BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17380_g2_i1 len=972 path=[950:0-465 1416:466-971]

Length=972
                                                                      Score     E

ref|XP_006428554.1|  hypothetical protein CICLE_v10011923mg           97.4    2e-19   
ref|XP_002512613.1|  conserved hypothetical protein                   97.1    5e-19   Ricinus communis
ref|XP_004302143.1|  PREDICTED: uncharacterized protein LOC101307...  97.4    6e-19   
ref|XP_004302142.1|  PREDICTED: uncharacterized protein LOC101307...  97.4    6e-19   
gb|KDO54892.1|  hypothetical protein CISIN_1g010118mg                 96.7    7e-19   
ref|XP_006491771.1|  PREDICTED: uncharacterized protein LOC102618...  96.7    8e-19   
ref|XP_006491769.1|  PREDICTED: uncharacterized protein LOC102618...  96.7    9e-19   
emb|CDP04236.1|  unnamed protein product                              96.3    1e-18   
ref|XP_002325462.1|  hypothetical protein POPTR_0019s07940g           95.1    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_010319806.1|  PREDICTED: uncharacterized protein LOC101264...  95.9    2e-18   
ref|XP_010319807.1|  PREDICTED: uncharacterized protein LOC101264...  95.9    2e-18   
ref|XP_011015350.1|  PREDICTED: uncharacterized protein LOC105118982  94.7    3e-18   
ref|XP_010319808.1|  PREDICTED: uncharacterized protein LOC101264...  95.1    3e-18   
ref|XP_006350384.1|  PREDICTED: ABC transporter F family member 4...  94.7    4e-18   
ref|XP_010674689.1|  PREDICTED: uncharacterized protein LOC104890795  94.4    6e-18   
ref|XP_007029454.1|  Uncharacterized protein TCM_025326               89.7    1e-17   
gb|KDP23305.1|  hypothetical protein JCGZ_23138                       92.4    2e-17   
emb|CBI17668.3|  unnamed protein product                              87.4    2e-17   
ref|XP_009590294.1|  PREDICTED: FK506-binding protein 5-like isof...  91.7    4e-17   
ref|XP_008218419.1|  PREDICTED: myb-like protein X                    90.9    9e-17   
ref|XP_010649268.1|  PREDICTED: uncharacterized protein LOC100251...  90.1    1e-16   
ref|XP_009796729.1|  PREDICTED: eukaryotic translation initiation...  90.1    1e-16   
gb|KHG06677.1|  gdp-mannose transporter                               89.7    2e-16   
ref|XP_008388786.1|  PREDICTED: uncharacterized protein LOC103451127  85.9    3e-16   
emb|CAN81170.1|  hypothetical protein VITISV_022560                   88.6    4e-16   Vitis vinifera
gb|KCW58731.1|  hypothetical protein EUGRSUZ_H01377                   87.4    7e-16   
ref|XP_010070134.1|  PREDICTED: uncharacterized protein LOC104456...  87.4    9e-16   
ref|XP_010070135.1|  PREDICTED: uncharacterized protein LOC104456...  87.4    9e-16   
ref|XP_010649265.1|  PREDICTED: uncharacterized protein LOC100251...  87.0    1e-15   
ref|XP_010649269.1|  PREDICTED: uncharacterized protein LOC100251...  86.7    2e-15   
ref|XP_006850265.1|  hypothetical protein AMTR_s00020p00091800        82.0    3e-15   
ref|XP_010247699.1|  PREDICTED: uncharacterized protein LOC104590675  86.3    4e-15   
gb|KEH42961.1|  transmembrane protein, putative                       85.5    5e-15   
ref|XP_010111046.1|  hypothetical protein L484_015100                 84.3    5e-15   
gb|KEH42962.1|  transmembrane protein, putative                       85.5    6e-15   
gb|KHN14783.1|  hypothetical protein glysoja_020956                   78.6    3e-14   
ref|XP_009337979.1|  PREDICTED: uncharacterized protein LOC103930376  81.6    9e-14   
ref|XP_004495546.1|  PREDICTED: uncharacterized protein LOC101503497  81.3    1e-13   
ref|XP_010553843.1|  PREDICTED: uncharacterized protein LOC104823...  79.7    2e-13   
ref|XP_003555554.1|  PREDICTED: uncharacterized protein LOC100802...  78.6    9e-13   
ref|XP_008787783.1|  PREDICTED: FK506-binding protein 5-like          77.8    9e-13   
gb|KHN04973.1|  hypothetical protein glysoja_013880                   78.2    1e-12   
ref|XP_009381888.1|  PREDICTED: uncharacterized protein LOC103969983  75.5    1e-12   
gb|AAT08670.1|  unknown                                               72.0    2e-12   Hyacinthus orientalis [common hyacinth]
ref|XP_007143985.1|  hypothetical protein PHAVU_007G119300g           71.2    6e-12   
ref|NP_001185316.1|  uncharacterized protein                          74.3    7e-12   
ref|XP_008370920.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  75.1    1e-11   
gb|AAF06044.1|AC009360_9  This gene is cut off                        67.0    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435485.1|  PREDICTED: uncharacterized protein LOC104719297  70.9    1e-10   
ref|XP_006286125.1|  hypothetical protein CARUB_v10007675mg           70.9    1e-10   
emb|CDY16388.1|  BnaA02g11920D                                        71.2    1e-10   
ref|XP_010440782.1|  PREDICTED: uncharacterized protein LOC104724030  70.9    1e-10   
ref|XP_009127384.1|  PREDICTED: uncharacterized protein LOC103852...  70.5    2e-10   
ref|XP_010496609.1|  PREDICTED: uncharacterized protein LOC104773...  70.5    2e-10   
ref|XP_010496605.1|  PREDICTED: uncharacterized protein LOC104773...  70.5    2e-10   
emb|CDX91523.1|  BnaC02g16370D                                        70.1    3e-10   
ref|NP_198459.4|  uncharacterized protein                             69.7    4e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EYU39696.1|  hypothetical protein MIMGU_mgv1a003144mg              70.1    6e-10   
ref|XP_006301457.1|  hypothetical protein CARUB_v10021879mg           67.8    1e-09   
ref|XP_006395921.1|  hypothetical protein EUTSA_v10005424mg           67.8    2e-09   
ref|XP_004171328.1|  PREDICTED: uncharacterized protein LOC101232333  68.2    2e-09   
ref|XP_002888307.1|  hypothetical protein ARALYDRAFT_338601           67.4    3e-09   
ref|XP_008459103.1|  PREDICTED: uncharacterized protein LOC103498312  66.2    9e-09   
ref|NP_001154447.1|  uncharacterized protein                          65.9    1e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CDY37644.1|  BnaC04g29860D                                        63.2    5e-08   
emb|CDX74621.1|  BnaA04g07680D                                        63.2    6e-08   
ref|XP_010511394.1|  PREDICTED: uncharacterized protein LOC104787...  63.2    6e-08   
ref|XP_009124239.1|  PREDICTED: uncharacterized protein LOC103849184  63.2    7e-08   
ref|XP_010415048.1|  PREDICTED: uncharacterized protein LOC104701...  62.0    1e-07   
ref|XP_002458843.1|  hypothetical protein SORBIDRAFT_03g041320        62.0    3e-07   Sorghum bicolor [broomcorn]
ref|XP_006590166.1|  PREDICTED: uncharacterized protein LOC102665739  60.8    6e-07   
ref|NP_001066840.2|  Os12g0506700                                     59.7    2e-06   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK06701.1|  predicted protein                                    59.7    2e-06   
ref|XP_008657019.1|  PREDICTED: uncharacterized protein LOC103636...  59.7    2e-06   
gb|EEC69344.1|  hypothetical protein OsI_38454                        59.3    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008657020.1|  PREDICTED: uncharacterized protein LOC103636...  59.7    2e-06   
ref|XP_011084641.1|  PREDICTED: uncharacterized protein LOC105166...  54.7    6e-05   
ref|XP_011084640.1|  PREDICTED: uncharacterized protein LOC105166...  54.7    6e-05   
ref|XP_004959655.1|  PREDICTED: uncharacterized protein LOC101756991  52.8    3e-04   
gb|AAD26867.1|AC007230_1  T23K8.1                                     50.4    9e-04   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_006428554.1| hypothetical protein CICLE_v10011923mg [Citrus clementina]
 gb|ESR41794.1| hypothetical protein CICLE_v10011923mg [Citrus clementina]
Length=392

