BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17414_g1_i1 len=206 path=[1865:0-205]

Length=206
                                                                      Score     E

gb|AFM82491.1|  coronatine insensitive 1                              89.4    7e-19   
gb|AAR87848.1|  coronatine-insensitive 1                              85.5    3e-18   Nicotiana tabacum [American tobacco]
gb|ABK27928.1|  coronatine-insensitive 1                              86.7    8e-18   Nicotiana attenuata
ref|XP_006355656.1|  PREDICTED: coronatine-insensitive protein 1-...  86.3    1e-17   
ref|XP_009787310.1|  PREDICTED: coronatine-insensitive protein 1-...  83.6    1e-16   
ref|NP_001234464.1|  coronatine-insensitive 1                         83.2    1e-16   
ref|XP_009590388.1|  PREDICTED: coronatine-insensitive protein 1      82.8    2e-16   
dbj|BAG68658.1|  coronatine-insensitive 1                             80.1    3e-16   Nicotiana tabacum [American tobacco]
ref|XP_009622775.1|  PREDICTED: coronatine-insensitive protein 1-...  80.5    1e-15   
ref|XP_007009091.1|  RNI-like superfamily protein                     80.1    2e-15   
gb|KHG01198.1|  Coronatine-insensitive 1 -like protein                79.0    4e-15   
ref|XP_009762532.1|  PREDICTED: coronatine-insensitive protein 1-...  77.8    8e-15   
gb|EYU19981.1|  hypothetical protein MIMGU_mgv1a002976mg              77.8    9e-15   
gb|KDP44828.1|  hypothetical protein JCGZ_01328                       77.0    2e-14   
gb|EPS71226.1|  coronatine-insensitive 1                              75.5    7e-14   
ref|XP_011076735.1|  PREDICTED: coronatine-insensitive protein 1      75.1    9e-14   
ref|XP_007220435.1|  hypothetical protein PRUPE_ppa003320mg           74.3    1e-13   
ref|XP_008233718.1|  PREDICTED: coronatine-insensitive protein 1      74.3    1e-13   
gb|AFF57759.1|  coronatine insensitive 1                              74.3    2e-13   
gb|AFD63135.1|  coronatine insensitive 1                              74.3    2e-13   
ref|XP_002276145.2|  PREDICTED: coronatine-insensitive protein 1      74.3    2e-13   Vitis vinifera
gb|EPS60135.1|  hypothetical protein M569_14670                       73.6    3e-13   
ref|XP_009143268.1|  PREDICTED: coronatine-insensitive protein 1-...  73.2    4e-13   
emb|CDY20501.1|  BnaC04g05430D                                        73.2    5e-13   
ref|XP_009344484.1|  PREDICTED: coronatine-insensitive protein 1-...  72.8    6e-13   
emb|CDP14062.1|  unnamed protein product                              72.8    6e-13   
ref|XP_002530419.1|  Coronatine-insensitive protein, putative         72.4    8e-13   Ricinus communis
emb|CDY07040.1|  BnaA04g22750D                                        72.0    1e-12   
ref|XP_006411238.1|  hypothetical protein EUTSA_v10016416mg           72.0    1e-12   
gb|KFK36886.1|  hypothetical protein AALP_AA4G184600                  72.0    1e-12   
gb|ABV72393.1|  coronatine-insensitive 1                              72.0    1e-12   Hevea brasiliensis [jebe]
ref|XP_009350961.1|  PREDICTED: coronatine-insensitive protein 1-...  71.6    1e-12   
ref|XP_009133392.1|  PREDICTED: coronatine-insensitive protein 1      71.2    2e-12   
emb|CDY24941.1|  BnaC03g22310D                                        71.2    2e-12   
ref|XP_010554643.1|  PREDICTED: coronatine-insensitive protein 1      71.2    2e-12   
gb|ABZ05469.1|  coronatine-insensitive 1                              67.8    2e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABZ05416.1|  coronatine-insensitive 1                              67.8    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011084944.1|  PREDICTED: coronatine-insensitive protein 1-...  71.2    2e-12   
gb|ABZ05420.1|  coronatine-insensitive 1                              67.8    2e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABZ05491.1|  coronatine-insensitive 1                              67.8    2e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABZ05485.1|  coronatine-insensitive 1                              67.8    2e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABZ05410.1|  coronatine-insensitive 1                              67.8    2e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDY60996.1|  BnaA03g56600D                                        71.2    2e-12   
gb|ABZ05406.1|  coronatine-insensitive 1                              67.8    2e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93225.1|  BnaC04g46710D                                        70.9    3e-12   
ref|XP_007163515.1|  hypothetical protein PHAVU_001G240400g           70.9    3e-12   
ref|XP_009141850.1|  PREDICTED: coronatine-insensitive protein 1-...  70.9    3e-12   
ref|XP_008381979.1|  PREDICTED: coronatine-insensitive protein 1-...  70.5    3e-12   
ref|XP_009407558.1|  PREDICTED: coronatine-insensitive protein 1 ...  70.5    3e-12   
dbj|BAJ95041.1|  predicted protein                                    70.5    4e-12   
ref|XP_009407559.1|  PREDICTED: coronatine-insensitive protein 1 ...  70.5    4e-12   
gb|ADK66974.1|  coronatine insensitive 2-like protein                 70.5    4e-12   
emb|CDM83639.1|  unnamed protein product                              70.1    4e-12   
gb|EMT16014.1|  hypothetical protein F775_27999                       70.1    4e-12   
ref|NP_001238590.1|  coronatine-insensitive 1                         69.7    6e-12   
gb|EMS66070.1|  hypothetical protein TRIUR3_35106                     69.7    6e-12   
ref|XP_010907624.1|  PREDICTED: coronatine-insensitive protein 1-...  69.3    8e-12   
emb|CDX93223.1|  BnaC04g46730D                                        69.3    1e-11   
ref|XP_009416210.1|  PREDICTED: coronatine-insensitive protein 1-...  68.9    1e-11   
ref|XP_009141849.1|  PREDICTED: coronatine-insensitive protein 1-...  68.9    1e-11   
gb|EYU41258.1|  hypothetical protein MIMGU_mgv1a002958mg              68.6    2e-11   
ref|XP_010505693.1|  PREDICTED: coronatine-insensitive protein 1      68.6    2e-11   
ref|XP_010508943.1|  PREDICTED: coronatine-insensitive protein 1-...  68.6    2e-11   
ref|XP_010517373.1|  PREDICTED: coronatine-insensitive protein 1-...  68.6    2e-11   
ref|XP_003552511.1|  PREDICTED: coronatine-insensitive protein 1-...  68.6    2e-11   
ref|NP_001044831.2|  Os01g0853400                                     68.6    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055700.1|  Os05g0449500                                     68.6    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AAO38719.1|  COI1                                                  68.6    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645032.1|  PREDICTED: coronatine-insensitive protein 1-...  68.6    2e-11   
ref|XP_010095054.1|  hypothetical protein L484_026361                 68.2    2e-11   
ref|XP_010262774.1|  PREDICTED: coronatine-insensitive protein 1-...  68.2    2e-11   
ref|XP_008392915.1|  PREDICTED: coronatine-insensitive protein 1-...  68.2    2e-11   
gb|EAY98249.1|  hypothetical protein OsI_20159                        68.2    3e-11   Oryza sativa Indica Group [Indian rice]
gb|ABR45956.1|  coronitine insensitive 1                              67.8    3e-11   Arabidopsis lyrata [lyrate rockcress]
ref|NP_565919.1|  coronatine-insensitive protein 1                    67.8    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881684.1|  coronitine insensitive 1                         67.8    3e-11   
gb|ABR45948.1|  coronitine insensitive 1                              67.8    3e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ABR45957.1|  coronitine insensitive 1                              67.8    3e-11   Arabidopsis lyrata [lyrate rockcress]
gb|ABR45955.1|  coronitine insensitive 1                              67.8    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150429.1|  coronatine-insensitive protein 1                 67.8    3e-11   Zea mays [maize]
gb|KHN17850.1|  Coronatine-insensitive protein 1                      67.4    3e-11   
ref|XP_008775055.1|  PREDICTED: coronatine-insensitive protein 1-...  67.8    3e-11   
ref|XP_010905359.1|  PREDICTED: coronatine-insensitive protein 1-...  67.4    4e-11   
ref|XP_004503230.1|  PREDICTED: coronatine-insensitive protein 1-...  67.4    4e-11   
gb|AFW81725.1|  coronatine-insensitive protein 1, mRNA                67.4    4e-11   
ref|XP_004970611.1|  PREDICTED: coronatine-insensitive protein 1-...  67.4    4e-11   
ref|XP_003600857.1|  Coronatine-insensitive                           67.4    4e-11   
gb|AIT39744.1|  coronatine-insensitive protein 1                      67.4    4e-11   
gb|AES99527.2|  coronatine-insensitive protein                        67.4    4e-11   
ref|XP_003564629.1|  PREDICTED: coronatine-insensitive protein 1-...  67.4    5e-11   
ref|XP_003616569.1|  Coronatine-insensitive 1-like protein            67.0    5e-11   
gb|AJA32915.1|  coronatine insensitive 1                              67.0    6e-11   
ref|XP_008812874.1|  PREDICTED: coronatine-insensitive protein 1-...  67.0    6e-11   
ref|XP_009402285.1|  PREDICTED: coronatine-insensitive protein 1-...  67.0    6e-11   
ref|XP_011036007.1|  PREDICTED: coronatine-insensitive protein 1      66.6    7e-11   
ref|XP_004961907.1|  PREDICTED: coronatine-insensitive protein 1-...  66.6    7e-11   
ref|XP_002439888.1|  hypothetical protein SORBIDRAFT_09g022040        66.6    8e-11   Sorghum bicolor [broomcorn]
ref|XP_006293881.1|  hypothetical protein CARUB_v10022866mg           66.2    1e-10   
gb|AFW81726.1|  hypothetical protein ZEAMMB73_728081                  63.9    1e-10   
ref|XP_002315178.1|  hypothetical protein POPTR_0010s20030g           66.2    1e-10   Populus trichocarpa [western balsam poplar]
gb|ABZ05452.1|  coronatine-insensitive 1                              63.2    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001147900.1|  LOC100281510                                     66.2    1e-10   Zea mays [maize]
gb|ABZ05477.1|  coronatine-insensitive 1                              62.8    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040511.1|  PREDICTED: coronatine-insensitive protein 1-...  66.2    1e-10   
ref|XP_010256650.1|  PREDICTED: coronatine-insensitive protein 1-...  65.9    1e-10   
ref|XP_004490952.1|  PREDICTED: coronatine-insensitive protein 1-...  65.9    1e-10   
gb|ACR35897.1|  unknown                                               65.9    1e-10   Zea mays [maize]
gb|AIT38271.1|  coronatine-insensitive 1                              65.9    1e-10   
ref|XP_002312140.1|  coronatine insensitive 1 family protein          65.9    2e-10   Populus trichocarpa [western balsam poplar]
ref|NP_001146577.1|  uncharacterized protein LOC100280173             65.5    2e-10   Zea mays [maize]
ref|XP_008647754.1|  PREDICTED: uncharacterized protein LOC100280...  65.5    2e-10   
gb|AHY19994.1|  coronatine-insensitive protein 1                      65.5    2e-10   
emb|CDY07041.1|  BnaA04g22740D                                        65.5    2e-10   
ref|XP_006654488.1|  PREDICTED: coronatine-insensitive protein 1-...  65.1    2e-10   
ref|XP_010534174.1|  PREDICTED: coronatine-insensitive protein 1-...  64.7    4e-10   
ref|NP_001169026.1|  uncharacterized protein LOC100382859             63.9    4e-10   Zea mays [maize]
ref|XP_010909152.1|  PREDICTED: coronatine-insensitive protein 1      64.3    4e-10   
gb|ABR67868.1|  coronatine-insensitive 1-like protein                 64.3    5e-10   Pisum sativum [garden pea]
emb|CDX74819.1|  BnaA05g05650D                                        64.3    5e-10   
gb|ADK47027.1|  coronatine insensitive 1                              64.3    5e-10   
ref|XP_010067498.1|  PREDICTED: coronatine-insensitive protein 1      63.9    6e-10   
ref|XP_008812756.1|  PREDICTED: coronatine-insensitive protein 1-...  63.9    6e-10   
gb|ADT91703.1|  coronatine-insensitive 1                              60.8    8e-10   
ref|XP_008463217.1|  PREDICTED: coronatine-insensitive protein 1      63.5    9e-10   
gb|KHN13082.1|  Coronatine-insensitive protein 1                      63.5    1e-09   
gb|AIR76997.1|  coronatine insensitive 1                              63.2    1e-09   
ref|XP_006848115.1|  hypothetical protein AMTR_s00029p00217840        63.5    1e-09   
ref|XP_010534559.1|  PREDICTED: coronatine-insensitive protein 1      63.2    1e-09   
ref|XP_007141797.1|  hypothetical protein PHAVU_008G226500g           62.8    2e-09   
gb|AFW84535.1|  hypothetical protein ZEAMMB73_080907                  60.8    3e-09   
gb|KHN20870.1|  Coronatine-insensitive protein 1                      61.2    5e-09   
ref|XP_004150227.1|  PREDICTED: LOW QUALITY PROTEIN: coronatine-i...  61.2    6e-09   
ref|XP_004162774.1|  PREDICTED: LOW QUALITY PROTEIN: coronatine-i...  61.2    6e-09   
gb|KGN50635.1|  Coronatine-insensitive 1                              61.2    6e-09   
ref|XP_003568339.1|  PREDICTED: coronatine-insensitive protein 1-...  60.8    8e-09   
ref|XP_010231314.1|  PREDICTED: coronatine-insensitive protein 1-...  60.8    8e-09   
ref|XP_004307613.1|  PREDICTED: coronatine-insensitive protein 1-...  60.8    9e-09   
ref|XP_004984685.1|  PREDICTED: coronatine-insensitive protein 1-...  60.1    1e-08   
ref|XP_002456649.1|  hypothetical protein SORBIDRAFT_03g040150        60.1    1e-08   Sorghum bicolor [broomcorn]
dbj|BAJ90363.1|  predicted protein                                    58.5    4e-08   
dbj|BAJ94334.1|  predicted protein                                    58.5    5e-08   
gb|ADK66973.1|  coronatine insensitive 1-like protein                 58.2    7e-08   
gb|KDO69096.1|  hypothetical protein CISIN_1g007586mg                 57.8    9e-08   
ref|XP_006435670.1|  hypothetical protein CICLE_v10031013mg           57.8    9e-08   
gb|EMT15861.1|  hypothetical protein F775_26704                       57.4    1e-07   
dbj|BAJ84926.1|  predicted protein                                    57.0    2e-07   
ref|XP_003558282.1|  PREDICTED: coronatine-insensitive protein 1-...  57.0    2e-07   
gb|EMT18237.1|  hypothetical protein F775_05439                       56.6    2e-07   
gb|EMS59081.1|  hypothetical protein TRIUR3_23066                     56.6    2e-07   
ref|NP_001169230.1|  hypothetical protein                             55.8    4e-07   Zea mays [maize]
gb|EMS55850.1|  hypothetical protein TRIUR3_31653                     55.8    4e-07   
ref|XP_002468131.1|  hypothetical protein SORBIDRAFT_01g040110        55.5    6e-07   Sorghum bicolor [broomcorn]
ref|XP_006649802.1|  PREDICTED: coronatine-insensitive protein 1-...  48.9    9e-05   
gb|ABR17804.1|  unknown                                               48.9    1e-04   Picea sitchensis



