVLS DPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYEIIKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPYTVTSM+AETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYTVTSMVAETTILWK  355



>gb|AGI78872.1| glutamine synthetase [Vigna unguiculata]
Length=356

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/342 (86%), Positives = 323/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+K+IAEYIW+GGSG+DLRSKART+ GPV+DPS+LPKWNYDGSSTGQA G+DSEVI+Y
Sbjct  14    DTTEKVIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDGSSTGQASGEDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGN+ILVMCD YTPAGE IPTNKR+ A+KIFSH DV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNHILVMCDAYTPAGEPIPTNKRHNAAKIFSHADVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD++WPLGWP+GG+PGPQGPYYCGVGA+KA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDISWPLGWPVGGFPGPQGPYYCGVGAEKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA DELWVARYILERITE+AGVVLSFDPKPI+GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGISAGDELWVARYILERITEVAGVVLSFDPKPIKGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MR DGGYE+IK AI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKTMREDGGYEVIKSAIEKLGKRHKEHIAAYGEGNERRLTGRHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK GKGYFEDRRPASNMDPY VTSMIA+TTIL K
Sbjct  314   SVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIADTTILWK  355



>emb|CDY49656.1| BnaC09g41340D [Brassica napus]
Length=356

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/340 (86%), Positives = 320/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIW+GGSG+D+RSKART+ GPV DPS+LPKWNYDGSSTGQAPG DSEVILYPQ
Sbjct  16    TEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQAPGSDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS P VA EE WYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPSVAAEETWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD+ WP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVDSHYKACLYAGIN+SG NGEVMP
Sbjct  136   QKDIKWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDSHYKACLYAGINVSGTNGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGI+AAD++WVARYILERITE+AGVVLS DPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR DGGYE+IKKAI KL LRHKEHI+AYGEGNERRLTG+HETADINTF WGVA+RGAS+
Sbjct  256   SMREDGGYEVIKKAIEKLGLRHKEHISAYGEGNERRLTGKHETADINTFLWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGRDTE+ GKGYFEDRRPASNMDPYTVTSMIAETTIL K
Sbjct  316   RVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIAETTILWK  355



>gb|KFK41041.1| hypothetical protein AALP_AA2G077900 [Arabis alpina]
Length=356

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/340 (86%), Positives = 322/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIWVGGSG+D+RSKART+ GPVTDPS LP+WNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTEKIIAEYIWVGGSGLDMRSKARTLPGPVTDPSNLPRWNYDGSSTGQAPGQDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAG+ IPTNKR+ A++IFS+PDV  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGDPIPTNKRHAAAEIFSNPDVVAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GG+PGPQGPYYC +GADK++GRDIVDSHYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPVGWPIGGFPGPQGPYYCSIGADKSFGRDIVDSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISAADE+W+ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAADEIWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR +GGYE+IKKAI KL LRHKEHI+AYGEGNERRLTG HETADINTF WGVA+RGA
Sbjct  254   TKSMREEGGYEVIKKAIDKLGLRHKEHISAYGEGNERRLTGHHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETT+L
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTLL  353



>ref|XP_009414782.1| PREDICTED: glutamine synthetase cytosolic isozyme 2-like [Musa 
acuminata subsp. malaccensis]
Length=357

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/340 (87%), Positives = 319/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIWVGGSG D+RSKART+SGPVTDPS+LP WNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAEYIWVGGSGEDIRSKARTLSGPVTDPSQLPNWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIFRDPFR+GNNILVMCDCYTP GE IPTNKR+ A+KIFS+P VA EE W+GIEQEYTLL
Sbjct  76    AIFRDPFRKGNNILVMCDCYTPQGEPIPTNKRHNAAKIFSNPAVAAEETWFGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDV WP+GWP+GGYPGPQGPYYC  GADKA+GRDIVD+HYKACLYAGINISGINGEVMP
Sbjct  136   QKDVKWPIGWPIGGYPGPQGPYYCSAGADKAFGRDIVDAHYKACLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP VG+SA D+LWVARY+LERITE+AGVVLS DPKPIQGDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPCVGVSAGDQLWVARYVLERITEMAGVVLSLDPKPIQGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR+DGGYE+IK+AI KL  RHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGAS+
Sbjct  256   SMRSDGGYEVIKQAIEKLGWRHKEHIAAYGEGNERRLTGRHETADINTFVWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  316   RVGRDTEKSGKGYFEDRRPASNMDPYAVTSMIAETTILWK  355