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  466  EVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDE  645
            EVM +E KIWEQ+  ++ ++GY AA Q++ ++ELKAL++ TGVEPP+ F+DP DL +V++
Sbjct  321  EVMYNEGKIWEQIVGMQKIVGYKAAKQATCLEELKALYLFTGVEPPASFKDPCDLQEVND  380

Query  646  KLRLLMSIIGAK  681
            KLRLLMSIIG K
Sbjct  381  KLRLLMSIIGVK  392



>ref|XP_002512613.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50065.1| conserved hypothetical protein [Ricinus communis]
Length=501

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 69/93 (74%), Gaps = 7/93 (8%)
 Frame = +1

Query  424  NNA-SEQVSAGA------PSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFI  582
            NNA S QV+AG        S+E+  SEEK+WE++  +R ++GYTAA  ++ + ELKAL++
Sbjct  409  NNADSLQVTAGGIPSGNGTSNEMPDSEEKMWEKIDGMRKIVGYTAARHATCIGELKALYV  468

Query  583  LTGVEPPSPFEDPSDLADVDEKLRLLMSIIGAK  681
             TGVEPP+ F+DPSDLA+V++K + LMSI+G K
Sbjct  469  FTGVEPPASFKDPSDLAEVNDKFKFLMSIVGVK  501



>ref|XP_004302143.1| PREDICTED: uncharacterized protein LOC101307804 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=608

 Score = 97.4 bits (241),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  460  SSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADV  639
            S+ V+ +E+KIW+Q+ AI+ ++GY   P +S ++ELKAL+I TGVEPPS F DP DLA V
Sbjct  535  SNGVLKNEDKIWKQIEAIQSIVGYKVTPHASYMEELKALYIFTGVEPPSSFNDPPDLAQV  594

Query  640  DEKLRLLMSIIGAK  681
            D KLR LMSIIG K
Sbjct  595  DNKLRFLMSIIGLK  608



>ref|XP_004302142.1| PREDICTED: uncharacterized protein LOC101307804 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=611

 Score = 97.4 bits (241),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  460  SSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADV  639
            S+ V+ +E+KIW+Q+ AI+ ++GY   P +S ++ELKAL+I TGVEPPS F DP DLA V
Sbjct  538  SNGVLKNEDKIWKQIEAIQSIVGYKVTPHASYMEELKALYIFTGVEPPSSFNDPPDLAQV  597

Query  640  DEKLRLLMSIIGAK  681
            D KLR LMSIIG K
Sbjct  598  DNKLRFLMSIIGLK  611



>gb|KDO54892.1| hypothetical protein CISIN_1g010118mg [Citrus sinensis]
Length=518

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  466  EVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDE  645
            EVM +E KIWEQ+  ++ ++GY AA Q++ ++ELKAL++ TGVEPP+ F+DP DL +V++
Sbjct  447  EVMYNEGKIWEQIVGMQKIVGYKAAKQATCLEELKALYLFTGVEPPASFKDPCDLQEVND  506

Query  646  KLRLLMSIIGAK  681
            KLRLLMSIIG K
Sbjct  507  KLRLLMSIIGVK  518



>ref|XP_006491771.1| PREDICTED: uncharacterized protein LOC102618019 isoform X3 [Citrus 
sinensis]
Length=518

 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  466  EVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDE  645
            EVM +E KIWEQ+  ++ ++GY AA Q++ ++ELKAL++ TGVEPP+ F+DP DL +V++
Sbjct  447  EVMYNEGKIWEQIVGMQKIVGYKAAKQATCLEELKALYLFTGVEPPASFKDPCDLQEVND  506

Query  646  KLRLLMSIIGAK  681
            KLRLLMSIIG K
Sbjct  507  KLRLLMSIIGVK  518



>ref|XP_006491769.1| PREDICTED: uncharacterized protein LOC102618019 isoform X1 [Citrus 
sinensis]
 ref|XP_006491770.1| PREDICTED: uncharacterized protein LOC102618019 isoform X2 [Citrus 
sinensis]
Length=541

 Score = 96.7 bits (239),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  466  EVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDE  645
            EVM +E KIWEQ+  ++ ++GY AA Q++ ++ELKAL++ TGVEPP+ F+DP DL +V++
Sbjct  470  EVMYNEGKIWEQIVGMQKIVGYKAAKQATCLEELKALYLFTGVEPPASFKDPCDLQEVND  529

Query  646  KLRLLMSIIGAK  681
            KLRLLMSIIG K
Sbjct  530  KLRLLMSIIGVK  541



>emb|CDP04236.1| unnamed protein product [Coffea canephora]
Length=570

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  460  SSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADV  639
            S+E+   E K+WEQ++A+R ++GY AAPQSS ++ELKAL+I TGVEPPS F+ P DL + 
Sbjct  497  SNEISAREGKMWEQINAMRMIVGYKAAPQSSCMEELKALYIFTGVEPPSSFDKPCDLREA  556

Query  640  DEKLRLLMSIIGAK  681
            ++KL  LMSI+G K
Sbjct  557  EDKLHFLMSIVGVK  570



>ref|XP_002325462.1| hypothetical protein POPTR_0019s07940g [Populus trichocarpa]
 gb|EEE99843.1| hypothetical protein POPTR_0019s07940g [Populus trichocarpa]
Length=471

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  GNNASEQVSAGAPSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEP  600
            G  +   +   A + +V+ SE+KIW+Q+ A+R ++GY A+ + + ++ELKAL+I TGVEP
Sbjct  385  GITSENDIHLAAGNVKVLYSEDKIWKQIRAVRTIVGYKASVRGTCIEELKALYIFTGVEP  444

Query  601  PSPFEDPSDLADVDEKLRLLMSIIGAK  681
            P+ F DPSDLA+V++KL+ LM+I+G K
Sbjct  445  PASFRDPSDLAEVNDKLKFLMTIVGVK  471



>ref|XP_010319806.1| PREDICTED: uncharacterized protein LOC101264922 isoform X1 [Solanum 
lycopersicum]
Length=649

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 82/131 (63%), Gaps = 12/131 (9%)
 Frame = +1

Query  325  PLIGTEAKVEITTVAVLVKETQFAPETEKQGNGNNAS-------EQVS--AGAPSSEVM-  474
            PL G +  V    V     + +    +E++GN +          +Q+S  AG P ++ + 
Sbjct  519  PLEGKDNLVAAKEVQRKAPDDRGNLPSERKGNTDRKENAYAGGVDQISGRAGIPEAKPVK  578

Query  475  --VSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEK  648
               SEEKIWE+M+A+R ++GYTAA Q  +VDELKAL+I TGVEPPS F +PS L +V++K
Sbjct  579  ESFSEEKIWEKMNAMRTIVGYTAATQPLLVDELKALYIFTGVEPPSMFSNPSTLEEVNDK  638

Query  649  LRLLMSIIGAK  681
            L+ LMSI+G K
Sbjct  639  LQFLMSIVGIK  649



>ref|XP_010319807.1| PREDICTED: uncharacterized protein LOC101264922 isoform X2 [Solanum 
lycopersicum]
Length=648

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 82/131 (63%), Gaps = 12/131 (9%)
 Frame = +1

Query  325  PLIGTEAKVEITTVAVLVKETQFAPETEKQGNGNNAS-------EQVS--AGAPSSEVM-  474
            PL G +  V    V     + +    +E++GN +          +Q+S  AG P ++ + 
Sbjct  518  PLEGKDNLVAAKEVQRKAPDDRGNLPSERKGNTDRKENAYAGGVDQISGRAGIPEAKPVK  577

Query  475  --VSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEK  648
               SEEKIWE+M+A+R ++GYTAA Q  +VDELKAL+I TGVEPPS F +PS L +V++K
Sbjct  578  ESFSEEKIWEKMNAMRTIVGYTAATQPLLVDELKALYIFTGVEPPSMFSNPSTLEEVNDK  637

Query  649  LRLLMSIIGAK  681
            L+ LMSI+G K
Sbjct  638  LQFLMSIVGIK  648



>ref|XP_011015350.1| PREDICTED: uncharacterized protein LOC105118982 [Populus euphratica]
 ref|XP_011015351.1| PREDICTED: uncharacterized protein LOC105118982 [Populus euphratica]
Length=472

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +1

Query  421  GNNASEQVSAGAPSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEP  600
            G  +   +   A + +V  SE+KIW+Q+ A+R ++GY A+ + + ++ELKAL++ TGVEP
Sbjct  386  GITSENDIHLAASNVKVSYSEDKIWKQIRAVRTIVGYKASVRGTCIEELKALYVFTGVEP  445