>gb|AFM82491.1| coronatine insensitive 1 [Capsicum annuum var. annuum]
Length=603

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 54/73 (74%), Positives = 61/73 (84%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    NGYNEQL-----VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFL  167
            NGYNEQ      V FPPRLC LGLTYLGKNEM ILFPIT R+++LDLLYALLDT +HCFL
Sbjct  260  NGYNEQAGKYAAVVFPPRLCQLGLTYLGKNEMSILFPITFRVKKLDLLYALLDTAAHCFL  319

Query  168  LEKCINLEVLETR  206
            L++C NLE+LETR
Sbjct  320  LQRCPNLEILETR  332



>gb|AAR87848.1| coronatine-insensitive 1 [Nicotiana tabacum]
Length=352

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 53/73 (73%), Positives = 59/73 (81%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    NGYNEQLVSF-----PPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFL  167
            NGYNEQL  +     PPRLC LGLTYLGK EMPILFPI  RL +LDLLYALLDT +HCFL
Sbjct  9    NGYNEQLEKYAAVVSPPRLCQLGLTYLGKYEMPILFPIASRLTKLDLLYALLDTAAHCFL  68

Query  168  LEKCINLEVLETR  206
            L++C NLE+LETR
Sbjct  69   LQRCPNLEILETR  81



>gb|ABK27928.1| coronatine-insensitive 1 [Nicotiana attenuata]
Length=605

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 53/73 (73%), Positives = 59/73 (81%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    NGYNEQLVSF-----PPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFL  167
            NGYNEQL  +     PPRLC LGLTYLGK EMPILFPI  RL +LDLLYALLDT +HCFL
Sbjct  263  NGYNEQLEKYAAVVSPPRLCQLGLTYLGKYEMPILFPIASRLTKLDLLYALLDTAAHCFL  322

Query  168  LEKCINLEVLETR  206
            L++C NLE+LETR
Sbjct  323  LQRCPNLEILETR  335



>ref|XP_006355656.1| PREDICTED: coronatine-insensitive protein 1-like [Solanum tuberosum]
Length=602

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 54/73 (74%), Positives = 60/73 (82%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    NGYNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFL  167
            NGYNEQ      + FPPRLC LGLTYLGKNEM ILFPI  RLR+LDLLYALLDT +HCFL
Sbjct  259  NGYNEQSGKYAALVFPPRLCQLGLTYLGKNEMSILFPIASRLRKLDLLYALLDTAAHCFL  318

Query  168  LEKCINLEVLETR  206
            L++C NLE+LETR
Sbjct  319  LQRCPNLEILETR  331



>ref|XP_009787310.1| PREDICTED: coronatine-insensitive protein 1-like [Nicotiana sylvestris]
Length=606

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 59/73 (81%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    NGYNEQLVSF-----PPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFL  167
            NGYNEQL  +     PPRLC LGLTYLGK EMPILFPI  RL +LDLLYALLDT +HCFL
Sbjct  263  NGYNEQLEKYAAVVSPPRLCQLGLTYLGKYEMPILFPIASRLTKLDLLYALLDTAAHCFL  322

Query  168  LEKCINLEVLETR  206
            L++C NLE+LETR
Sbjct  323  LQRCPNLEILETR  335



>ref|NP_001234464.1| coronatine-insensitive 1 [Solanum lycopersicum]
 gb|AAR82925.1| coronatine-insensitive 1 [Solanum lycopersicum]
 gb|AAR82926.1| coronatine-insensitive 1 [Solanum lycopersicum]
Length=603

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 52/73 (71%), Positives = 59/73 (81%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    NGYNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFL  167
            NGYNE       + FPPRLC LGLTYLG+NEM ILFPI  RLR+LDLLYALLDT +HCFL
Sbjct  260  NGYNEHSGKYAALVFPPRLCQLGLTYLGRNEMSILFPIASRLRKLDLLYALLDTAAHCFL  319

Query  168  LEKCINLEVLETR  206
            L++C NLE+LETR
Sbjct  320  LQRCPNLEILETR  332



>ref|XP_009590388.1| PREDICTED: coronatine-insensitive protein 1 [Nicotiana tomentosiformis]
Length=589

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 52/73 (71%), Positives = 57/73 (78%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    NGYNEQL-----VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFL  167
            NGYNEQL     VSFP RLC LG TYLG NEM ILFPI   L++LDLLYA LDTE+HCFL
Sbjct  258  NGYNEQLGRYSAVSFPQRLCHLGPTYLGINEMHILFPIASHLKKLDLLYAFLDTEAHCFL  317

Query  168  LEKCINLEVLETR  206
            L+KC NLE+LE R
Sbjct  318  LQKCPNLEILEAR  330



>dbj|BAG68658.1| coronatine-insensitive 1 [Nicotiana tabacum]
Length=310

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 58/73 (79%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    NGYNEQLVSF-----PPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFL  167
            NGYNEQL  +     PPRLC LGLTYLGK EMPILFPI  RL +LDLLYALLDT +HCFL
Sbjct  62   NGYNEQLEKYAAVVSPPRLCQLGLTYLGKYEMPILFPIASRLTKLDLLYALLDTAAHCFL  121

Query  168  LEKCINLEVLETR  206
            L++C NL +LETR
Sbjct  122  LQRCPNLVILETR  134



>ref|XP_009622775.1| PREDICTED: coronatine-insensitive protein 1-like [Nicotiana tomentosiformis]
Length=606

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 58/73 (79%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    NGYNEQLVSF-----PPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFL  167
            NGYNEQL  +     PPRLC LGLTYLGK EMPILFPI  RL +LDLLYALLDT +HCFL
Sbjct  263  NGYNEQLEKYAAVVSPPRLCQLGLTYLGKYEMPILFPIASRLTKLDLLYALLDTAAHCFL  322

Query  168  LEKCINLEVLETR  206
            L++C NL +LETR
Sbjct  323  LQRCPNLVILETR  335



>ref|XP_007009091.1| RNI-like superfamily protein [Theobroma cacao]
 gb|EOY17901.1| RNI-like superfamily protein [Theobroma cacao]
Length=593

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            +NEQ      VSFPP+LC LGLTY+GKNEMPI+FP    L++LDLLYALLDTE HC L++
Sbjct  255  FNEQPDRYYAVSFPPKLCRLGLTYMGKNEMPIVFPFASLLKKLDLLYALLDTEDHCLLIQ  314

Query  174  KCINLEVLETR  206
            +C NLEVLETR
Sbjct  315  RCPNLEVLETR  325



>gb|KHG01198.1| Coronatine-insensitive 1 -like protein [Gossypium arboreum]
Length=589

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            +NEQ      VSFPPRLC LGLTY+GKNEMPI+FP    L++LDLLYALLDTE HC L++
Sbjct  255  FNEQPERYTAVSFPPRLCRLGLTYMGKNEMPIVFPFASLLKKLDLLYALLDTEDHCLLIQ  314

Query  174  KCINLEVLETR  206
            +C NLEVLETR
Sbjct  315  RCPNLEVLETR  325



>ref|XP_009762532.1| PREDICTED: coronatine-insensitive protein 1-like [Nicotiana sylvestris]
Length=589

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 56/73 (77%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    NGYNEQL-----VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFL  167
            NGYNEQ      VSFP RLC LG TYLG NEM I FPI  RL++LDLLYA LDTE+HCFL
Sbjct  258  NGYNEQFGRYSAVSFPQRLCHLGPTYLGINEMHIFFPIASRLKKLDLLYAFLDTEAHCFL  317