>ref|XP_002527139.1| glutamine synthetase plant, putative [Ricinus communis]
 gb|EEF35241.1| glutamine synthetase plant, putative [Ricinus communis]
Length=356

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/342 (85%), Positives = 324/342 (95%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TDKIIAEYIW+GGSG+DLRSK+RT+ GPV+DPSKLPKWNYDGSST QA G +SEVILY
Sbjct  14    DSTDKIIAEYIWIGGSGLDLRSKSRTLPGPVSDPSKLPKWNYDGSSTDQATGDNSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAG+ +PTNKR+ A+KIFSHPD+A EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDSYTPAGDPLPTNKRFNAAKIFSHPDIAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GG+P PQGPYYCGVGADKA+GR+IVDSH+KACL+AGI+ISGINGEV
Sbjct  134   LLQKDVKWPIGWPVGGFPSPQGPYYCGVGADKAFGRNIVDSHFKACLFAGISISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGISA+DELW+ARYILERITEIAGV+L+FDPKPIQGDWNGAGAHTN+S
Sbjct  194   MPGQWEFQVGPAVGISASDELWMARYILERITEIAGVILTFDPKPIQGDWNGAGAHTNFS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGG ++IKKAI KL  RHKEHIAAYG+GNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRSDGGIDVIKKAIEKLGQRHKEHIAAYGKGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGRDTEK+GKGYFEDRRP+SNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRDTEKNGKGYFEDRRPSSNMDPYIVTSMIAETTILWK  355



>ref|XP_010453820.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like [Camelina 
sativa]
Length=356

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/342 (86%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TD+IIAEYIW+GGSG+D+RSKART+SGPV DPS+LPKWNYDGSSTGQAPG DSEVILY
Sbjct  14    DSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSSTGQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS P+V  E  WYGIEQEYT
Sbjct  74    PQAIFQDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVVAEVTWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVDSHYKACLYAGIN+SG NGEV
Sbjct  134   LLQKDIKWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDSHYKACLYAGINVSGTNGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGI+AAD++WVARYILERIT++AGVVLS DPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGIAAADQVWVARYILERITQLAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE IKKAI KL LRHKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEAIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAE+TIL K
Sbjct  314   SIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAESTILWK  355



>tpg|DAA44139.1| TPA: glutamine synthetase6 [Zea mays]
Length=362

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/345 (85%), Positives = 323/345 (94%), Gaps = 5/345 (1%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             +CTD+IIAEYIW+GG+G+DLRSKART+ GP+TDPS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILV-----MCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGI  500
             PQAIF+DPFR+GN+ILV     MCDCYTP GE IPTNKRY+A+K+FSHPDVA E PWYGI
Sbjct  74    PQAIFKDPFRKGNHILVSLCVVMCDCYTPQGEPIPTNKRYSAAKVFSHPDVAAEVPWYGI  133

Query  501   EQEYTLLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISG  680
             EQEYTLLQKDV+WPLGWP+GGYPGPQGPYYC  GADKA+GRD+VD+HYKACLYAGINISG
Sbjct  134   EQEYTLLQKDVSWPLGWPVGGYPGPQGPYYCAAGADKAFGRDVVDAHYKACLYAGINISG  193