Query  601  PSPFEDPSDLADVDEKLRLLMSIIGAK  681
            PS F DPSDLA+V++KL+ LM+I+G K
Sbjct  446  PSSFRDPSDLAEVNDKLKFLMTIVGVK  472



>ref|XP_010319808.1| PREDICTED: uncharacterized protein LOC101264922 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010319809.1| PREDICTED: uncharacterized protein LOC101264922 isoform X3 [Solanum 
lycopersicum]
Length=604

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 81/123 (66%), Gaps = 19/123 (15%)
 Frame = +1

Query  370  VLVKETQF-APE------TEKQGNGNNAS-------EQVS--AGAPSSEVM---VSEEKI  492
            V  KE Q  AP+      +E++GN +          +Q+S  AG P ++ +    SEEKI
Sbjct  482  VAAKEVQRKAPDDRGNLPSERKGNTDRKENAYAGGVDQISGRAGIPEAKPVKESFSEEKI  541

Query  493  WEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRLLMSII  672
            WE+M+A+R ++GYTAA Q  +VDELKAL+I TGVEPPS F +PS L +V++KL+ LMSI+
Sbjct  542  WEKMNAMRTIVGYTAATQPLLVDELKALYIFTGVEPPSMFSNPSTLEEVNDKLQFLMSIV  601

Query  673  GAK  681
            G K
Sbjct  602  GIK  604



>ref|XP_006350384.1| PREDICTED: ABC transporter F family member 4-like isoform X1 
[Solanum tuberosum]
 ref|XP_006350385.1| PREDICTED: ABC transporter F family member 4-like isoform X2 
[Solanum tuberosum]
Length=584

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 65/91 (71%), Gaps = 3/91 (3%)
 Frame = +1

Query  415  GNGNNASEQ--VSAGAPSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILT  588
            G  N  SE+  +    P+ E   SEEKIWE+M+A+R ++GYT A Q  +VDELKAL+I T
Sbjct  495  GGVNQVSERAGIPEAKPAKE-FSSEEKIWEKMNAMRTIVGYTVATQPLLVDELKALYIFT  553

Query  589  GVEPPSPFEDPSDLADVDEKLRLLMSIIGAK  681
            GVEPPS F +PS L +V++KL+ LMSI+G K
Sbjct  554  GVEPPSTFHNPSTLEEVNDKLQFLMSIVGIK  584



>ref|XP_010674689.1| PREDICTED: uncharacterized protein LOC104890795 [Beta vulgaris 
subsp. vulgaris]
Length=587

 Score = 94.4 bits (233),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  442  VSAGAPSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDP  621
            +   A S +V + EEKIWEQ++A+R ++GYT   Q S  +ELKAL++ TGVEPP+  ++P
Sbjct  508  IGTTAGSEKVKMEEEKIWEQINAMRTIVGYTTTRQPSYAEELKALYVFTGVEPPASSKNP  567

Query  622  SDLADVDEKLRLLMSIIGAK  681
            +DLAD++EKL  LMSI+G K
Sbjct  568  ADLADINEKLHFLMSIVGVK  587



>ref|XP_007029454.1| Uncharacterized protein TCM_025326 [Theobroma cacao]
 gb|EOY09956.1| Uncharacterized protein TCM_025326 [Theobroma cacao]
Length=238

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 62/82 (76%), Gaps = 3/82 (4%)
 Frame = +1

Query  445  SAGA---PSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFE  615
            +AGA    S+E + S+ K+WEQ++A+R ++GY AA + +  +ELKAL++ TG+EPP+ F+
Sbjct  157  AAGAIDKASNEALYSKAKVWEQINALRTIVGYEAARKETCTEELKALYLFTGIEPPASFK  216

Query  616  DPSDLADVDEKLRLLMSIIGAK  681
            D SD+ +V+ KLR LMS+IG K
Sbjct  217  DTSDVVEVNAKLRFLMSVIGVK  238



>gb|KDP23305.1| hypothetical protein JCGZ_23138 [Jatropha curcas]
Length=462

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +1

Query  451  GAPSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDL  630
            G  S+EV+ SE+ IW++++A+R ++GYT A   + ++ELKAL++ TGVEPP+ F++ SDL
Sbjct  386  GMASNEVLYSEKTIWKKINAMRKIVGYTTARHGTCIEELKALYVFTGVEPPASFKETSDL  445

Query  631  ADVDEKLRLLMSIIGAK  681
             +V++KLR LMSI+G K
Sbjct  446  VEVNDKLRFLMSIVGVK  462



>emb|CBI17668.3| unnamed protein product [Vitis vinifera]
Length=155

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  478  SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRL  657
            SEEKIWE++ A+R ++GY A    + V+ELKAL++ TGVEPP  F+DPSDL +V  +L+ 
Sbjct  88   SEEKIWERIDAMRAIVGYKAPSSRTCVEELKALYMFTGVEPPPSFKDPSDLMEVSSRLQF  147

Query  658  LMSIIGAK  681
            LMSI+G K
Sbjct  148  LMSIVGVK  155



>ref|XP_009590294.1| PREDICTED: FK506-binding protein 5-like isoform X1 [Nicotiana 
tomentosiformis]
Length=595

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 83/135 (61%), Gaps = 5/135 (4%)
 Frame = +1

Query  292  DTPSSMVDNENPLIGTEAKVEITTV-AVLVKETQFAPETEKQGNGNNASE-QVSAG---A  456
            D   S+   + P+   +A+ +   V   L  E +   + +K GN +  +     AG   A
Sbjct  461  DASRSVESKDKPVAAEDAQRKADGVHGNLPSERKGTTDQKKNGNASGVAHVPGRAGILDA  520

Query  457  PSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLAD  636
              ++   SEE IWE+++A+R ++GY AAPQ  +VDELKAL++ TGVEPPS F + S+LA+
Sbjct  521  KHTQEFFSEEIIWEKINAMRTIVGYGAAPQPLLVDELKALYVFTGVEPPSTFRNTSELAE  580

Query  637  VDEKLRLLMSIIGAK  681
            V++KL+ LMSI+G K
Sbjct  581  VNDKLQFLMSIVGIK  595



>ref|XP_008218419.1| PREDICTED: myb-like protein X [Prunus mume]
Length=587

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  469  VMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEK  648
            V+  E KIW Q+ A+R ++GY A P ++ ++ELKAL++ TGVEPP+ F D  DLA V++K
Sbjct  515  VLYDEAKIWRQIDAMRRIVGYKATPHATCIEELKALYLFTGVEPPASFGDHPDLAQVNDK  574

Query  649  LRLLMSIIGAK  681
            LR+LMSIIG K
Sbjct  575  LRILMSIIGVK  585



>ref|XP_010649268.1| PREDICTED: uncharacterized protein LOC100251233 isoform X2 [Vitis 
vinifera]
Length=517

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +1

Query  439  QVSAGAPSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFED  618
            ++ +   S+EV  SEEKIWE++ A+R ++GY A    + V+ELKAL++ TGVEPP  F+D
Sbjct  437  EIDSTVKSNEVPESEEKIWERIDAMRAIVGYKAPSSRTCVEELKALYMFTGVEPPPSFKD  496

Query  619  PSDLADVDEKLRLLMSIIGAK  681
            PSDL +V  +L+ LMSI+G K
Sbjct  497  PSDLMEVSSRLQFLMSIVGVK  517



>ref|XP_009796729.1| PREDICTED: eukaryotic translation initiation factor 5B-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009796731.1| PREDICTED: eukaryotic translation initiation factor 5B-like isoform 
X2 [Nicotiana sylvestris]
Length=592

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  478  SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRL  657
            SEE IWE+++A+R ++GY A PQ  +VDELKAL+I TGVEPPS F + S+LA+V++KL+ 
Sbjct  525  SEEIIWEKINAMRTIVGYGATPQPLLVDELKALYIFTGVEPPSTFRNTSELAEVNDKLQF  584

Query  658  LMSIIGAK  681
            LMSI+G K
Sbjct  585  LMSIVGIK  592



>gb|KHG06677.1| gdp-mannose transporter [Gossypium arboreum]
Length=651

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  454  APSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLA  633
            APS+E +  EEKIWEQM+A+R ++GY AA + + +DELKAL++ TG+EPP   +D  D A
Sbjct  576  APSNEAIHCEEKIWEQMNALRTIVGYKAARRETCIDELKALYVFTGIEPPPSLKDTCDPA  635

