BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17362_g1_i1 len=602 path=[451:0-416 868:417-601]

Length=602
                                                                      Score     E

ref|XP_011082846.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    226   9e-67   
gb|AEH41591.1|  9-cis-epoxycarotenoid dioxygenase 1                     226   1e-66   
ref|NP_001275103.1|  9-cis-epoxy-carotenoid dioxygenase 1               224   5e-66   
emb|CAB76920.1|  putative 9-cis-epoxycarotenoid dioxygenase             224   6e-66   Solanum tuberosum [potatoes]
emb|CDP06103.1|  unnamed protein product                                224   1e-65   
gb|ABA43901.1|  9-cis-epoxycarotenoid dioxygenase 3                     224   1e-65   Coffea canephora [robusta coffee]
gb|AIY62759.1|  9-cis epoxycarotenoid dioxygenase                       222   4e-65   
gb|AFO85470.1|  9-cis-epoxy-carotenoid dioxygenase                      222   4e-65   
gb|ACL00683.2|  9-cis-epoxycarotenoid dioxygenase 2                     218   5e-65   Solanum lycopersicum
ref|NP_001234455.1|  nine-cis-epoxycarotenoid dioxygenase               222   5e-65   
gb|AIX87507.1|  9-cis-epoxycarotenoid dioxygenase 1                     222   6e-65   
gb|AIX87531.1|  9-cis-epoxycarotenoid dioxygenase 1                     222   6e-65   
gb|EYU38203.1|  hypothetical protein MIMGU_mgv1a003133mg                221   7e-65   
gb|ABB52079.1|  putative 9-cis epoxycarotenoid dioxygenase              221   8e-65   Daucus carota subsp. sativus
gb|AGN03861.1|  9-cis epoxycarotenoid dioxygenase                       221   9e-65   
ref|XP_004244807.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    219   4e-64   
ref|XP_009603531.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    218   9e-64   
gb|AFP57678.1|  9-cis-epoxycarotenoid dioxygenase 3 protein famil...    218   1e-63   
ref|XP_009804376.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    218   1e-63   
gb|ABB52080.1|  putative 9-cis epoxycarotenoid dioxygenase              218   1e-63   Daucus carota subsp. sativus
ref|NP_001274963.1|  9-cis-epoxy-carotenoid dioxygenase 2               217   2e-63   
gb|KDP37985.1|  hypothetical protein JCGZ_04628                         216   6e-63   
gb|AEK99070.1|  9-cis-epoxycarotenoid dioxygenase                       212   7e-63   
ref|XP_002519665.1|  9-cis-epoxycarotenoid dioxygenase, putative        216   8e-63   Ricinus communis
gb|AAY82458.1|  9-cis-epoxycarotenoid dioxygenase 1                     215   2e-62   Cuscuta reflexa [giant dodder]
gb|AFP57677.1|  9-cis-epoxycarotenoid dioxygenase 3 protein famil...    215   2e-62   
ref|XP_009615476.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    215   2e-62   
ref|XP_009797946.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    214   4e-62   
dbj|BAE72091.1|  Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 2     214   4e-62   Lactuca sativa [cultivated lettuce]
ref|XP_011098124.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    214   6e-62   
ref|XP_010694572.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    213   7e-62   
gb|AFM77567.1|  9-cis-epoxycarotenoid dioxygenase                       209   9e-62   
ref|XP_004300667.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    213   9e-62   
dbj|BAF36657.2|  putative 9-cis-epoxycarotenoid dioxygenase             213   1e-61   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|KHN26771.1|  9-cis-epoxycarotenoid dioxygenase NCED1, chloropl...    205   2e-61   
gb|ACH58414.1|  9-cis-epoxycarotenoid dioxygenase                       199   2e-61   Prunus dulcis [sweet almond]
gb|KDO50508.1|  hypothetical protein CISIN_1g007379mg                   212   3e-61   
ref|XP_011096581.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    211   6e-61   
dbj|BAE72092.1|  Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 3     210   9e-61   Lactuca sativa [cultivated lettuce]
gb|ACU86971.1|  9-cis-epoxycarotenoid dioxygenase                       209   2e-60   Caragana korshinskii
ref|XP_008382970.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    209   2e-60   
ref|XP_006442236.1|  hypothetical protein CICLE_v10019364mg             209   2e-60   
gb|ADQ74072.1|  9-cis-epoxycarotenoid dioxygenase                       209   2e-60   
ref|XP_006449708.1|  hypothetical protein CICLE_v10014639mg             209   3e-60   
gb|AAS47838.1|  9-cis-epoxycarotenoid dioxygenase                       209   3e-60   Gentiana lutea
gb|KDO78199.1|  hypothetical protein CISIN_1g007291mg                   209   4e-60   
ref|XP_007214657.1|  hypothetical protein PRUPE_ppa002804mg             209   4e-60   
ref|XP_009783401.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    209   4e-60   
ref|XP_007022180.1|  Nine-cis-epoxycarotenoid dioxygenase 3             209   4e-60   
emb|CBI32922.3|  unnamed protein product                                206   5e-60   
gb|ADN65136.1|  9-cis-epoxycarotenoid dioxygenase                       204   7e-60   
gb|AEK99289.1|  9-cis-epoxycarotenoid dioxygenase                       204   8e-60   
gb|AAY98512.2|  9-cis-epoxycarotenoid dioxygenase                       208   8e-60   Stylosanthes guianensis [stylo]
ref|XP_009367762.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    208   1e-59   
ref|NP_001275864.1|  putative 9-cis-epoxycarotenoid dioxygenase 3       207   1e-59   
ref|NP_001275868.1|  9-cis-epoxycarotenoid dioxygenase 2                207   1e-59   
ref|XP_008226239.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    207   2e-59   
gb|AGV54468.1|  9-cis-epoxycarotenoid dioxygenase                       207   2e-59   
dbj|BAE72090.1|  Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 1     206   3e-59   Lactuca sativa [cultivated lettuce]
gb|ADQ74055.1|  9-cis-epoxycarotenoid dioxygenase                       206   3e-59   
ref|XP_010247741.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    206   3e-59   
gb|ADQ74052.1|  9-cis-epoxycarotenoid dioxygenase                       206   3e-59   
gb|ADQ74027.1|  9-cis-epoxycarotenoid dioxygenase                       206   3e-59   
gb|ADQ74044.1|  9-cis-epoxycarotenoid dioxygenase                       206   3e-59   
gb|ADQ74056.1|  9-cis-epoxycarotenoid dioxygenase                       206   4e-59   
dbj|BAF36655.1|  putative 9-cis-epoxycarotenoid dioxygenase             206   4e-59   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADQ74019.1|  9-cis-epoxycarotenoid dioxygenase                       206   4e-59   
gb|ADQ74047.1|  9-cis-epoxycarotenoid dioxygenase                       206   4e-59   
ref|XP_007149219.1|  hypothetical protein PHAVU_005G051600g             206   4e-59   
gb|ADQ74069.1|  9-cis-epoxycarotenoid dioxygenase                       206   4e-59   
gb|ADQ74054.1|  9-cis-epoxycarotenoid dioxygenase                       206   4e-59   
gb|ADQ74048.1|  9-cis-epoxycarotenoid dioxygenase                       206   4e-59   
gb|ADQ74018.1|  9-cis-epoxycarotenoid dioxygenase                       206   4e-59   
gb|ADQ74042.1|  9-cis-epoxycarotenoid dioxygenase                       206   4e-59   
gb|KCW69861.1|  hypothetical protein EUGRSUZ_F03199                     205   4e-59   
gb|ADQ74025.1|  9-cis-epoxycarotenoid dioxygenase                       206   4e-59   
gb|ADQ74013.1|  9-cis-epoxycarotenoid dioxygenase                       206   4e-59   
gb|AIG92852.1|  9-cis-epoxycarotenoid dioxygenase                       206   5e-59   
sp|Q9M6E8.1|NCED1_PHAVU  RecName: Full=9-cis-epoxycarotenoid diox...    206   5e-59   Phaseolus vulgaris [French bean]
gb|ADQ74065.1|  9-cis-epoxycarotenoid dioxygenase                       206   5e-59   
gb|ADQ74039.1|  9-cis-epoxycarotenoid dioxygenase                       206   5e-59   
gb|ADQ74050.1|  9-cis-epoxycarotenoid dioxygenase                       206   5e-59   
gb|ADQ74017.1|  9-cis-epoxycarotenoid dioxygenase                       206   5e-59   
gb|AAY89370.1|  9-cis-epoxycarotenoid dioxygenase 1                     206   5e-59   Citrus sinensis [apfelsine]
gb|ADQ74016.1|  9-cis-epoxycarotenoid dioxygenase                       206   5e-59   
gb|ADQ74061.1|  9-cis-epoxycarotenoid dioxygenase                       206   6e-59   
gb|ADQ74038.1|  9-cis-epoxycarotenoid dioxygenase                       206   6e-59   
gb|ADQ74059.1|  9-cis-epoxycarotenoid dioxygenase                       206   6e-59   
gb|ADQ74032.1|  9-cis-epoxycarotenoid dioxygenase                       206   6e-59   
gb|ADQ74020.1|  9-cis-epoxycarotenoid dioxygenase                       206   6e-59   
ref|XP_011029543.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    205   6e-59   
gb|ADQ74040.1|  9-cis-epoxycarotenoid dioxygenase                       206   6e-59   
gb|ADQ74022.1|  9-cis-epoxycarotenoid dioxygenase                       206   6e-59   
gb|ADQ74036.1|  9-cis-epoxycarotenoid dioxygenase                       205   6e-59   
gb|ADQ74030.1|  9-cis-epoxycarotenoid dioxygenase                       206   6e-59   
gb|ADQ74028.1|  9-cis-epoxycarotenoid dioxygenase                       205   6e-59   
ref|XP_010060796.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    206   6e-59   
gb|ADQ74012.1|  9-cis-epoxycarotenoid dioxygenase                       205   6e-59   
gb|AAR11193.1|  9-cis-epoxycarotenoid dioxygenase 1                     206   6e-59   Vitis vinifera
ref|NP_001268199.1|  9-cis-epoxycarotenoid dioxygenase 1                206   7e-59   
gb|ADQ74024.1|  9-cis-epoxycarotenoid dioxygenase                       205   7e-59   
emb|CAN81383.1|  hypothetical protein VITISV_018449                     206   7e-59   Vitis vinifera
ref|XP_009354854.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    206   7e-59   
emb|CDY57471.1|  BnaCnng32080D                                          201   8e-59   
ref|XP_002316871.1|  hypothetical protein POPTR_0011s11370g             205   9e-59   Populus trichocarpa [western balsam poplar]
ref|XP_008465499.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    205   9e-59   
ref|XP_008378396.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    205   9e-59   
gb|KEH38404.1|  9-cis-epoxycarotenoid dioxygenase                       205   9e-59   
ref|XP_007025058.1|  Nine-cis-epoxycarotenoid dioxygenase 5             205   1e-58   
gb|EYU26242.1|  hypothetical protein MIMGU_mgv1a025212mg                204   1e-58   
ref|XP_010062726.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    205   1e-58   
gb|ADQ74053.1|  9-cis-epoxycarotenoid dioxygenase                       205   1e-58   
gb|ADQ74021.1|  9-cis-epoxycarotenoid dioxygenase                       205   1e-58   
emb|CDX82482.1|  BnaA03g33390D                                          200   1e-58   
dbj|BAB11932.1|  neoxanthin cleavage enzyme                             205   1e-58   Vigna unguiculata
gb|KCW75914.1|  hypothetical protein EUGRSUZ_D002911                    192   1e-58   
ref|XP_010110953.1|  hypothetical protein L484_021647                   204   1e-58   
ref|XP_006377601.1|  hypothetical protein POPTR_0011s08240g             204   2e-58   
ref|XP_002316710.2|  hypothetical protein POPTR_0011s02230g             204   2e-58   Populus trichocarpa [western balsam poplar]
gb|AIU94747.1|  9-cis-epoxycarotenoid dioxygenase                       204   2e-58   
gb|AFO59594.1|  9-cis-epoxycarotenoid dioxygenase                       200   2e-58   
gb|ADP20465.1|  9-cis-epoxycarotenoid dioxygenase                       200   2e-58   
gb|AHJ80777.1|  9-cis-epoxicarotenoid dioxygenase 1 protein             204   3e-58   
ref|XP_010552176.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    204   3e-58   
gb|ADQ74029.1|  9-cis-epoxycarotenoid dioxygenase                       204   3e-58   
gb|ADQ74046.1|  9-cis-epoxycarotenoid dioxygenase                       203   3e-58   
gb|AEK99290.1|  9-cis-epoxycarotenoid dioxygenase                       200   4e-58   
gb|KGN53537.1|  hypothetical protein Csa_4G064690                       199   5e-58   
ref|XP_006370181.1|  nine-cis-epoxycarotenoid dioxygenase3 family...    203   6e-58   
gb|AEK99067.1|  9-cis-epoxycarotenoid dioxygenase                       199   6e-58   
ref|XP_011010890.1|  PREDICTED: LOW QUALITY PROTEIN: probable 9-c...    202   8e-58   
ref|XP_008225495.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    202   1e-57   
ref|XP_010247635.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    202   1e-57   
gb|ABB52078.1|  putative 9-cis epoxycarotenoid dioxygenase              201   2e-57   Daucus carota subsp. sativus
ref|XP_010092722.1|  hypothetical protein L484_024617                   202   2e-57   
ref|XP_008787808.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    202   2e-57   
gb|AEN94304.1|  9-cis-epoxycarotenoid dioxygenase                       201   2e-57   
emb|CAE00459.2|  9-cis-epoxycarotenoid dioxygenase                      201   2e-57   Arachis hypogaea [goober]
ref|XP_007213614.1|  hypothetical protein PRUPE_ppa002314mg             202   2e-57   
emb|CBI30914.3|  unnamed protein product                                199   2e-57   
dbj|BAN15738.1|  9-cis-epoxy-carotenoid dioxygenase                     201   3e-57   
dbj|BAN15737.1|  9-cis-epoxy-carotenoid dioxygenase                     201   3e-57   
ref|XP_006415513.1|  hypothetical protein EUTSA_v10007160mg             201   3e-57   
ref|XP_010923828.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    201   4e-57   
ref|XP_011012661.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    201   4e-57   
ref|XP_009398335.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    201   4e-57   
gb|ADG03462.1|  9-cis-epoxycarotenoid dioxygenase                       200   5e-57   
ref|XP_009115186.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    200   6e-57   
ref|XP_004147768.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    200   6e-57   
dbj|BAM72560.1|  9-cis-epoxycarotenoid dioxygenase                      201   6e-57   
emb|CDY26294.1|  BnaA09g26450D                                          200   6e-57   
ref|XP_008439625.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    200   6e-57   
ref|XP_008371610.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    200   7e-57   
ref|XP_004167844.1|  PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxyc...    200   7e-57   
gb|AEK99069.1|  9-cis-epoxycarotenoid dioxygenase                       196   8e-57   
ref|XP_009360900.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    199   1e-56   
gb|AFU91491.1|  9-cis-epoxycarotenoid dioxygenase                       199   1e-56   
ref|XP_008809583.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    199   2e-56   
gb|ADR78340.1|  9-cis-epoxycarotenoid dioxygenase                       196   2e-56   
gb|KDP27683.1|  hypothetical protein JCGZ_19722                         199   2e-56   
gb|AGV54244.1|  9-cis-epoxycarotenoid dioxygenase NCED1                 199   2e-56   
gb|AGQ03804.1|  9-cis-epoxycarotenoid dioxygenase                       199   2e-56   
emb|CAN74478.1|  hypothetical protein VITISV_002243                     199   2e-56   Vitis vinifera
gb|EPS60683.1|  9-cis-epoxycarotenoid dioxygenase                       198   3e-56   
ref|XP_002529528.1|  9-cis-epoxycarotenoid dioxygenase, putative        198   3e-56   Ricinus communis
ref|XP_006307061.1|  hypothetical protein CARUB_v10008647mg             198   4e-56   
gb|ADP20466.1|  9-cis-epoxycarotenoid dioxygenase                       195   5e-56   
ref|XP_004293530.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    197   6e-56   
gb|AIG92851.1|  9-cis-epoxycarotenoid dioxygenase                       197   6e-56   
gb|ADU85829.1|  9-cis-epoxycarotenoid dioxygenase                       197   6e-56   
ref|XP_008371764.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    197   6e-56   
gb|ACH85193.1|  9-cis-epoxycarotenoid dioxygenase                       197   7e-56   Malus hupehensis var. mengshanensis
ref|XP_004488719.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    197   1e-55   
dbj|BAE92962.1|  9-cis-epoxycarotenoid dioxygenase                      196   1e-55   Citrus limon [lemon]
ref|NP_001268200.1|  9-cis-epoxycarotenoid dioxygenase 2                197   1e-55   
ref|XP_006407071.1|  hypothetical protein EUTSA_v10020337mg             196   2e-55   
ref|XP_004134911.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    196   2e-55   
gb|KFK44832.1|  hypothetical protein AALP_AA1G308500                    195   3e-55   
dbj|BAE92960.1|  9-cis-epoxycarotenoid-dioxygenase                      195   3e-55   Citrus unshiu [satsuma mandarin]
ref|XP_002890850.1|  nine-cis-epoxycarotenoid dioxygenase 5             195   3e-55   
gb|AEK07906.1|  9-cis-epoxycarotenoid dioxygenase                       192   4e-55   
dbj|BAE92961.1|  9-cis-epoxycarotenoid dioxygenase                      195   4e-55   Citrus sinensis [apfelsine]
gb|KFK38809.1|  hypothetical protein AALP_AA3G162900                    195   4e-55   
ref|NP_174302.1|  9-cis-epoxycarotenoid dioxygenase                     195   4e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540581.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    195   5e-55   
ref|XP_010666721.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    195   6e-55   
gb|AAS47837.1|  9-cis-epoxycarotenoid dioxygenase                       194   7e-55   Gentiana lutea
emb|CDX98456.1|  BnaC05g39190D                                          186   8e-55   
gb|EYU33373.1|  hypothetical protein MIMGU_mgv1a003582mg                194   8e-55   
dbj|BAC10550.1|  nine-cis-epoxycarotenoid dioxygenase2                  194   8e-55   Pisum sativum [garden pea]
ref|XP_009406704.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    194   9e-55   
gb|AGT28471.1|  9-cis-epoxycarotenoid dioxygenase                       194   1e-54   
ref|XP_002889190.1|  hypothetical protein ARALYDRAFT_895735             181   1e-54   
dbj|BAF42336.1|  9-cis-epoxycarotenoid dioxygenase                      194   1e-54   Raphanus sativus
emb|CDY61838.1|  BnaCnng38510D                                          194   1e-54   
gb|AEG78287.1|  9-cis-epoxycarotenoid dioxygenase                       194   1e-54   
ref|XP_010478382.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    193   2e-54   
gb|AFY10513.1|  9-cis-epoxycarotenoid-dioxygenase                       189   2e-54   
gb|AAS68632.2|  putative 9-cis-epoxycarotenoid dioxygenase              193   3e-54   Chorispora bungeana
ref|XP_010499525.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    192   3e-54   
gb|AEK99287.1|  9-cis-epoxycarotenoid dioxygenase                       185   3e-54   
dbj|BAN15740.1|  9-cis-epoxy-carotenoid dioxygenase                     192   4e-54   
emb|CDX97576.1|  BnaA05g25030D                                          192   4e-54   
ref|XP_010054257.1|  PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxyc...    192   4e-54   
gb|AGI98130.1|  9-cis-epoxycarotenoid dioxygenase                       192   4e-54   
dbj|BAN15739.1|  9-cis-epoxy-carotenoid dioxygenase                     192   4e-54   
emb|CDX98455.1|  BnaC05g39200D                                          192   6e-54   
ref|XP_010941288.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    192   7e-54   
gb|ACD44928.1|  plastid 9-cis-epoxycarotenoid dioxygenase               192   7e-54   Crocus sativus [saffron crocus]
ref|XP_010428966.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    192   8e-54   
ref|XP_010460787.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    191   8e-54   
ref|XP_010529159.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    191   1e-53   
ref|XP_010549494.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    191   2e-53   
ref|XP_010537673.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    191   3e-53   
ref|XP_009146365.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    190   3e-53   
ref|XP_009399013.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    190   3e-53   
ref|XP_010416821.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    189   5e-53   
gb|EPS70455.1|  hypothetical protein M569_04294                         189   6e-53   
ref|XP_010472055.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    189   7e-53   
ref|XP_010487252.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    189   7e-53   
gb|EPS69338.1|  9-cis-epoxycarotenoid dioxygenase 3                     187   7e-53   
ref|NP_177960.1|  9-cis-epoxycarotenoid dioxygenase                     189   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487250.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    189   8e-53   
ref|XP_006650343.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    189   1e-52   
dbj|BAC10551.1|  nine-cis-epoxycarotenoid dioxygenase3                  188   2e-52   Pisum sativum [garden pea]
gb|AAY82459.1|  putative 9-cis-epoxycarotenoid dioxygenase 2            189   2e-52   Cuscuta reflexa [giant dodder]
gb|AAL07104.1|  putative 9-cis-epoxycarotenoid dioxygenase              188   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188062.1|  9-cis-epoxycarotenoid dioxygenase NCED3               188   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501914.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    188   2e-52   
ref|XP_009397411.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    188   2e-52   
emb|CDY33218.1|  BnaC01g36910D                                          188   2e-52   
emb|CAD71149.1|  nine-cis-epoxycarotenoid dioxygenase                   188   2e-52   Bixa orellana [achiote]
ref|XP_006297265.1|  hypothetical protein CARUB_v10013279mg             187   2e-52   
gb|EAY91193.1|  hypothetical protein OsI_12802                          187   3e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_009116867.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    187   3e-52   
ref|NP_001050765.1|  Os03g0645900                                       187   3e-52   Oryza sativa Japonica Group [Japonica rice]
emb|CDY39117.1|  BnaA01g29390D                                          186   6e-52   
ref|XP_009388971.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    186   7e-52   
ref|XP_006302015.1|  hypothetical protein CARUB_v10019990mg             186   8e-52   
ref|NP_193569.1|  9-cis-epoxycarotenoid dioxygenase NCED2               186   1e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CDX88443.1|  BnaC06g38870D                                          186   1e-51   
ref|XP_002862994.1|  nine-cis-epoxycarotenoid dioxygenase 9             186   1e-51   