Query  681   INGEVMPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGA  860
             INGEVMPGQWEFQVGPSVGISA DE+WVARYILERITE+AG+VLS DPKPI+GDWNGAGA
Sbjct  194   INGEVMPGQWEFQVGPSVGISAGDEIWVARYILERITEMAGIVLSLDPKPIKGDWNGAGA  253

Query  861   HTNYSTKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGV  1040
             HTNYSTKSMR  GGYE+IK AI KL  RHKEHIAAYGEGNERRLTGRHETADINTFKWGV
Sbjct  254   HTNYSTKSMREAGGYEVIKAAIDKLGKRHKEHIAAYGEGNERRLTGRHETADINTFKWGV  313

Query  1041  ADRGASVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             A+RGAS+RVGRDTE++GKGYFEDRRPASNMDPY VT MIAETTIL
Sbjct  314   ANRGASIRVGRDTEREGKGYFEDRRPASNMDPYVVTGMIAETTIL  358



>dbj|BAM84282.1| glutamine synthetase [Tulipa pulchella]
Length=353

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/340 (87%), Positives = 318/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSG DLRSKART+ GPVT+PS+LPKWNYDGSSTGQAPG+DSEVILY
Sbjct  14    DSTRKIIAEYIWIGGSGTDLRSKARTLPGPVTNPSELPKWNYDGSSTGQAPGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CDCYTPAGE IPTNKR+ A+KIFS P V  E PWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRHNAAKIFSDPAVEAEVPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKDV WP+GWP+GGYPGPQGPYYC  GADKA+GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDVKWPIGWPIGGYPGPQGPYYCSAGADKAFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+W ARYILERITEIAGVVLS DPKPIQGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWAARYILERITEIAGVVLSLDPKPIQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR+DGGYE+I KAI KL L+HKEHI+AYGEGNERRLTGRHETADINTFKWGVA+RGA
Sbjct  254   TKSMRSDGGYEVILKAIEKLSLKHKEHISAYGEGNERRLTGRHETADINTFKWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             S+RVGRDTEK GKGYFEDRRPASNMDPY VTSMIAETT+L
Sbjct  314   SIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIAETTLL  353



>emb|CDX69442.1| BnaA10g17910D [Brassica napus]
Length=356

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/342 (86%), Positives = 320/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSG+D+RSKART+ GPV DPS+LPKWNYDGSSTGQAPG DSEVILY
Sbjct  14    DSTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQAPGSDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS P VA EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPSVAAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWP+GG+PGPQGPYYCG GADKA+GRDIVDSHYKACLYAGIN+SG NGEV
Sbjct  134   LLQKDIKWPVGWPVGGFPGPQGPYYCGAGADKAFGRDIVDSHYKACLYAGINVSGTNGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGI+AAD++WVARYILERITE+AGVVLS DPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYEIIKKAI KL LRHKEHI+AYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEIIKKAIEKLGLRHKEHISAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTE+ GKGYFEDRRPASNMDPYTVTSMIAETTIL K
Sbjct  314   SIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIAETTILWK  355



>ref|XP_006437563.1| hypothetical protein CICLE_v10031939mg [Citrus clementina]
 gb|ESR50803.1| hypothetical protein CICLE_v10031939mg [Citrus clementina]
Length=356

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/342 (86%), Positives = 317/342 (93%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+K+IAEY+W+GGSGMDLRSKART+  P TDP+KLPKWNYDGSST QAPG DSEVILY
Sbjct  14    ESTEKVIAEYVWIGGSGMDLRSKARTLPAPTTDPTKLPKWNYDGSSTNQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQ +F+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+K+F HPDV  EEPWYGIEQEYT
Sbjct  74    PQTVFKDPFRRGNNILVMCDAYTPAGEPIPTNKRFNAAKVFGHPDVVAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GGYPGPQGPYYCGVGADKA GRDIV+SHYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPVGGYPGPQGPYYCGVGADKALGRDIVNSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP VGI++ D+LW+ARYILERITEIAGVVLSFDPKPI+GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPCVGIASGDQLWMARYILERITEIAGVVLSFDPKPIKGDWNGAGAHANYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG ++IKKAI KL  RH EHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNDGGIDVIKKAIEKLGKRHGEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>gb|AAM63710.1| glutamine synthetase, putative [Arabidopsis thaliana]
Length=356