Query  634  DVDEKLRLLMSIIGAK  681
            +VD KL  L S++G +
Sbjct  636  EVDAKLGFLKSVVGVQ  651



>ref|XP_008388786.1| PREDICTED: uncharacterized protein LOC103451127 [Malus domestica]
Length=258

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +1

Query  457  PSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPS-PFEDPSDLA  633
            PS+ V+  E KIW ++ AIR ++GY   P ++ ++ELKAL++ TGVE P+  F DP DLA
Sbjct  180  PSNGVLYDETKIWAKIDAIRSIVGYKGTPHATCIEELKALYLFTGVEHPTVSFSDPPDLA  239

Query  634  DVDEKLRLLMSIIGAK  681
              + KLR LMSIIG K
Sbjct  240  QXNHKLRFLMSIIGVK  255



>emb|CAN81170.1| hypothetical protein VITISV_022560 [Vitis vinifera]
Length=532

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +1

Query  478  SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRL  657
            SEEKIWE++ A+R ++GY A    + V+ELKAL++ TGVEPPS F+DPSDL +V  +L+ 
Sbjct  465  SEEKIWERIHAMRAIVGYKAPTSRTCVEELKALYMFTGVEPPSSFKDPSDLMEVSSRLQF  524

Query  658  LMSIIGAK  681
            LMSI+G K
Sbjct  525  LMSIVGVK  532



>gb|KCW58731.1| hypothetical protein EUGRSUZ_H01377 [Eucalyptus grandis]
Length=467

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  481  EEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRLL  660
            EEK+W+Q+ A+R ++GY A  Q+S ++ELK+L+I TGVEPP  F+D SDL +V++KLR L
Sbjct  401  EEKLWQQIEAMRKIVGYKAKLQASCIEELKSLYIFTGVEPPDSFKDTSDLVEVNKKLRFL  460

Query  661  MSIIGAK  681
            MS++G K
Sbjct  461  MSVVGVK  467



>ref|XP_010070134.1| PREDICTED: uncharacterized protein LOC104456927 isoform X1 [Eucalyptus 
grandis]
Length=516

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  481  EEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRLL  660
            EEK+W+Q+ A+R ++GY A  Q+S ++ELK+L+I TGVEPP  F+D SDL +V++KLR L
Sbjct  450  EEKLWQQIEAMRKIVGYKAKLQASCIEELKSLYIFTGVEPPDSFKDTSDLVEVNKKLRFL  509

Query  661  MSIIGAK  681
            MS++G K
Sbjct  510  MSVVGVK  516



>ref|XP_010070135.1| PREDICTED: uncharacterized protein LOC104456927 isoform X2 [Eucalyptus 
grandis]
Length=511

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +1

Query  472  MVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKL  651
            +  EEK+W+Q+ A+R ++GY A  Q+S ++ELK+L+I TGVEPP  F+D SDL +V++KL
Sbjct  442  IYGEEKLWQQIEAMRKIVGYKAKLQASCIEELKSLYIFTGVEPPDSFKDTSDLVEVNKKL  501

Query  652  RLLMSIIGAK  681
            R LMS++G K
Sbjct  502  RFLMSVVGVK  511



>ref|XP_010649265.1| PREDICTED: uncharacterized protein LOC100251233 isoform X1 [Vitis 
vinifera]
 ref|XP_010649266.1| PREDICTED: uncharacterized protein LOC100251233 isoform X1 [Vitis 
vinifera]
 ref|XP_010649267.1| PREDICTED: uncharacterized protein LOC100251233 isoform X1 [Vitis 
vinifera]
Length=519

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  478  SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRL  657
            SEEKIWE++ A+R ++GY A    + V+ELKAL++ TGVEPP  F+DPSDL +V  +L+ 
Sbjct  452  SEEKIWERIDAMRAIVGYKAPSSRTCVEELKALYMFTGVEPPPSFKDPSDLMEVSSRLQF  511

Query  658  LMSIIGAK  681
            LMSI+G K
Sbjct  512  LMSIVGVK  519



>ref|XP_010649269.1| PREDICTED: uncharacterized protein LOC100251233 isoform X3 [Vitis 
vinifera]
Length=513

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  478  SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRL  657
            SEEKIWE++ A+R ++GY A    + V+ELKAL++ TGVEPP  F+DPSDL +V  +L+ 
Sbjct  446  SEEKIWERIDAMRAIVGYKAPSSRTCVEELKALYMFTGVEPPPSFKDPSDLMEVSSRLQF  505

Query  658  LMSIIGAK  681
            LMSI+G K
Sbjct  506  LMSIVGVK  513



>ref|XP_006850265.1| hypothetical protein AMTR_s00020p00091800 [Amborella trichopoda]
 gb|ERN11846.1| hypothetical protein AMTR_s00020p00091800 [Amborella trichopoda]
Length=175

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 61/99 (62%), Gaps = 1/99 (1%)
 Frame = +1

Query  388  QFAPETEKQGNGNNASEQVSAGAP-SSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDE  564
            Q    TE        SE +  G P S E + +EE IWEQ+ A+R ++GY     +S ++E
Sbjct  77   QSGAHTESIPGRKPKSESIPGGKPVSEEDLYNEEVIWEQIEAMRAIVGYKGVIHASCLEE  136

Query  565  LKALFILTGVEPPSPFEDPSDLADVDEKLRLLMSIIGAK  681
            LKAL++ TGVEP + F+D  DL ++++KLR L S++G K
Sbjct  137  LKALYVFTGVEPLASFKDTPDLMELNDKLRFLKSVVGVK  175



>ref|XP_010247699.1| PREDICTED: uncharacterized protein LOC104590675 [Nelumbo nucifera]
Length=827

 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +1

Query  445  SAGAPSSE-VMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDP  621
            S   PS+E V+ +EEKIW+Q+ AIR ++GY      S  +ELKAL++ TGVEPP+ F++ 
Sbjct  748  SKKVPSNEQVLCNEEKIWKQIYAIRKIVGYKEPLYPSCTEELKALYVFTGVEPPASFKES  807

Query  622  SDLADVDEKLRLLMSIIGAK  681
            SDL +V++KL+ LMSI+G K
Sbjct  808  SDLVEVNDKLQFLMSIVGVK  827



>gb|KEH42961.1| transmembrane protein, putative [Medicago truncatula]
Length=600

 Score = 85.5 bits (210),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +1

Query  454  APSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPF-EDPSDL  630
             PS EV  +EE IW+Q+  IR ++GY    Q+S  DELKAL+I TGVEPP+   E+P DL
Sbjct  519  CPSEEVSFNEENIWKQIHVIRTIIGYEGTIQASCADELKALYIFTGVEPPTFVKENPFDL  578

Query  631  ADVDEKLRLLMSIIGAK  681
             +++EKL  LMSI+G K
Sbjct  579  VEINEKLHFLMSIVGVK  595



>ref|XP_010111046.1| hypothetical protein L484_015100 [Morus notabilis]
 gb|EXC29908.1| hypothetical protein L484_015100 [Morus notabilis]
Length=377

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  478  SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRL  657
            SEEKIW Q+  +R ++GY A  Q + ++ELKAL+I TGVEPP+ F++PSDLA+V +KL+ 
Sbjct  310  SEEKIWGQIEGLRKIVGYKATIQKTSIEELKALYIFTGVEPPASFKEPSDLAEVVDKLQF  369

Query  658  LMSIIG  675
            L SIIG
Sbjct  370  LKSIIG  375



>gb|KEH42962.1| transmembrane protein, putative [Medicago truncatula]
Length=718

 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 54/77 (70%), Gaps = 1/77 (1%)
 Frame = +1

Query  454  APSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPF-EDPSDL  630
             PS EV  +EE IW+Q+  IR ++GY    Q+S  DELKAL+I TGVEPP+   E+P DL
Sbjct  637  CPSEEVSFNEENIWKQIHVIRTIIGYEGTIQASCADELKALYIFTGVEPPTFVKENPFDL  696

Query  631  ADVDEKLRLLMSIIGAK  681
             +++EKL  LMSI+G K
Sbjct  697  VEINEKLHFLMSIVGVK  713



>gb|KHN14783.1| hypothetical protein glysoja_020956 [Glycine soja]
Length=148

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 5/93 (5%)
 Frame = +1

Query  403  TEKQGNGNNASEQVSAGAPSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFI  582
             EK+      S   +   PS EV++ EE IW++M+ IR ++GY    Q+S  DELKAL++
Sbjct  57   VEKESRPYKCSSAENHVCPSQEVVLGEENIWKKMNMIRKIVGYEGRMQASCSDELKALYM  116