ref|XP_010465340.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    185   3e-51   
ref|XP_009136923.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    184   3e-51   
emb|CDY55629.1|  BnaA03g58230D                                          184   3e-51   
gb|KFK42225.1|  hypothetical protein AALP_AA2G227500                    184   3e-51   
ref|XP_002885045.1|  nine-cis-epoxycarotenoid dioxygenase3              184   4e-51   
ref|XP_002870052.1|  nine-cis-epoxycarotenoid dioxygenase 2             184   5e-51   
gb|AAK00623.1|  9-cis-epoxycarotenoid dioxygenase                       184   6e-51   Persea americana
ref|XP_006664750.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    181   6e-51   
ref|XP_009128294.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    183   8e-51   
ref|XP_009408528.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    184   8e-51   
ref|XP_006389988.1|  hypothetical protein EUTSA_v10019707mg             183   1e-50   
ref|XP_010439868.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    182   1e-50   
ref|XP_004504912.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    182   1e-50   
ref|XP_002466753.1|  hypothetical protein SORBIDRAFT_01g013520          183   2e-50   Sorghum bicolor [broomcorn]
gb|ADC53069.1|  9-cis-epoxycarotenoid dioxygenase                       180   2e-50   
emb|CDY01534.1|  BnaC07g35240D                                          182   2e-50   
ref|XP_006414120.1|  hypothetical protein EUTSA_v10027182mg             183   2e-50   
ref|XP_010434549.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    182   2e-50   
ref|XP_003561898.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    182   3e-50   
gb|AGI97131.1|  9-cis-epoxy carotenoid dioxygenase                      182   3e-50   
gb|ACX33872.1|  NCED3                                                   182   3e-50   Lilium formosanum
ref|XP_010517551.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    181   4e-50   
ref|XP_009131600.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    181   4e-50   
gb|AHJ80847.1|  9-cis-epoxycarotenoid dioxygenase 1                     181   5e-50   
gb|EMT29848.1|  hypothetical protein F775_05318                         176   5e-50   
pdb|3NPE|A  Chain A, Structure Of Vp14 In Complex With Oxygen           180   5e-50   
gb|AGO64765.1|  9-cis-epoxycarotenoid dioxygenase                       181   8e-50   
gb|AHA94921.1|  viviparous 14                                           181   8e-50   
gb|AGA83648.1|  9-cis-epoxycarotenoid dioxygenase                       181   8e-50   
ref|XP_004986352.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    181   9e-50   
ref|XP_008446856.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    181   1e-49   
emb|CDX99475.1|  BnaC01g10770D                                          180   1e-49   
ref|XP_008644645.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    180   2e-49   
gb|AFN11666.1|  putative 9-cis-epoxycarotenoid dioxygenase              179   3e-49   
emb|CDY52448.1|  BnaA07g39250D                                          179   3e-49   
gb|ACX46382.1|  plastid NCED3                                           179   3e-49   Lilium hybrid cultivar
ref|XP_009106546.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    180   3e-49   
ref|NP_001105902.2|  9-cis-epoxycarotenoid dioxygenase 1, chlorop...    179   3e-49   
gb|ABB71583.1|  9-cis-epoxycarotenoid dioxygenase 1                     178   3e-49   
tpg|DAA50307.1|  TPA: viviparous14                                      179   3e-49   
dbj|BAJ84863.1|  predicted protein                                      178   6e-49   
gb|ABB71584.1|  9-cis-epoxycarotenoid dioxygenase 2                     178   6e-49   
dbj|BAF02838.1|  putative 9-cis-epoxycarotenoid dioxygenase             178   6e-49   
ref|XP_002459357.1|  hypothetical protein SORBIDRAFT_02g003240          175   6e-49   
gb|ACN26876.1|  unknown                                                 173   7e-49   
gb|AHJ80848.1|  9-cis-epoxycarotenoid dioxygenase 2                     178   8e-49   
dbj|BAF02837.1|  putative 9-cis-epoxycarotenoid dioxygenase             178   8e-49   
dbj|BAJ93203.1|  predicted protein                                      178   9e-49   
gb|AGA84060.1|  9-cis-epoxycarotenoid dioxygenase                       178   1e-48   
emb|CAR92133.1|  9-cis-epoxy-carotenoid dioxygenase                     169   1e-48   
ref|XP_004149672.1|  PREDICTED: probable 9-cis-epoxycarotenoid di...    177   2e-48   
ref|XP_010243984.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    177   2e-48   
ref|XP_004955480.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    176   3e-48   
gb|ACX33873.1|  NCED3                                                   176   4e-48   
ref|XP_006607053.1|  PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxyc...    174   5e-48   
emb|CDX78842.1|  BnaA01g09090D                                          176   6e-48   
ref|NP_001177063.1|  Os12g0617400                                       175   9e-48   
gb|KHN46077.1|  Putative 9-cis-epoxycarotenoid dioxygenase NCED5,...    174   9e-48   
gb|EAY83911.1|  hypothetical protein OsI_39134                          175   1e-47   
tpg|DAA47540.1|  TPA: hypothetical protein ZEAMMB73_071878              172   1e-47   
ref|XP_004963201.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    174   2e-47   
ref|NP_001147781.1|  viviparous-14                                      174   2e-47   
gb|AGA84061.1|  9-cis-epoxycarotenoid dioxygenase                       174   2e-47   
ref|XP_002459356.1|  hypothetical protein SORBIDRAFT_02g003230          174   2e-47   
ref|XP_006282855.1|  hypothetical protein CARUB_v10006815mg             174   2e-47   
ref|NP_001241616.1|  probable 9-cis-epoxycarotenoid dioxygenase N...    173   3e-47   
ref|XP_008670979.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    173   3e-47   
ref|XP_009400988.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    171   4e-47   
ref|XP_003579121.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    174   4e-47   
tpg|DAA54707.1|  TPA: viviparous-14                                     171   4e-47   
ref|XP_009412831.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    171   5e-47   
ref|XP_010264135.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    171   1e-46   
ref|XP_008676109.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    169   1e-46   
ref|XP_006836449.1|  hypothetical protein AMTR_s00092p00172590          172   1e-46   
ref|XP_008653974.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    165   4e-46   
gb|KHN12459.1|  Putative 9-cis-epoxycarotenoid dioxygenase NCED5,...    166   5e-46   
dbj|BAE92965.1|  9-cis-epoxycarotenoid dioxygenase                      170   7e-46   
ref|NP_001147527.1|  viviparous-14                                      170   7e-46   
gb|AAK00632.1|  9-cis-epoxycarotenoid dioxygenase                       169   9e-46   
emb|CDO99408.1|  unnamed protein product                                168   1e-45   
dbj|BAE92963.1|  9-cis-epoxycarotenoid dioxygenase                      168   2e-45   
ref|XP_008654195.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    167   2e-45   
tpg|DAA64342.1|  TPA: hypothetical protein ZEAMMB73_260873              166   3e-45   
gb|EAZ02812.1|  hypothetical protein OsI_24937                          166   6e-45   
gb|AIX87532.1|  9-cis-epoxycarotenoid dioxygenase 6                     167   7e-45   
dbj|BAD31592.1|  putative viviparous-14 protein                         166   2e-44   
gb|AIX87508.1|  9-cis-epoxycarotenoid dioxygenase 6                     166   2e-44   
ref|NP_001241251.1|  probable 9-cis-epoxycarotenoid dioxygenase N...    165   3e-44   
ref|XP_007144972.1|  hypothetical protein PHAVU_007G198800g             165   4e-44   
gb|AAY82457.1|  9-cis-epoxycarotenoid dioxygenase 2                     165   4e-44   
ref|XP_010535003.1|  PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxyc...    165   5e-44   
gb|AAV35466.1|  9-cis-epoxycarotenoid dioxygenase                       164   8e-44   
ref|NP_001058913.1|  Os07g0154100                                       164   1e-43   
ref|XP_003561467.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    164   1e-43   
dbj|BAE92964.1|  9-cis-epoxycarotenoid dioxygenase                      163   1e-43   
ref|XP_009804458.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    163   2e-43   
sp|C3VEQ3.1|NCED_ONCHC  RecName: Full=9-cis-epoxycarotenoid dioxy...    163   3e-43   
ref|XP_004162808.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    162   3e-43   
ref|XP_009608069.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    162   4e-43   
ref|XP_008804455.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    160   6e-43   
ref|XP_010911051.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    161   1e-42   
gb|KDO43597.1|  hypothetical protein CISIN_1g044684mg                   160   1e-42   
ref|XP_006420602.1|  hypothetical protein CICLE_v10006710mg             160   1e-42   
ref|XP_006489810.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    160   1e-42   
ref|XP_002304701.2|  hypothetical protein POPTR_0003s17490g             157   2e-41   
ref|XP_010321597.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    157   2e-41   
ref|XP_004150345.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    155   9e-41   
gb|AEW91475.1|  9-cis-epoxycarotenoid dioxygenase                       155   1e-40   
ref|XP_009611958.1|  PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxyc...    154   1e-40   
ref|XP_011020689.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    155   2e-40   
ref|XP_007034452.1|  Nine-cis-epoxycarotenoid dioxygenase 6             153   6e-40   
ref|XP_006854405.1|  hypothetical protein AMTR_s00039p00194530          153   7e-40   
ref|XP_008460725.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    152   2e-39   
dbj|BAF32138.1|  putative 9-cis-epoxycarotenoid dioxygenase             151   3e-39   
ref|XP_002518139.1|  9-cis-epoxycarotenoid dioxygenase, putative        150   7e-39   
gb|AFO59595.1|  9-cis-epoxycarotenoid dioxygenase                       149   8e-39   
ref|XP_006349526.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    150   9e-39   
dbj|BAF31906.1|  putative 9-cis-epoxycarotenoid dioxygenase             150   1e-38   
ref|XP_009365476.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    148   3e-38   
dbj|BAF31922.1|  putative 9-cis-epoxycarotenoid dioxygenase             148   4e-38   
dbj|BAF31929.1|  putative 9-cis-epoxycarotenoid dioxygenase             148   4e-38   
dbj|BAF31900.1|  putative 9-cis-epoxycarotenoid dioxygenase             148   4e-38   
dbj|BAF31905.1|  putative 9-cis-epoxycarotenoid dioxygenase             148   4e-38   
dbj|BAF31903.1|  putative 9-cis-epoxycarotenoid dioxygenase             148   5e-38   
dbj|BAF31899.1|  putative 9-cis-epoxycarotenoid dioxygenase             148   5e-38   
dbj|BAF31898.1|  putative 9-cis-epoxycarotenoid dioxygenase             148   5e-38   
ref|XP_004289731.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    147   7e-38   
gb|EMT26898.1|  hypothetical protein F775_52691                         146   2e-37   
ref|XP_002981140.1|  hypothetical protein SELMODRAFT_113788             147   2e-37   
gb|AFN22051.1|  9-cis-epoxycarotenoid dioxygenase                       142   2e-37   
ref|XP_002982621.1|  hypothetical protein SELMODRAFT_116420             146   2e-37   
ref|XP_009365475.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    146   2e-37   
gb|EYU43820.1|  hypothetical protein MIMGU_mgv1a026010mg                144   1e-36   
ref|NP_001183085.1|  uncharacterized protein LOC100501444               142   1e-36   
ref|XP_008223978.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    144   2e-36   
ref|XP_006418817.1|  hypothetical protein EUTSA_v10002459mg             143   2e-36   
ref|XP_001765996.1|  predicted protein                                  142   4e-36   
ref|XP_007223976.1|  hypothetical protein PRUPE_ppa014647mg             142   4e-36   
emb|CDX85148.1|  BnaC07g07580D                                          142   7e-36   
ref|XP_006300091.1|  hypothetical protein CARUB_v10016319mg             141   9e-36   
ref|XP_010688979.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    140   2e-35   
gb|KDP20332.1|  hypothetical protein JCGZ_06418                         140   3e-35   
gb|ADC95722.1|  9-cis epoxycarotenoid dioxygenase                       139   3e-35   
ref|XP_001784596.1|  predicted protein                                  139   4e-35   
ref|XP_010026759.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    139   6e-35   
ref|XP_008356480.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    138   1e-34   
gb|AFA36207.1|  9-cis-epoxycarotenoid dioxygenase 4                     138   2e-34   
gb|AFA36209.1|  9-cis-epoxycarotenoid dioxygenase 4                     137   2e-34   
gb|AFA36208.1|  9-cis-epoxycarotenoid dioxygenase 4                     137   2e-34   
ref|NP_189064.1|  9-cis-epoxycarotenoid dioxygenase NCED6               137   3e-34   
gb|AFY10514.1|  9-cis-epoxycarotenoid-dioxygenase                       134   5e-34   
ref|XP_010466768.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    136   6e-34   
dbj|BAE72093.1|  Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 4     136   6e-34   
gb|AFA36205.1|  9-cis-epoxycarotenoid dioxygenase 4                     136   7e-34   
emb|CDX77467.1|  BnaA07g06050D                                          136   8e-34   
ref|XP_009102557.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    136   9e-34   
gb|AGM34083.1|  nine-cis-epoxycarotenoid dioxygenase 4                  135   1e-33   
emb|CAH65873.1|  OSIGBa0103I21.6                                        129   2e-33   
ref|XP_010532802.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    134   4e-33   
ref|XP_010488479.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    134   5e-33   
gb|ADE80897.1|  9-cis-epoxycarotenoid dioxygenase                       133   6e-33   
emb|CBI33352.3|  unnamed protein product                                133   9e-33   
ref|XP_002283185.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...    132   1e-32   
gb|EEC76696.1|  hypothetical protein OsI_14699                          129   2e-32   
ref|XP_006379330.1|  hypothetical protein POPTR_0009s15400g             130   1e-31   
gb|AAK94454.1|AF399655_1  9-cis-epoxycarotenoid dioxygenase             123   3e-31   
ref|XP_002312876.2|  hypothetical protein POPTR_0009s15440g             126   8e-31   
ref|XP_002885610.1|  nine-cis-epoxycarotenoid dioxygenase 6             127   9e-31   
ref|XP_002963374.1|  hypothetical protein SELMODRAFT_79628              126   2e-30   
ref|XP_011044128.1|  PREDICTED: zeaxanthin 7,8(7',8')-cleavage di...    126   2e-30   
ref|XP_002970910.1|  hypothetical protein SELMODRAFT_11292              125   5e-30   
ref|XP_002970754.1|  hypothetical protein SELMODRAFT_11293              124   8e-30   
gb|AIT98183.1|  nine-cis-epoxycarotenoid dioxygenase 4                  119   2e-29   
ref|XP_002312877.2|  hypothetical protein POPTR_0009s15430g             124   2e-29   
ref|XP_010099124.1|  hypothetical protein L484_017919                   124   3e-29   
gb|AJB84627.1|  9-cis epoxycarotenoid dioxygenase-2                     114   3e-29   
ref|XP_010662172.1|  PREDICTED: zeaxanthin 7,8(7',8')-cleavage di...    118   4e-29   
gb|ABK78686.1|  neoxanthin cleavage enzyme-like protein                 117   1e-28   
ref|XP_002963376.1|  hypothetical protein SELMODRAFT_80651              121   2e-28   
ref|XP_002969646.1|  hypothetical protein SELMODRAFT_91815              121   2e-28   
gb|EAZ21238.1|  hypothetical protein OsJ_36889                          120   2e-28   
ref|XP_006414000.1|  hypothetical protein EUTSA_v10024711mg             120   4e-28   
ref|XP_002970755.1|  hypothetical protein SELMODRAFT_11304              119   6e-28   
ref|XP_009108417.1|  PREDICTED: LOW QUALITY PROTEIN: probable car...    120   6e-28   
ref|XP_002969641.1|  hypothetical protein SELMODRAFT_11287              119   8e-28   
ref|XP_002967439.1|  hypothetical protein SELMODRAFT_31991              118   1e-27   
ref|XP_010275133.1|  PREDICTED: probable carotenoid cleavage diox...    119   1e-27   
gb|ABK96278.1|  unknown                                                 118   1e-27   
gb|AES95419.2|  carotenoid cleavage dioxygenase 4a-6                    119   2e-27   
gb|AFA26703.1|  carotenoid cleavage dioxygenase 4                       113   2e-27   
ref|XP_002960273.1|  hypothetical protein SELMODRAFT_75383              119   2e-27   
ref|XP_007023695.1|  Nine-cis-epoxycarotenoid dioxygenase 4             118   2e-27   
ref|XP_002970756.1|  hypothetical protein SELMODRAFT_94523              118   2e-27   
ref|XP_002891948.1|  hypothetical protein ARALYDRAFT_892786             110   3e-27   
ref|XP_010449385.1|  PREDICTED: probable carotenoid cleavage diox...    118   3e-27   
ref|XP_010434441.1|  PREDICTED: probable carotenoid cleavage diox...    118   3e-27   
ref|XP_003612461.1|  50S ribosomal protein L14                          118   3e-27   
ref|XP_003612460.1|  Carotenoid cleavage dioxygenase 4a                 117   4e-27   
ref|XP_002969420.1|  hypothetical protein SELMODRAFT_11289              117   4e-27   
dbj|BAH20347.1|  AT4G19170                                              116   4e-27   
ref|XP_009132578.1|  PREDICTED: probable carotenoid cleavage diox...    117   4e-27   
emb|CDX78923.1|  BnaA01g09900D                                          117   4e-27   
ref|XP_002326037.2|  hypothetical protein POPTR_0019s12320g             117   5e-27   
emb|CDX99397.1|  BnaC01g11550D                                          117   5e-27   
ref|XP_002869997.1|  nine-cis-epoxycarotenoid dioxygenase 4             117   7e-27   
ref|XP_008451876.1|  PREDICTED: probable carotenoid cleavage diox...    117   8e-27   
gb|ABK24456.1|  unknown                                                 117   9e-27   
ref|XP_010439749.1|  PREDICTED: probable carotenoid cleavage diox...    116   1e-26   
ref|XP_010439748.1|  PREDICTED: probable carotenoid cleavage diox...    116   1e-26   
ref|XP_010251938.1|  PREDICTED: probable carotenoid cleavage diox...    116   1e-26   
ref|XP_003612459.1|  Nine-cis-epoxycarotenoid dioxygenase4              116   1e-26   
ref|XP_011002658.1|  PREDICTED: probable carotenoid cleavage diox...    116   1e-26   
gb|AEO50759.1|  CCD4c                                                   116   1e-26   
ref|XP_006282800.1|  hypothetical protein CARUB_v10006410mg             116   1e-26   
ref|NP_193652.1|  nine-cis-epoxycarotenoid dioxygenase 4                116   1e-26   
gb|KCW60088.1|  hypothetical protein EUGRSUZ_H02823                     115   2e-26   
ref|XP_008340019.1|  PREDICTED: probable carotenoid cleavage diox...    115   2e-26   
ref|XP_004512437.1|  PREDICTED: probable carotenoid cleavage diox...    115   2e-26   
ref|XP_010275132.1|  PREDICTED: probable carotenoid cleavage diox...    115   3e-26   
ref|XP_010108103.1|  hypothetical protein L484_023189                   115   4e-26   
ref|XP_006482651.1|  PREDICTED: probable carotenoid cleavage diox...    114   5e-26   
ref|XP_002268404.1|  PREDICTED: probable carotenoid cleavage diox...    114   5e-26   
ref|XP_006359966.1|  PREDICTED: probable carotenoid cleavage diox...    114   5e-26   
gb|AFJ94675.1|  carotenoid cleavage dioxygenase 4a                      114   5e-26   
gb|AGT63321.1|  carotenoid cleavage dioxygenase 4a                      114   5e-26   
gb|AFG30026.1|  carotenoid cleavage dioxygenase 4                       113   5e-26   
gb|AFJ94676.1|  carotenoid cleavage dioxygenase 4b                      114   6e-26   
gb|AGT63322.1|  carotenoid cleavage dioxygenase 4b                      114   6e-26   
ref|XP_002270161.1|  PREDICTED: probable carotenoid cleavage diox...    114   6e-26   
ref|XP_004246004.1|  PREDICTED: probable carotenoid cleavage diox...    114   7e-26   
ref|XP_007015623.1|  Nine-cis-epoxycarotenoid dioxygenase 4             114   8e-26   
ref|XP_006484631.1|  PREDICTED: probable carotenoid cleavage diox...    114   9e-26   
emb|CBI26459.3|  unnamed protein product                                113   1e-25   
ref|XP_002269538.2|  PREDICTED: probable carotenoid cleavage diox...    114   1e-25   
ref|XP_004161563.1|  PREDICTED: probable carotenoid cleavage diox...    114   1e-25   
gb|KDO36461.1|  hypothetical protein CISIN_1g044599mg                   113   1e-25   
ref|XP_004512308.1|  PREDICTED: probable carotenoid cleavage diox...    113   1e-25   
ref|XP_006430912.1|  hypothetical protein CICLE_v10011335mg             113   2e-25   
gb|KDO72273.1|  hypothetical protein CISIN_1g044992mg                   113   2e-25   
gb|KDO40923.1|  hypothetical protein CISIN_1g040986mg                   112   2e-25   
gb|AEO14932.1|  9-cis-epoxycarotenoid dioxygenase                       108   3e-25   
ref|XP_006437482.1|  hypothetical protein CICLE_v10031003mg             112   3e-25   
gb|AEO14920.1|  9-cis-epoxycarotenoid dioxygenase                       108   3e-25   
ref|XP_002519944.1|  9-cis-epoxycarotenoid dioxygenase, putative        112   3e-25   
gb|KDP37806.1|  hypothetical protein JCGZ_06708                         112   3e-25   
ref|XP_006424046.1|  hypothetical protein CICLE_v10028113mg             112   4e-25   
gb|AIX87534.1|  carotenoid cleavage dioxygenase 4                       112   4e-25   
gb|ABC26012.1|  carotenoid cleavage dioxygenase 4b                      112   4e-25   
gb|AIX87510.1|  carotenoid cleavage dioxygenase 4                       112   4e-25   
ref|XP_008646127.1|  PREDICTED: zeaxanthin 7,8(7',8')-cleavage di...    112   5e-25   
ref|XP_006359975.1|  PREDICTED: probable carotenoid cleavage diox...    107   5e-25   
ref|XP_009363530.1|  PREDICTED: probable carotenoid cleavage diox...    112   5e-25   
ref|XP_006487822.1|  PREDICTED: probable carotenoid cleavage diox...    111   6e-25   
ref|XP_009778728.1|  PREDICTED: probable carotenoid cleavage diox...    112   6e-25   
gb|AFW73001.1|  hypothetical protein ZEAMMB73_627312                    112   6e-25   
ref|XP_008353194.1|  PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxyc...    108   7e-25   
gb|AEO14921.1|  9-cis-epoxycarotenoid dioxygenase                       107   8e-25   
ref|XP_004147771.1|  PREDICTED: probable carotenoid cleavage diox...    111   8e-25   