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/338 (87%), Positives = 321/338 (95%), Gaps = 0/338 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             ++KIIAEYIWVGGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    SEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGQDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A++IF++PDV  E PWYGIEQEYTLL
Sbjct  76    AIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVIAEVPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKDVNWPLGWP+GG+PGPQGPYYC +GADK++GRDIVD+HYKA LYAGINISGINGEVMP
Sbjct  136   QKDVNWPLGWPIGGFPGPQGPYYCSIGADKSFGRDIVDAHYKASLYAGINISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISAADE+W+ARYILERITEIAGVV+SFDPKPI GDWNGAGAHTNYSTK
Sbjct  196   GQWEFQVGPSVGISAADEIWIARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTK  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR +GGYEIIKKAI KL LRHKEHI+AYGEGNE RLTG HETADINTF WGVA+RGAS+
Sbjct  256   SMREEGGYEIIKKAIEKLGLRHKEHISAYGEGNELRLTGHHETADINTFLWGVANRGASI  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETT+L
Sbjct  316   RVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTLL  353



>gb|AAO42253.1| putative glutamine synthetase [Arabidopsis thaliana]
Length=354

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/340 (86%), Positives = 321/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T KIIAEYIW+GGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQA G+DSEVILY
Sbjct  14    DATGKIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSSTGQAAGEDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFR+ NNILVMCD YTPAG+ IPTNKR+ A+KIFSHPDVAKEEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRKDNNILVMCDAYTPAGDPIPTNKRHNAAKIFSHPDVAKEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             L+QKDVNWP+GWP+GGYPGPQGPYYCGVGADKA GRDIVD+HYKACLYAGI ISGINGEV
Sbjct  134   LMQKDVNWPIGWPVGGYPGPQGPYYCGVGADKAIGRDIVDAHYKACLYAGIGISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP  GIS+ D++WVARY+LERITEI+GV++SFDPKP+ GDWNGAGAH NYS
Sbjct  194   MPGQWEFQVGPVEGISSGDQVWVARYLLERITEISGVIVSFDPKPVPGDWNGAGAHCNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TK+MRNDGG E+IKKAI KLQL+HKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKTMRNDGGLEVIKKAIGKLQLKHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             SVRVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  314   SVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTIL  353



>ref|XP_002306385.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEE93381.1| glutamine synthetase family protein [Populus trichocarpa]
Length=356

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/342 (86%), Positives = 322/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEY+W+GGSGMDLRSKART+ GPVTDP++LPKWN+DGSSTGQAPG DSEVILY
Sbjct  14    DTTEKIIAEYLWIGGSGMDLRSKARTLPGPVTDPAELPKWNFDGSSTGQAPGDDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQ+IF+DPFR+GNNILVMCD YTPAGE IPTNKR+ A++IFS P VA EEPWYGIEQEYT
Sbjct  74    PQSIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRFNAAQIFSDPVVAAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+NWPLGWP+GG+PGPQGPYYC VGADK++GRDIVD+HYKACLYAGINISGINGEV
Sbjct  134   LLQKDINWPLGWPVGGFPGPQGPYYCSVGADKSFGRDIVDAHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGPSVGISA DE+WVARYILERI EIAGVV+SFDPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPSVGISAGDEVWVARYILERIAEIAGVVVSFDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRN+GG  +IKKAI KL LRHKEHIAAYGEGNERRLTGRHETADINTF WGVA+RGA
Sbjct  254   TKSMRNEGGIAVIKKAIEKLGLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTI+ +
Sbjct  314   SIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTIIWR  355