Query  168  LEKCINLEVLETR  206
            L+KC NLE+LE R
Sbjct  318  LQKCPNLEILEAR  330



>gb|EYU19981.1| hypothetical protein MIMGU_mgv1a002976mg [Erythranthe guttata]
Length=620

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 57/71 (80%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQL-----VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            +NEQL     V FPP+LC LGLTYLGK EMPI++P+  RL +LDLLYALLDTE HC LL+
Sbjct  280  FNEQLERYAPVVFPPKLCRLGLTYLGKAEMPIVYPVASRLTKLDLLYALLDTEGHCLLLQ  339

Query  174  KCINLEVLETR  206
            +C NLE+LETR
Sbjct  340  RCPNLEILETR  350



>gb|KDP44828.1| hypothetical protein JCGZ_01328 [Jatropha curcas]
Length=597

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V+FP RLC LGLTY+GKNEMPI+FP    L++LDLLYALLDTE HCFL++KC NLEVLE 
Sbjct  266  VTFPQRLCRLGLTYMGKNEMPIVFPFAPMLKKLDLLYALLDTEDHCFLIQKCCNLEVLEA  325

Query  204  R  206
            R
Sbjct  326  R  326



>gb|EPS71226.1| coronatine-insensitive 1 [Genlisea aurea]
Length=623

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQL-----VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            +N QL     V FPP+LC LGLTYLG +EMPI++PI  +L++LDL YALLDTESHC LL+
Sbjct  290  HNAQLERYASVVFPPKLCRLGLTYLGNDEMPIVYPIAAKLKKLDLFYALLDTESHCRLLQ  349

Query  174  KCINLEVLETR  206
            +C NLEVLE R
Sbjct  350  RCPNLEVLEVR  360



>ref|XP_011076735.1| PREDICTED: coronatine-insensitive protein 1 [Sesamum indicum]
 ref|XP_011076736.1| PREDICTED: coronatine-insensitive protein 1 [Sesamum indicum]
Length=621

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQL-----VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            +NEQL     V FPP+LC L LTYLGK EMPI++P+  +LR+LDLLYALLDTE+HC LL+
Sbjct  283  FNEQLERYAAVVFPPKLCRLCLTYLGKAEMPIVYPVASKLRKLDLLYALLDTEAHCVLLQ  342

Query  174  KCINLEVLETR  206
            +C NLEVLETR
Sbjct  343  RCPNLEVLETR  353



>ref|XP_007220435.1| hypothetical protein PRUPE_ppa003320mg [Prunus persica]
 gb|EMJ21634.1| hypothetical protein PRUPE_ppa003320mg [Prunus persica]
Length=585

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            +NEQ     +VS P +LC LGLTY+GKNEMPI+FP    L++LDLLYALLDTE HC L++
Sbjct  247  FNEQSERYSVVSLPQKLCRLGLTYMGKNEMPIVFPYATLLKKLDLLYALLDTEDHCTLIQ  306

Query  174  KCINLEVLETR  206
            +C NLEVLETR
Sbjct  307  RCPNLEVLETR  317



>ref|XP_008233718.1| PREDICTED: coronatine-insensitive protein 1 [Prunus mume]
Length=585

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 56/71 (79%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            +NEQ     +VS P +LC LGLTY+GKNEMPI+FP    L++LDLLYALLDTE HC L++
Sbjct  247  FNEQSERYSVVSLPQKLCRLGLTYMGKNEMPIVFPYATLLKKLDLLYALLDTEDHCTLIQ  306

Query  174  KCINLEVLETR  206
            +C NLEVLETR
Sbjct  307  RCPNLEVLETR  317



>gb|AFF57759.1| coronatine insensitive 1 [Vitis vinifera]
Length=586

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            VSFPP+LC LGL Y+GKNEMPI+FP    L++LDLLY LLDTE HC L++KC NLE LE 
Sbjct  256  VSFPPKLCRLGLNYMGKNEMPIVFPFASLLKKLDLLYCLLDTEDHCLLIQKCPNLEFLEA  315

Query  204  R  206
            R
Sbjct  316  R  316



>gb|AFD63135.1| coronatine insensitive 1 [Vitis quinquangularis]
Length=598

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            VSFPP+LC LGL Y+GKNEMPI+FP    L++LDLLY LLDTE HC L++KC NLE LE 
Sbjct  268  VSFPPKLCRLGLNYMGKNEMPIVFPFASLLKKLDLLYCLLDTEDHCLLIQKCPNLEFLEA  327

Query  204  R  206
            R
Sbjct  328  R  328



>ref|XP_002276145.2| PREDICTED: coronatine-insensitive protein 1 [Vitis vinifera]
 emb|CBI31536.3| unnamed protein product [Vitis vinifera]
Length=598

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            VSFPP+LC LGL Y+GKNEMPI+FP    L++LDLLY LLDTE HC L++KC NLE LE 
Sbjct  268  VSFPPKLCRLGLNYMGKNEMPIVFPFASLLKKLDLLYCLLDTEDHCLLIQKCPNLEFLEA  327

Query  204  R  206
            R
Sbjct  328  R  328



>gb|EPS60135.1| hypothetical protein M569_14670 [Genlisea aurea]
Length=606

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPP+LC LGLTYLG+ EMP+++P+   L++LDL YALLDTESHC L+++C NLE+LET
Sbjct  286  VVFPPKLCRLGLTYLGRAEMPVVYPVASNLKKLDLFYALLDTESHCQLIQRCPNLEILET  345

Query  204  R  206
            R
Sbjct  346  R  346



>ref|XP_009143268.1| PREDICTED: coronatine-insensitive protein 1-like [Brassica rapa]
Length=603

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FPP+LC LGL+YLG NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLET
Sbjct  277  LTFPPKLCRLGLSYLGANEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLET  336

Query  204  R  206
            R
Sbjct  337  R  337



>emb|CDY20501.1| BnaC04g05430D [Brassica napus]
Length=602

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FPP+LC LGL+YLG NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLET
Sbjct  276  LTFPPKLCRLGLSYLGANEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLET  335

Query  204  R  206
            R
Sbjct  336  R  336



>ref|XP_009344484.1| PREDICTED: coronatine-insensitive protein 1-like [Pyrus x bretschneideri]
Length=592

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            +NEQ     +V+ P +LC LGLTY+GKNEMPI+FP    L++LDLLYALLDTE HC L++
Sbjct  256  FNEQSERYSVVTLPQKLCRLGLTYMGKNEMPIVFPFATLLKKLDLLYALLDTEDHCTLIQ  315

Query  174  KCINLEVLETR  206
            +C NLE+LETR
Sbjct  316  RCPNLEILETR  326



>emb|CDP14062.1| unnamed protein product [Coffea canephora]
Length=603

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 47/70 (67%), Positives = 54/70 (77%), Gaps = 5/70 (7%)
 Frame = +3

Query  12   NEQL-----VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEK  176
            N+QL     V+FP RLC LGLTYLG  EMPI+FPI  RLR+LDLLYA LDTE HC LL++
Sbjct  263  NDQLGRYSAVTFPQRLCQLGLTYLGNGEMPIVFPIAARLRKLDLLYAFLDTEGHCILLQR  322

Query  177  CINLEVLETR  206
            C  LE+LETR
Sbjct  323  CPKLEILETR  332



>ref|XP_002530419.1| Coronatine-insensitive protein, putative [Ricinus communis]
 gb|EEF31989.1| Coronatine-insensitive protein, putative [Ricinus communis]
Length=602

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V+FP +LC LGLTYLGKNEMPI+FP    L++LDLLYALLDTE HC L++K  NLEVLET
Sbjct  274  VTFPRKLCRLGLTYLGKNEMPIVFPFASLLKKLDLLYALLDTEDHCLLIQKFCNLEVLET  333

Query  204  R  206
            R
Sbjct  334  R  334



>emb|CDY07040.1| BnaA04g22750D [Brassica napus]
Length=607

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FPP+L  LGLTYLG NEMPILFP   +LR+LDL+Y+ L+T  HC L+EKC NLEVLET
Sbjct  267  LAFPPKLSRLGLTYLGANEMPILFPFAAQLRKLDLIYSFLETNDHCQLIEKCPNLEVLET  326

Query  204  R  206
            R
Sbjct  327  R  327



>ref|XP_006411238.1| hypothetical protein EUTSA_v10016416mg [Eutrema salsugineum]
 gb|ESQ52691.1| hypothetical protein EUTSA_v10016416mg [Eutrema salsugineum]
Length=590

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FPP+LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLET
Sbjct  265  LTFPPKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLET  324

Query  204  R  206
            R
Sbjct  325  R  325



>gb|KFK36886.1| hypothetical protein AALP_AA4G184600 [Arabis alpina]
Length=590

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FPP+LC LGL+YLG NEMPILFP   R+R+LDLLYALL+TE HC L+++C NLEVLET
Sbjct  265  LTFPPKLCRLGLSYLGTNEMPILFPFAARIRKLDLLYALLETEDHCTLIQRCPNLEVLET  324

Query  204  R  206
            R
Sbjct  325  R  325



>gb|ABV72393.1| coronatine-insensitive 1 [Hevea brasiliensis]
Length=597

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V+FP +LC LGLTY+GKNEM I+FP    L++LDLLYALLDTE HC L++KC NLEVLET
Sbjct  266  VTFPQKLCRLGLTYMGKNEMRIVFPFASLLKKLDLLYALLDTEDHCLLIQKCFNLEVLET  325

Query  204  R  206
            R
Sbjct  326  R  326



>ref|XP_009350961.1| PREDICTED: coronatine-insensitive protein 1-like [Pyrus x bretschneideri]
Length=586

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            +N+Q     +V+ P +LC LGLTY+GKNEMPI+FP    L++LDLLYALLDTE HC L++
Sbjct  247  FNDQSERYSVVTLPQKLCRLGLTYMGKNEMPIVFPFATLLKKLDLLYALLDTEDHCTLIQ  306

Query  174  KCINLEVLETR  206
            +C NLEVLETR
Sbjct  307  RCPNLEVLETR  317



>ref|XP_009133392.1| PREDICTED: coronatine-insensitive protein 1 [Brassica rapa]
Length=590

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FPP+LC LGL+Y+G NEMPILFP   ++R+LDL+YALL TE HC L++KC NLEVLET
Sbjct  265  LTFPPKLCCLGLSYMGPNEMPILFPFAAQIRKLDLIYALLATEDHCTLIQKCPNLEVLET  324

Query  204  R  206
            R
Sbjct  325  R  325



>emb|CDY24941.1| BnaC03g22310D [Brassica napus]
Length=590

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FPP+LC LGL+Y+G NEMPILFP   ++R+LDL+YALL TE HC L++KC NLEVLET
Sbjct  265  LTFPPKLCCLGLSYMGPNEMPILFPFAAQIRKLDLIYALLATEDHCTLIQKCPNLEVLET  324

Query  204  R  206
            R
Sbjct  325  R  325



>ref|XP_010554643.1| PREDICTED: coronatine-insensitive protein 1 [Tarenaya hassleriana]
Length=591

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            +SFP +LC LGL+Y+G NEMPI+FP   ++R+LDLLYALLDTE HC L++KC NLEVLET
Sbjct  265  LSFPRKLCRLGLSYMGTNEMPIIFPFAAQIRKLDLLYALLDTEDHCTLIQKCPNLEVLET  324

Query  204  R  206
            R
Sbjct  325  R  325



>gb|ABZ05469.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
Length=137

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  2    FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  60