>ref|XP_011082846.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic 
[Sesamum indicum]
Length=606

 Score =   226 bits (577),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPR+
Sbjct  484  AGMVNRNRLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRD  543

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEKA KSELQIVNA+T++LEASVKLPSRVPYGFHGTFI+A 
Sbjct  544  PNS---EAEDDGYILAFVHDEKAWKSELQIVNAKTMKLEASVKLPSRVPYGFHGTFISAK  600

Query  361  DLSSQA  378
            DL++QA
Sbjct  601  DLANQA  606



>gb|AEH41591.1| 9-cis-epoxycarotenoid dioxygenase 1 [Ipomoea nil]
Length=615

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 116/126 (92%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN
Sbjct  492  AGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  551

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +S   + EDDGYILAFVHDEK  KSELQIVN+QTL LEA+VKLPSRVPYGFHGTFI A 
Sbjct  552  SDS---DAEDDGYILAFVHDEKTWKSELQIVNSQTLHLEATVKLPSRVPYGFHGTFITAT  608

Query  361  DLSSQA  378
            DLS+QA
Sbjct  609  DLSTQA  614



>ref|NP_001275103.1| 9-cis-epoxy-carotenoid dioxygenase 1 [Solanum tuberosum]
 gb|AAT75151.1| 9-cis-epoxy-carotenoid dioxygenase 1 [Solanum tuberosum]
Length=603

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  481  AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVEKFIYGDNKYGGEPLFLPRD  540

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+   EEDDGYILAFVHDEK   SELQIVNA TL+LEA+VKLPSRVPYGFHGTFINA+
Sbjct  541  PNSK---EEDDGYILAFVHDEKEWNSELQIVNAMTLKLEATVKLPSRVPYGFHGTFINAN  597

Query  361  DLSSQA  378
            DL++QA
Sbjct  598  DLANQA  603



>emb|CAB76920.1| putative 9-cis-epoxycarotenoid dioxygenase [Solanum tuberosum]
Length=604

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  482  AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVEKFIYGDNKYGGEPLFLPRD  541

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+   EEDDGYILAFVHDEK   SELQIVNA TL+LEA+VKLPSRVPYGFHGTFINA+
Sbjct  542  PNSK---EEDDGYILAFVHDEKEWTSELQIVNAMTLKLEATVKLPSRVPYGFHGTFINAN  598

Query  361  DLSSQA  378
            DL++QA
Sbjct  599  DLANQA  604



>emb|CDP06103.1| unnamed protein product [Coffea canephora]
Length=635

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 116/126 (92%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEV+KFIYGDEKYGGEPLFLPR+
Sbjct  513  AGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVRKFIYGDEKYGGEPLFLPRD  572

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N    E EDDGYILAFVHDEK  KSEL+IVNA TLELEASV+LPSRVPYGFHGTFI+A 
Sbjct  573  PNC---EAEDDGYILAFVHDEKEWKSELRIVNAMTLELEASVQLPSRVPYGFHGTFISAK  629

Query  361  DLSSQA  378
            DL+SQA
Sbjct  630  DLASQA  635



>gb|ABA43901.1| 9-cis-epoxycarotenoid dioxygenase 3 [Coffea canephora]
Length=635

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 116/126 (92%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEV+KFIYGDEKYGGEPLFLPR+
Sbjct  513  AGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVRKFIYGDEKYGGEPLFLPRD  572

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N    E EDDGYILAFVHDEK  KSEL+IVNA TLELEASV+LPSRVPYGFHGTFI+A 
Sbjct  573  PNC---EAEDDGYILAFVHDEKEWKSELRIVNAMTLELEASVQLPSRVPYGFHGTFISAK  629

Query  361  DLSSQA  378
            DL+SQA
Sbjct  630  DLASQA  635



>gb|AIY62759.1| 9-cis epoxycarotenoid dioxygenase [Lycium chinense]
Length=608

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGE+ KF YGD KYGGEPLFLPR+
Sbjct  486  AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEINKFFYGDNKYGGEPLFLPRD  545

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+   +EDDGYILAFVHDEK  KSELQIVNA TL+LEA+VKLPSRVPYGFHGTFINA 
Sbjct  546  PNSK---DEDDGYILAFVHDEKEWKSELQIVNAMTLKLEATVKLPSRVPYGFHGTFINAK  602

Query  361  DLSSQA  378
            DL++QA
Sbjct  603  DLANQA  608



>gb|AFO85470.1| 9-cis-epoxy-carotenoid dioxygenase [Lycium barbarum]
Length=607

 Score =   222 bits (565),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGE+ KF YGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEINKFFYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+   +EDDGYILAFVHDEK  KSELQIVNA TL+LEA+VKLPSRVPYGFHGTFINA 
Sbjct  545  PNSK---DEDDGYILAFVHDEKEWKSELQIVNAMTLKLEATVKLPSRVPYGFHGTFINAK  601

Query  361  DLSSQA  378
            DL++QA
Sbjct  602  DLANQA  607



>gb|ACL00683.2| 9-cis-epoxycarotenoid dioxygenase 2 [Solanum lycopersicum]
Length=429

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQ+AYLAIAEPWPKVSGFAKVDL TGE+KK IYGD++YGGEPLFLPRN
Sbjct  307  AGMVNRNKLGRKTQFAYLAIAEPWPKVSGFAKVDLSTGEIKKHIYGDKRYGGEPLFLPRN  366

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            VNS   E+EDDGYILAF HDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI++ 
Sbjct  367  VNS---EKEDDGYILAFCHDEKTWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISSK  423

Query  361  DLSSQA  378
            DL +Q 
Sbjct  424  DLQNQV  429



>ref|NP_001234455.1| nine-cis-epoxycarotenoid dioxygenase [Solanum lycopersicum]
 emb|CAB10168.1| nine-cis-epoxycarotenoid dioxygenase [Solanum lycopersicum]
 emb|CAD30202.1| 9-cis-epoxycarotenoid dioxygenase [Solanum lycopersicum]
Length=605

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTFINA+
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTFINAN  599

Query  361  DLSSQA  378
            DL++QA
Sbjct  600  DLANQA  605



>gb|AIX87507.1| 9-cis-epoxycarotenoid dioxygenase 1 [Lycium barbarum]
Length=607

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGE+ KF YGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEINKFFYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+   +EDDGYILAFVHDEK  KSELQIVNA TL+LEA+VKLPSRVPYGFHGTFINA 
Sbjct  545  PNSK---DEDDGYILAFVHDEKEWKSELQIVNAMTLKLEATVKLPSRVPYGFHGTFINAK  601

Query  361  DLSSQA  378
            DL++QA
Sbjct  602  DLANQA  607



>gb|AIX87531.1| 9-cis-epoxycarotenoid dioxygenase 1 [Lycium ruthenicum]
Length=607

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGE+ KF YGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEINKFFYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+   +EDDGYILAFVHDEK  KSELQIVNA TL LEA+VKLPSRVPYGFHGTFINA 
Sbjct  545  PNSK---DEDDGYILAFVHDEKEWKSELQIVNAMTLRLEATVKLPSRVPYGFHGTFINAK  601

Query  361  DLSSQA  378
            DL++QA
Sbjct  602  DLANQA  607



>gb|EYU38203.1| hypothetical protein MIMGU_mgv1a003133mg [Erythranthe guttata]
Length=605

 Score =   221 bits (564),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++AYLAIAEPWPKVSGFAKVDLFTGEVKKF+YGD+KYGGEPLFLPR+
Sbjct  480  AGMVNRNKLGRKTRFAYLAIAEPWPKVSGFAKVDLFTGEVKKFMYGDDKYGGEPLFLPRD  539

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              +  DEEEDDGYILAF HDEK  KSELQIVNA T+ELEASVKLPSRVPYGFHGTFI   
Sbjct  540  YPNSSDEEEDDGYILAFSHDEKNSKSELQIVNAVTMELEASVKLPSRVPYGFHGTFIGDK  599

Query  361  DLSSQA  378
            +L++QA
Sbjct  600  ELANQA  605



>gb|ABB52079.1| putative 9-cis epoxycarotenoid dioxygenase [Daucus carota subsp. 
sativus]
Length=588

 Score =   221 bits (563),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+NKLGRKTQ+AYLAIAEPWPKVSGFAKVDLFTG+V+KF YGD KYGGEPLFLP+N
Sbjct  466  AGMVNKNKLGRKTQFAYLAIAEPWPKVSGFAKVDLFTGQVQKFFYGDHKYGGEPLFLPKN  525

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEKA KSELQIVNA TLELEA+V+LPSRVPYGFHGTFI+A 
Sbjct  526  PNS---ENEDDGYILAFVHDEKAWKSELQIVNAMTLELEATVQLPSRVPYGFHGTFISAK  582

Query  361  DLSSQA  378
            DL SQA
Sbjct  583  DLESQA  588



>gb|AGN03861.1| 9-cis epoxycarotenoid dioxygenase [Scutellaria baicalensis]
Length=598

 Score =   221 bits (563),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEV KF YG+EK+GGEPLFLPR+
Sbjct  476  AGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVTKFFYGEEKFGGEPLFLPRD  535

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   EEEDDGYILAFVHDEKA KSELQIVNA+T+++EASVKLPSRVPYGFHGTFI + 
Sbjct  536  ANS---EEEDDGYILAFVHDEKAWKSELQIVNAKTMKMEASVKLPSRVPYGFHGTFIGSK  592

Query  361  DLSSQA  378
            D+++QA
Sbjct  593  DMANQA  598



>ref|XP_004244807.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Solanum lycopersicum]
Length=581

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQ+AYLAIAEPWPKVSGFAKVDL TGE+KK IYGD++YGGEPLFLPRN
Sbjct  459  AGMVNRNKLGRKTQFAYLAIAEPWPKVSGFAKVDLSTGEIKKHIYGDKRYGGEPLFLPRN  518

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            VNS   E+EDDGYILAF HDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI++ 
Sbjct  519  VNS---EKEDDGYILAFCHDEKTWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISSK  575

Query  361  DLSSQA  378
            DL +Q 
Sbjct  576  DLQNQV  581



>ref|XP_009603531.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Nicotiana tomentosiformis]
Length=601

 Score =   218 bits (556),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDL TGEV+K++YGD++YGGEPLFLPRN
Sbjct  479  AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEVQKYMYGDKRYGGEPLFLPRN  538

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            VNS   E EDDG+ILAF HDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI++ 
Sbjct  539  VNS---ENEDDGFILAFCHDEKTWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISSK  595

Query  361  DLSSQA  378
            DL +Q 
Sbjct  596  DLQNQV  601



>gb|AFP57678.1| 9-cis-epoxycarotenoid dioxygenase 3 protein family isoform 2 
[Nicotiana tabacum]
Length=601

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDL TGEV+K++YGD++YGGEPLFLPRN
Sbjct  479  AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEVQKYMYGDKRYGGEPLFLPRN  538

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            VNS   E EDDG+ILAF HDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI++ 
Sbjct  539  VNS---ENEDDGFILAFCHDEKTWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISSK  595

Query  361  DLSSQA  378
            DL +Q 
Sbjct  596  DLQNQV  601



>ref|XP_009804376.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Nicotiana sylvestris]
Length=601

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDL TGEV+K++YGD++YGGEPLFLPRN
Sbjct  479  AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGEVQKYMYGDKRYGGEPLFLPRN  538

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            VNS   E EDDG+ILAF HDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI++ 
Sbjct  539  VNS---ENEDDGFILAFCHDEKTWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISSK  595

Query  361  DLSSQA  378
            DL +Q 
Sbjct  596  DLQNQV  601



>gb|ABB52080.1| putative 9-cis epoxycarotenoid dioxygenase [Daucus carota subsp. 
sativus]
Length=588

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN NKLGRKTQ+AYLAIAEPWPKVSGFAKVDLF GE+KKF YGD KYGGEPLFLPRN
Sbjct  466  AGMVNINKLGRKTQFAYLAIAEPWPKVSGFAKVDLFNGEIKKFFYGDNKYGGEPLFLPRN  525

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEKA KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI+  
Sbjct  526  PNS---ENEDDGYILAFVHDEKAWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISEK  582

Query  361  DLSSQA  378
            DL  QA
Sbjct  583  DLEKQA  588



>ref|NP_001274963.1| 9-cis-epoxy-carotenoid dioxygenase 2 [Solanum tuberosum]
 gb|AAT75152.1| 9-cis-epoxy-carotenoid dioxygenase 2 [Solanum tuberosum]
Length=580

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQ+ YLAIAEPWPKVSGFAKVDL TGE+KK IYGD++YGGEPLFLPRN
Sbjct  458  AGMVNRNKLGRKTQFTYLAIAEPWPKVSGFAKVDLSTGEIKKHIYGDKRYGGEPLFLPRN  517

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            VNS   E+EDDGYILAF HDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI++ 
Sbjct  518  VNS---EKEDDGYILAFCHDEKTWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISSK  574