>ref|XP_009401139.1| PREDICTED: glutamine synthetase nodule isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/342 (86%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             E T+KIIAEYIW+GGSGMD+RSKART+ GPV+DPSKLPKWNYDGSSTGQAPG +SEVI++
Sbjct  14    ETTEKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGDNSEVIVH  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILV+CD YTPAG+ IPTNKR+ A KIFSHPDV  EEPWYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVVCDAYTPAGDPIPTNKRFNAQKIFSHPDVIAEEPWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             L Q+DV WPLGWP+GG+PGPQGPYYCG GADKA+GRDIV+SHYKACLYAGINISGINGEV
Sbjct  134   LFQRDVPWPLGWPVGGFPGPQGPYYCGTGADKAFGRDIVNSHYKACLYAGINISGINGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGI+A D+LWVARYILERITEIAG VLSFDPKP+QGDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPAVGITAGDQLWVARYILERITEIAGAVLSFDPKPMQGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMRNDGG E+IKKAI KL  +HKEHIAAYGEGN+RRLTGRHETADI++F WGVA+RGA
Sbjct  254   TKSMRNDGGIEVIKKAIEKLSKKHKEHIAAYGEGNDRRLTGRHETADISSFSWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             SVRVGR+TEKDGKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  314   SVRVGRETEKDGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>ref|XP_009121474.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 [Brassica 
rapa]
Length=356

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/342 (86%), Positives = 320/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T+KIIAEYIW+GGSG+D+RSKART+ GPV DPS+LPKWNYDGSSTGQAPG DSEVILY
Sbjct  14    DSTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQAPGSDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IP NKR+ A+KIFS P VA EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPANKRHAAAKIFSDPSVAAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVDSHYKACLYAGIN+SG NGEV
Sbjct  134   LLQKDIKWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDSHYKACLYAGINVSGTNGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGI+AAD++WVARYILERITE+AGVVLS DPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL LRHKEHI+AYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEVIKKAIEKLGLRHKEHISAYGEGNERRLTGKHETADINTFVWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTE+ GKGYFEDRRPASNMDPYTVTSMIAETTIL K
Sbjct  314   SIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIAETTILWK  355



>gb|AEM42903.1| cytosolic glutamine synthetase isoform [Secale cereale x Triticum 
turgidum subsp. durum]
Length=356

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/340 (85%), Positives = 323/340 (95%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIA YIW+GGSGMDLRSKART+ GPVTDPSKLPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  16    TEKIIAGYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ  75

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             A FRDPFR+GNNILVMCDCYTPAG  IPTNKRY A+KIFS+PDVAKEEPWYGIEQEYTLL
Sbjct  76    ATFRDPFRKGNNILVMCDCYTPAGVPIPTNKRYNAAKIFSNPDVAKEEPWYGIEQEYTLL  135

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD+NWPLGWP+GG+PGPQGPYYC +GADK++GRDIVD+HYKACL+AG+NISGINGEVMP
Sbjct  136   QKDINWPLGWPVGGFPGPQGPYYCSIGADKSFGRDIVDAHYKACLFAGVNISGINGEVMP  195

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGP+VGISA D+ WVARY+LERITEIAGVV++FDPKPI GDWNGAGAHTNYST+
Sbjct  196   GQWEFQVGPTVGISAGDQAWVARYLLERITEIAGVVVTFDPKPIPGDWNGAGAHTNYSTE  255

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR DGG+++I  A+ KL+L+HKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGASV
Sbjct  256   SMRKDGGFKVIVDAVEKLKLKHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGASV  315

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGR+TE++GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  316   RVGRETEQNGKGYFEDRRPASNMDPYVVTSMIAETTILWK  355