>gb|ABZ05416.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05418.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
Length=130

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  10   FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  68



>ref|XP_011084944.1| PREDICTED: coronatine-insensitive protein 1-like [Sesamum indicum]
Length=624

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 5/70 (7%)
 Frame = +3

Query  12   NEQL-----VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEK  176
            NEQL     V+FPPRL  LGLTYLG  EMPI++P+  +L++LDLL ALLDTE HC LL++
Sbjct  284  NEQLERYASVTFPPRLSRLGLTYLGNAEMPIVYPVASKLKKLDLLQALLDTEGHCQLLQR  343

Query  177  CINLEVLETR  206
            C NLE LETR
Sbjct  344  CPNLEFLETR  353



>gb|ABZ05420.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05483.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
Length=129

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  10   FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  68



>gb|ABZ05491.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
Length=128

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  10   FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  68



>gb|ABZ05485.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
Length=140

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  5    FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  63



>gb|ABZ05410.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
Length=145

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  10   FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  68



>emb|CDY60996.1| BnaA03g56600D [Brassica napus]
Length=703

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FPP+LC LGL+Y+G NEMPILFP   ++R+LDL+YALL TE HC L++KC NLEVLET
Sbjct  378  LTFPPKLCCLGLSYMGPNEMPILFPFAAQIRKLDLIYALLATEDHCTLIQKCPNLEVLET  437

Query  204  R  206
            R
Sbjct  438  R  438



>gb|ABZ05406.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05407.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05408.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05409.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05411.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05412.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05413.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05414.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05415.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05417.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05419.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05421.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05422.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05423.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05424.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05425.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05426.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05427.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05428.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05429.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05430.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05431.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05432.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05433.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05434.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05435.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05436.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05437.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05438.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05439.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05440.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05441.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05442.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05443.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05444.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05445.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05446.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05447.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05448.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05449.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05450.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05451.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05453.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05454.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05455.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05456.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05457.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05458.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05459.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05460.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05461.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05462.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05463.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05465.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05466.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05467.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05468.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05470.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05471.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05472.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05473.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05475.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05476.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05478.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05479.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05480.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05481.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05482.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05484.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05486.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05488.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05489.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05490.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05492.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05493.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05494.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05495.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05496.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05497.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05498.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05499.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05500.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05501.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
Length=145

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  10   FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  68



>emb|CDX93225.1| BnaC04g46710D [Brassica napus]
Length=594

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FPP+L  LGLTYLG NEMPILFP   +LR+LDL+YA L+T  HC L++KC NLEVLET
Sbjct  266  LTFPPKLSRLGLTYLGANEMPILFPFAAQLRKLDLIYAFLETNDHCKLIQKCPNLEVLET  325

Query  204  R  206
            R
Sbjct  326  R  326



>ref|XP_007163515.1| hypothetical protein PHAVU_001G240400g [Phaseolus vulgaris]
 gb|ESW35509.1| hypothetical protein PHAVU_001G240400g [Phaseolus vulgaris]
Length=591

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            YNE+      +S PP+LC LGLTY+GKNE+PI+F     L++LDLLYA+LDTE HC L  
Sbjct  249  YNEEPENYSAISLPPKLCRLGLTYIGKNELPIVFLFAGVLKKLDLLYAMLDTEDHCILFR  308

Query  174  KCINLEVLETR  206
            KC NLEVLETR
Sbjct  309  KCPNLEVLETR  319



>ref|XP_009141850.1| PREDICTED: coronatine-insensitive protein 1-like [Brassica rapa]
Length=607

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FPP+L  LGLTYLG NEMPILFP   +LR+LDL+Y+ L+T  HC L++KC NLEVLET
Sbjct  267  LAFPPKLSRLGLTYLGANEMPILFPFAAQLRKLDLIYSFLETNDHCQLIQKCPNLEVLET  326

Query  204  R  206
            R
Sbjct  327  R  327



>ref|XP_008381979.1| PREDICTED: coronatine-insensitive protein 1-like [Malus domestica]
Length=583

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            +NEQ     +V+ P +LC LGLTY+GK EMPI+FP    L++LDLLYALLDTE HC L++
Sbjct  247  FNEQSERYSVVTLPQKLCRLGLTYMGKKEMPIVFPFATLLKKLDLLYALLDTEDHCTLIQ  306

Query  174  KCINLEVLETR  206
            +C NLE+LETR
Sbjct  307  RCPNLEILETR  317



>ref|XP_009407558.1| PREDICTED: coronatine-insensitive protein 1 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=601

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 8/74 (11%)
 Frame = +3

Query  9    YNEQL--------VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCF  164
            +N+QL        + FPPRLC +GL Y+GKNEM ILFP    L++LDL Y LL TE HC 
Sbjct  268  FNDQLGEVNTYKKIQFPPRLCCVGLIYMGKNEMSILFPFAAALKKLDLQYTLLSTEDHCQ  327

Query  165  LLEKCINLEVLETR  206
            L+++C NLEVLE R
Sbjct  328  LIQRCPNLEVLEVR  341



>dbj|BAJ95041.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=594

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPPR+C LGLT++GKNEMP++FP +  L++LDL Y  L TE HC L+ KC NL VLE 
Sbjct  267  VKFPPRVCFLGLTFMGKNEMPVIFPFSASLKKLDLQYTFLTTEDHCQLISKCPNLFVLEV  326

Query  204  R  206
            R
Sbjct  327  R  327



>ref|XP_009407559.1| PREDICTED: coronatine-insensitive protein 1 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=583

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 8/74 (11%)
 Frame = +3

Query  9    YNEQL--------VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCF  164
            +N+QL        + FPPRLC +GL Y+GKNEM ILFP    L++LDL Y LL TE HC 
Sbjct  250  FNDQLGEVNTYKKIQFPPRLCCVGLIYMGKNEMSILFPFAAALKKLDLQYTLLSTEDHCQ  309

Query  165  LLEKCINLEVLETR  206
            L+++C NLEVLE R
Sbjct  310  LIQRCPNLEVLEVR  323



>gb|ADK66974.1| coronatine insensitive 2-like protein [Triticum aestivum]
Length=594

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPPR+C LGLT++GKNEMP++FP +  L++LDL Y  L TE HC L+ KC NL VLE 
Sbjct  267  VKFPPRVCFLGLTFMGKNEMPVIFPFSASLKKLDLQYTFLTTEDHCQLISKCPNLFVLEV  326

Query  204  R  206
            R
Sbjct  327  R  327



>emb|CDM83639.1| unnamed protein product [Triticum aestivum]
Length=594

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPPR+C LGLT++GKNEMP++FP +  L++LDL Y  L TE HC L+ KC NL VLE 
Sbjct  267  VKFPPRVCFLGLTFMGKNEMPVIFPFSASLKKLDLQYTFLSTEDHCQLISKCPNLFVLEV  326

Query  204  R  206
            R
Sbjct  327  R  327



>gb|EMT16014.1| hypothetical protein F775_27999 [Aegilops tauschii]
Length=504

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPPR+C LGLT++GKNEMP++FP +  L++LDL Y  L TE HC L+ KC NL VLE 
Sbjct  177  VKFPPRICFLGLTFMGKNEMPVIFPFSASLKKLDLQYTFLTTEDHCQLISKCPNLFVLEV  236

Query  204  R  206
            R
Sbjct  237  R  237



>ref|NP_001238590.1| coronatine-insensitive 1 [Glycine max]
 gb|AAZ66745.1| coronatine-insensitive 1 [Glycine max]
Length=590

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            YNE+      +S P +LC LGLTY+GKNE+PI+F     L++LDLLYA+LDTE HC L++
Sbjct  249  YNEEPEKYSAISLPAKLCRLGLTYIGKNELPIVFMFAAVLKKLDLLYAMLDTEDHCMLIQ  308

Query  174  KCINLEVLETR  206
            KC NLEVLETR
Sbjct  309  KCPNLEVLETR  319



>gb|EMS66070.1| hypothetical protein TRIUR3_35106 [Triticum urartu]
Length=504

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPPR+C LGLT++GKNEMP++FP +  L++LDL Y  L TE HC L+ KC NL VLE 
Sbjct  177  VKFPPRVCFLGLTFMGKNEMPVIFPFSASLKKLDLQYTFLTTEDHCQLISKCPNLFVLEV  236

Query  204  R  206
            R
Sbjct  237  R  237



>ref|XP_010907624.1| PREDICTED: coronatine-insensitive protein 1-like [Elaeis guineensis]
Length=580

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  18   QLVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVL  197
            ++V FPPRLC LGL Y+G NEM I+FP    L++LDL Y  L TE HC L+++C NLE+L
Sbjct  252  EMVRFPPRLCCLGLIYMGTNEMQIMFPFAASLKKLDLQYTFLSTEDHCQLIQRCPNLEIL  311

Query  198  ETR  206
            E R
Sbjct  312  EVR  314



>emb|CDX93223.1| BnaC04g46730D [Brassica napus]
Length=591

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FPP+L  LGLTYLG NEMP++FP   ++R+LDLL+A L T+ HC L++KC NLEVLET
Sbjct  266  LTFPPKLSRLGLTYLGANEMPMIFPFAAQIRKLDLLFAFLGTDDHCKLIQKCPNLEVLET  325

Query  204  R  206
            R
Sbjct  326  R  326



>ref|XP_009416210.1| PREDICTED: coronatine-insensitive protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            + FPP+LC +GL Y+GKNEM ILFP    L++LDL Y  L TE HC L+++C NLEVLE 
Sbjct  263  IQFPPKLCCIGLIYMGKNEMDILFPFAAALKKLDLQYTFLSTEDHCQLIQRCPNLEVLEV  322

Query  204  R  206
            R
Sbjct  323  R  323



>ref|XP_009141849.1| PREDICTED: coronatine-insensitive protein 1-like [Brassica rapa]
Length=604

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 39/61 (64%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FPP+L  LGLTYLG NEMP++FP   ++R+LDLLYA L T+ HC L++KC NLEVLET
Sbjct  266  LAFPPKLSRLGLTYLGANEMPMIFPFAAQIRKLDLLYAFLGTDDHCELIQKCPNLEVLET  325

Query  204  R  206
            R
Sbjct  326  R  326



>gb|EYU41258.1| hypothetical protein MIMGU_mgv1a002958mg [Erythranthe guttata]
Length=621

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V+FPP+LC LGLTY+GK EMP+++P+  +L++LDLLY+LL TE HC LL++C NLE LE 
Sbjct  290  VAFPPKLCGLGLTYMGKAEMPVIYPVASKLKKLDLLYSLLGTEDHCELLKRCPNLEFLEA  349

Query  204  R  206
            R
Sbjct  350  R  350



>ref|XP_010505693.1| PREDICTED: coronatine-insensitive protein 1 [Camelina sativa]
Length=596

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLET
Sbjct  268  LTFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLET  327

Query  204  R  206
            R
Sbjct  328  R  328



>ref|XP_010508943.1| PREDICTED: coronatine-insensitive protein 1-like [Camelina sativa]
Length=597

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLET
Sbjct  269  LTFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLET  328

Query  204  R  206
            R
Sbjct  329  R  329



>ref|XP_010517373.1| PREDICTED: coronatine-insensitive protein 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010517375.1| PREDICTED: coronatine-insensitive protein 1-like isoform X2 [Camelina 
sativa]
Length=595

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLET
Sbjct  267  LTFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLET  326