Query  361  DLSSQA  378
            DL +Q 
Sbjct  575  DLQNQV  580



>gb|KDP37985.1| hypothetical protein JCGZ_04628 [Jatropha curcas]
Length=598

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRK+QYAYLAIAEPWPKVSGFAKVDLFTGEVKK IYGD+KYGGEP FLPR+
Sbjct  476  AGMVNRNRLGRKSQYAYLAIAEPWPKVSGFAKVDLFTGEVKKHIYGDKKYGGEPFFLPRD  535

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSELQIVNA  L+LEAS+KLPSRVPYGFHGT+IN+ 
Sbjct  536  PNS---ENEDDGYILAFVHDEKKCKSELQIVNAINLQLEASIKLPSRVPYGFHGTYINSS  592

Query  361  DLSSQA  378
            DL +QA
Sbjct  593  DLVNQA  598



>gb|AEK99070.1| 9-cis-epoxycarotenoid dioxygenase [Fragaria x ananassa]
Length=428

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++AYLA+AEPWPKVSGFAKVDLFTGEVKK IYG++++GGEPLFLPR+
Sbjct  306  AGMVNRNKLGRKTRFAYLALAEPWPKVSGFAKVDLFTGEVKKHIYGEQRFGGEPLFLPRD  365

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSELQIVNA TL+LEAS+KLPSRVPYGFHGTFI++ 
Sbjct  366  PNS---ENEDDGYILAFVHDEKEWKSELQIVNAMTLKLEASIKLPSRVPYGFHGTFISSK  422

Query  361  DLSSQA  378
            DL  QA
Sbjct  423  DLQKQA  428



>ref|XP_002519665.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
 gb|EEF42638.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
Length=607

 Score =   216 bits (550),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN++GRKT+Y YLAI EPWPKVSGFAKVDLFTGEVKK+IYGD+K+GGEP FLPR+
Sbjct  485  AGMVNRNRIGRKTRYVYLAIVEPWPKVSGFAKVDLFTGEVKKYIYGDKKFGGEPFFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   EEEDDGY+LAFVHDEK  KSELQIVNA  L+LEASVKLPSRVPYGFHGTFI+++
Sbjct  545  PNS---EEEDDGYVLAFVHDEKKCKSELQIVNATNLQLEASVKLPSRVPYGFHGTFIDSE  601

Query  361  DLSSQA  378
            DL SQA
Sbjct  602  DLVSQA  607



>gb|AAY82458.1| 9-cis-epoxycarotenoid dioxygenase 1 [Cuscuta reflexa]
Length=586

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEV+KF+YG+EKYGGEPLFLP  
Sbjct  465  AGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVEKFMYGEEKYGGEPLFLP--  522

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                ++ EEDDGYIL F HDEKA KSELQIVNAQTL+LEA+VKLPSRVPYGFHGTFINA 
Sbjct  523  --GDDEAEEDDGYILTFAHDEKAWKSELQIVNAQTLKLEATVKLPSRVPYGFHGTFINAM  580

Query  361  DLSSQA  378
            DL++Q 
Sbjct  581  DLATQV  586



>gb|AFP57677.1| 9-cis-epoxycarotenoid dioxygenase 3 protein family isoform 1 
[Nicotiana tabacum]
Length=613

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 116/126 (92%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++AYLAIAEPWPKVSGFAKVDLFTGEV+KFIYGD K+GGEPLFLPR+
Sbjct  491  AGMVNRNKLGRKTRFAYLAIAEPWPKVSGFAKVDLFTGEVEKFIYGDNKFGGEPLFLPRD  550

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+    EDDGYILAFVH+EK  KSELQIVNA T++LEA+VKLP+RVPYGFHGTFINA 
Sbjct  551  PNSK---AEDDGYILAFVHNEKEWKSELQIVNAMTMKLEATVKLPTRVPYGFHGTFINAK  607

Query  361  DLSSQA  378
            D+++QA
Sbjct  608  DMANQA  613



>ref|XP_009615476.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=613

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 116/126 (92%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++AYLAIAEPWPKVSGFAKVDLFTGEV+KFIYGD K+GGEPLFLPR+
Sbjct  491  AGMVNRNKLGRKTRFAYLAIAEPWPKVSGFAKVDLFTGEVEKFIYGDNKFGGEPLFLPRD  550

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+    EDDGYILAFVH+EK  KSELQIVNA T++LEA+VKLP+RVPYGFHGTFINA 
Sbjct  551  PNSK---AEDDGYILAFVHNEKEWKSELQIVNAMTMKLEATVKLPTRVPYGFHGTFINAK  607

Query  361  DLSSQA  378
            D+++QA
Sbjct  608  DMANQA  613



>ref|XP_009797946.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Nicotiana sylvestris]
Length=609

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++AYLAIAEPWPKVSGFAKVDLFTGEV+KFIYGD K+GGEPLFLPR+
Sbjct  487  AGMVNRNKLGRKTRFAYLAIAEPWPKVSGFAKVDLFTGEVEKFIYGDNKFGGEPLFLPRD  546

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+    EDDGYILAF H+EK  KSELQIVNA T++LEA+VKLP+RVPYGFHGTFINA 
Sbjct  547  PNSK---AEDDGYILAFAHNEKEWKSELQIVNAMTMKLEATVKLPTRVPYGFHGTFINAK  603

Query  361  DLSSQA  378
            DL++QA
Sbjct  604  DLANQA  609



>dbj|BAE72091.1| Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 2
Length=607

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+N LGRK++YAYLAIAEPWPKVSGFAKVDL TG+ +KFIYGDEKYGGEPLFLPR+
Sbjct  485  AGMVNKNLLGRKSKYAYLAIAEPWPKVSGFAKVDLSTGDTQKFIYGDEKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDG+ILAFVHDEK  KSELQIVNA T+ELEA+VKLPSRVPYGFHGTFINA 
Sbjct  545  PNS---EAEDDGHILAFVHDEKTWKSELQIVNAMTMELEATVKLPSRVPYGFHGTFINAK  601

Query  361  DLSSQA  378
            DL++QA
Sbjct  602  DLATQA  607



>ref|XP_011098124.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Sesamum indicum]
Length=605

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 113/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEV KF YG+EKYGGEPLFLP +
Sbjct  483  AGMVNRNWLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVNKFFYGEEKYGGEPLFLPTD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS     EDDGYILAFVHDEKA KSELQIVNA+T+ LEASVKLPSRVPYGFHGTFI+A 
Sbjct  543  PNSG---AEDDGYILAFVHDEKAWKSELQIVNAKTMSLEASVKLPSRVPYGFHGTFISAK  599

Query  361  DLSSQA  378
            DL++QA
Sbjct  600  DLANQA  605



>ref|XP_010694572.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=598

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKF YGD  YGGEPLFLPR+
Sbjct  476  AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFEYGDGTYGGEPLFLPRD  535

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDE   +SEL+IVNA TLEL A+VKLPSRVPYGFHGTFINA 
Sbjct  536  ANS---EREDDGYILAFVHDEINWESELKIVNAMTLELVATVKLPSRVPYGFHGTFINAK  592

Query  361  DLSSQA  378
            DL +QA
Sbjct  593  DLMAQA  598



>gb|AFM77567.1| 9-cis-epoxycarotenoid dioxygenase, partial [Pyrus pyrifolia]
Length=427

 Score =   209 bits (532),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQ+AYLA+AEPWPKVSGFAKVDL TGEVKK IYGDEKYGGEPLFLPR+
Sbjct  305  AGMVNRNKLGRKTQFAYLALAEPWPKVSGFAKVDLSTGEVKKHIYGDEKYGGEPLFLPRD  364

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSELQIVNA  L++EA+++LPSRVPYGFHGTFI+  
Sbjct  365  PNS---ENEDDGYILAFVHDEKKWKSELQIVNAMDLKVEATIQLPSRVPYGFHGTFISTK  421

Query  361  DLSSQA  378
            DL  QA
Sbjct  422  DLKKQA  427



>ref|XP_004300667.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
 gb|AFU61915.1| 9-cis-epoxycarotenoid dioxygenase 2 [Fragaria x ananassa]
Length=619

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++AYLA+AEPWPKVSGFAKVDLFTGEVKK IYG++++GGEPLFLPR+
Sbjct  497  AGMVNRNKLGRKTRFAYLALAEPWPKVSGFAKVDLFTGEVKKHIYGEQRFGGEPLFLPRD  556

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSELQIVNA TL+LEAS+KLPSRVPYGFHGTFI++ 
Sbjct  557  PNS---ENEDDGYILAFVHDEKEWKSELQIVNAMTLKLEASIKLPSRVPYGFHGTFISSK  613

Query  361  DLSSQA  378
            DL  QA
Sbjct  614  DLQKQA  619



>dbj|BAF36657.2| putative 9-cis-epoxycarotenoid dioxygenase [Chrysanthemum x morifolium]
Length=582

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 113/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+N LGRKT++AYLAIAEPWPKVSGFAKVDL TGE KKFIYGDEKYGGEPLFLPR+
Sbjct  460  AGMVNKNLLGRKTKFAYLAIAEPWPKVSGFAKVDLQTGETKKFIYGDEKYGGEPLFLPRD  519

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDG+ILAFVHDEK  KSELQIVNA TLELEA VKLPSRVPYGFHGTFI+A 
Sbjct  520  PNS---EAEDDGHILAFVHDEKTWKSELQIVNAMTLELEAVVKLPSRVPYGFHGTFISAK  576

Query  361  DLSSQA  378
            DL++QA
Sbjct  577  DLATQA  582



>gb|KHN26771.1| 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic [Glycine 
soja]
Length=305

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 113/126 (90%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++ YLA+AEPWPKVSGFAKVDLF+GEVKK++YG+E++GGEPLFLP  
Sbjct  184  AGMVNRNKLGRKTKFGYLALAEPWPKVSGFAKVDLFSGEVKKYMYGEERFGGEPLFLPNG  243

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            V    D +EDDG+ILAFVHDEK  KSELQIVNA+TL+LEASVKLPSRVPYGFHGTFI++ 
Sbjct  244  V----DGDEDDGHILAFVHDEKEWKSELQIVNAKTLKLEASVKLPSRVPYGFHGTFIHSK  299

Query  361  DLSSQA  378
            DL  QA
Sbjct  300  DLRKQA  305



>gb|ACH58414.1| 9-cis-epoxycarotenoid dioxygenase, partial [Prunus dulcis]
Length=145

 Score =   199 bits (507),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 106/117 (91%), Gaps = 3/117 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK IYGDEKYGGEPLFLPR+
Sbjct  32   AGMVNRNKLGRKTRFAYLALAEPWPKVSGFAKVDLSTGEVKKHIYGDEKYGGEPLFLPRD  91

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFI  351
             NS   E EDDGYILAFVHDEK  KSELQIVNA  L++EA+++LPSRVPYGFHGTFI
Sbjct  92   PNS---ENEDDGYILAFVHDEKEWKSELQIVNAMDLKVEATIQLPSRVPYGFHGTFI  145



>gb|KDO50508.1| hypothetical protein CISIN_1g007379mg [Citrus sinensis]
Length=606

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TG+V KFIYGD++YGGEPLF PR+
Sbjct  484  AGMVNRNLLGRKTRFAYLALAEPWPKVSGFAKVDLLTGQVNKFIYGDQRYGGEPLFFPRD  543

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI A 
Sbjct  544  PNS---ENEDDGYILAFVHDEKEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFIGAK  600

Query  361  DLSSQA  378
            DL+ QA
Sbjct  601  DLAKQA  606



>ref|XP_011096581.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Sesamum indicum]
Length=603

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT+YAYLAIAEPWPKVSGFAKVDL TG+V+KFIYGD +YGGEP F+PR+
Sbjct  481  AGMVNRNRLGRKTRYAYLAIAEPWPKVSGFAKVDLSTGKVEKFIYGDRRYGGEPFFVPRD  540

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYIL+FVHDEKA KSELQIVN+ TL+LEASV+LPSRVPYGFHGTFI++ 
Sbjct  541  PNS---EREDDGYILSFVHDEKAWKSELQIVNSMTLKLEASVRLPSRVPYGFHGTFISSR  597

Query  361  DLSSQA  378
            DL +QA
Sbjct  598  DLENQA  603



>dbj|BAE72092.1| Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 3
Length=583

 Score =   210 bits (534),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+N LGRK++YAYLAIAEPWPKVSGFAKVDL TGE KKFIYG++KYGGEPLFLPR+
Sbjct  461  AGMVNKNLLGRKSKYAYLAIAEPWPKVSGFAKVDLSTGETKKFIYGNQKYGGEPLFLPRD  520

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDG+IL FVHDEK  KSELQIVNA TL+LEA+VKLPSRVPYGFHGTFI+A+
Sbjct  521  PNS---ETEDDGHILTFVHDEKTWKSELQIVNAITLQLEATVKLPSRVPYGFHGTFISAN  577

Query  361  DLSSQA  378
            DL++QA
Sbjct  578  DLATQA  583



>gb|ACU86971.1| 9-cis-epoxycarotenoid dioxygenase [Caragana korshinskii]
Length=605

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQ+AYLA+AEPWPKVSGFAKVDLF+GEVKK++YG+ ++GGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTQFAYLALAEPWPKVSGFAKVDLFSGEVKKYLYGEGRFGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYIL FVHDEK  KSELQIVNA  L+LEAS+KLPSRVPYGFHGTFI+++
Sbjct  543  PNS---EREDDGYILTFVHDEKEWKSELQIVNAMNLKLEASIKLPSRVPYGFHGTFIHSN  599

Query  361  DLSSQA  378
            DL  QA
Sbjct  600  DLRKQA  605



>ref|XP_008382970.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Malus domestica]
Length=615

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQ AYLA+AEPWPKVSGFAKVDL TGEVKK IYGDEKYGGEPLFLPR+
Sbjct  493  AGMVNRNKLGRKTQSAYLALAEPWPKVSGFAKVDLSTGEVKKHIYGDEKYGGEPLFLPRD  552

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E+EDDGYILAFVHDEK  KSELQIVN   L++EA+++LPSRVPYGFHGTFI+A 
Sbjct  553  PNS---EDEDDGYILAFVHDEKKWKSELQIVNTMDLKVEATIQLPSRVPYGFHGTFISAK  609

Query  361  DLSSQA  378
            DL  QA
Sbjct  610  DLKKQA  615



>ref|XP_006442236.1| hypothetical protein CICLE_v10019364mg [Citrus clementina]
 gb|ABC26013.1| 9-cis-epoxycarotenoid dioxygenase 3 [Citrus clementina]
 gb|ESR55476.1| hypothetical protein CICLE_v10019364mg [Citrus clementina]
Length=606

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TG+V KFIYG ++YGGEPLF PR+
Sbjct  484  AGMVNRNLLGRKTRFAYLALAEPWPKVSGFAKVDLLTGQVNKFIYGGQRYGGEPLFFPRD  543

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI+A 
Sbjct  544  PNS---ENEDDGYILAFVHDEKEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISAK  600

Query  361  DLSSQA  378
            DL+ QA
Sbjct  601  DLAKQA  606



>gb|ADQ74072.1| 9-cis-epoxycarotenoid dioxygenase [Solanum ochranthum]
 gb|ADQ74073.1| 9-cis-epoxycarotenoid dioxygenase [Solanum ochranthum]
Length=592

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  480  AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVEKFIYGDNKYGGEPLFLPRD  539

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  540  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  592



>ref|XP_006449708.1| hypothetical protein CICLE_v10014639mg [Citrus clementina]
 gb|ABC26010.1| 9-cis-epoxycarotenoid dioxygenase 5 [Citrus clementina]
 gb|ESR62948.1| hypothetical protein CICLE_v10014639mg [Citrus clementina]
Length=609

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKTQ+AYLAIAEPWPKVSGFAKVDL +GEVKK+ YGD KYGGEP FLPR+
Sbjct  486  AGMVNRNSLGRKTQFAYLAIAEPWPKVSGFAKVDLSSGEVKKYFYGDNKYGGEPFFLPRD  545

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N+ E+  EDDGYILAFVHDEK  KSELQIVNA  L+LEAS+KLPSRVPYGFHGTF+++ 
Sbjct  546  ANNSEN--EDDGYILAFVHDEKTWKSELQIVNAMNLQLEASIKLPSRVPYGFHGTFVDSK  603

Query  361  DLSSQA  378
            DL +QA
Sbjct  604  DLVNQA  609



>gb|AAS47838.1| 9-cis-epoxycarotenoid dioxygenase [Gentiana lutea]
Length=604

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDLF+GEVKKF YGDEKYGGEPLFLP +
Sbjct  482  AGMVNRNILGRKTRYAYLAIAEPWPKVSGFAKVDLFSGEVKKFFYGDEKYGGEPLFLPND  541

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDG+ILAFVH+EK  KSEL+IVNA TLE EA+VKLPSRVPYGFHGTF++A 
Sbjct  542  SNS---EVEDDGHILAFVHNEKTSKSELRIVNAMTLEEEATVKLPSRVPYGFHGTFMSAK  598

Query  361  DLSSQA  378
            DL +QA
Sbjct  599  DLENQA  604



>gb|KDO78199.1| hypothetical protein CISIN_1g007291mg [Citrus sinensis]
Length=609

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKTQ+AYLAIAEPWPKVSGFAKVDL +GEVKK+ YGD KYGGEP FLPR+
Sbjct  486  AGMVNRNSLGRKTQFAYLAIAEPWPKVSGFAKVDLSSGEVKKYFYGDNKYGGEPFFLPRD  545

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N+ E+  EDDGYILAFVHDEK  KSELQIVNA  L+LEAS+KLPSRVPYGFHGTF+++ 
Sbjct  546  ANNSEN--EDDGYILAFVHDEKTWKSELQIVNAMNLQLEASIKLPSRVPYGFHGTFVDSK  603

Query  361  DLSSQA  378
            DL +QA
Sbjct  604  DLVNQA  609



>ref|XP_007214657.1| hypothetical protein PRUPE_ppa002804mg [Prunus persica]
 gb|EMJ15856.1| hypothetical protein PRUPE_ppa002804mg [Prunus persica]
Length=632

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK IYGDEKYGGEPLFLPR+
Sbjct  510  AGMVNRNKLGRKTRFAYLALAEPWPKVSGFAKVDLSTGEVKKHIYGDEKYGGEPLFLPRD  569

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSELQIVNA  L++EA+++LPSRVPYGFHGTFI++ 
Sbjct  570  PNS---ENEDDGYILAFVHDEKEWKSELQIVNAMDLKIEATIQLPSRVPYGFHGTFISSK  626

Query  361  DLSSQA  378
            DL  QA
Sbjct  627  DLEKQA  632



>ref|XP_009783401.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Nicotiana sylvestris]
Length=599

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+NKLGRKTQYAYLAIAEPWP+VSG AKVDL TGEV+K++YGD +YGGEPLFLPRN
Sbjct  477  AGMVNKNKLGRKTQYAYLAIAEPWPRVSGLAKVDLSTGEVQKYMYGDTRYGGEPLFLPRN  536

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               Q  E+EDDGYILAFVHDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTF++  
Sbjct  537  ---QCTEKEDDGYILAFVHDEKIWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFVSKK  593