>gb|KFK25875.1| hypothetical protein AALP_AA8G173600 [Arabis alpina]
Length=356

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/342 (85%), Positives = 321/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + T++IIAEYIW+GGSG+D+RSKART++GPV DPS+LPKWNYDGSSTGQAPG DSEVILY
Sbjct  14    DSTNQIIAEYIWIGGSGIDMRSKARTLAGPVKDPSELPKWNYDGSSTGQAPGNDSEVILY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIFS P V  EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPTVVAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVDSHYKACLYAGIN+SG NGEV
Sbjct  134   LLQKDIKWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDSHYKACLYAGINVSGTNGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGI+AAD++WVARYILERITE+AGVVLS DPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+I KAI KL LRHKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEVILKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTEKDGKGYFEDRRPASNMDPYTVTSM+AE+TIL K
Sbjct  314   SIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMVAESTILWK  355



>ref|XP_002883089.1| ATGSKB6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59348.1| ATGSKB6 [Arabidopsis lyrata subsp. lyrata]
Length=354

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/339 (86%), Positives = 320/339 (94%), Gaps = 0/339 (0%)
 Frame = +3

Query  159   CTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYP  338
              TDKIIAEYIW+GGSGMD+RSKART+ GPVTDPSKLPKWNYDGSSTGQA G+DSEVILYP
Sbjct  15    ATDKIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSSTGQAAGEDSEVILYP  74

Query  339   QAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTL  518
             QAIF+DPFR+GNNILVMCD YTPAG+ IPTNKR+ A+KIFSHP+VA EEPWYGIEQEYTL
Sbjct  75    QAIFKDPFRKGNNILVMCDAYTPAGDPIPTNKRHNAAKIFSHPNVASEEPWYGIEQEYTL  134

Query  519   LQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVM  698
             +QKDVNWP+GWP+GG+PGPQGPYYCGVGADKA GRDIVD+HYKAC+YAGI ISG+NGEVM
Sbjct  135   MQKDVNWPIGWPVGGFPGPQGPYYCGVGADKAIGRDIVDAHYKACIYAGIGISGVNGEVM  194

Query  699   PGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYST  878
             PGQWEFQVGP  GISA D++WVARY+LERITEI+GV +SFDPKP+ GDWNGAGAH NYST
Sbjct  195   PGQWEFQVGPVEGISAGDQVWVARYLLERITEISGVNVSFDPKPVPGDWNGAGAHCNYST  254

Query  879   KSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGAS  1058
             K+MRNDGG E+IKKAI KLQL+HKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGAS
Sbjct  255   KTMRNDGGLEVIKKAIGKLQLKHKEHIAAYGEGNERRLTGKHETADINTFSWGVANRGAS  314

Query  1059  VRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTIL  1175
             VR+GRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL
Sbjct  315   VRIGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTIL  353



>ref|NP_568335.1| glutamine synthetase 1;4 [Arabidopsis thaliana]
 sp|Q9FMD9.1|GLN14_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-4; AltName: 
Full=Glutamate--ammonia ligase GLN1;4; Short=GLN1;4 [Arabidopsis 
thaliana]
 dbj|BAB10184.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAL24414.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAM91149.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED92312.1| glutamine synthetase 1;4 [Arabidopsis thaliana]
Length=356

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/342 (85%), Positives = 320/342 (94%), Gaps = 0/342 (0%)
 Frame = +3

Query  156   ECTDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILY  335
             + TD+IIAEYIW+GGSG+D+RSKART+ GPVTDPS+LPKWNYDGSSTGQAPG DSEVI+Y
Sbjct  14    DSTDQIIAEYIWIGGSGLDMRSKARTLPGPVTDPSQLPKWNYDGSSTGQAPGDDSEVIIY  73

Query  336   PQAIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYT  515
             PQAIF+DPFRRGNNILVMCD YTPAGE IPTNKR+ A+KIF  P V  EE WYGIEQEYT
Sbjct  74    PQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFEDPSVVAEETWYGIEQEYT  133