Query  204  R  206
            R
Sbjct  327  R  327



>ref|XP_003552511.1| PREDICTED: coronatine-insensitive protein 1-like [Glycine max]
 gb|KHN07642.1| Coronatine-insensitive protein 1 [Glycine soja]
Length=590

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            YNE+      +S P +LC LGLTY+GKNE+PI+F     L++LDLLYA+LDTE HC L++
Sbjct  249  YNEEPERYSAISLPAKLCRLGLTYIGKNELPIVFMFAAVLKKLDLLYAMLDTEDHCMLIQ  308

Query  174  KCINLEVLETR  206
            +C NLEVLETR
Sbjct  309  RCPNLEVLETR  319



>ref|NP_001044831.2| Os01g0853400 [Oryza sativa Japonica Group]
 dbj|BAF06745.2| Os01g0853400 [Oryza sativa Japonica Group]
Length=630

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPPRLC LGLTY+G NEMP++FP + +L++LDL Y  L TE HC ++ KC NL +LE 
Sbjct  304  VKFPPRLCFLGLTYMGTNEMPVIFPFSMKLKKLDLQYTFLTTEDHCQIIAKCPNLLILEV  363

Query  204  R  206
            R
Sbjct  364  R  364



>ref|NP_001055700.1| Os05g0449500 [Oryza sativa Japonica Group]
 gb|AAU90110.1| putative LRR-containing F-box protein [Oryza sativa Japonica 
Group]
 dbj|BAF17614.1| Os05g0449500 [Oryza sativa Japonica Group]
 gb|EEE63917.1| hypothetical protein OsJ_18742 [Oryza sativa Japonica Group]
Length=597

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FP RLCSLGLTY+G NEMPI+FP +  L++LDL Y  L TE HC L+ KC NL VL  
Sbjct  271  VKFPSRLCSLGLTYMGTNEMPIIFPFSALLKKLDLQYTFLTTEDHCQLIAKCPNLLVLAV  330

Query  204  R  206
            R
Sbjct  331  R  331



>gb|AAO38719.1| COI1 [Oryza sativa Japonica Group]
 dbj|BAD81943.1| COI1 [Oryza sativa Japonica Group]
 gb|AAY41186.1| coronatine-insensitive 1 [Oryza sativa Japonica Group]
 gb|EAY76526.1| hypothetical protein OsI_04468 [Oryza sativa Indica Group]
 gb|EAZ14179.1| hypothetical protein OsJ_04105 [Oryza sativa Japonica Group]
Length=595

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPPRLC LGLTY+G NEMP++FP + +L++LDL Y  L TE HC ++ KC NL +LE 
Sbjct  269  VKFPPRLCFLGLTYMGTNEMPVIFPFSMKLKKLDLQYTFLTTEDHCQIIAKCPNLLILEV  328

Query  204  R  206
            R
Sbjct  329  R  329



>ref|XP_006645032.1| PREDICTED: coronatine-insensitive protein 1-like [Oryza brachyantha]
Length=630

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPPRLC LGLTY+G NEMP++FP + +L++LDL Y  L TE HC ++ KC NL +LE 
Sbjct  304  VKFPPRLCLLGLTYMGTNEMPVIFPFSMKLKKLDLQYTFLTTEDHCQIIAKCPNLLILEV  363

Query  204  R  206
            R
Sbjct  364  R  364



>ref|XP_010095054.1| hypothetical protein L484_026361 [Morus notabilis]
 gb|EXB58160.1| hypothetical protein L484_026361 [Morus notabilis]
Length=507

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 54/71 (76%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            +NEQ      VS P +LC LG TY+GKNEMPI+FP    L++LDLLYALLDTE HC L++
Sbjct  166  FNEQPEKYSAVSLPQKLCRLGPTYMGKNEMPIVFPFASLLKKLDLLYALLDTEDHCTLIQ  225

Query  174  KCINLEVLETR  206
            +C NLEVLETR
Sbjct  226  RCPNLEVLETR  236



>ref|XP_010262774.1| PREDICTED: coronatine-insensitive protein 1-like [Nelumbo nucifera]
Length=589

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +3

Query  21   LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLE  200
            +V+ PPRL S+GL+Y+G+NEMPI+FP    L++LDLLY LLDTE HC L+++C NLE+LE
Sbjct  260  IVTLPPRLRSVGLSYMGRNEMPIVFPFASLLKKLDLLYVLLDTEDHCQLIQRCPNLEILE  319

Query  201  TR  206
             R
Sbjct  320  AR  321



>ref|XP_008392915.1| PREDICTED: coronatine-insensitive protein 1-like [Malus domestica]
Length=586

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            +N+Q     +V+ P +LC LGLTY+GKNEM I+FP    L++LDLLYALLDTE HC L++
Sbjct  247  FNDQSESYSVVTLPQKLCRLGLTYMGKNEMQIVFPFATLLKKLDLLYALLDTEDHCTLIQ  306

Query  174  KCINLEVLETR  206
            +C NLEVLETR
Sbjct  307  RCPNLEVLETR  317



>gb|EAY98249.1| hypothetical protein OsI_20159 [Oryza sativa Indica Group]
Length=583

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FP RLCSLGLTY+G NEMPI+FP +  L++LDL Y  L TE HC L+ KC NL VL  
Sbjct  257  VKFPSRLCSLGLTYMGTNEMPIIFPFSALLKKLDLQYTFLTTEDHCQLIAKCPNLLVLAV  316

Query  204  R  206
            R
Sbjct  317  R  317



>gb|ABR45956.1| coronitine insensitive 1 [Arabidopsis lyrata]
Length=593

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  269  FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  327



>ref|NP_565919.1| coronatine-insensitive protein 1 [Arabidopsis thaliana]
 sp|O04197.1|COI1_ARATH RecName: Full=Coronatine-insensitive protein 1; AltName: Full=COI-1; 
AltName: Full=F-box/LRR-repeat protein 2; Short=AtCOI1; 
Short=AtFBL2 [Arabidopsis thaliana]
 pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|D Chain D, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|F Chain F, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|H Chain H, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|J Chain J, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|L Chain L, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|N Chain N, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|P Chain P, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGL|B Chain B, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|D Chain D, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|F Chain F, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|H Chain H, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|J Chain J, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|L Chain L, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|N Chain N, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|P Chain P, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGM|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|D Chain D, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|F Chain F, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|H Chain H, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|J Chain J, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|L Chain L, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|N Chain N, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|P Chain P, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 gb|AAB95279.1| coronatine-insensitive 1 (COI1), AtFBL2 [Arabidopsis thaliana]
 gb|AAC17498.1| LRR-containing F-box protein [Arabidopsis thaliana]
 gb|AAK73983.1| At2g39940/T28M21.10 [Arabidopsis thaliana]
 gb|AAM91386.1| At2g39940/T28M21.10 [Arabidopsis thaliana]
 gb|ABR45936.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45937.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45938.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45939.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45940.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45941.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45942.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45943.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45944.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45945.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45946.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45947.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45949.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45950.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45951.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45952.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45953.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|ABR45954.1| coronitine insensitive 1 [Arabidopsis thaliana]
 gb|AEC09753.1| coronatine-insensitive protein 1 [Arabidopsis thaliana]
Length=592

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  268  FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  326



>ref|XP_002881684.1| coronitine insensitive 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57943.1| coronitine insensitive 1 [Arabidopsis lyrata subsp. lyrata]
Length=592

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  268  FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  326



>gb|ABR45948.1| coronitine insensitive 1 [Arabidopsis thaliana]
Length=592

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  268  FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  326



>gb|ABR45957.1| coronitine insensitive 1 [Arabidopsis lyrata]
 gb|ABR45958.1| coronitine insensitive 1 [Arabidopsis lyrata]
 gb|ABR45959.1| coronitine insensitive 1 [Arabidopsis lyrata]
 gb|ABR45960.1| coronitine insensitive 1 [Arabidopsis lyrata]
 gb|ABR45961.1| coronitine insensitive 1 [Arabidopsis lyrata]
Length=592

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  268  FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  326



>gb|ABR45955.1| coronitine insensitive 1 [Arabidopsis thaliana]
Length=592

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  268  FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  326



>ref|NP_001150429.1| coronatine-insensitive protein 1 [Zea mays]
 gb|ACG39067.1| coronatine-insensitive protein 1 [Zea mays]
 gb|AFW81724.1| LOW QUALITY PROTEIN: coronatine-insensitive protein 1 [Zea mays]
Length=599

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FP RLCSLGLTY+G NEMPI+FP +  L++LDL Y  L TE HC L+ KC NL VL  
Sbjct  273  VKFPSRLCSLGLTYMGTNEMPIMFPFSAILKKLDLQYTFLTTEDHCQLIAKCPNLLVLAV  332

Query  204  R  206
            R
Sbjct  333  R  333



>gb|KHN17850.1| Coronatine-insensitive protein 1 [Glycine soja]
Length=507

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            YNE+      +S P +LC LGLTY+GKNE+PI+F     L++LDLLYA+LDTE HC L++
Sbjct  166  YNEEPEKYSAISLPAKLCRLGLTYIGKNELPIVFMFAAVLKKLDLLYAMLDTEDHCMLIQ  225

Query  174  KCINLEVLETR  206
            +C NLEVLETR
Sbjct  226  RCPNLEVLETR  236



>ref|XP_008775055.1| PREDICTED: coronatine-insensitive protein 1-like [Phoenix dactylifera]
Length=580

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPPRLC LGL Y+G NEM I+FP    L++LDL Y  L TE HC L+++C NLE+LE 
Sbjct  254  VRFPPRLCCLGLIYMGTNEMQIIFPFAASLKKLDLQYTFLSTEDHCQLIQRCPNLEILEA  313

Query  204  R  206
            R
Sbjct  314  R  314



>ref|XP_010905359.1| PREDICTED: coronatine-insensitive protein 1-like [Elaeis guineensis]
 ref|XP_010905360.1| PREDICTED: coronatine-insensitive protein 1-like [Elaeis guineensis]
Length=590

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPPRLC LGL+Y+G NEM I+FP    L++LDL Y  L TE HC L+++C NLE+LE 
Sbjct  263  VCFPPRLCCLGLSYMGMNEMHIIFPFAASLKKLDLQYTFLSTEDHCQLIQRCPNLEILEV  322

Query  204  R  206
            R
Sbjct  323  R  323



>ref|XP_004503230.1| PREDICTED: coronatine-insensitive protein 1-like [Cicer arietinum]
Length=595

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            YNE+      VS P +LC LGLTY+GKNE+PI+F     L++LDLLYA+LDTE HC L +
Sbjct  249  YNEEPERYSSVSLPAKLCRLGLTYIGKNELPIVFMYAAALKKLDLLYAMLDTEDHCMLFQ  308

Query  174  KCINLEVLETR  206
            KC NLEVLETR
Sbjct  309  KCPNLEVLETR  319



>gb|AFW81725.1| coronatine-insensitive protein 1, mRNA [Zea mays]
Length=503

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FP RLCSLGLTY+G NEMPI+FP +  L++LDL Y  L TE HC L+ KC NL VL  
Sbjct  177  VKFPSRLCSLGLTYMGTNEMPIMFPFSAILKKLDLQYTFLTTEDHCQLIAKCPNLLVLAV  236

Query  204  R  206
            R
Sbjct  237  R  237



>ref|XP_004970611.1| PREDICTED: coronatine-insensitive protein 1-like [Setaria italica]
Length=598