Query  361  DLSSQA  378
            DL +Q 
Sbjct  594  DLENQV  599



>ref|XP_007022180.1| Nine-cis-epoxycarotenoid dioxygenase 3 [Theobroma cacao]
 gb|EOY13705.1| Nine-cis-epoxycarotenoid dioxygenase 3 [Theobroma cacao]
Length=613

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK+IYGD++YGGEPLF PRN
Sbjct  491  AGMVNRNLLGRKTRFAYLALAEPWPKVSGFAKVDLSTGEVKKYIYGDQRYGGEPLFFPRN  550

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  +SELQIVNA  L+LEA+VKLPSRVPYGFHGTFI++ 
Sbjct  551  PNS---ENEDDGYILAFVHDEKTWQSELQIVNAMNLQLEATVKLPSRVPYGFHGTFISSK  607

Query  361  DLSSQA  378
            DL  QA
Sbjct  608  DLEKQA  613



>emb|CBI32922.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKTQ+AYLA+AEPWPKVSGFAKVDL TG+V K+IYG+++YGGEPLFLPR+
Sbjct  352  AGMVNRNRLGRKTQFAYLAVAEPWPKVSGFAKVDLSTGQVSKYIYGEQRYGGEPLFLPRD  411

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS     EDDGYILAFVHDEK  KSELQIVNA  L+LEASVKLPSRVPYGFHGTFI++ 
Sbjct  412  PNSG---REDDGYILAFVHDEKTWKSELQIVNATNLQLEASVKLPSRVPYGFHGTFISSK  468

Query  361  DLSSQA  378
            +L  QA
Sbjct  469  ELEKQA  474



>gb|ADN65136.1| 9-cis-epoxycarotenoid dioxygenase [Prunus avium]
Length=427

 Score =   204 bits (519),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK IYGDEKYGGEPLFLPR+
Sbjct  305  AGMVNRNKLGRKTRFAYLALAEPWPKVSGFAKVDLSTGEVKKHIYGDEKYGGEPLFLPRD  364

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFV DEK  KSELQIVNA  L++EA+++LPSRVPYGFHGTFI++ 
Sbjct  365  PNS---ENEDDGYILAFVQDEKEWKSELQIVNAMDLKVEATIQLPSRVPYGFHGTFISSK  421

Query  361  DLSSQA  378
            DL  QA
Sbjct  422  DLVKQA  427



>gb|AEK99289.1| 9-cis-epoxycarotenoid dioxygenase [Cucumis melo]
Length=428

 Score =   204 bits (519),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 4/125 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKTQ++YLA+AEPWPKVSGFAKVDLFTGE+KK++YG+++YGGEPLFLPR 
Sbjct  306  AGMVNRNLLGRKTQFSYLALAEPWPKVSGFAKVDLFTGEIKKYLYGEQRYGGEPLFLPR-  364

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +  E EDDG+ILAFVHDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI+++
Sbjct  365  ---EGAEAEDDGHILAFVHDEKEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISSE  421

Query  361  DLSSQ  375
            DL  Q
Sbjct  422  DLQKQ  426



>gb|AAY98512.2| 9-cis-epoxycarotenoid dioxygenase [Stylosanthes guianensis]
Length=602

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 113/126 (90%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+NKLGRK+Q+AYLA+AEPWPKVSGFAKVDL TGEVKK+IYGDEK+GGEP+FLPR+
Sbjct  480  AGMVNKNKLGRKSQFAYLALAEPWPKVSGFAKVDLSTGEVKKYIYGDEKFGGEPMFLPRS  539

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +S   + EDDGYILAFVHDEK  KSELQ+VNA TLELEA+++LPSRVPYGFHGTFI + 
Sbjct  540  PSS---DREDDGYILAFVHDEKEWKSELQVVNAMTLELEATIELPSRVPYGFHGTFIQSK  596

Query  361  DLSSQA  378
            DL  QA
Sbjct  597  DLRKQA  602



>ref|XP_009367762.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009367763.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=617

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNR+KLGRKTQ+AYLA+AEPWPKVSGFAKVDL TGEVKK IYGDEKYGGEPLFLPR+
Sbjct  495  AGMVNRDKLGRKTQFAYLALAEPWPKVSGFAKVDLPTGEVKKHIYGDEKYGGEPLFLPRD  554

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSE+QIVNA  L++EA+++LPSRVPYGFHGTFI+  
Sbjct  555  PNS---ENEDDGYILAFVHDEKKWKSEMQIVNAMDLKVEATIQLPSRVPYGFHGTFISTK  611

Query  361  DLSSQA  378
            DL +QA
Sbjct  612  DLKNQA  617



>ref|NP_001275864.1| putative 9-cis-epoxycarotenoid dioxygenase 3 [Citrus sinensis]
 gb|AER70359.1| putative 9-cis-epoxycarotenoid dioxygenase 3 [Citrus sinensis]
Length=606

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TG+V KFIYG ++YGGEPLF PR+
Sbjct  484  AGMVNRNLLGRKTRFAYLALAEPWPKVSGFAKVDLLTGQVNKFIYGGQRYGGEPLFFPRD  543

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSELQIVNA TLELEA+VKLPS+VPYGFHGTFI+A 
Sbjct  544  PNS---ENEDDGYILAFVHDEKEWKSELQIVNAMTLELEATVKLPSQVPYGFHGTFISAK  600

Query  361  DLSSQA  378
            DL+ QA
Sbjct  601  DLAKQA  606



>ref|NP_001275868.1| 9-cis-epoxycarotenoid dioxygenase 2 [Citrus sinensis]
 gb|AAY89371.1| 9-cis-epoxycarotenoid dioxygenase 2 [Citrus sinensis]
Length=609

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 110/126 (87%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKTQ+AYLAIAEPWPKVSGFAKVDL +GEVKK+ YGD KYGGEP F PR+
Sbjct  486  AGMVNRNSLGRKTQFAYLAIAEPWPKVSGFAKVDLSSGEVKKYFYGDNKYGGEPFFFPRD  545

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N+ E+  EDDGYILAFVHDEK  KSELQIVNA  L+LEAS+KLPSRVPYGFHGTF+++ 
Sbjct  546  ANNSEN--EDDGYILAFVHDEKTWKSELQIVNAMNLQLEASIKLPSRVPYGFHGTFVDSK  603

Query  361  DLSSQA  378
            DL +QA
Sbjct  604  DLVNQA  609



>ref|XP_008226239.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Prunus mume]
Length=622

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK IYGDEKYGGEPLFLPR+
Sbjct  500  AGMVNRNKLGRKTRFAYLALAEPWPKVSGFAKVDLSTGEVKKHIYGDEKYGGEPLFLPRD  559

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVH+EK  KSELQIVNA  L++EA+++LPSRVPYGFHGTFI++ 
Sbjct  560  PNS---ENEDDGYILAFVHNEKEWKSELQIVNAMDLKVEATIQLPSRVPYGFHGTFISSK  616

Query  361  DLSSQA  378
            DL  QA
Sbjct  617  DLEKQA  622



>gb|AGV54468.1| 9-cis-epoxycarotenoid dioxygenase [Phaseolus vulgaris]
Length=615

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 6/126 (5%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQ+AYLA+AEPWPKVSGFAKVDLF+GEV+K++YG+EK+GGEPLFLP  
Sbjct  496  AGMVNRNKLGRKTQFAYLALAEPWPKVSGFAKVDLFSGEVQKYMYGEEKFGGEPLFLPNG  555

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                  EEE DGYILAFVHDEK  KSELQIVNAQ L+LEAS+KLPSRVPYGFHGTFI++ 
Sbjct  556  ------EEEGDGYILAFVHDEKEWKSELQIVNAQNLKLEASIKLPSRVPYGFHGTFIHSK  609

Query  361  DLSSQA  378
            DL  QA
Sbjct  610  DLRKQA  615



>dbj|BAE72090.1| Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 1
Length=585

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNR+KLGRKTQ+AYLAIAEPWPKVSGFAKVDL TGE+KKF YGDE+YGGEP FLP  
Sbjct  461  AGMVNRDKLGRKTQFAYLAIAEPWPKVSGFAKVDLTTGEIKKFFYGDERYGGEPFFLPSG  520

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NSQ    EDDGYIL+FVHDE   KSELQI+NA T+ +EASVKLPSRVPYGFHGTFI++ 
Sbjct  521  RNSQ---REDDGYILSFVHDENTWKSELQIINAMTMLMEASVKLPSRVPYGFHGTFISSK  577

Query  361  DLSSQA  378
            DL+ QA
Sbjct  578  DLAEQA  583



>gb|ADQ74055.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=593

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  481  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  540

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  541  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  593



>ref|XP_010247741.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Nelumbo nucifera]
Length=622

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRK+Q+AYLAIAEPWP+VSGFAKVDL TGEV KF+YGD  YGGEP F+PR+
Sbjct  500  AGMVNRNRLGRKSQFAYLAIAEPWPRVSGFAKVDLTTGEVSKFMYGDRCYGGEPFFVPRH  559

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAF+HDEK  KSEL IVNA  L+LEASVKLPSRVPYGFHGTFIN++
Sbjct  560  PNS---EREDDGYILAFMHDEKTSKSELVIVNAMNLQLEASVKLPSRVPYGFHGTFINSN  616

Query  361  DLSSQA  378
            DL  QA
Sbjct  617  DLEKQA  622



>gb|ADQ74052.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74058.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74062.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74027.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=595

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74044.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74045.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74056.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74057.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74070.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74071.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>dbj|BAF36655.1| putative 9-cis-epoxycarotenoid dioxygenase [Chrysanthemum x morifolium]
Length=601

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 113/126 (90%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+N LGRK++YAYLAIAEPWPKVSGFAKVDL TGE KKFIYGDEKYGGEPL+LPR+
Sbjct  480  AGMVNKNLLGRKSKYAYLAIAEPWPKVSGFAKVDLSTGETKKFIYGDEKYGGEPLYLPRD  539

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S    +EDDG+ILAFVHDEKA KSELQIVNA+T++LEA+V LPSRVPYGFHGTFI A 
Sbjct  540  NAS----DEDDGHILAFVHDEKAWKSELQIVNAKTMKLEATVMLPSRVPYGFHGTFIPAR  595

Query  361  DLSSQA  378
            DL+SQA
Sbjct  596  DLASQA  601



>gb|ADQ74019.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  545  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74047.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74049.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74051.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74067.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>ref|XP_007149219.1| hypothetical protein PHAVU_005G051600g [Phaseolus vulgaris]
 gb|ESW21213.1| hypothetical protein PHAVU_005G051600g [Phaseolus vulgaris]
Length=615

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 6/126 (5%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQ+AYLA+AEPWPKVSGFAKVDLF+GEV+K++YG+EK+GGEPLFLP  
Sbjct  496  AGMVNRNKLGRKTQFAYLALAEPWPKVSGFAKVDLFSGEVQKYMYGEEKFGGEPLFLPNG  555

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                  EEE DGYILAFVHDEK  KSELQIVNAQ L+LEAS+KLPSRVPYGFHGTFI++ 
Sbjct  556  ------EEEGDGYILAFVHDEKEWKSELQIVNAQNLKLEASIKLPSRVPYGFHGTFIHSK  609

Query  361  DLSSQA  378
            DL  QA
Sbjct  610  DLRKQA  615



>gb|ADQ74069.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74054.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74048.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=596

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  484  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  543

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  544  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  596



>gb|ADQ74018.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  545  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74042.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74043.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|KCW69861.1| hypothetical protein EUGRSUZ_F03199 [Eucalyptus grandis]
Length=569

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLA+AEPWPKVSGFAKVDL TGEV+K++YG+E+YGGEP+F+PR 
Sbjct  447  AGMVNRNLLGRKTRYAYLALAEPWPKVSGFAKVDLSTGEVRKYMYGEERYGGEPMFVPR-  505

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S++ E EDDGY+LAFVHDEK   SELQIVNA TLELEA+VKLPSRVPYGFHGTFI++ 
Sbjct  506  --SRDSEREDDGYVLAFVHDEKERSSELQIVNAVTLELEATVKLPSRVPYGFHGTFISSK  563

Query  361  DLSSQA  378
            DL  QA
Sbjct  564  DLERQA  569



>gb|ADQ74025.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=595

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74013.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74014.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74015.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  545  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|AIG92852.1| 9-cis-epoxycarotenoid dioxygenase [Malus prunifolia]
Length=614

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++ YLA+AEPWPKVSGFAKVDL TGEVKK IYG+EKYGGEPLFLPR+
Sbjct  492  AGMVNRNRLGRKTRFTYLALAEPWPKVSGFAKVDLSTGEVKKHIYGEEKYGGEPLFLPRD  551

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSELQIVNA  L++EA+++LPSRVPYGFHGTFI+A 
Sbjct  552  PNS---ENEDDGYILAFVHDEKEWKSELQIVNAMDLKVEATIQLPSRVPYGFHGTFISAK  608

Query  361  DLSSQA  378
            DL  QA
Sbjct  609  DLEMQA  614



>sp|Q9M6E8.1|NCED1_PHAVU RecName: Full=9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic; 
AltName: Full=PvNCED1; Flags: Precursor [Phaseolus 
vulgaris]
 gb|AAF26356.1|AF190462_1 9-cis-epoxycarotenoid dioxygenase [Phaseolus vulgaris]
Length=615

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 6/126 (5%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQ+AYLA+AEPWPKVSGFAKVDLF+GEV+K++YG+EK+GGEPLFLP  
Sbjct  496  AGMVNRNKLGRKTQFAYLALAEPWPKVSGFAKVDLFSGEVQKYMYGEEKFGGEPLFLPNG  555

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                  EEE DGYILAFVHDEK  KSELQIVNAQ L+LEAS+KLPSRVPYGFHGTFI++ 
Sbjct  556  ------EEEGDGYILAFVHDEKEWKSELQIVNAQNLKLEASIKLPSRVPYGFHGTFIHSK  609

Query  361  DLSSQA  378
            DL  QA
Sbjct  610  DLRKQA  615



>gb|ADQ74065.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74039.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=596

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  484  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  543

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  544  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  596



>gb|ADQ74050.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74017.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  545  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|AAY89370.1| 9-cis-epoxycarotenoid dioxygenase 1 [Citrus sinensis]
Length=605

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TG+V KFIYGD++YGGEPLF  R+
Sbjct  483  AGMVNRNLLGRKTRFAYLALAEPWPKVSGFAKVDLLTGQVNKFIYGDQRYGGEPLFFSRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSEL IVNA TLELEA+VKLPSRVPYGFHGTFI A 
Sbjct  543  PNS---ENEDDGYILAFVHDEKEWKSELPIVNAMTLELEATVKLPSRVPYGFHGTFIGAK  599

Query  361  DLSSQA  378
            DL+ QA
Sbjct  600  DLAKQA  605



>gb|ADQ74016.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  545  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74061.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74038.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  545  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74059.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74063.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74064.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74066.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74068.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74032.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74033.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74034.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74035.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74037.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74041.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  545  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74020.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  545  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>ref|XP_011029543.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Populus euphratica]
Length=592

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRK+++AYLA+AEPWPKVSGFAKVDL TGEV K+IYGD+K+GGEPLFLPR+
Sbjct  470  AGMVNRNLLGRKSRFAYLALAEPWPKVSGFAKVDLSTGEVHKYIYGDQKFGGEPLFLPRD  529

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSELQIVNA  L+LEA+VKLPSRVPYGFHGTFI A 
Sbjct  530  PNS---EREDDGYILAFVHDEKEWKSELQIVNAMNLKLEATVKLPSRVPYGFHGTFIGAK  586

Query  361  DLSSQA  378
            DL  QA
Sbjct  587  DLEKQA  592



>gb|ADQ74040.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  545  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74022.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74023.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=598

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  486  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  545

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  546  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  598



>gb|ADQ74036.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=593

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  481  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  540

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  541  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  593



>gb|ADQ74030.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=598

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  486  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  545

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  546  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  598



>gb|ADQ74028.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=595

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>ref|XP_010060796.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW67664.1| hypothetical protein EUGRSUZ_F01409 [Eucalyptus grandis]
Length=600

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 114/126 (90%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDL TG+V+KF+YG+++YGGEPLFLPR 
Sbjct  477  AGMVNRNRLGRKTRFAYLALAEPWPKVSGFAKVDLATGQVRKFMYGEQRYGGEPLFLPRE  536

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +S     EDDGY+LAFVHDEK  +SELQIVNA TLELEA+V+LPSRVPYGFHGTFI+A+
Sbjct  537  ASSGSG--EDDGYVLAFVHDEKEWRSELQIVNAATLELEATVQLPSRVPYGFHGTFISAE  594

Query  361  DLSSQA  378
            DL+ QA
Sbjct  595  DLAKQA  600



>gb|ADQ74012.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  545  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|AAR11193.1| 9-cis-epoxycarotenoid dioxygenase 1 [Vitis vinifera]
Length=610

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKTQ+AYLA+AEPWPKVSGFAKVDL TG+V K+IYG+++YGGEPLFLPR+
Sbjct  488  AGMVNRNRLGRKTQFAYLAVAEPWPKVSGFAKVDLSTGQVSKYIYGEQRYGGEPLFLPRD  547

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS     EDDGYILAFVHDEK  KSELQIVNA  L+LEASVKLPSRVPYGFHGTFI++ 
Sbjct  548  PNSG---REDDGYILAFVHDEKTWKSELQIVNATNLQLEASVKLPSRVPYGFHGTFISSK  604

Query  361  DLSSQA  378
            +L  QA
Sbjct  605  ELEKQA  610



>ref|NP_001268199.1| 9-cis-epoxycarotenoid dioxygenase 1 [Vitis vinifera]
 gb|AFP28804.1| 9-cis epoxy carotenoid dioxygenase 3 [Vitis vinifera]
Length=610

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKTQ+AYLA+AEPWPKVSGFAKVDL TG+V K+IYG+++YGGEPLFLPR+
Sbjct  488  AGMVNRNRLGRKTQFAYLAVAEPWPKVSGFAKVDLSTGQVSKYIYGEQRYGGEPLFLPRD  547

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS     EDDGYILAFVHDEK  KSELQIVNA  L+LEASVKLPSRVPYGFHGTFI++ 
Sbjct  548  PNSG---REDDGYILAFVHDEKTWKSELQIVNATNLQLEASVKLPSRVPYGFHGTFISSK  604

Query  361  DLSSQA  378
            +L  QA
Sbjct  605  ELEKQA  610



>gb|ADQ74024.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74026.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
 gb|ADQ74031.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KFIYGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFIYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  545  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>emb|CAN81383.1| hypothetical protein VITISV_018449 [Vitis vinifera]
Length=610

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKTQ+AYLA+AEPWPKVSGFAKVDL TG+V K+IYG+++YGGEPLFLPR+
Sbjct  488  AGMVNRNRLGRKTQFAYLAVAEPWPKVSGFAKVDLSTGQVSKYIYGEQRYGGEPLFLPRD  547

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS     EDDGYILAFVHDEK  KSELQIVNA  L+LEASVKLPSRVPYGFHGTFI++ 
Sbjct  548  PNSG---REDDGYILAFVHDEKTWKSELQIVNATNLQLEASVKLPSRVPYGFHGTFISSK  604

Query  361  DLSSQA  378
            +L  QA
Sbjct  605  ELEKQA  610



>ref|XP_009354854.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Pyrus x bretschneideri]
Length=613

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK IYG+EKYGGEP+FLPR+
Sbjct  491  AGMVNRNKLGRKTRFAYLALAEPWPKVSGFAKVDLSTGEVKKHIYGEEKYGGEPMFLPRD  550