Query  583  LTGVEPPSPFEDPSDLADVDEKLRLLMSIIGAK  681
             TGVEPP+       LA++ EKL  LMSI G K
Sbjct  117  FTGVEPPT-----CSLAEIKEKLHFLMSIPGIK  144



>ref|XP_009337979.1| PREDICTED: uncharacterized protein LOC103930376 [Pyrus x bretschneideri]
Length=606

 Score = 81.6 bits (200),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +1

Query  460  SSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPS-PFEDPSDLAD  636
            S+ V+  E KI E++ A+R ++GY   P ++ ++ELKAL++ TGVEPP+  F DP DL  
Sbjct  529  SNGVLYDEAKIREKIGAVRSIVGYKGTPHATCIEELKALYLFTGVEPPTISFGDPRDLEQ  588

Query  637  VDEKLRLLMSIIGAK  681
            V+ KLR LMSIIG K
Sbjct  589  VNHKLRFLMSIIGVK  603



>ref|XP_004495546.1| PREDICTED: uncharacterized protein LOC101503497 [Cicer arietinum]
Length=610

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 57/80 (71%), Gaps = 4/80 (5%)
 Frame = +1

Query  454  APSSEVM---VSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPF-EDP  621
             PS E++    ++E IW+Q++ IR ++GY A  Q+S  DELKAL+I TGVEPP+   E+P
Sbjct  527  CPSEELLQVSFNKENIWKQINVIRKIIGYEATNQTSYADELKALYIFTGVEPPTFLKENP  586

Query  622  SDLADVDEKLRLLMSIIGAK  681
             D A+++EKL  LMSI+G K
Sbjct  587  FDPAEINEKLHFLMSIVGIK  606



>ref|XP_010553843.1| PREDICTED: uncharacterized protein LOC104823805 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010553844.1| PREDICTED: uncharacterized protein LOC104823805 isoform X1 [Tarenaya 
hassleriana]
Length=368

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 57/77 (74%), Gaps = 4/77 (5%)
 Frame = +1

Query  463  SEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSP----FEDPSDL  630
            SEV+ +EE+I E++ A+R ++GY AA   +  +EL+AL++ TGVEPPSP    F+D +D+
Sbjct  292  SEVVYNEEQIREKIDAVRTIVGYDAAKGKTCAEELRALYVFTGVEPPSPMSPSFDDSADV  351

Query  631  ADVDEKLRLLMSIIGAK  681
            A + ++LR LMS+IG K
Sbjct  352  AQISDRLRFLMSVIGIK  368



>ref|XP_003555554.1| PREDICTED: uncharacterized protein LOC100802932 isoform X1 [Glycine 
max]
 ref|XP_006606440.1| PREDICTED: uncharacterized protein LOC100802932 isoform X2 [Glycine 
max]
Length=559

 Score = 78.6 bits (192),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 5/78 (6%)
 Frame = +1

Query  454  APSSEVMV-SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPS-PFEDPSD  627
             PS EV+V  EEKIW+ M+ IR ++GY    Q S  DELKAL+I TGVEPP+   +DP  
Sbjct  481  CPSQEVVVLDEEKIWKAMNIIRKIVGYEGRMQGSCSDELKALYIFTGVEPPTGTLDDP--  538

Query  628  LADVDEKLRLLMSIIGAK  681
             A++ EKL  LMSI+G K
Sbjct  539  -AEIKEKLHFLMSIVGIK  555



>ref|XP_008787783.1| PREDICTED: FK506-binding protein 5-like [Phoenix dactylifera]
Length=351

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = +1

Query  382  ETQFAPETEKQGNGNNASE---QVSAGA----PSS-EVMVSEEKIWEQMSAIRGVLGYTA  537
            E Q A ET  +     ++E   +  AGA    PS  E + SEEKIWEQ+SA++ ++GY +
Sbjct  244  EDQSAVETTDEAKSECSAEHGPEAKAGAAVEQPSDDEGIYSEEKIWEQISALQTIVGYKS  303

Query  538  APQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRLLMSIIG  675
            A +SS V+EL+AL++ TGVEPP+  +DP D  +V++KL  L  ++G
Sbjct  304  ALRSSCVEELRALYLFTGVEPPASLKDPFDPLEVNDKLCFLKYLVG  349



>gb|KHN04973.1| hypothetical protein glysoja_013880 [Glycine soja]
Length=559

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 5/78 (6%)
 Frame = +1

Query  454  APSSEVMV-SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPS-PFEDPSD  627
             PS EV+V  EEKIW+ M+ IR ++GY    Q S  DELKAL+I TGVEPP+   +DP  
Sbjct  481  CPSQEVVVLDEEKIWKAMNIIRKIVGYEGRMQGSCSDELKALYIFTGVEPPTGTLDDP--  538

Query  628  LADVDEKLRLLMSIIGAK  681
             A++ EKL  LMSI+G K
Sbjct  539  -AEIKEKLHFLMSIVGIK  555



>ref|XP_009381888.1| PREDICTED: uncharacterized protein LOC103969983 [Musa acuminata 
subsp. malaccensis]
Length=232

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  481  EEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRLL  660
            ++ IWE++SA+R ++GY  A +SS V+EL+AL+I TGVEPP   +DPS++ ++ +KLR L
Sbjct  166  KDMIWEEISALRTIMGYRDALRSSTVEELRALYIFTGVEPPISLKDPSNMMEIQDKLRFL  225

Query  661  MSIIGAK  681
              ++G K
Sbjct  226  KLLVGVK  232



>gb|AAT08670.1| unknown [Hyacinthus orientalis]
Length=88

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +1

Query  466  EVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDE  645
            EV  SEE +WEQ+ AIR ++GY  A    + DELKA+ I  GVEPP   ED SD+  + E
Sbjct  17   EVFYSEEIMWEQVHAIRTIIGYRDALHPILADELKAICIFIGVEPPVSLEDASDIMQIGE  76

Query  646  KLRLLMSIIGAK  681
             L+ L  +IG K
Sbjct  77   MLKFLKWVIGVK  88



>ref|XP_007143985.1| hypothetical protein PHAVU_007G119300g [Phaseolus vulgaris]
 gb|ESW15979.1| hypothetical protein PHAVU_007G119300g [Phaseolus vulgaris]
Length=108

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = +1

Query  454  APSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPS-DL  630
             P  +V++ +E +W+Q++ IR ++GY    ++S  DELKAL+I TGVEPP+   + S   
Sbjct  28   VPFGQVVLEDENLWKQINVIRKIVGYEGRKEASCADELKALYIFTGVEPPTSLHENSIHP  87

Query  631  ADVDEKLRLLMSIIGAK  681
             ++ EKL+ LM I+G K
Sbjct  88   LEIKEKLQFLMCILGIK  104



>ref|NP_001185316.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE34330.1| uncharacterized protein AT1G65090 [Arabidopsis thaliana]
Length=288

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 7/105 (7%)
 Frame = +1

Query  382  ETQFAPETEKQGNGNNASEQVSAGAPSSEV----MVSEEKIWEQMSAIRGVLGYTAAPQS  549
            E + APET ++G       + S G    E+    + SEE++WE M  +R V+GY+ A  +
Sbjct  182  EKREAPETRREGETGATKIETSTGKDDEEISSNEVYSEEQLWETMETLRKVVGYSVARSA  241

Query  550  SIVDELKALFILTG-VEPP--SPFEDPSDLADVDEKLRLLMSIIG  675
            +  +ELKAL++ TG VEPP  S  +D  D+A +  +LR LMS+IG
Sbjct  242  TCAEELKALYVFTGVVEPPRSSLNQDTYDIAHLTIRLRFLMSVIG  286



>ref|XP_008370920.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103434365 
[Malus domestica]
Length=606

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +1

Query  469  VMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPS-PFEDPSDLADVDE  645
            V+  + KI E++ A+R ++GY   P ++ ++ELKAL++ TGVE P+  F DP DL  V+ 
Sbjct  532  VLYDDAKIREKIGAMRSIVGYKGTPHATCIEELKALYLFTGVELPTISFSDPPDLEQVNH  591

Query  646  KLRLLMSIIGAK  681
            KLR LMSIIG K
Sbjct  592  KLRFLMSIIGVK  603



>gb|AAF06044.1|AC009360_9 This gene is cut off, partial [Arabidopsis thaliana]
Length=73