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +3

Query  24   VSFPPRLCSLG-LTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLE  200
            V FPPRLC LG LT++GKNEMPI+FP +  L++LDL Y LL TE HC L+ KC NL VLE
Sbjct  271  VQFPPRLCFLGSLTFMGKNEMPIIFPFSATLKKLDLQYTLLTTEDHCQLIAKCPNLLVLE  330

Query  201  TR  206
             R
Sbjct  331  VR  332



>ref|XP_003600857.1| Coronatine-insensitive [Medicago truncatula]
 gb|AES71108.1| coronatine-insensitive protein [Medicago truncatula]
Length=601

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            YNE+      +  P +LC LGLTY+GKNE+PI FP    L++LDLLYA+LDTE HC L++
Sbjct  258  YNEEPERYTALMLPAKLCRLGLTYIGKNELPIAFPYAAGLKKLDLLYAMLDTEDHCMLIQ  317

Query  174  KCINLEVLETR  206
            KC NLEVLETR
Sbjct  318  KCPNLEVLETR  328



>gb|AIT39744.1| coronatine-insensitive protein 1 [Chrysanthemum boreale]
Length=584

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V++PPRLC LGL Y+  NEMP +FP   RL++LDLLYALLDT+ HC LL++C NLEVLET
Sbjct  261  VAYPPRLCRLGLNYMSTNEMPFVFPFASRLKKLDLLYALLDTDDHCLLLQRCPNLEVLET  320

Query  204  R  206
            R
Sbjct  321  R  321



>gb|AES99527.2| coronatine-insensitive protein [Medicago truncatula]
Length=593

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            YNE       +S P +L  LGLTY+GKNEMPI FP   +L++LDLLYA+LDTE HC L+E
Sbjct  248  YNEDPEKYAAISLPSKLSRLGLTYIGKNEMPIAFPYASQLKKLDLLYAMLDTEDHCTLIE  307

Query  174  KCINLEVLETR  206
            KC NLE+LE+R
Sbjct  308  KCPNLEILESR  318



>ref|XP_003564629.1| PREDICTED: coronatine-insensitive protein 1-like [Brachypodium 
distachyon]
Length=594

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V+FPPR+C LGLTY+GKNE+P++FP + RL++LDL Y  L  E HC ++ KC NL VLE 
Sbjct  269  VNFPPRVCLLGLTYMGKNEIPVIFPFSARLKKLDLQYTFLTAEDHCQVISKCPNLFVLEV  328

Query  204  R  206
            R
Sbjct  329  R  329



>ref|XP_003616569.1| Coronatine-insensitive 1-like protein [Medicago truncatula]
Length=587

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            YNE       +S P +L  LGLTY+GKNEMPI FP   +L++LDLLYA+LDTE HC L+E
Sbjct  242  YNEDPEKYAAISLPSKLSRLGLTYIGKNEMPIAFPYASQLKKLDLLYAMLDTEDHCTLIE  301

Query  174  KCINLEVLETR  206
            KC NLE+LE+R
Sbjct  302  KCPNLEILESR  312



>gb|AJA32915.1| coronatine insensitive 1, partial [Trifolium repens]
Length=564

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            YNE       VS P +L  LGLTY+GKNEMPI FP   +L++LDLLYA+LDTE HC L+E
Sbjct  232  YNEDPEEYAAVSLPAKLNRLGLTYIGKNEMPIAFPYAAQLKKLDLLYAMLDTEDHCTLIE  291

Query  174  KCINLEVLETR  206
            KC NLE+LE+R
Sbjct  292  KCPNLEILESR  302



>ref|XP_008812874.1| PREDICTED: coronatine-insensitive protein 1-like [Phoenix dactylifera]
Length=590

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPPRLC LGL Y+G NEM I+FP    L++LDL Y  L TE HC L+++C NLE+LE 
Sbjct  263  VCFPPRLCCLGLIYMGMNEMHIIFPFAASLKKLDLQYTFLSTEDHCQLIQRCPNLEILEV  322

Query  204  R  206
            R
Sbjct  323  R  323



>ref|XP_009402285.1| PREDICTED: coronatine-insensitive protein 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402286.1| PREDICTED: coronatine-insensitive protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=588

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  21   LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLE  200
            ++ FPPRLC +GL ++G NEM +LFP    L++LDL Y  L TE HC L+E+C NLEVLE
Sbjct  262  VIRFPPRLCCVGLIFMGTNEMNLLFPFAAALKKLDLQYTFLSTEDHCQLIERCPNLEVLE  321

Query  201  TR  206
             R
Sbjct  322  VR  323



>ref|XP_011036007.1| PREDICTED: coronatine-insensitive protein 1 [Populus euphratica]
Length=609

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  12   NEQLVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLE  191
            N   V FPP+LC LGL+Y+ KN M I+FP   RL++LDLLY LL TE HC L+++C NLE
Sbjct  270  NYSAVEFPPKLCRLGLSYMEKNVMSIVFPFASRLKKLDLLYVLLGTEDHCVLVQRCPNLE  329

Query  192  VLETR  206
            VLETR
Sbjct  330  VLETR  334



>ref|XP_004961907.1| PREDICTED: coronatine-insensitive protein 1-like [Setaria italica]
Length=598

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FP RLCSLGLT++G NEMPI+FP +  L++LDL Y +L TE HC L+ KC NL VL  
Sbjct  273  VKFPSRLCSLGLTFMGTNEMPIIFPFSAILKKLDLQYTVLTTEDHCQLISKCPNLLVLAV  332

Query  204  R  206
            R
Sbjct  333  R  333



>ref|XP_002439888.1| hypothetical protein SORBIDRAFT_09g022040 [Sorghum bicolor]
 gb|EES18318.1| hypothetical protein SORBIDRAFT_09g022040 [Sorghum bicolor]
Length=599

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FP RLCSLGLT++G NEMPI+FP +  L++LDL Y +L TE HC L+ KC NL VL  
Sbjct  273  VRFPSRLCSLGLTFMGTNEMPIIFPFSAILKKLDLQYTVLTTEDHCQLIAKCPNLLVLAV  332

Query  204  R  206
            R
Sbjct  333  R  333



>ref|XP_006293881.1| hypothetical protein CARUB_v10022866mg [Capsella rubella]
 gb|EOA26779.1| hypothetical protein CARUB_v10022866mg [Capsella rubella]
Length=594

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FP +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+T+ HC L++KC NLE+LETR
Sbjct  268  FPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETDDHCTLIQKCPNLEILETR  326



>gb|AFW81726.1| hypothetical protein ZEAMMB73_728081 [Zea mays]
Length=254

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/58 (64%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVL  197
            V FP RLCSLGLTY+G NEMPI+FP +  L++LDL Y  L TE HC L+ KC NL VL
Sbjct  177  VKFPSRLCSLGLTYMGTNEMPIMFPFSAILKKLDLQYTFLTTEDHCQLIAKCPNLLVL  234



>ref|XP_002315178.1| hypothetical protein POPTR_0010s20030g [Populus trichocarpa]
 gb|EEF01349.1| hypothetical protein POPTR_0010s20030g [Populus trichocarpa]
Length=574

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPP+LC LGL+Y+ KN M I+FP    L++LDLLY LL TE HC L+++C NLEVLET
Sbjct  243  VVFPPKLCRLGLSYMEKNVMSIVFPFASLLKKLDLLYVLLGTEDHCVLVQRCPNLEVLET  302

Query  204  R  206
            R
Sbjct  303  R  303



>gb|ABZ05452.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05464.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
 gb|ABZ05474.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
Length=145

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  39   RLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  13   KLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  68



>ref|NP_001147900.1| LOC100281510 [Zea mays]
 gb|ACG29063.1| coronatine-insensitive protein 1 [Zea mays]
Length=598

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +3

Query  24   VSFPPRLCSLG-LTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLE  200
            V FPPRLC LG LT++GKNEMP++FP +  L++LDL +  L TE HC L+ KC NL VLE
Sbjct  270  VIFPPRLCFLGGLTFMGKNEMPVIFPYSTMLKKLDLQFTFLTTEDHCQLIAKCPNLSVLE  329

Query  201  TR  206
             R
Sbjct  330  VR  331



>gb|ABZ05477.1| coronatine-insensitive 1, partial [Arabidopsis thaliana]
Length=133

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +3

Query  39   RLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            +LC LGL+Y+G NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLEVLETR
Sbjct  1    KLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETR  56



>ref|XP_011040511.1| PREDICTED: coronatine-insensitive protein 1-like [Populus euphratica]
Length=602

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPP+LC LGL+Y+ KN M I+FP    L++LDLLYA L TE HC L+++C NLEVLET
Sbjct  271  VKFPPKLCCLGLSYMEKNVMSIVFPFASLLKKLDLLYAFLGTEDHCVLVQRCPNLEVLET  330

Query  204  R  206
            R
Sbjct  331  R  331



>ref|XP_010256650.1| PREDICTED: coronatine-insensitive protein 1-like [Nelumbo nucifera]
Length=590

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            +NEQ     +V FP RLC LGL Y+G+NEM I+FP    L++LDLLYALLDTE HC L++
Sbjct  251  FNEQPDRYLVVPFPSRLCRLGLGYMGRNEMSIVFPFASLLKKLDLLYALLDTEDHCQLIQ  310

Query  174  KCINLEVLETR  206
            +C NLE LE R
Sbjct  311  RCPNLETLEAR  321



>ref|XP_004490952.1| PREDICTED: coronatine-insensitive protein 1-like [Cicer arietinum]
Length=593

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNE-----QLVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            YNE       +S P +L  LGLTY+GKNEMP +FP    L++LDLLYA+LDTE HC L++
Sbjct  254  YNEDPEKYSAISLPAKLSRLGLTYIGKNEMPFVFPYAAMLKKLDLLYAMLDTEDHCTLIQ  313

Query  174  KCINLEVLETR  206
            KC NLEVLE+R
Sbjct  314  KCPNLEVLESR  324



>gb|ACR35897.1| unknown [Zea mays]
 tpg|DAA56799.1| TPA: coronatine-insensitive protein 1 [Zea mays]
Length=598

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +3

Query  24   VSFPPRLCSLG-LTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLE  200
            V FPPRLC LG LT++GKNEMP++FP +  L++LDL +  L TE HC L+ KC NL VLE
Sbjct  270  VIFPPRLCFLGGLTFMGKNEMPVIFPYSTMLKKLDLQFTFLTTEDHCQLIAKCPNLSVLE  329

Query  201  TR  206
             R
Sbjct  330  VR  331



>gb|AIT38271.1| coronatine-insensitive 1, partial [Phaseolus lunatus]
Length=559

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 13/65 (20%)
 Frame = +3

Query  12   NEQLVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLE  191
            N   +S PP+LC LGLTY+GKNE+PIL+ +             LDTE HC L+ KC NLE
Sbjct  236  NYSAISLPPKLCRLGLTYIGKNELPILYAM-------------LDTEDHCILIRKCPNLE  282

Query  192  VLETR  206
            VLETR
Sbjct  283  VLETR  287



>ref|XP_002312140.1| coronatine insensitive 1 family protein [Populus trichocarpa]
 gb|EEE89507.1| coronatine insensitive 1 family protein [Populus trichocarpa]
Length=573

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPP+LC LGL+Y+ KN M I+FP    L++LDLLYA L TE HC L+++C NLEVLET
Sbjct  242  VKFPPKLCCLGLSYMEKNVMSIVFPFASLLKKLDLLYAFLGTEDHCVLVQRCPNLEVLET  301

Query  204  R  206
            R
Sbjct  302  R  302



>ref|NP_001146577.1| uncharacterized protein LOC100280173 [Zea mays]
 gb|ACL54317.1| unknown [Zea mays]
Length=599