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N    E EDDGYILAFVHDEK  KSELQIVNA  L++EA+++LPSRVPYGFHGTFI+A 
Sbjct  551  PNW---ENEDDGYILAFVHDEKEWKSELQIVNAMDLKVEATIQLPSRVPYGFHGTFISAK  607

Query  361  DLSSQA  378
            DL  QA
Sbjct  608  DLEKQA  613



>emb|CDY57471.1| BnaCnng32080D [Brassica napus]
Length=396

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 110/126 (87%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDLFTGEVKK++YG ++YGGEPLFLP  
Sbjct  275  AGMVNRNMLGRKTRFAYLALAEPWPKVSGFAKVDLFTGEVKKYLYGGDRYGGEPLFLP--  332

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                E+  EDDGYIL FVHDE+  KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI A+
Sbjct  333  --GDENRAEDDGYILCFVHDEETWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAN  390

Query  361  DLSSQA  378
            DL++Q 
Sbjct  391  DLATQV  396



>ref|XP_002316871.1| hypothetical protein POPTR_0011s11370g [Populus trichocarpa]
 gb|EEE97483.1| hypothetical protein POPTR_0011s11370g [Populus trichocarpa]
Length=592

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRK+++AYLA+AEPWPKVSGFAKVDL TGEV K+IYGD+K+GGEPLFLPR+
Sbjct  470  AGMVNRNLLGRKSRFAYLALAEPWPKVSGFAKVDLSTGEVHKYIYGDQKFGGEPLFLPRD  529

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSELQIVNA  L+LEA+VKLPSRVPYGFHGTFI A 
Sbjct  530  PNS---EREDDGYILAFVHDEKEWKSELQIVNAMNLKLEATVKLPSRVPYGFHGTFIGAK  586

Query  361  DLSSQA  378
            DL  QA
Sbjct  587  DLEKQA  592



>ref|XP_008465499.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Cucumis melo]
Length=591

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 4/125 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKTQ++YLA+AEPWPKVSGFAKVDLFTGE+KK++YG+++YGGEPLFLPR 
Sbjct  469  AGMVNRNLLGRKTQFSYLALAEPWPKVSGFAKVDLFTGEIKKYLYGEQRYGGEPLFLPR-  527

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +  E EDDG+ILAFVHDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI+++
Sbjct  528  ---EGAEAEDDGHILAFVHDEKEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISSE  584

Query  361  DLSSQ  375
            DL  Q
Sbjct  585  DLQKQ  589



>ref|XP_008378396.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Malus domestica]
Length=614

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++ YLA+AEPWPKVSGFAKVDL TGEVKK IYG+EKYGGEPLFLPR+
Sbjct  492  AGMVNRNRLGRKTRFTYLALAEPWPKVSGFAKVDLSTGEVKKHIYGEEKYGGEPLFLPRD  551

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSELQIVNA  L++EA+++LPSRVPYGFHGTFI A 
Sbjct  552  PNS---ENEDDGYILAFVHDEKEWKSELQIVNAMDLKVEATIQLPSRVPYGFHGTFIXAK  608

Query  361  DLSSQA  378
            DL  QA
Sbjct  609  DLEMQA  614



>gb|KEH38404.1| 9-cis-epoxycarotenoid dioxygenase [Medicago truncatula]
Length=610

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 111/125 (89%), Gaps = 4/125 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+NKLGRKTQ+AYLA+AEPWPKVSGFAKVDLF+GEVKK+IYG+ ++GGEPLFLP  
Sbjct  489  AGMVNKNKLGRKTQFAYLALAEPWPKVSGFAKVDLFSGEVKKYIYGENRFGGEPLFLP--  546

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              + + E EDDGYIL FVHDEK  KSELQIVNA TL+LEAS++LPSRVPYGFHGTFIN++
Sbjct  547  --NSDSENEDDGYILTFVHDEKEWKSELQIVNAATLKLEASIQLPSRVPYGFHGTFINSN  604

Query  361  DLSSQ  375
            DL  Q
Sbjct  605  DLKKQ  609



>ref|XP_007025058.1| Nine-cis-epoxycarotenoid dioxygenase 5 [Theobroma cacao]
 gb|EOY27680.1| Nine-cis-epoxycarotenoid dioxygenase 5 [Theobroma cacao]
Length=613

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 109/126 (87%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEVKK IYGD +YGGEP FLPR+
Sbjct  490  AGMVNRNRLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVKKHIYGDRRYGGEPFFLPRD  549

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N +    EDDGYIL+FVHDEK  KSELQIVNA  L+LEAS+KL SRVPYGFHGTFI+A 
Sbjct  550  DNCE--SAEDDGYILSFVHDEKTWKSELQIVNAMNLQLEASIKLQSRVPYGFHGTFIDAK  607

Query  361  DLSSQA  378
             L +QA
Sbjct  608  ALVNQA  613



>gb|EYU26242.1| hypothetical protein MIMGU_mgv1a025212mg [Erythranthe guttata]
Length=580

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 1/126 (1%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++AYLAIAEPWPKVSGFAKVDL  G+V KF YGDEKYGGEPLFLP+ 
Sbjct  456  AGMVNRNKLGRKTRFAYLAIAEPWPKVSGFAKVDLSNGDVSKFFYGDEKYGGEPLFLPKE  515

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS  D + ++GYILAFVHDEK  KSELQIVNA T+ELEA+V+LPSRVPYGFHGTFI++ 
Sbjct  516  -NSDSDSDCEEGYILAFVHDEKTWKSELQIVNALTMELEATVELPSRVPYGFHGTFISSK  574

Query  361  DLSSQA  378
            DL +QA
Sbjct  575  DLETQA  580



>ref|XP_010062726.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Eucalyptus grandis]
Length=616

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLA+AEPWPKVSGFAKVDL TGEV+K++YG+E+YGGEP+F+PR 
Sbjct  494  AGMVNRNLLGRKTRYAYLALAEPWPKVSGFAKVDLSTGEVRKYMYGEERYGGEPMFVPR-  552

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S++ E EDDGY+LAFVHDEK   SELQIVNA TLELEA+VKLPSRVPYGFHGTFI++ 
Sbjct  553  --SRDSEREDDGYVLAFVHDEKERSSELQIVNAVTLELEATVKLPSRVPYGFHGTFISSK  610

Query  361  DLSSQA  378
            DL  QA
Sbjct  611  DLERQA  616



>gb|ADQ74053.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
 gb|ADQ74060.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 107/116 (92%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT YAYLAIAEPWPKVSGFAKV+LFTGEV+KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTAYAYLAIAEPWPKVSGFAKVNLFTGEVEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|ADQ74021.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE++KF+YGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGEIEKFVYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  545  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>emb|CDX82482.1| BnaA03g33390D [Brassica napus]
Length=396

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 110/126 (87%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDLFTGEVKK++YG ++YGGEPLFLP  
Sbjct  275  AGMVNRNMLGRKTRFAYLALAEPWPKVSGFAKVDLFTGEVKKYLYGGDRYGGEPLFLP--  332

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                E+  EDDGYIL FVHDE+  KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI A+
Sbjct  333  --GDENRAEDDGYILCFVHDEETWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAN  390

Query  361  DLSSQA  378
            DL++Q 
Sbjct  391  DLATQV  396



>dbj|BAB11932.1| neoxanthin cleavage enzyme [Vigna unguiculata]
Length=612

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 6/126 (5%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQ+AYLA+AEPWPKVSGFAKVDL +GEVKK++YG+EK+GGEPLFLP  
Sbjct  493  AGMVNRNKLGRKTQFAYLALAEPWPKVSGFAKVDLLSGEVKKYMYGEEKFGGEPLFLPNG  552

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                  ++EDDGYILAFVHDEK  KSELQIVNAQ L+LEAS+KLPSRVPYGFHGTFI++ 
Sbjct  553  ------QKEDDGYILAFVHDEKEWKSELQIVNAQNLKLEASIKLPSRVPYGFHGTFIHSK  606

Query  361  DLSSQA  378
            DL  QA
Sbjct  607  DLRKQA  612



>gb|KCW75914.1| hypothetical protein EUGRSUZ_D002911, partial [Eucalyptus grandis]
Length=128

 Score =   192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 105/125 (84%), Gaps = 3/125 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKV+L TGEVKK+ YGD +YGGEP F P  
Sbjct  6    AGMVNRNLLGRKTKYAYLAIAEPWPKVSGFAKVNLETGEVKKYFYGDNRYGGEPFFSPA-  64

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               Q+   ED G+ILAFVHDE+A  SELQIVNA+ LELEASVKLPSRVPYGFHGTFI + 
Sbjct  65   --GQDPASEDHGHILAFVHDEEAWTSELQIVNAENLELEASVKLPSRVPYGFHGTFIESK  122

Query  361  DLSSQ  375
            DL+SQ
Sbjct  123  DLASQ  127



>ref|XP_010110953.1| hypothetical protein L484_021647 [Morus notabilis]
 gb|EXC29339.1| hypothetical protein L484_021647 [Morus notabilis]
Length=605

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLAIAEPWPKVSGFAKVDL TGEV+K+ YG+ +YGGEP FLPR+
Sbjct  483  AGMVNRNRLGRKTRFAYLAIAEPWPKVSGFAKVDLRTGEVRKYFYGNRRYGGEPFFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E+EDDG+++AFVHDE+ GKSE+QIVNA  LELEASVKLPSRVPYGFHGTF+++ 
Sbjct  543  PNS---EKEDDGHVMAFVHDERTGKSEMQIVNAVDLELEASVKLPSRVPYGFHGTFVDSK  599

Query  361  DLSSQA  378
            DL  QA
Sbjct  600  DLVHQA  605



>ref|XP_006377601.1| hypothetical protein POPTR_0011s08240g [Populus trichocarpa]
 gb|ERP55398.1| hypothetical protein POPTR_0011s08240g [Populus trichocarpa]
Length=597

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGR+T YAYLAIAEPWPKVSGFAKVDLFTGEVKK++YG++ YGGEP FLP N
Sbjct  475  AGMVNRNRLGRQTNYAYLAIAEPWPKVSGFAKVDLFTGEVKKYMYGNKSYGGEPFFLPTN  534

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N    E EDDGYILAFVHDEK  KSELQIVNA+ L+LEASV+LPSRVPYGFHGTFI+  
Sbjct  535  QNC---ETEDDGYILAFVHDEKTWKSELQIVNAKNLQLEASVRLPSRVPYGFHGTFIDRR  591

Query  361  DLSSQA  378
             L +QA
Sbjct  592  GLVNQA  597



>ref|XP_002316710.2| hypothetical protein POPTR_0011s02230g [Populus trichocarpa]
 gb|EEE97322.2| hypothetical protein POPTR_0011s02230g [Populus trichocarpa]
Length=597

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGR+T YAYLAIAEPWPKVSGFAKVDLFTGEVKK++YG++ YGGEP FLP N
Sbjct  475  AGMVNRNRLGRQTNYAYLAIAEPWPKVSGFAKVDLFTGEVKKYMYGNKSYGGEPFFLPTN  534

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N    E EDDGYILAFVHDEK  KSELQIVNA+ L+LEASV+LPSRVPYGFHGTFI+  
Sbjct  535  QNC---ETEDDGYILAFVHDEKTWKSELQIVNAKNLQLEASVRLPSRVPYGFHGTFIDRR  591

Query  361  DLSSQA  378
             L +QA
Sbjct  592  GLVNQA  597



>gb|AIU94747.1| 9-cis-epoxycarotenoid dioxygenase [Morus alba var. multicaulis]
Length=607

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDLFTG+V K++YGD+++GGEPLFLPR+
Sbjct  482  AGMVNRNRLGRKTRFAYLALAEPWPKVSGFAKVDLFTGQVTKYLYGDQRFGGEPLFLPRD  541

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +     EEDDGYILAFVHDEK  KS+LQI+NA  ++LEAS+ LPSRVPYGFHGTFI++ 
Sbjct  542  SDINSSSEEDDGYILAFVHDEKEWKSQLQIINAMNMKLEASIDLPSRVPYGFHGTFISSK  601

Query  361  DLSSQ  375
            DL  Q
Sbjct  602  DLEKQ  606



>gb|AFO59594.1| 9-cis-epoxycarotenoid dioxygenase, partial [Juglans regia]
Length=417

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 109/119 (92%), Gaps = 3/119 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKTQ+AYLA+AEPWPKV GFAKVDLFTGE+KK++YG+EK+GGEPLFLPR+
Sbjct  302  AGMVNRNMLGRKTQFAYLALAEPWPKVPGFAKVDLFTGELKKYMYGEEKFGGEPLFLPRS  361

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINA  357
             +S   E+EDDGYILAFVHDEK  +SELQI+NA  L+LEA+VKLPSRVPYGFHGTFINA
Sbjct  362  PDS---EKEDDGYILAFVHDEKEWRSELQIINAMDLKLEATVKLPSRVPYGFHGTFINA  417



>gb|ADP20465.1| 9-cis-epoxycarotenoid dioxygenase [Diospyros kaki]
Length=429

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGM NRNKLGRKT++AYLAIAEPWPKVSGFAKVDLF+GEVKK++Y D  YGGEPLFLPR 
Sbjct  307  AGMANRNKLGRKTRFAYLAIAEPWPKVSGFAKVDLFSGEVKKYMYSDGNYGGEPLFLPRG  366

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +    E ED+G+ILAFVH+EK  +SEL+IVNA TL+LEAS+KLPSRVPYGFHGTFI+A+
Sbjct  367  ADC---EAEDEGHILAFVHNEKTDESELRIVNAMTLKLEASIKLPSRVPYGFHGTFISAN  423

Query  361  DLSSQA  378
            DL++QA
Sbjct  424  DLANQA  429



>gb|AHJ80777.1| 9-cis-epoxicarotenoid dioxygenase 1 protein [Citrus reshni]
Length=606

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TG+V KF YG ++YGGEPLF PR+
Sbjct  484  AGMVNRNLLGRKTRFAYLALAEPWPKVSGFAKVDLLTGQVNKFTYGGQRYGGEPLFFPRD  543

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGY LAFVHDE+  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI+A 
Sbjct  544  PNS---ENEDDGYTLAFVHDEEEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISAK  600

Query  361  DLSSQA  378
            DL+ QA
Sbjct  601  DLAKQA  606



>ref|XP_010552176.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Tarenaya hassleriana]
Length=592

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK++YG+++YGGEPLF PR 
Sbjct  469  AGMVNRNMLGRKTRFAYLALAEPWPKVSGFAKVDLSTGEVKKYLYGEDRYGGEPLFFPR-  527

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +   + +EDDGYIL FVHDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI A 
Sbjct  528  -DGSPENQEDDGYILCFVHDEKTWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFIGAS  586

Query  361  DLSSQA  378
            D + QA
Sbjct  587  DTAKQA  592



>gb|ADQ74029.1| 9-cis-epoxycarotenoid dioxygenase [Solanum chilense]
Length=597

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFTGE +KF+YGD KYGGEPLFLPR+
Sbjct  485  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTGETEKFVYGDNKYGGEPLFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  545  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  597



>gb|ADQ74046.1| 9-cis-epoxycarotenoid dioxygenase [Solanum peruvianum]
Length=595

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 3/116 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKV+LFT EV+KFIYGD KYGGEPLFLPR+
Sbjct  483  AGMVNRNKLGRKTEYAYLAIAEPWPKVSGFAKVNLFTDEVEKFIYGDNKYGGEPLFLPRD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS+   EEDDGYILAFVHDEK  KSELQIVNA +L+LEA+VKLPSRVPYGFHGTF
Sbjct  543  PNSK---EEDDGYILAFVHDEKEWKSELQIVNAMSLKLEATVKLPSRVPYGFHGTF  595



>gb|AEK99290.1| 9-cis-epoxycarotenoid dioxygenase [Cucumis melo]
Length=432

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+ ++GRK++YAYLAIAEPWPKVSGFAKVDL TGEVKK IYG  K+GGEP FLP++
Sbjct  307  AGMVNKTRVGRKSRYAYLAIAEPWPKVSGFAKVDLVTGEVKKHIYGGRKFGGEPFFLPKD  366

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+ +EEED+GYILAFVHDE+  KSE+QIVNA+ L++EA++KLPSRVPYGFHGTF+ ++
Sbjct  367  ENSKAEEEEDEGYILAFVHDERTWKSEVQIVNAKDLKVEATIKLPSRVPYGFHGTFVQSN  426

Query  361  DLSSQA  378
            +L +QA
Sbjct  427  NLQNQA  432



>gb|KGN53537.1| hypothetical protein Csa_4G064690 [Cucumis sativus]
Length=425

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 109/125 (87%), Gaps = 4/125 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKTQ++YLA+AEPWPKVSGFAKVD+ +GEVKK++YG+++YGGEPLFLPR 
Sbjct  303  AGMVNRNLLGRKTQFSYLALAEPWPKVSGFAKVDVLSGEVKKYLYGEQRYGGEPLFLPR-  361

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +  E EDDG+ILAFVHDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI+  
Sbjct  362  ---EGAEAEDDGHILAFVHDEKEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISCK  418

Query  361  DLSSQ  375
            DL  Q
Sbjct  419  DLQKQ  423



>ref|XP_006370181.1| nine-cis-epoxycarotenoid dioxygenase3 family protein [Populus 
trichocarpa]
 gb|ERP66750.1| nine-cis-epoxycarotenoid dioxygenase3 family protein [Populus 
trichocarpa]
Length=599

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEV K  YGD+K+GGEPLFLPR+
Sbjct  477  AGMVNRNLLGRKTRFAYLALAEPWPKVSGFAKVDLSTGEVHKHTYGDQKFGGEPLFLPRD  536

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS   E EDDGYILAFVHDEK  KSELQIVNA  L+LEA+VK+PSRVPYGFHGTFI A 
Sbjct  537  PNS---EREDDGYILAFVHDEKEWKSELQIVNAMNLKLEATVKIPSRVPYGFHGTFIGAK  593

Query  361  DLSSQA  378
            DL  QA
Sbjct  594  DLEKQA  599



>gb|AEK99067.1| 9-cis-epoxycarotenoid dioxygenase, partial [Cucumis sativus]
Length=430

 Score =   199 bits (506),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 109/125 (87%), Gaps = 4/125 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKTQ++YLA+AEPWPKVSGFAKVD+ +GEVKK++YG+++YGGEPLFLPR 
Sbjct  308  AGMVNRNLLGRKTQFSYLALAEPWPKVSGFAKVDVLSGEVKKYLYGEQRYGGEPLFLPR-  366

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +  E EDDG+ILAFVHDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI+  
Sbjct  367  ---EGAEAEDDGHILAFVHDEKEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISCK  423

Query  361  DLSSQ  375
            DL  Q
Sbjct  424  DLQKQ  428



>ref|XP_011010890.1| PREDICTED: LOW QUALITY PROTEIN: probable 9-cis-epoxycarotenoid 
dioxygenase NCED5, chloroplastic [Populus euphratica]
Length=596

 Score =   202 bits (515),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGR+T YAYLAIAEPWPKVSGFAKVDLFTGEV++++YG+++YGGEP FLP N
Sbjct  474  AGMVNRNRLGRQTNYAYLAIAEPWPKVSGFAKVDLFTGEVRRYMYGNKRYGGEPFFLPTN  533