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +1

Query  478  SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTG-VEPP--SPFEDPSDLADVDEK  648
            SEE++WE M  +R V+GY+ A  ++  +ELKAL++ TG VEPP  S  +D  D+A +  +
Sbjct  3    SEEQLWETMETLRKVVGYSVARSATCAEELKALYVFTGVVEPPRSSLNQDTYDIAHLTIR  62

Query  649  LRLLMSIIG  675
            LR LMS+IG
Sbjct  63   LRFLMSVIG  71



>ref|XP_010435485.1| PREDICTED: uncharacterized protein LOC104719297 [Camelina sativa]
 ref|XP_010435486.1| PREDICTED: uncharacterized protein LOC104719297 [Camelina sativa]
 ref|XP_010435487.1| PREDICTED: uncharacterized protein LOC104719297 [Camelina sativa]
Length=294

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 67/116 (58%), Gaps = 10/116 (9%)
 Frame = +1

Query  328  LIGTEAKVEITTVAVLVKETQFAPETEKQGNGNNASEQVSAGAPSSEVMVSEEKIWEQMS  507
            L+GT+       V++   E +  P T K   G +     +A     + + SEE+IW ++ 
Sbjct  187  LLGTKQ------VSMTRHEGEPKPTTTKAARGKDMENSSTA----VKTLYSEEQIWTKIE  236

Query  508  AIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRLLMSIIG  675
            A+R V+GY+AA  ++ ++ELKAL++ TGVE P+   +  D+A V E L  LM++IG
Sbjct  237  ALRKVVGYSAARSTTYLEELKALYMFTGVEMPTSTLENQDIAKVTEGLSFLMTVIG  292



>ref|XP_006286125.1| hypothetical protein CARUB_v10007675mg [Capsella rubella]
 gb|EOA19023.1| hypothetical protein CARUB_v10007675mg [Capsella rubella]
Length=290

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 57/90 (63%), Gaps = 7/90 (8%)
 Frame = +1

Query  412  QGNGNNASEQVSAGAPSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTG  591
            +G+ NN+S  V A       + SEE+IW ++ A+R V+GY+ A  ++  +ELKAL++ TG
Sbjct  208  RGDVNNSSTVVKA-------LYSEEQIWSKIEALRKVVGYSVARSTTYSEELKALYMFTG  260

Query  592  VEPPSPFEDPSDLADVDEKLRLLMSIIGAK  681
            VE P+   +  D+A V E L  L+S+IG K
Sbjct  261  VELPTSMLEDQDIAKVSEGLSFLISVIGIK  290



>emb|CDY16388.1| BnaA02g11920D [Brassica napus]
Length=314

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 53/76 (70%), Gaps = 4/76 (5%)
 Frame = +1

Query  460  SSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTG-VEPPSPF---EDPSD  627
            +SE + SEEKIWE+M  +R V+GY+ A  ++  +ELKAL++ TG VEPP      +D  D
Sbjct  237  NSESVYSEEKIWEKMEELRKVVGYSVARSATYAEELKALYVFTGVVEPPQSSLMNQDSHD  296

Query  628  LADVDEKLRLLMSIIG  675
            +A+V  +LR LMS+IG
Sbjct  297  IANVCVRLRFLMSVIG  312



>ref|XP_010440782.1| PREDICTED: uncharacterized protein LOC104724030 [Camelina sativa]
Length=294

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 66/116 (57%), Gaps = 10/116 (9%)
 Frame = +1

Query  328  LIGTEAKVEITTVAVLVKETQFAPETEKQGNGNNASEQVSAGAPSSEVMVSEEKIWEQMS  507
            L+GT+       V++   E +    T K   G +     +A     + + SEE+IW ++ 
Sbjct  187  LLGTKQ------VSMTRHEGELKSTTTKAARGKDMENSSTA----VKALYSEEQIWTKIE  236

Query  508  AIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRLLMSIIG  675
            A+R V+GY+AA  ++ ++ELKAL++ TGVE P+   +  D+A V E L  LMS+IG
Sbjct  237  ALRKVVGYSAARSTTYLEELKALYMFTGVEMPTSTLENQDIAKVTEGLSFLMSVIG  292



>ref|XP_009127384.1| PREDICTED: uncharacterized protein LOC103852216 isoform X1 [Brassica 
rapa]
Length=275

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = +1

Query  460  SSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTG-VEPPSPF---EDPSD  627
            SS  + SEEKIWE+M  +R V+GY+ A  ++  +ELKAL++ TG VEPP      +D  D
Sbjct  198  SSNEVYSEEKIWEKMEELRKVVGYSVARSATYAEELKALYVFTGVVEPPQSSLMNQDSHD  257

Query  628  LADVDEKLRLLMSIIG  675
            +A+V  +LR LMS+IG
Sbjct  258  IANVCVRLRFLMSVIG  273



>ref|XP_010496609.1| PREDICTED: uncharacterized protein LOC104773659 isoform X2 [Camelina 
sativa]
Length=284

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 72/135 (53%), Gaps = 14/135 (10%)
 Frame = +1

Query  292  DTPSSMVDNENPLIGTEAKVE----ITTVAVLVKETQFAPETEKQGNGN---NASEQVSA  450
            D   S+V  E       A++E       V++   E +    T K   G    N+S  V A
Sbjct  155  DKDQSIVPGEAKSENVRARLEDLLGTKQVSMTRHEGELKSTTTKASRGKDMENSSTVVKA  214

Query  451  GAPSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDL  630
                   + SEE+IW ++ A+R V+GY+AA +++ ++ELKAL++ TGVE P+   +  D+
Sbjct  215  -------LYSEEQIWTKIEALRKVVGYSAARRTTYLEELKALYMFTGVEMPTSTLENQDI  267

Query  631  ADVDEKLRLLMSIIG  675
            A V E L  LMS+IG
Sbjct  268  AKVTEGLSFLMSVIG  282



>ref|XP_010496605.1| PREDICTED: uncharacterized protein LOC104773659 isoform X1 [Camelina 
sativa]
 ref|XP_010496607.1| PREDICTED: uncharacterized protein LOC104773659 isoform X1 [Camelina 
sativa]
 ref|XP_010496608.1| PREDICTED: uncharacterized protein LOC104773659 isoform X1 [Camelina 
sativa]
Length=294

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 72/135 (53%), Gaps = 14/135 (10%)
 Frame = +1

Query  292  DTPSSMVDNENPLIGTEAKVE----ITTVAVLVKETQFAPETEKQGNGN---NASEQVSA  450
            D   S+V  E       A++E       V++   E +    T K   G    N+S  V A
Sbjct  165  DKDQSIVPGEAKSENVRARLEDLLGTKQVSMTRHEGELKSTTTKASRGKDMENSSTVVKA  224

Query  451  GAPSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDL  630
                   + SEE+IW ++ A+R V+GY+AA +++ ++ELKAL++ TGVE P+   +  D+
Sbjct  225  -------LYSEEQIWTKIEALRKVVGYSAARRTTYLEELKALYMFTGVEMPTSTLENQDI  277

Query  631  ADVDEKLRLLMSIIG  675
            A V E L  LMS+IG
Sbjct  278  AKVTEGLSFLMSVIG  292



>emb|CDX91523.1| BnaC02g16370D [Brassica napus]
Length=316

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +1

Query  469  VMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTG-VEPPSPF---EDPSDLAD  636
            ++ SEEKIWE+M  +R V+GY+ A  ++  +ELKAL++ TG VEPP      +D  D+A+
Sbjct  242  LVYSEEKIWEKMEVLRKVVGYSVARSATFAEELKALYVFTGVVEPPQSSLINQDSHDIAN  301

Query  637  VDEKLRLLMSIIG  675
            V  +LR LMS+IG
Sbjct  302  VCVRLRFLMSVIG  314



>ref|NP_198459.4| uncharacterized protein [Arabidopsis thaliana]
 gb|AED94043.1| uncharacterized protein AT5G36100 [Arabidopsis thaliana]
Length=295

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 55/94 (59%), Gaps = 0/94 (0%)
 Frame = +1

Query  400  ETEKQGNGNNASEQVSAGAPSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALF  579
            E E +   +  S +      S+ V+ SEE+IW ++ A+R V+GY     ++  +ELKAL+
Sbjct  202  EGELESTTSKTSREKDMEISSTTVLYSEEQIWTKIEALRKVVGYNVTRSTTYSEELKALY  261