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FP R+CSLGLT++G NEMPI+FP +  L++LDL Y  L TE HC L+ KC NL VL  
Sbjct  273  VKFPSRICSLGLTFMGANEMPIIFPFSAILKKLDLQYTFLTTEDHCQLIAKCPNLLVLAV  332

Query  204  R  206
            R
Sbjct  333  R  333



>ref|XP_008647754.1| PREDICTED: uncharacterized protein LOC100280173 isoform X1 [Zea 
mays]
 gb|AFW78106.1| hypothetical protein ZEAMMB73_423217 [Zea mays]
Length=599

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FP R+CSLGLT++G NEMPI+FP +  L++LDL Y  L TE HC L+ KC NL VL  
Sbjct  273  VKFPSRICSLGLTFMGANEMPIIFPFSAILKKLDLQYTFLTTEDHCQLIAKCPNLLVLAV  332

Query  204  R  206
            R
Sbjct  333  R  333



>gb|AHY19994.1| coronatine-insensitive protein 1 [Gladiolus hybrid cultivar]
Length=613

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            + FPPRLC LGL+Y+G NEM ++FP+   L++LDL Y  L TE HC L+++C NLE+LE 
Sbjct  285  ICFPPRLCRLGLSYMGTNEMHVIFPVAGALKKLDLQYTFLTTEDHCELIQRCPNLEILEV  344

Query  204  R  206
            R
Sbjct  345  R  345



>emb|CDY07041.1| BnaA04g22740D [Brassica napus]
Length=592

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++ PP+L  LGLTYLG NEMP++FP   ++R+LDLLYA L T+ HC L++KC NLEVLET
Sbjct  264  LTLPPKLSRLGLTYLGANEMPMIFPFAAQIRKLDLLYAFLGTDDHCELIQKCPNLEVLET  323

Query  204  R  206
            R
Sbjct  324  R  324



>ref|XP_006654488.1| PREDICTED: coronatine-insensitive protein 1-like [Oryza brachyantha]
Length=500

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FP R+CSLGLTY+G NE+PI+FP +  L++LDL Y  L TE HC L+ KC NL VL  
Sbjct  177  VKFPSRMCSLGLTYMGTNEVPIIFPFSAILKKLDLQYTFLTTEDHCQLIAKCPNLLVLAV  236

Query  204  R  206
            R
Sbjct  237  R  237



>ref|XP_010534174.1| PREDICTED: coronatine-insensitive protein 1-like [Tarenaya hassleriana]
Length=591

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FPP+L  LGL+Y+G  EMPI+FP   +LR+LDLLY LL+TE HC L++KC NLEVLE R
Sbjct  267  FPPQLSRLGLSYMGAKEMPIIFPFAAQLRKLDLLYVLLNTEDHCTLIQKCPNLEVLEAR  325



>ref|NP_001169026.1| uncharacterized protein LOC100382859 [Zea mays]
 gb|ACN31438.1| unknown [Zea mays]
Length=365

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +3

Query  24   VSFPPRLCSLG-LTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLE  200
            V  PPRLC LG LT++GKNEMP++FP +  L++LDL Y  L TE HC L+ KC NL VLE
Sbjct  39   VKLPPRLCFLGGLTFMGKNEMPVIFPYSASLKKLDLQYTFLTTEDHCQLIAKCPNLLVLE  98

Query  201  TR  206
             R
Sbjct  99   VR  100



>ref|XP_010909152.1| PREDICTED: coronatine-insensitive protein 1 [Elaeis guineensis]
 ref|XP_010909153.1| PREDICTED: coronatine-insensitive protein 1 [Elaeis guineensis]
Length=594

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPPRLC LGL Y+G NEM I+FP    L++LDL Y LL TE HC L+++C NLE+LE 
Sbjct  267  VRFPPRLCCLGLIYMGMNEMHIIFPFATSLKKLDLQYTLLSTEDHCQLIQRCPNLEILEV  326

Query  204  R  206
            R
Sbjct  327  R  327



>gb|ABR67868.1| coronatine-insensitive 1-like protein [Pisum sativum]
Length=591

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 5/73 (7%)
 Frame = +3

Query  3    NGYNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFL  167
              YNE       VS P +L  LGLTY+GKNEMPI FP   +L++LDLLYA+LDTE HC L
Sbjct  252  GSYNEDPEKYAAVSLPAKLNRLGLTYIGKNEMPIAFPYAAQLKKLDLLYAMLDTEDHCTL  311

Query  168  LEKCINLEVLETR  206
            + KC NLE+LE+R
Sbjct  312  IGKCPNLEILESR  324



>emb|CDX74819.1| BnaA05g05650D [Brassica napus]
Length=600

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEV  194
            ++FPP+LC LGL+YLG NEMPILFP   ++R+LDLLYALL+TE HC L++KC NLE 
Sbjct  277  LTFPPKLCRLGLSYLGANEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLET  333



>gb|ADK47027.1| coronatine insensitive 1 [Brassica rapa subsp. chinensis]
Length=596

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            ++FPP+L  LGLTYLG NEMPILFP   +LR+LDL+Y+ L+T  HC L++KC NLEV + 
Sbjct  267  LAFPPKLSRLGLTYLGANEMPILFPFAAQLRKLDLIYSFLETNDHCELIQKCPNLEVSQP  326

Query  204  R  206
            R
Sbjct  327  R  327



>ref|XP_010067498.1| PREDICTED: coronatine-insensitive protein 1 [Eucalyptus grandis]
 gb|KCW65640.1| hypothetical protein EUGRSUZ_G03030 [Eucalyptus grandis]
Length=591

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            +SFP RLC LGLTY+ +NEMPI+FPI  RLR LDLLYA L T+  C L+++C  LEVLET
Sbjct  261  LSFPARLCRLGLTYISENEMPIVFPIASRLRMLDLLYAFLSTDDLCLLIQQCPILEVLET  320

Query  204  R  206
            R
Sbjct  321  R  321



>ref|XP_008812756.1| PREDICTED: coronatine-insensitive protein 1-like [Phoenix dactylifera]
Length=590

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FPPRLC LGL Y+G NEM I+FP    L++LDL Y  L TE HC L+++C NLE+LE 
Sbjct  263  VRFPPRLCCLGLLYMGMNEMHIIFPFAASLKKLDLQYTFLSTEDHCQLIQQCPNLEILEV  322

Query  204  R  206
            R
Sbjct  323  R  323



>gb|ADT91703.1| coronatine-insensitive 1 [Solanum nigrum]
Length=155

 Score = 60.8 bits (146),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +3

Query  54   GLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            GLTYLGKNEM ILFPI  RL +LDLLYA LDT +HCFLL++C NLE+LETR
Sbjct  1    GLTYLGKNEMSILFPIASRLMKLDLLYAFLDTAAHCFLLQRCPNLEILETR  51



>ref|XP_008463217.1| PREDICTED: coronatine-insensitive protein 1 [Cucumis melo]
Length=587

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 54/72 (75%), Gaps = 5/72 (7%)
 Frame = +3

Query  6    GYNEQL-----VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLL  170
            G+N+Q      ++ P  L +LGLTY+G++EMPI+FP    L++LDLLYALL TE HC L+
Sbjct  251  GFNDQPERYAGIALPQNLRNLGLTYMGRSEMPIVFPFASLLKKLDLLYALLHTEDHCTLI  310

Query  171  EKCINLEVLETR  206
            ++C NLE+LETR
Sbjct  311  QRCPNLEILETR  322



>gb|KHN13082.1| Coronatine-insensitive protein 1 [Glycine soja]
Length=599

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            YNE+      +S P +L  LGLTY+ KNEMPI+FP    L++LDLLYA+LDTE HC L++
Sbjct  258  YNEESEKYSAMSLPAKLSRLGLTYITKNEMPIVFPYAALLKKLDLLYAMLDTEDHCTLIQ  317

Query  174  KCINLEVLETR  206
            +C NLEVLE+R
Sbjct  318  RCPNLEVLESR  328



>gb|AIR76997.1| coronatine insensitive 1, partial [Lilium longiflorum]
Length=546

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  12   NEQLVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLE  191
            N   V FP RLC LGLTY+G N+M I+FP    L++LDL Y  L+TE HC L+++C NLE
Sbjct  261  NYGAVKFPRRLCRLGLTYMGTNDMHIMFPFANMLKKLDLQYTFLNTEDHCQLIQRCPNLE  320

Query  192  VLETR  206
            VLE R
Sbjct  321  VLEVR  325



>ref|XP_006848115.1| hypothetical protein AMTR_s00029p00217840 [Amborella trichopoda]
 gb|ERN09696.1| hypothetical protein AMTR_s00029p00217840 [Amborella trichopoda]
Length=590

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FPPRL  LGL+Y+ +NEMP++FP    L++LDL Y LL+TE HC L+++C NLEVLE R
Sbjct  267  FPPRLARLGLSYMSENEMPMIFPFAASLKKLDLQYTLLNTEDHCQLIQRCPNLEVLEVR  325



>ref|XP_010534559.1| PREDICTED: coronatine-insensitive protein 1 [Tarenaya hassleriana]
 ref|XP_010534560.1| PREDICTED: coronatine-insensitive protein 1 [Tarenaya hassleriana]
Length=591

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FPP+L  LGL+Y+G NEM I+FP   ++R+LDLLYALLDTE HC L++KC NLEVLETR
Sbjct  267  FPPKLRGLGLSYMGTNEMLIIFPFAAQIRKLDLLYALLDTEDHCTLIQKCPNLEVLETR  325



>ref|XP_007141797.1| hypothetical protein PHAVU_008G226500g [Phaseolus vulgaris]
 gb|ESW13791.1| hypothetical protein PHAVU_008G226500g [Phaseolus vulgaris]
Length=585

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            YNE+      +S P +L  LGLTY+ KNEMPI+FP    L++LDLLYA+LDTE HC L++
Sbjct  244  YNEESEKYAAISLPAKLSRLGLTYITKNEMPIVFPHAALLKKLDLLYAMLDTEDHCTLIQ  303

Query  174  KCINLEVLETR  206
            +C NLEVLE+R
Sbjct  304  RCPNLEVLESR  314



>gb|AFW84535.1| hypothetical protein ZEAMMB73_080907 [Zea mays]
Length=303

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = +3

Query  24   VSFPPRLCSLG-LTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLE  200
            V  PPRLC LG LT++GKNEMP++FP +  L++LDL Y  L TE HC L+ KC NL VLE
Sbjct  145  VKLPPRLCFLGGLTFMGKNEMPVIFPYSASLKKLDLQYTFLTTEDHCQLIAKCPNLLVLE  204

Query  201  TR  206
             R
Sbjct  205  VR  206



>gb|KHN20870.1| Coronatine-insensitive protein 1 [Glycine soja]
Length=507

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 5/71 (7%)
 Frame = +3

Query  9    YNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLE  173
            YNE+      +S P +L  LGLTY+ KNEMP++FP    L++LDLLYA+LDTE HC L++
Sbjct  166  YNEESEKYSAISLPAKLSRLGLTYITKNEMPMVFPYAALLKKLDLLYAMLDTEDHCTLIQ  225

Query  174  KCINLEVLETR  206
            +C NLEVLE+R
Sbjct  226  RCPNLEVLESR  236



>ref|XP_004150227.1| PREDICTED: LOW QUALITY PROTEIN: coronatine-insensitive protein 
1-like [Cucumis sativus]
Length=596