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N    E EDDGYIL FVHDEK  KSELQIVNA+ L+LEASV+LPSRVPYGFHGTFI+  
Sbjct  534  QNC---ETEDDGYILGFVHDEKTWKSELQIVNAKNLQLEASVRLPSRVPYGFHGTFIDRR  590

Query  361  DLSSQA  378
             L +QA
Sbjct  591  GLVNQA  596



>ref|XP_008225495.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Prunus mume]
Length=617

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLAIAEPWPKVSGFAKVD+ TGEVKKFIYGD+KYGGEP F+P  
Sbjct  495  AGMVNRNRLGRKTRFAYLAIAEPWPKVSGFAKVDVSTGEVKKFIYGDKKYGGEPFFVP--  552

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N++    EDDGYI+ FVHDEK  KSELQIVNA  L+LEA+VKLPSRVPYGFHGTFI + 
Sbjct  553  -NTELGSSEDDGYIMTFVHDEKTWKSELQIVNAVNLKLEATVKLPSRVPYGFHGTFIESK  611

Query  361  DLSSQA  378
            DL++QA
Sbjct  612  DLANQA  617



>ref|XP_010247635.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Nelumbo nucifera]
Length=631

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 105/125 (84%), Gaps = 2/125 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKTQ+ YLAIAEPWP+VSG AKVDL TGEV KFIYGD  YGGEP FLPR+
Sbjct  508  AGMVNRNRLGRKTQFTYLAIAEPWPRVSGIAKVDLTTGEVNKFIYGDRCYGGEPFFLPRD  567

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N+   E EDDGYILAF+HDEK  KSEL IVNA  L+LEASVKLPSRVPYGFHGTFIN+ 
Sbjct  568  PNN--SEREDDGYILAFMHDEKTSKSELLIVNAINLQLEASVKLPSRVPYGFHGTFINSK  625

Query  361  DLSSQ  375
            DL  Q
Sbjct  626  DLEKQ  630



>gb|ABB52078.1| putative 9-cis epoxycarotenoid dioxygenase [Daucus carota subsp. 
sativus]
Length=573

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 109/126 (87%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+N LGRKTQ+AYLAIAEPWPKVSGFAKVDL +G+V KF YGDEK+GGEPLF P  
Sbjct  452  AGMVNKNMLGRKTQFAYLAIAEPWPKVSGFAKVDLSSGQVNKFFYGDEKFGGEPLFFP--  509

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              + + + EDDGYILAFVHDEK  +SELQIVNA TLELEAS+KLPSRVPYGFHGTFI+A 
Sbjct  510  --NPDSKNEDDGYILAFVHDEKNWESELQIVNAATLELEASIKLPSRVPYGFHGTFISAK  567

Query  361  DLSSQA  378
            DL +QA
Sbjct  568  DLETQA  573



>ref|XP_010092722.1| hypothetical protein L484_024617 [Morus notabilis]
 gb|EXB52067.1| hypothetical protein L484_024617 [Morus notabilis]
Length=605

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDLFTG+V K++YGD+++GGEPLFLPR 
Sbjct  480  AGMVNRNQLGRKTRFAYLALAEPWPKVSGFAKVDLFTGQVTKYLYGDQRFGGEPLFLPRE  539

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +     EEDDGYILAFVHDEK  KS+LQI+NA  ++LEAS+ LPSRVPYGFHGTFI++ 
Sbjct  540  SDINFSSEEDDGYILAFVHDEKEWKSQLQIINAMNMKLEASIDLPSRVPYGFHGTFISSK  599

Query  361  DLSSQ  375
            DL  Q
Sbjct  600  DLEKQ  604



>ref|XP_008787808.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Phoenix dactylifera]
Length=609

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEV KFIYGD +YGGEP FLPR+
Sbjct  487  AGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVAKFIYGDNRYGGEPYFLPRD  546

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S     EDDGY+L F+H+E   +SEL IVNA  + L+ASVKLPSRVPYGFHGTFIN+ 
Sbjct  547  ATS---PTEDDGYVLTFMHNETTSESELLIVNAADMRLQASVKLPSRVPYGFHGTFINSK  603

Query  361  DLSSQA  378
            DL SQA
Sbjct  604  DLESQA  609



>gb|AEN94304.1| 9-cis-epoxycarotenoid dioxygenase [Brassica napus]
Length=592

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 110/125 (88%), Gaps = 4/125 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDLFTGEVKK++YG ++YGGEPLFLP  
Sbjct  471  AGMVNRNMLGRKTRFAYLALAEPWPKVSGFAKVDLFTGEVKKYLYGGDRYGGEPLFLP--  528

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                E+  EDDGYIL FVHDE+  KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI A+
Sbjct  529  --GDENRAEDDGYILCFVHDEETWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAN  586

Query  361  DLSSQ  375
            DL++Q
Sbjct  587  DLATQ  591



>emb|CAE00459.2| 9-cis-epoxycarotenoid dioxygenase [Arachis hypogaea]
Length=601

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN++KLGRKTQ+AYLA+AEPWPKVSGFAKVDL +GEVKK++YG EK+GGEP+FLPR+
Sbjct  479  AGMVNKSKLGRKTQFAYLALAEPWPKVSGFAKVDLSSGEVKKYMYGGEKFGGEPMFLPRS  538

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S   E EDDGYILAFVHDEK  +SELQ+VNA TLELEA+++LPSRVPYGFHGTFI + 
Sbjct  539  AWS---EREDDGYILAFVHDEKEWRSELQVVNAMTLELEATIELPSRVPYGFHGTFIQSK  595

Query  361  DLSSQA  378
            DL  QA
Sbjct  596  DLRKQA  601



>ref|XP_007213614.1| hypothetical protein PRUPE_ppa002314mg [Prunus persica]
 gb|EMJ14813.1| hypothetical protein PRUPE_ppa002314mg [Prunus persica]
Length=688

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLAIAEPWPKVSGFAKVD+ TGEVKKFIYGD+KYGGEP F+P  
Sbjct  566  AGMVNRNRLGRKTRFAYLAIAEPWPKVSGFAKVDVSTGEVKKFIYGDKKYGGEPFFVP--  623

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N++    EDDGYI+ FVHDEK  KSELQIVNA  L+LEA+VKLPSRVPYGFHGTFI + 
Sbjct  624  -NAELGSSEDDGYIMTFVHDEKTWKSELQIVNAVNLKLEATVKLPSRVPYGFHGTFIESK  682

Query  361  DLSSQA  378
            DL++QA
Sbjct  683  DLANQA  688



>emb|CBI30914.3| unnamed protein product [Vitis vinifera]
Length=473

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNR +LGRKTQYAYLAIAEPWPKVSGFAKVDL TG+V+K+ YGD++YGGEP F+ ++
Sbjct  351  AGMVNRTRLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGDVQKYQYGDQRYGGEPYFVHKD  410

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S   E EDDGYILAFVHDEK  KSEL IVNA  L+LEA+VKLPSRVPYGFHGTF+N++
Sbjct  411  PTS---EREDDGYILAFVHDEKTWKSELHIVNAMNLQLEATVKLPSRVPYGFHGTFVNSE  467

Query  361  DLSSQA  378
            DL++QA
Sbjct  468  DLANQA  473



>dbj|BAN15738.1| 9-cis-epoxy-carotenoid dioxygenase [Dianthus caryophyllus]
Length=586

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 107/126 (85%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDLFTG V KFIYGD KYGGEPLFLPR 
Sbjct  465  AGMVNRNMLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGNVTKFIYGDNKYGGEPLFLPR-  523

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               ++   EDDG+IL FVHDE   +SELQIVNA T+E+EA V+LPSRVPYGFHGTFI A+
Sbjct  524  ---EDGTSEDDGHILTFVHDEDKWESELQIVNAATMEVEALVQLPSRVPYGFHGTFIAAN  580

Query  361  DLSSQA  378
            DL +QA
Sbjct  581  DLKTQA  586



>dbj|BAN15737.1| 9-cis-epoxy-carotenoid dioxygenase [Dianthus caryophyllus]
Length=592

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 107/126 (85%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDLFTG V KFIYGD KYGGEPLFLPR 
Sbjct  471  AGMVNRNMLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGNVTKFIYGDNKYGGEPLFLPR-  529

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               ++   EDDG+IL FVHDE   +SELQIVNA T+E+EA V+LPSRVPYGFHGTFI A+
Sbjct  530  ---EDGTSEDDGHILTFVHDEDKWESELQIVNAATMEVEALVQLPSRVPYGFHGTFIAAN  586

Query  361  DLSSQA  378
            DL +QA
Sbjct  587  DLKTQA  592



>ref|XP_006415513.1| hypothetical protein EUTSA_v10007160mg [Eutrema salsugineum]
 gb|ESQ33866.1| hypothetical protein EUTSA_v10007160mg [Eutrema salsugineum]
Length=589

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL TGEVK  IYG +KYGGEP FLPR 
Sbjct  467  AGMVNRNLLGRKTRYAYLAIAEPWPKVSGFAKVDLSTGEVKNHIYGGKKYGGEPFFLPRG  526

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            +   E + EDDGYI++FVHDE++ KSELQIVNA TLELEA+VKLPSRVPYGFHGTF+N+ 
Sbjct  527  L---ESDGEDDGYIMSFVHDEESWKSELQIVNAVTLELEATVKLPSRVPYGFHGTFVNSA  583

Query  361  DLSSQA  378
            D+ +QA
Sbjct  584  DMLNQA  589



>ref|XP_010923828.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Elaeis guineensis]
Length=620

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEV KF++G+E+YGGEP F+PR+
Sbjct  498  AGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVAKFMFGEERYGGEPYFVPRH  557

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +S     EDDGY+L F+H+EK  +SEL IVNA  + LEASVKLPSRVPYGFHGTFIN+ 
Sbjct  558  PSS---PREDDGYVLTFMHNEKTSESELLIVNAADMRLEASVKLPSRVPYGFHGTFINSK  614

Query  361  DLSSQA  378
            DL SQA
Sbjct  615  DLESQA  620



>ref|XP_011012661.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Populus euphratica]
Length=603

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEV K  YGD+K+GGEPLFLPR+
Sbjct  481  AGMVNRNLLGRKTRFAYLALAEPWPKVSGFAKVDLSTGEVHKHTYGDQKFGGEPLFLPRD  540

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +S   E EDDGYILAFVHDEK  KSELQIVNA  L+LEA+VK+PSRVPYGFHGTFI A 
Sbjct  541  PHS---EREDDGYILAFVHDEKEWKSELQIVNAMNLKLEATVKIPSRVPYGFHGTFIGAK  597

Query  361  DLSSQA  378
            DL  QA
Sbjct  598  DLEKQA  603



>ref|XP_009398335.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=601

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 105/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDLFTGE+ KFI+GD +YGGEP FLPR+
Sbjct  479  AGMVNRNMLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEISKFIFGDSRYGGEPYFLPRD  538

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS     EDDGY+L F+HDEK   SEL IVNA  + LEASVKLPSRVPYGFHGTF+ + 
Sbjct  539  SNSL---REDDGYVLTFMHDEKTSASELLIVNAVDMRLEASVKLPSRVPYGFHGTFVGSK  595

Query  361  DLSSQA  378
            DL SQA
Sbjct  596  DLESQA  601



>gb|ADG03462.1| 9-cis-epoxycarotenoid dioxygenase [Gossypium hirsutum]
Length=608

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 111/126 (88%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGR+T+YAYLAIAEPWPKVSGFAK+DLFTGEVKK IYGD+K+GGEP FLPR+
Sbjct  485  AGMVNRNRLGRRTRYAYLAIAEPWPKVSGFAKIDLFTGEVKKHIYGDKKFGGEPFFLPRD  544

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N +    EDDGYI++FVHDE + KSELQ+V+A  L+LE+S+KLPSRVPYGFHGTFI+A 
Sbjct  545  DNCE--SAEDDGYIISFVHDENSWKSELQVVDAINLQLESSIKLPSRVPYGFHGTFIDAK  602

Query  361  DLSSQA  378
             L +QA
Sbjct  603  SLINQA  608



>ref|XP_009115186.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Brassica rapa]
Length=588

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL TGEVK   YGD+KYGGEP FLPR 
Sbjct  466  AGMVNRNFLGRKTRYAYLAIAEPWPKVSGFAKVDLSTGEVKNHFYGDKKYGGEPFFLPRG  525

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            +   E + EDDGYI++FVHDE+  KSELQIVNA TLELEA++KLPSRVPYGFHGTF+N+ 
Sbjct  526  L---ESDGEDDGYIMSFVHDEEGWKSELQIVNAVTLELEATIKLPSRVPYGFHGTFVNSA  582

Query  361  DLSSQA  378
            D+ +QA
Sbjct  583  DMLNQA  588



>ref|XP_004147768.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Cucumis sativus]
Length=594

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 109/125 (87%), Gaps = 4/125 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKTQ++YLA+AEPWPKVSGFAKVD+ +GEVKK++YG+++YGGEPLFLPR 
Sbjct  472  AGMVNRNLLGRKTQFSYLALAEPWPKVSGFAKVDVLSGEVKKYLYGEQRYGGEPLFLPR-  530

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +  E EDDG+ILAFVHDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI+  
Sbjct  531  ---EGAEAEDDGHILAFVHDEKEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISCK  587

Query  361  DLSSQ  375
            DL  Q
Sbjct  588  DLQKQ  592



>dbj|BAM72560.1| 9-cis-epoxycarotenoid dioxygenase [Cicer arietinum]
Length=620

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 112/126 (89%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+NKLGRKTQ+AYLA+AEPWPKVSGFAKVDLF+G+V K++YGD+++GGEPLFLP  
Sbjct  497  AGMVNKNKLGRKTQFAYLALAEPWPKVSGFAKVDLFSGQVNKYLYGDQRFGGEPLFLP-T  555

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            ++S     EDDGYIL FVHDEK  KSELQIVNA TL+LEAS+KLPSRVPYGFHGTFI+++
Sbjct  556  LDSNSG-REDDGYILTFVHDEKEWKSELQIVNAITLKLEASIKLPSRVPYGFHGTFIHSN  614

Query  361  DLSSQA  378
            DL  QA
Sbjct  615  DLKKQA  620



>emb|CDY26294.1| BnaA09g26450D [Brassica napus]
Length=589

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL TGEVK   YGD+KYGGEP FLPR 
Sbjct  467  AGMVNRNFLGRKTRYAYLAIAEPWPKVSGFAKVDLSTGEVKNHFYGDKKYGGEPFFLPRG  526

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            +   E + EDDGYI++FVHDE+  KSELQIVNA TLELEA++KLPSRVPYGFHGTF+N+ 
Sbjct  527  L---ESDGEDDGYIMSFVHDEEGWKSELQIVNAVTLELEATIKLPSRVPYGFHGTFVNSA  583

Query  361  DLSSQA  378
            D+ +QA
Sbjct  584  DMLNQA  589



>ref|XP_008439625.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Cucumis melo]
Length=599

 Score =   200 bits (509),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+ ++GRK++YAYLAIAEPWPKVSGFAKVDL TGEVKK IYG  K+GGEP FLP++
Sbjct  474  AGMVNKTRVGRKSRYAYLAIAEPWPKVSGFAKVDLVTGEVKKHIYGGRKFGGEPFFLPKD  533

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+ +EEED+GYILAFVHDE+  KSE+QIVNA+ L++EA++KLPSRVPYGFHGTF+ ++
Sbjct  534  ENSKAEEEEDEGYILAFVHDERTWKSEVQIVNAKDLKVEATIKLPSRVPYGFHGTFVQSN  593

Query  361  DLSSQA  378
            +L +QA
Sbjct  594  NLQNQA  599



>ref|XP_008371610.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Malus domestica]
Length=603

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLAIAEPWPKVSGFAKVDLFTGEVKKF YG++KYGGEP F+P  
Sbjct  481  AGMVNRNRLGRKTRFAYLAIAEPWPKVSGFAKVDLFTGEVKKFFYGEKKYGGEPFFVP--  538

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             ++ E   ED+GYIL FVHDEK  KSELQIVNA  ++LEA+VKLPSRVPYGFHGTFI + 
Sbjct  539  -STAERASEDEGYILTFVHDEKKWKSELQIVNAXNMKLEATVKLPSRVPYGFHGTFIESK  597

Query  361  DLSSQA  378
            DL +QA
Sbjct  598  DLVNQA  603



>ref|XP_004167844.1| PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxycarotenoid dioxygenase 
NCED1, chloroplastic-like [Cucumis sativus]
Length=594

 Score =   200 bits (508),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 109/125 (87%), Gaps = 4/125 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKTQ++YLA+AEPWPKVSGFAKVD+ +GEVKK++YG+++YGGEPLFLPR 
Sbjct  472  AGMVNRNLLGRKTQFSYLALAEPWPKVSGFAKVDVLSGEVKKYLYGEQRYGGEPLFLPR-  530

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +  E EDDG+ILAFVHDEK  KSELQIVNA TLELEA+VKLPSRVPYGFHGTFI+  
Sbjct  531  ---EGAEAEDDGHILAFVHDEKEWKSELQIVNAMTLELEATVKLPSRVPYGFHGTFISCK  587

Query  361  DLSSQ  375
            DL  Q
Sbjct  588  DLQKQ  592



>gb|AEK99069.1| 9-cis-epoxycarotenoid dioxygenase [Fragaria x ananassa]
Length=428

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEVKK IYGD K+GGEP FLP  
Sbjct  307  AGMVNRNLLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVKKHIYGDRKFGGEPFFLP--  364

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S    EED+GYIL+FVHDEK  KSELQIVNA +L++EA+V LPSRVPYGFHGTFI++ 
Sbjct  365  --SSSTGEEDEGYILSFVHDEKTWKSELQIVNAVSLKVEATVTLPSRVPYGFHGTFIDSK  422

Query  361  DLSSQA  378
             L +QA
Sbjct  423  ALKNQA  428



>ref|XP_009360900.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Pyrus x bretschneideri]
Length=603

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLAIAEPWPKVSGFAKVDLFTGEVKKF YG++KYGGEP F+P  
Sbjct  481  AGMVNRNRLGRKTRFAYLAIAEPWPKVSGFAKVDLFTGEVKKFFYGEKKYGGEPFFVP--  538

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             ++ E   ED+GYIL FVHDEK  KSELQIVNA  ++LEA+VKLPSRVPYGFHGTFI + 
Sbjct  539  -STAEGASEDEGYILTFVHDEKKWKSELQIVNAVNMKLEATVKLPSRVPYGFHGTFIESK  597

Query  361  DLSSQA  378
            DL +QA
Sbjct  598  DLVNQA  603



>gb|AFU91491.1| 9-cis-epoxycarotenoid dioxygenase [Momordica charantia]
Length=589

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKTQ+AYLA+AEPWPKVSGFAKVDL TGE++K+IYG+++YGGEPLFLPR 
Sbjct  467  AGMVNRNRLGRKTQFAYLALAEPWPKVSGFAKVDLSTGEIRKYIYGEQRYGGEPLFLPR-  525

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +  E EDDG+ILAFVHDEK  KSELQIVNA TL+LEASVKLPSRVPYGFHGTFI + 
Sbjct  526  ---EGAEAEDDGHILAFVHDEKEWKSELQIVNAITLKLEASVKLPSRVPYGFHGTFIGSK  582