Query  580  ILTGVEPPSPFEDPSDLADVDEKLRLLMSIIGAK  681
            + TGVE P+   +  D+A V E L  LMS+IG K
Sbjct  262  MFTGVELPTSTLENQDIAKVSEGLSFLMSVIGIK  295



>gb|EYU39696.1| hypothetical protein MIMGU_mgv1a003144mg [Erythranthe guttata]
Length=605

 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 4/82 (5%)
 Frame = +1

Query  448  AGAPSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPF---ED  618
            A   S E M  EE+IW+++ AIR ++G+ A  ++S  +ELKA++I TG+EPPS       
Sbjct  524  ASGDSVEGMRDEEEIWKKIDAIRVIVGFKAPRRASYFEELKAMYIFTGIEPPSDLTMDHS  583

Query  619  PSDL-ADVDEKLRLLMSIIGAK  681
             SD  AD   KLR LMS+IG K
Sbjct  584  SSDSGADFRNKLRFLMSVIGLK  605



>ref|XP_006301457.1| hypothetical protein CARUB_v10021879mg [Capsella rubella]
 gb|EOA34355.1| hypothetical protein CARUB_v10021879mg [Capsella rubella]
Length=291

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 59/101 (58%), Gaps = 8/101 (8%)
 Frame = +1

Query  397  PETEKQGNGNNASEQVSAGAP----SSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDE  564
            PET ++G   +   + S G      SS  + SE++IWE+M A+R V+GY+ A  ++  +E
Sbjct  189  PETGREGELGSTKTETSTGKDDEETSSNEVYSEDQIWEKMEALRKVVGYSVARSATYAEE  248

Query  565  LKALFILTGVEPPSPFE----DPSDLADVDEKLRLLMSIIG  675
            L+AL++ TGV  PS       D  D+A V  +LR LMS IG
Sbjct  249  LQALYVFTGVVEPSRSSLNQLDTHDIAYVSLRLRFLMSAIG  289



>ref|XP_006395921.1| hypothetical protein EUTSA_v10005424mg [Eutrema salsugineum]
 gb|ESQ33207.1| hypothetical protein EUTSA_v10005424mg [Eutrema salsugineum]
Length=285

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = +1

Query  466  EVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVE-PPSPFEDPSDLADVD  642
            +V+ SEE+IW +M A+R ++GY+ A  ++  +ELKAL++ TGVE P S  E+  D++ V 
Sbjct  213  KVLFSEEQIWAKMEALRKIVGYSVARSTTYSEELKALYMFTGVELPTSMVEENQDVSQVS  272

Query  643  EKLRLLMSIIG  675
            E+L  LMS+IG
Sbjct  273  ERLCFLMSVIG  283



>ref|XP_004171328.1| PREDICTED: uncharacterized protein LOC101232333 [Cucumis sativus]
 gb|KGN65973.1| hypothetical protein Csa_1G555090 [Cucumis sativus]
Length=395

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 60/96 (63%), Gaps = 6/96 (6%)
 Frame = +1

Query  400  ETEKQGNGNNASEQVSAGAPSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALF  579
            E + + N  +  ++VSA    +E + SE KI E + +++ ++GY A P  + +DE+ AL+
Sbjct  304  EPKVEANAPHKDDRVSA----NEELASELKIRENIVSMKKIIGYNATPIGTYIDEVNALY  359

Query  580  ILTGVEPPSPFEDPS--DLADVDEKLRLLMSIIGAK  681
               GVEPP+P +D S  DL  + +KL+ LMSI+G K
Sbjct  360  SFVGVEPPTPLKDSSSDDLNLLSQKLQFLMSIVGVK  395



>ref|XP_002888307.1| hypothetical protein ARALYDRAFT_338601 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64566.1| hypothetical protein ARALYDRAFT_338601 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +1

Query  478  SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTG-VEPP--SPFEDPSDLADVDEK  648
            SEE+IWE+M  +R V+GY+ A  ++  +ELKAL++ TG VEPP  S   D  D+A +  +
Sbjct  256  SEEQIWEKMETLRKVVGYSVASSATCAEELKALYVFTGVVEPPHSSLNHDTHDIAHLTIR  315

Query  649  LRLLMSIIG  675
            LR LMS+IG
Sbjct  316  LRFLMSVIG  324



>ref|XP_008459103.1| PREDICTED: uncharacterized protein LOC103498312 [Cucumis melo]
Length=390

 Score = 66.2 bits (160),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 9/90 (10%)
 Frame = +1

Query  439  QVSAGAP-------SSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVE  597
            +V A AP       S+E + SE KI E + +++ ++GY   P  + +DE+ AL+ L GVE
Sbjct  301  KVEANAPRKDDRVSSNEDLASELKIRENIVSMKKIIGYNTTPIGTYIDEVNALYSLVGVE  360

Query  598  PPSPFEDPS--DLADVDEKLRLLMSIIGAK  681
            PP+P +D S  DL  + ++L+ LMSI+G K
Sbjct  361  PPTPLKDSSDDDLNLLSQRLQFLMSIVGVK  390



>ref|NP_001154447.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE34329.1| uncharacterized protein AT1G65090 [Arabidopsis thaliana]
Length=379

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +1

Query  478  SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTG-VEPP--SPFEDPSDLADVDEK  648
            SEE++WE M  +R V+GY+ A  ++  +ELKAL++ TG VEPP  S  +D  D+A +  +
Sbjct  309  SEEQLWETMETLRKVVGYSVARSATCAEELKALYVFTGVVEPPRSSLNQDTYDIAHLTIR  368

Query  649  LRLLMSIIG  675
            LR LMS+IG
Sbjct  369  LRFLMSVIG  377



>emb|CDY37644.1| BnaC04g29860D [Brassica napus]
Length=276

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = +1

Query  466  EVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPF---EDPSDLAD  636
            +V+ +EE+IW +M A+R ++GY+ A  ++  +ELKAL++  GVE P+     ++  D+A 
Sbjct  202  KVLYNEEQIWAKMEALRKIVGYSVARSTTYSEELKALYMFMGVELPTLMMLEKENQDIAH  261

Query  637  VDEKLRLLMSIIGAK  681
            V E+L +L+S+IG K
Sbjct  262  VSERLCVLLSVIGIK  276



>emb|CDX74621.1| BnaA04g07680D [Brassica napus]
Length=281

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = +1

Query  466  EVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPF---EDPSDLAD  636
            +V+ +EE+IW +M A+R ++GY+ A  ++  +ELKAL++  GVE P+     ++  D+A 
Sbjct  207  KVLYNEEQIWAKMEALRKIVGYSVARSTTYSEELKALYMFMGVELPTLMMLEKENQDIAH  266

Query  637  VDEKLRLLMSIIGAK  681
            V E+L +L+S+IG K
Sbjct  267  VSERLCVLLSVIGIK  281



>ref|XP_010511394.1| PREDICTED: uncharacterized protein LOC104787494 isoform X1 [Camelina 
sativa]
Length=297

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = +1

Query  460  SSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFE----DPSD  627
            SS  + SE++IWE+M A+R V+GY+    +S  +EL+AL++ TGV  P        D  D
Sbjct  220  SSNEVYSEDQIWEKMEALRKVVGYSVTRSASYAEELQALYVFTGVVEPRRSSLNQLDTHD  279

Query  628  LADVDEKLRLLMSIIG  675
            +A V  +LR LMS IG
Sbjct  280  IAHVSLRLRFLMSAIG  295



>ref|XP_009124239.1| PREDICTED: uncharacterized protein LOC103849184 [Brassica rapa]
 ref|XP_009124241.1| PREDICTED: uncharacterized protein LOC103849184 [Brassica rapa]
 ref|XP_009124242.1| PREDICTED: uncharacterized protein LOC103849184 [Brassica rapa]
 ref|XP_009124243.1| PREDICTED: uncharacterized protein LOC103849184 [Brassica rapa]
Length=300

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = +1

Query  466  EVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPF---EDPSDLAD  636
            +V+ +EE+IW +M A+R ++GY+ A  ++  +ELKAL++  GVE P+     ++  D+A 
Sbjct  226  KVLYNEEQIWAKMEALRKIVGYSVARSTTYSEELKALYMFMGVELPTLMMLEKENQDIAH  285

Query  637  VDEKLRLLMSIIGAK  681
            V E+L +L+S+IG K
Sbjct  286  VSERLCVLLSVIGIK  300



>ref|XP_010415048.1| PREDICTED: uncharacterized protein LOC104701107 isoform X1 [Camelina 
sativa]
Length=287