Query  516   LLQKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEV  695
             LLQKD+ WP+GWP+GG+PGPQGPYYCGVGADKA+GRDIVDSHYKACLYAGIN+SG NGEV
Sbjct  134   LLQKDIKWPVGWPVGGFPGPQGPYYCGVGADKAFGRDIVDSHYKACLYAGINVSGTNGEV  193

Query  696   MPGQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYS  875
             MPGQWEFQVGP+VGI+AAD++WVARYILERITE+AGVVLS DPKPI GDWNGAGAHTNYS
Sbjct  194   MPGQWEFQVGPTVGIAAADQVWVARYILERITELAGVVLSLDPKPIPGDWNGAGAHTNYS  253

Query  876   TKSMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGA  1055
             TKSMR DGGYE+IKKAI KL LRHKEHIAAYGEGNERRLTG+HETADINTF WGVA+RGA
Sbjct  254   TKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGNERRLTGKHETADINTFLWGVANRGA  313

Query  1056  SVRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             S+RVGRDTE+ GKGYFEDRRPASNMDPYTVTSMIAE+TIL K
Sbjct  314   SIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIAESTILWK  355



>sp|P08282.2|GLNA1_PEA RecName: Full=Glutamine synthetase nodule isozyme; AltName: Full=Cytosolic 
GS1; AltName: Full=Glutamate--ammonia ligase [Pisum 
sativum]
 gb|AAA33669.1| glutamine synthetase (cytosolic GS1) (EC 6.3.1.2) [Pisum sativum]
Length=355

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/340 (86%), Positives = 320/340 (94%), Gaps = 0/340 (0%)
 Frame = +3

Query  162   TDKIIAEYIWVGGSGMDLRSKARTISGPVTDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ  341
             T+KIIAEYIW+GGSG+DLR KART+ GPVTDPS+LPKWNYDGSSTGQAPG+DSEVILYPQ
Sbjct  15    TEKIIAEYIWIGGSGLDLRCKARTLPGPVTDPSELPKWNYDGSSTGQAPGQDSEVILYPQ  74

Query  342   AIFRDPFRRGNNILVMCDCYTPAGEAIPTNKRYTASKIFSHPDVAKEEPWYGIEQEYTLL  521
             AIF+DPFRRGN+ILVMCD Y+PAGE IPTNKR+ A+K+FSHPDV  EE WYGIEQEYTLL
Sbjct  75    AIFKDPFRRGNHILVMCDAYSPAGEPIPTNKRHAAAKVFSHPDVVAEETWYGIEQEYTLL  134

Query  522   QKDVNwplgwplggypgpqgpyyCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMP  701
             QKD+NWPLGWP GGYPGPQGPYYC VGADKA+GRD+V++HYKACL+AGINISGINGEVMP
Sbjct  135   QKDINWPLGWPAGGYPGPQGPYYCSVGADKAFGRDVVEAHYKACLFAGINISGINGEVMP  194

Query  702   GQWEFQVGPSVGISAADELWVARYILERITEIAGVVLSFDPKPIQGDWNGAGAHTNYSTK  881
             GQWEFQVGPSVGISA DE+WVARYILERITE+AGVVL+FDPKPI+GDWNGAGAHTNYSTK
Sbjct  195   GQWEFQVGPSVGISAGDEIWVARYILERITEVAGVVLTFDPKPIKGDWNGAGAHTNYSTK  254

Query  882   SMRNDGGYEIIKKAIAKLQLRHKEHIAAYGEGNERRLTGRHETADINTFKWGVADRGASV  1061
             SMR DGGYEIIKKAI KL  R  EHI+AYGEGNERRLTG+HETADINTF WGVA+RGASV
Sbjct  255   SMREDGGYEIIKKAIEKLGKRLPEHISAYGEGNERRLTGKHETADINTFSWGVANRGASV  314

Query  1062  RVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIAETTILHK  1181
             RVGRDTEK+GKGYFEDRRPASNMDPY VTSMIAETTIL K
Sbjct  315   RVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILLK  354



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4006524533058