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 54/72 (75%), Gaps = 5/72 (7%)
 Frame = +3

Query  6    GYNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLL  170
            G+N+Q      ++ P  L +LGLTY+G++EMPI+FP    L++LDLLYALL TE HC L+
Sbjct  254  GFNDQPEKYAGIALPQNLRNLGLTYMGRSEMPIVFPFANLLKKLDLLYALLHTEDHCTLI  313

Query  171  EKCINLEVLETR  206
            ++C NLE+LETR
Sbjct  314  QRCPNLEILETR  325



>ref|XP_004162774.1| PREDICTED: LOW QUALITY PROTEIN: coronatine-insensitive protein 
1-like [Cucumis sativus]
Length=593

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 54/72 (75%), Gaps = 5/72 (7%)
 Frame = +3

Query  6    GYNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLL  170
            G+N+Q      ++ P  L +LGLTY+G++EMPI+FP    L++LDLLYALL TE HC L+
Sbjct  251  GFNDQPEKYAGIALPQNLRNLGLTYMGRSEMPIVFPFANLLKKLDLLYALLHTEDHCTLI  310

Query  171  EKCINLEVLETR  206
            ++C NLE+LETR
Sbjct  311  QRCPNLEILETR  322



>gb|KGN50635.1| Coronatine-insensitive 1 [Cucumis sativus]
Length=587

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 54/72 (75%), Gaps = 5/72 (7%)
 Frame = +3

Query  6    GYNEQ-----LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLL  170
            G+N+Q      ++ P  L +LGLTY+G++EMPI+FP    L++LDLLYALL TE HC L+
Sbjct  251  GFNDQPEKYAGIALPQNLRNLGLTYMGRSEMPIVFPFANLLKKLDLLYALLHTEDHCTLI  310

Query  171  EKCINLEVLETR  206
            ++C NLE+LETR
Sbjct  311  QRCPNLEILETR  322



>ref|XP_003568339.1| PREDICTED: coronatine-insensitive protein 1-like isoform X2 [Brachypodium 
distachyon]
Length=596

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FP RLCSLGLT LG NEM I+FP +  L++LDL Y  L TE HC L+ KC NL VL  
Sbjct  270  VKFPSRLCSLGLTCLGTNEMHIIFPFSTVLKKLDLQYTFLTTEDHCQLIAKCPNLLVLAV  329

Query  204  R  206
            R
Sbjct  330  R  330



>ref|XP_010231314.1| PREDICTED: coronatine-insensitive protein 1-like isoform X1 [Brachypodium 
distachyon]
Length=597

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FP RLCSLGLT LG NEM I+FP +  L++LDL Y  L TE HC L+ KC NL VL  
Sbjct  271  VKFPSRLCSLGLTCLGTNEMHIIFPFSTVLKKLDLQYTFLTTEDHCQLIAKCPNLLVLAV  330

Query  204  R  206
            R
Sbjct  331  R  331



>ref|XP_004307613.1| PREDICTED: coronatine-insensitive protein 1-like [Fragaria vesca 
subsp. vesca]
Length=595

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +3

Query  21   LVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLE  200
            +VS P +L  LGLT +G+NEMPI+FP+   L +LDLLYALLDTE HC L++KC NL VLE
Sbjct  262  VVSLPRKLSRLGLTMMGRNEMPIVFPLAPLLVKLDLLYALLDTEDHCTLIQKCPNLIVLE  321

Query  201  TR  206
            TR
Sbjct  322  TR  323



>ref|XP_004984685.1| PREDICTED: coronatine-insensitive protein 1-like [Setaria italica]
Length=592

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FPP L  LGL Y+G NEM ILFP +  L++LDL + LL+TE HC ++++C NLEVLE R
Sbjct  275  FPPSLHRLGLHYMGANEMQILFPYSAALKKLDLQFTLLNTEDHCQIVQRCPNLEVLEAR  333



>ref|XP_002456649.1| hypothetical protein SORBIDRAFT_03g040150 [Sorghum bicolor]
 gb|EES01769.1| hypothetical protein SORBIDRAFT_03g040150 [Sorghum bicolor]
Length=596

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +3

Query  24   VSFPPRLCSLG-LTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLE  200
            V FPPRLC LG LT++ KNEM ++FP +  L++LDL Y  L TE HC L+ KC NL VLE
Sbjct  270  VKFPPRLCFLGGLTFMSKNEMQVIFPYSAMLKKLDLQYTCLTTEDHCQLIAKCPNLLVLE  329

Query  201  TR  206
             R
Sbjct  330  VR  331



>dbj|BAJ90363.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=591

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FP ++CS GLT++G NEM I+FP +  L++LDL Y+ L TE HC L+ KC NL VL  
Sbjct  266  VKFPSKICSFGLTFMGINEMHIIFPFSAVLKKLDLQYSFLTTEDHCQLIAKCPNLLVLAV  325

Query  204  R  206
            R
Sbjct  326  R  326



>dbj|BAJ94334.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86228.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95670.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=591

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V FP ++CS GLT++G NEM I+FP +  L++LDL Y+ L TE HC L+ KC NL VL  
Sbjct  266  VKFPSKICSFGLTFMGINEMHIIFPFSAVLKKLDLQYSFLTTEDHCQLIAKCPNLLVLAV  325

Query  204  R  206
            R
Sbjct  326  R  326



>gb|ADK66973.1| coronatine insensitive 1-like protein [Triticum aestivum]
Length=592

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V  P +LCS GLT++G NEM I+FP +  L++LDL Y+ L TE HC L+ KC NL VL  
Sbjct  266  VKLPSKLCSFGLTFMGTNEMHIIFPFSAVLKKLDLQYSFLTTEDHCQLIAKCPNLLVLAV  325

Query  204  R  206
            R
Sbjct  326  R  326



>gb|KDO69096.1| hypothetical protein CISIN_1g007586mg [Citrus sinensis]
Length=597

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V+FP  +C LGL+Y+ ++ M I+FP    L++LDLLYALL+TE HC L+++C NLE+LET
Sbjct  263  VAFPRSICRLGLSYMEQDHMWIIFPFAAMLKKLDLLYALLNTEDHCLLIQRCPNLEILET  322

Query  204  R  206
            R
Sbjct  323  R  323



>ref|XP_006435670.1| hypothetical protein CICLE_v10031013mg [Citrus clementina]
 ref|XP_006486371.1| PREDICTED: coronatine-insensitive protein 1-like [Citrus sinensis]
 gb|ESR48910.1| hypothetical protein CICLE_v10031013mg [Citrus clementina]
Length=597

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V+FP  +C LGL+Y+ ++ M I+FP    L++LDLLYALL+TE HC L+++C NLE+LET
Sbjct  263  VAFPRSICRLGLSYMEQDHMWIIFPFAAMLKKLDLLYALLNTEDHCLLIQRCPNLEILET  322

Query  204  R  206
            R
Sbjct  323  R  323



>gb|EMT15861.1| hypothetical protein F775_26704 [Aegilops tauschii]
Length=465

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/61 (54%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLET  203
            V  P +LCS GLT++G NEM I+FP +  L++LDL Y+ L TE HC L+ KC NL VL  
Sbjct  139  VKLPSKLCSFGLTFMGTNEMHIIFPFSAVLKKLDLQYSFLTTEDHCQLIAKCPNLLVLAV  198

Query  204  R  206
            R
Sbjct  199  R  199



>dbj|BAJ84926.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=586

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FPP +  L L Y+G NEM ILFP    L++LDL +  L TE HC L+++C NLEVLE R
Sbjct  267  FPPSVQRLSLLYMGTNEMQILFPYGATLKKLDLQFTFLTTEDHCQLVQRCPNLEVLEVR  325



>ref|XP_003558282.1| PREDICTED: coronatine-insensitive protein 1-like [Brachypodium 
distachyon]
Length=587

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FPP L  L L Y+G NEM ILFP    +++LDL +  L TE HC ++++C NLEVLE R
Sbjct  270  FPPSLHRLSLLYMGTNEMQILFPYGAAIKKLDLQFTFLTTEDHCQIVQRCPNLEVLEVR  328



>gb|EMT18237.1| hypothetical protein F775_05439 [Aegilops tauschii]
Length=562

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FPP +  L L Y+G NEM ILFP    L++LDL +  L TE HC L+++C NLEVLE R
Sbjct  243  FPPSVQRLSLLYMGTNEMQILFPYGATLKKLDLQFTFLTTEDHCQLVQRCPNLEVLEVR  301



>gb|EMS59081.1| hypothetical protein TRIUR3_23066 [Triticum urartu]
Length=575

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FPP +  L L Y+G NEM ILFP    L++LDL +  L TE HC L+++C NLEVLE R
Sbjct  256  FPPSVQHLSLLYMGTNEMQILFPYGATLKKLDLQFTFLTTEDHCQLVQRCPNLEVLEVR  314



>ref|NP_001169230.1| hypothetical protein [Zea mays]
 gb|ACN32035.1| unknown [Zea mays]
 tpg|DAA44543.1| TPA: hypothetical protein ZEAMMB73_428372 [Zea mays]
Length=591

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = +3

Query  6    GYNEQLVSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCIN  185
            G N +   FPP L  L L Y+G NEM ILFP    L++LDL +  L TE HC ++++C N
Sbjct  266  GRNYENYYFPPLLHRLSLLYMGTNEMQILFPYAAALKKLDLQFTFLSTEDHCQIVQRCPN  325

Query  186  LEVLETR  206
            LE LE R
Sbjct  326  LETLEVR  332



>gb|EMS55850.1| hypothetical protein TRIUR3_31653 [Triticum urartu]
Length=477

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +3

Query  24   VSFPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVL  197
            V  P +LCS GLT++G NEM I+FP +  L++LDLLY+ L TE HC L+ KC NL VL
Sbjct  139  VKLPSKLCSFGLTFMGTNEMHIIFPFSAVLKKLDLLYSFLTTEDHCQLIAKCPNLLVL  196



>ref|XP_002468131.1| hypothetical protein SORBIDRAFT_01g040110 [Sorghum bicolor]
 gb|EER95129.1| hypothetical protein SORBIDRAFT_01g040110 [Sorghum bicolor]
Length=591

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FPP L  L L Y+G NEM ILFP    L++LDL +  L TE HC ++++C NLE LE R
Sbjct  274  FPPSLHRLSLLYMGTNEMQILFPYAAALKKLDLQFTFLSTEEHCQIVQRCPNLETLEVR  332



>ref|XP_006649802.1| PREDICTED: coronatine-insensitive protein 1-like [Oryza brachyantha]
Length=589

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +3

Query  30   FPPRLCSLGLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEVLETR  206
            FPP L  L L Y+G  EM +LFP    L++LDL +  L TE HC L+++C NLE+LE R
Sbjct  272  FPPSLLLLSLLYMGTKEMQVLFPYGAALKKLDLQFTFLSTEDHCQLVQRCPNLEILEVR  330



>gb|ABR17804.1| unknown [Picea sitchensis]
Length=603

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +3

Query  18   QLVSFPPRLCSL-GLTYLGKNEMPILFPITCrlrrldllyalldTESHCFLLEKCINLEV  194
            Q++ FPP+L SL GL ++ + +MP +FP    L RLDL Y  L TE+HC L   C NLE+
Sbjct  262  QMIKFPPKLTSLLGLNFMMEADMPAIFPRASALTRLDLQYTFLSTENHCQLAGLCPNLEI  321

Query  195  LETR  206
            LE R
Sbjct  322  LEVR  325



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515927033552