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 54/100 (54%), Gaps = 8/100 (8%)
 Frame = +1

Query  400  ETEKQGNGNNASEQVSAGA----PSSEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDEL  567
            ET ++G       + S G      SS  + SE +IWE+M A+R V+GY+    +S  +EL
Sbjct  186  ETGREGELGATKTETSTGKDDEETSSNEVYSEVQIWEKMEALRKVVGYSVTRSASYAEEL  245

Query  568  KALFILTGVEPPSPFE----DPSDLADVDEKLRLLMSIIG  675
            +AL++ TGV  P        D  D+A V  +LR LMS IG
Sbjct  246  QALYVFTGVVEPRRSSLNQLDTHDIAHVSLRLRFLMSAIG  285



>ref|XP_002458843.1| hypothetical protein SORBIDRAFT_03g041320 [Sorghum bicolor]
 gb|EES03963.1| hypothetical protein SORBIDRAFT_03g041320 [Sorghum bicolor]
Length=842

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = +1

Query  478  SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRL  657
            +EE++ EQ+  +R + GY   P  ++  EL  L+I  GVEPP    D SDL D++ KLR 
Sbjct  775  TEEQLREQLDTLRTITGYRPTPSLTLEAELVGLYIFVGVEPPVSSRDESDLNDLNTKLRF  834

Query  658  LMSIIGAK  681
            L SIIG +
Sbjct  835  LKSIIGVE  842



>ref|XP_006590166.1| PREDICTED: uncharacterized protein LOC102665739 [Glycine max]
Length=521

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (70%), Gaps = 3/56 (5%)
 Frame = +1

Query  454  APSSE---VMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPF  612
             PS E   V++ EE IW++M+ IR ++GY    Q+S  DELKAL++ TGVEPP+ F
Sbjct  464  CPSQELLQVVLGEENIWKKMNMIRKIVGYEGRMQASCSDELKALYMFTGVEPPNLF  519



>ref|NP_001066840.2| Os12g0506700 [Oryza sativa Japonica Group]
 gb|ABA98684.2| expressed protein [Oryza sativa Japonica Group]
 gb|EEE53275.1| hypothetical protein OsJ_36222 [Oryza sativa Japonica Group]
 dbj|BAF29859.2| Os12g0506700 [Oryza sativa Japonica Group]
Length=477

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +1

Query  400  ETEKQGNGNNASEQVSAGAPSSEV-MVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKAL  576
            ET + G  ++ S+   A   S +  + +EE + +Q+  +R + GY +   S++  EL AL
Sbjct  383  ETSQPGQEHDQSDGFEAKVISGDKDLYTEEHVRQQLETLRTITGYRSPFSSTLEGELAAL  442

Query  577  FILTGVEPPSPFEDPSDLADVDEKLRLLMSIIG  675
            ++  GVEPP    + SDL +++ KLRLL SI+G
Sbjct  443  YLFIGVEPPVSSRNASDLMEINAKLRLLKSIVG  475



>dbj|BAK06701.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1053

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +1

Query  463   SEVMVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSD-LADV  639
             SE   +EE++ EQ+  IR + GY A P S++  E+  L++  GVEPP+   D SD L  +
Sbjct  980   SEAPYTEEQLREQLDTIRTITGYGAVPSSTLEGEMAGLYVFVGVEPPAGSSDTSDRLMAL  1039

Query  640   DEKLRLLMSIIG  675
               +LR L SIIG
Sbjct  1040  SAELRFLKSIIG  1051



>ref|XP_008657019.1| PREDICTED: uncharacterized protein LOC103636442 isoform X1 [Zea 
mays]
 gb|AFW84441.1| hypothetical protein ZEAMMB73_341836 [Zea mays]
Length=674

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = +1

Query  478  SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPP--SPFEDPSDLADVDEKL  651
            +EE++ EQ+ A+R + GY   P  ++  EL  L++  GVEPP  S   + SDL+D+  KL
Sbjct  605  TEEQMREQLDALRTITGYRPTPSLTLEAELVGLYVFVGVEPPVGSGSREDSDLSDLSAKL  664

Query  652  RLLMSIIG  675
            RLL SIIG
Sbjct  665  RLLKSIIG  672



>gb|EEC69344.1| hypothetical protein OsI_38454 [Oryza sativa Indica Group]
Length=480

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +1

Query  400  ETEKQGNGNNASEQVSAGAPSSEV-MVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKAL  576
            ET + G   + S+   A   S +  + +EE + +Q+  +R + GY +   S++  EL AL
Sbjct  386  ETSQPGQERDQSDGFEAKVISGDKDLYTEEHVRQQLETLRTITGYRSPFSSTLEGELAAL  445

Query  577  FILTGVEPPSPFEDPSDLADVDEKLRLLMSIIG  675
            ++  GVEPP    + SDL +++ KLRLL SI+G
Sbjct  446  YLFIGVEPPVSSRNASDLMEINAKLRLLKSIVG  478



>ref|XP_008657020.1| PREDICTED: uncharacterized protein LOC103636442 isoform X2 [Zea 
mays]
Length=669

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = +1

Query  478  SEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPP--SPFEDPSDLADVDEKL  651
            +EE++ EQ+ A+R + GY   P  ++  EL  L++  GVEPP  S   + SDL+D+  KL
Sbjct  600  TEEQMREQLDALRTITGYRPTPSLTLEAELVGLYVFVGVEPPVGSGSREDSDLSDLSAKL  659

Query  652  RLLMSIIG  675
            RLL SIIG
Sbjct  660  RLLKSIIG  667



>ref|XP_011084641.1| PREDICTED: uncharacterized protein LOC105166848 isoform X2 [Sesamum 
indicum]
Length=593

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 3/116 (3%)
 Frame = +1

Query  334  GTEAKVEITTVAVLVKETQFAPETEKQGNGNNASEQVSAGAPSSEVMVSEEKIWEQMSAI  513
            G   +V   T    +K  + AP   ++G    A     +G  S E +  +E IW+++ AI
Sbjct  481  GYSVEVAAITGTPALKHDEAAPVELEEGKDAGAG---YSGLHSDEELSRDEDIWKKIDAI  537

Query  514  RGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRLLMSIIGAK  681
            R ++G+ A  + S V+ELKAL++ TG+EPPS   D SD      KL  LMS+IG K
Sbjct  538  RVIVGFNAPRRVSYVEELKALYLFTGIEPPSSSMDSSDTLQFSNKLNFLMSVIGLK  593



>ref|XP_011084640.1| PREDICTED: uncharacterized protein LOC105166848 isoform X1 [Sesamum 
indicum]
Length=597

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 3/116 (3%)
 Frame = +1

Query  334  GTEAKVEITTVAVLVKETQFAPETEKQGNGNNASEQVSAGAPSSEVMVSEEKIWEQMSAI  513
            G   +V   T    +K  + AP   ++G    A     +G  S E +  +E IW+++ AI
Sbjct  485  GYSVEVAAITGTPALKHDEAAPVELEEGKDAGAG---YSGLHSDEELSRDEDIWKKIDAI  541

Query  514  RGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRLLMSIIGAK  681
            R ++G+ A  + S V+ELKAL++ TG+EPPS   D SD      KL  LMS+IG K
Sbjct  542  RVIVGFNAPRRVSYVEELKALYLFTGIEPPSSSMDSSDTLQFSNKLNFLMSVIGLK  597



>ref|XP_004959655.1| PREDICTED: uncharacterized protein LOC101756991 [Setaria italica]
Length=719

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +1

Query  481  EEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTGVEPPSPFEDPSDLADVDEKLRLL  660
            E ++ EQ+  +R + GY  A   ++  EL  L+I  GVEPP    D SDL +++ KL+ L
Sbjct  653  EVQLREQLDTLRTITGYRPATSLTLEAELAGLYIFVGVEPPVSSRDSSDLIEINLKLQFL  712

Query  661  MSIIGAK  681
             SIIG +
Sbjct  713  KSIIGVE  719



>gb|AAD26867.1|AC007230_1 T23K8.1, partial [Arabidopsis thaliana]
Length=309

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = +1

Query  472  MVSEEKIWEQMSAIRGVLGYTAAPQSSIVDELKALFILTG-VEPP  603
            + SEE++WE M  +R V+GY+ A  ++  +ELKAL++ TG VEPP
Sbjct  262  VYSEEQLWETMETLRKVVGYSVARSATCAEELKALYVFTGVVEPP  306



Lambda      K        H        a         alpha
   0.317    0.133    0.385    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2171042290025