Query  361  DLSSQA  378
             L  Q 
Sbjct  583  GLQKQT  588



>ref|XP_008809583.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Phoenix dactylifera]
Length=616

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIA PWPKVSGFAKVDLFTGEV KFI+G+++YGGEP F+PR+
Sbjct  494  AGMVNRNKLGRKTRYAYLAIANPWPKVSGFAKVDLFTGEVAKFIFGEDRYGGEPYFVPRH  553

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +S     EDDGY+L F+H+EK  +SEL IVNA  + LEASVKLPSRVPYGFHGTFIN+ 
Sbjct  554  ASS---PREDDGYVLTFMHNEKTSQSELLIVNAVDMRLEASVKLPSRVPYGFHGTFINSK  610

Query  361  DLSSQA  378
            DL SQA
Sbjct  611  DLESQA  616



>gb|ADR78340.1| 9-cis-epoxycarotenoid dioxygenase [Cucumis sativus]
Length=430

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+N++GRK++YAYLAIAEPWPKVSGFAKVDL TGEVKK IYG  K+GGEP FLP+ 
Sbjct  308  AGMVNKNRVGRKSRYAYLAIAEPWPKVSGFAKVDLVTGEVKKHIYGGRKFGGEPFFLPKE  367

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+   EED+GYILAFVHDE+  KSE+QIVNA+ L++EA++KLPSRVPYGFHGTF+ ++
Sbjct  368  ENSK---EEDEGYILAFVHDERTWKSEVQIVNAKDLKVEATIKLPSRVPYGFHGTFVQSN  424

Query  361  DLSSQA  378
            DL +QA
Sbjct  425  DLQNQA  430



>gb|KDP27683.1| hypothetical protein JCGZ_19722 [Jatropha curcas]
Length=589

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 105/126 (83%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKTQ+AYLA+AEPWPKVSGFAKVDL TGE KK+IYGD KYGGEPLFLP  
Sbjct  468  AGMVNRNLLGRKTQFAYLALAEPWPKVSGFAKVDLSTGETKKYIYGDNKYGGEPLFLP--  525

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                   +EDDG+IL FVHDEK  KSELQIVNA+ L+LEA+VKLPSRVPYGFHGTFI A 
Sbjct  526  --DSNSGKEDDGFILCFVHDEKEWKSELQIVNAKNLQLEATVKLPSRVPYGFHGTFITAK  583

Query  361  DLSSQA  378
            DL  QA
Sbjct  584  DLEKQA  589



>gb|AGV54244.1| 9-cis-epoxycarotenoid dioxygenase NCED1 [Phaseolus vulgaris]
Length=615

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 108/126 (86%), Gaps = 6/126 (5%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKTQ+AYLA+AEPWPKVSGFAKVDLF+GEV+K++YG+EK+GGEPLFLP  
Sbjct  496  AGMVNRNKLGRKTQFAYLALAEPWPKVSGFAKVDLFSGEVQKYMYGEEKFGGEPLFLPNG  555

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                  EEE DGYILAFVH EK  KSELQ+VNAQ L+ EAS+KLPSRVPYGFHGTFI + 
Sbjct  556  ------EEEGDGYILAFVHVEKEWKSELQLVNAQNLKPEASIKLPSRVPYGFHGTFIPSK  609

Query  361  DLSSQA  378
            DL  QA
Sbjct  610  DLRKQA  615



>gb|AGQ03804.1| 9-cis-epoxycarotenoid dioxygenase [Malus domestica x Malus honanensis]
Length=606

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLAIAEPWPKVSGFAKVDLFTGEVKKF YG++KYGGEP F+P  
Sbjct  484  AGMVNRNRLGRKTRFAYLAIAEPWPKVSGFAKVDLFTGEVKKFFYGEKKYGGEPFFVP--  541

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              + E   ED+GYIL FVHDEK  KSELQIVNA  + LEA+VKLPSRVPYGFHGTFI + 
Sbjct  542  -GTAEGASEDEGYILTFVHDEKKWKSELQIVNAANMRLEATVKLPSRVPYGFHGTFIESK  600

Query  361  DLSSQA  378
            DL +QA
Sbjct  601  DLVNQA  606



>emb|CAN74478.1| hypothetical protein VITISV_002243 [Vitis vinifera]
Length=605

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNR +LGRKTQYAYLAIAEPWPKVSGFAKVDL TG+V+K+ YGD++YGGEP F+ ++
Sbjct  483  AGMVNRTRLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGDVQKYQYGDQRYGGEPYFVHKD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S   E EDDGYILAFVHDEK  KSEL IVNA  L+LEA+VKLPSRVPYGFHGTF+N++
Sbjct  543  PTS---EREDDGYILAFVHDEKTWKSELHIVNAMNLQLEATVKLPSRVPYGFHGTFVNSE  599

Query  361  DLSSQA  378
            DL++QA
Sbjct  600  DLANQA  605



>gb|EPS60683.1| 9-cis-epoxycarotenoid dioxygenase [Genlisea aurea]
Length=577

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEV KF YGD KYGGEPLFLP+N
Sbjct  455  AGMVNRNRLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVTKFFYGDNKYGGEPLFLPKN  514

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +E+++    ++LAF H E AG+SELQIVNA+T+ELEA+VKLPSRVPYGFHGTFI A 
Sbjct  515  GEEEEEDDG---HVLAFAHQENAGRSELQIVNARTMELEATVKLPSRVPYGFHGTFIGAR  571

Query  361  DLSSQA  378
            DL +QA
Sbjct  572  DLENQA  577



>ref|XP_002529528.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
 gb|EEF32866.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
Length=603

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 106/126 (84%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMV+RN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEV K++YGD KYGGEP+FLP  
Sbjct  482  AGMVSRNLLGRKTRFAYLALAEPWPKVSGFAKVDLNTGEVHKYVYGDSKYGGEPMFLP--  539

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S +  +ED GYIL FVHDEK  KSELQIVNA  L+LEA+VKLPSRVPYGFHGTFINA 
Sbjct  540  --SSDSAQEDSGYILCFVHDEKEWKSELQIVNAMNLKLEATVKLPSRVPYGFHGTFINAS  597

Query  361  DLSSQA  378
            DL  QA
Sbjct  598  DLQKQA  603



>ref|XP_006307061.1| hypothetical protein CARUB_v10008647mg [Capsella rubella]
 gb|EOA39959.1| hypothetical protein CARUB_v10008647mg [Capsella rubella]
Length=596

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL TGEVK   YG +KYGGEP FLPR 
Sbjct  474  AGMVNRNLLGRKTRYAYLAIAEPWPKVSGFAKVDLSTGEVKNHFYGGKKYGGEPFFLPRG  533

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            +   E + EDDGYI++FVHDE++ +SELQIVNA TLELEA+VKLPSRVPYGFHGTF+N+ 
Sbjct  534  L---ESDGEDDGYIMSFVHDEESWESELQIVNAVTLELEATVKLPSRVPYGFHGTFVNSS  590

Query  361  DLSSQA  378
            D+ +QA
Sbjct  591  DMLNQA  596



>gb|ADP20466.1| 9-cis-epoxycarotenoid dioxygenase [Diospyros kaki]
Length=447

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 105/120 (88%), Gaps = 3/120 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLG+KT Y YLAIAEPWPKVSGFAKVDL TG+V KFIYG+ +YGGEP F+PR+
Sbjct  307  AGMVNRNKLGQKTPYVYLAIAEPWPKVSGFAKVDLSTGKVHKFIYGEGRYGGEPYFVPRD  366

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            VNS   E EDDGYIL FVHDEK  KSELQIVNA  L+LEASVKLPSRVPYGFHGTFI+++
Sbjct  367  VNS---EREDDGYILGFVHDEKTWKSELQIVNAMNLKLEASVKLPSRVPYGFHGTFISSE  423



>ref|XP_004293530.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
 gb|AFU61914.1| 9-cis-epoxycarotenoid dioxygenase 1 [Fragaria x ananassa]
Length=609

 Score =   197 bits (502),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEVKK IYGD K+GGEP FLP  
Sbjct  488  AGMVNRNLLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVKKHIYGDRKFGGEPFFLP--  545

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S    EED+GYIL+FVHDEK  KSELQIVNA +L++EA+V LPSRVPYGFHGTFI++ 
Sbjct  546  --SSSTGEEDEGYILSFVHDEKTWKSELQIVNAVSLKVEATVTLPSRVPYGFHGTFIDSK  603

Query  361  DLSSQA  378
             L +QA
Sbjct  604  ALKNQA  609



>gb|AIG92851.1| 9-cis-epoxycarotenoid dioxygenase [Malus prunifolia]
Length=607

 Score =   197 bits (502),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLAIAEPWPKVSGFAKVDLFTGEVKKF YG++ YGGEP F+P  
Sbjct  485  AGMVNRNLLGRKTRFAYLAIAEPWPKVSGFAKVDLFTGEVKKFFYGEKMYGGEPFFVP--  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +++E   EDDGYIL FVHDEK  KSELQIVNA  ++LEA+VKLPSRVPYGFHGTFI + 
Sbjct  543  -STEEGASEDDGYILTFVHDEKNWKSELQIVNAVNMKLEATVKLPSRVPYGFHGTFIESK  601

Query  361  DLSSQA  378
            DL +QA
Sbjct  602  DLVNQA  607



>gb|ADU85829.1| 9-cis-epoxycarotenoid dioxygenase [Fragaria x ananassa]
Length=609

 Score =   197 bits (502),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEVKK IYGD K+GGEP FLP  
Sbjct  488  AGMVNRNLLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVKKHIYGDRKFGGEPFFLP--  545

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S    EED+GYIL+FVHDEK  KSELQIVNA +L++EA+V LPSRVPYGFHGTFI++ 
Sbjct  546  --SSSTGEEDEGYILSFVHDEKTWKSELQIVNAVSLKVEATVTLPSRVPYGFHGTFIDSK  603

Query  361  DLSSQA  378
             L +QA
Sbjct  604  ALKNQA  609



>ref|XP_008371764.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Malus domestica]
Length=607

 Score =   197 bits (502),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLAIAEPWPKVSGFAKVDLFTGEVKKF YG++ YGGEP F+P  
Sbjct  485  AGMVNRNLLGRKTRFAYLAIAEPWPKVSGFAKVDLFTGEVKKFFYGEKMYGGEPFFVP--  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +++E   EDDGYIL FVHDEK  KSELQIVNA  ++LEA+VKLPSRVPYGFHGTFI + 
Sbjct  543  -STEEGASEDDGYILTFVHDEKNWKSELQIVNAVNMKLEATVKLPSRVPYGFHGTFIESK  601

Query  361  DLSSQA  378
            DL +QA
Sbjct  602  DLVNQA  607



>gb|ACH85193.1| 9-cis-epoxycarotenoid dioxygenase [Malus hupehensis var. mengshanensis]
Length=606

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLAIAEPWPKVSGFAKVDLFTGEVKKF YG++ YGGEP F+P  
Sbjct  484  AGMVNRNLLGRKTRFAYLAIAEPWPKVSGFAKVDLFTGEVKKFFYGEKMYGGEPFFVP--  541

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +++E   EDDGYIL FVHDEK  KSELQIVNA  ++LEA+VKLPSRVPYGFHGTFI + 
Sbjct  542  -STEEGASEDDGYILTFVHDEKNWKSELQIVNAVNMKLEATVKLPSRVPYGFHGTFIESK  600

Query  361  DLSSQA  378
            DL +QA
Sbjct  601  DLVNQA  606



>ref|XP_004488719.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Cicer arietinum]
Length=620

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 111/126 (88%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+NKLGRKTQ+AYLA+AE WPKVSGFAKVDLF+G+V K++YGD+++GGEPLFLP  
Sbjct  497  AGMVNKNKLGRKTQFAYLALAETWPKVSGFAKVDLFSGQVNKYLYGDQRFGGEPLFLP-T  555

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            ++S     EDDGYIL FVHDEK  KSELQIVNA TL+LEAS+KLPSRVPYGFHGTFI+++
Sbjct  556  LDSNSG-REDDGYILTFVHDEKEWKSELQIVNAITLKLEASIKLPSRVPYGFHGTFIHSN  614

Query  361  DLSSQA  378
            DL  QA
Sbjct  615  DLKKQA  620



>dbj|BAE92962.1| 9-cis-epoxycarotenoid dioxygenase [Citrus limon]
Length=587

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 103/115 (90%), Gaps = 2/115 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKTQ+AYLAIAEPWPKVSGFAKVDL +GEVKK+ YGD KYGGEP FLPR+
Sbjct  475  AGMVNRNRLGRKTQFAYLAIAEPWPKVSGFAKVDLSSGEVKKYFYGDNKYGGEPFFLPRD  534

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGT  345
             N+ E+  EDDGYILAFVHDEK  KSELQIVNA  L+LEAS++LPSRVPYGFHGT
Sbjct  535  ANNSEN--EDDGYILAFVHDEKTWKSELQIVNAMNLQLEASIQLPSRVPYGFHGT  587



>ref|NP_001268200.1| 9-cis-epoxycarotenoid dioxygenase 2 [Vitis vinifera]
 gb|AAR11194.1| 9-cis-epoxycarotenoid dioxygenase 2 [Vitis vinifera]
Length=605

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMV+R +LGRKTQYAYLAIAEPWPKVSGFAKVDL TG+V+K+ YGD++YGGEP F+ ++
Sbjct  483  AGMVDRTRLGRKTQYAYLAIAEPWPKVSGFAKVDLSTGDVQKYQYGDQRYGGEPYFVHKD  542

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S   E EDDGYILAFVHDEK  KSEL IVNA  L+LEA+VKLPSRVPYGFHGTF+N++
Sbjct  543  PTS---EREDDGYILAFVHDEKTWKSELHIVNAMNLQLEATVKLPSRVPYGFHGTFVNSE  599

Query  361  DLSSQA  378
            DL++QA
Sbjct  600  DLANQA  605



>ref|XP_006407071.1| hypothetical protein EUTSA_v10020337mg [Eutrema salsugineum]
 gb|ESQ48524.1| hypothetical protein EUTSA_v10020337mg [Eutrema salsugineum]
Length=601

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 108/126 (86%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK +YGD +YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLATGEVKKHLYGDNRYGGEPLFLPG-  536

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             + + +  EDDG+IL FVHDEK  KSELQIVNA TLE+EA+VKLPSRVPYGFHGTFI A+
Sbjct  537  -DEKNNGGEDDGHILCFVHDEKTWKSELQIVNAVTLEVEATVKLPSRVPYGFHGTFIGAN  595

Query  361  DLSSQA  378
            DL+ Q 
Sbjct  596  DLAQQV  601



>ref|XP_004134911.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004166758.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN49403.1| hypothetical protein Csa_6G523440 [Cucumis sativus]
Length=600

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 111/126 (88%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+N++GRK++YAYLAIAEPWPKVSGFAKVDL TGEVKK IYG  K+GGEP FLP+ 
Sbjct  478  AGMVNKNRVGRKSRYAYLAIAEPWPKVSGFAKVDLVTGEVKKHIYGGRKFGGEPFFLPKE  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS+   EED+GYILAFVHDE+  KSE+QIVNA+ L++EA++KLPSRVPYGFHGTF+ ++
Sbjct  538  ENSK---EEDEGYILAFVHDERTWKSEVQIVNAKDLKVEATIKLPSRVPYGFHGTFVQSN  594

Query  361  DLSSQA  378
            DL +QA
Sbjct  595  DLQNQA  600



>gb|KFK44832.1| hypothetical protein AALP_AA1G308500 [Arabis alpina]
Length=546

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLAIAEPWPKVSGFAKVDL TGEVK   YG +KYGGEP FLPR 
Sbjct  424  AGMVNRNLLGRKTRFAYLAIAEPWPKVSGFAKVDLLTGEVKNHFYGGKKYGGEPFFLPRG  483

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            +   E + EDDGYI++FVHDE++ +SELQIVNA TLE+EA VKLPSRVPYGFHGTF+N+ 
Sbjct  484  L---ESDGEDDGYIMSFVHDEESWESELQIVNAVTLEIEAIVKLPSRVPYGFHGTFVNSV  540

Query  361  DLSSQA  378
            D+ +QA
Sbjct  541  DMVNQA  546



>dbj|BAE92960.1| 9-cis-epoxycarotenoid-dioxygenase [Citrus unshiu]
Length=587

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 101/115 (88%), Gaps = 2/115 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKTQ+AYLAIAEPWPKVSGFAKVDL +GEVKK+ YGD KYGGEP FLPR+
Sbjct  475  AGMVNRNSLGRKTQFAYLAIAEPWPKVSGFAKVDLSSGEVKKYFYGDNKYGGEPFFLPRD  534

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGT  345
             N+ E+  EDDGYILAFVHDEK  KSELQI NA  L+LEAS+KLPSRVPYGFHGT
Sbjct  535  ANNSEN--EDDGYILAFVHDEKTWKSELQIANAMNLQLEASIKLPSRVPYGFHGT  587



>ref|XP_002890850.1| nine-cis-epoxycarotenoid dioxygenase 5 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67109.1| nine-cis-epoxycarotenoid dioxygenase 5 [Arabidopsis lyrata subsp. 
lyrata]
Length=589

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL TGEVK   YG +KYGGEP FLPR 
Sbjct  467  AGMVNRNLLGRKTRYAYLAIAEPWPKVSGFAKVDLSTGEVKNHFYGGKKYGGEPFFLPRG  526

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            +   E + EDDGYI++FVHDE++ +SEL IVNA TLELEA+VKLPSRVPYGFHGTF+N+ 
Sbjct  527  L---ESDGEDDGYIMSFVHDEESWESELHIVNAVTLELEATVKLPSRVPYGFHGTFVNSA  583

Query  361  DLSSQA  378
            D+ +QA
Sbjct  584  DMLNQA  589



>gb|AEK07906.1| 9-cis-epoxycarotenoid dioxygenase [Pyrus pyrifolia]
Length=429

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLAIAEPWPKVSGFAKVDL TGEVKKF YG++ YGGEP F+P  
Sbjct  307  AGMVNRNLLGRKTRFAYLAIAEPWPKVSGFAKVDLSTGEVKKFFYGEKMYGGEPFFVP--  364

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +++E   EDDGYIL FVHDEK  KSELQIVNA  ++LEA+VKLPSRVPYGFHGTFI   
Sbjct  365  -STEEGASEDDGYILTFVHDEKNWKSELQIVNAVNMKLEATVKLPSRVPYGFHGTFIEWK  423

Query  361  DLSSQA  378
            DL +QA
Sbjct  424  DLVNQA  429



>dbj|BAE92961.1| 9-cis-epoxycarotenoid dioxygenase [Citrus sinensis]
Length=587

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 101/115 (88%), Gaps = 2/115 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKTQ+AYLAIAEPWPKVSGFAKVDL +GEVKK+ YGD KYGGEP F PR+
Sbjct  475  AGMVNRNSLGRKTQFAYLAIAEPWPKVSGFAKVDLSSGEVKKYFYGDNKYGGEPFFFPRD  534

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGT  345
             N+ E+  EDDGYILAFVHDEK  KSELQIVNA  L+LEAS+KLPSRVPYGFHGT
Sbjct  535  ANNSEN--EDDGYILAFVHDEKTWKSELQIVNAMNLQLEASIKLPSRVPYGFHGT  587



>gb|KFK38809.1| hypothetical protein AALP_AA3G162900 [Arabis alpina]
Length=599

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLA+AEPWPKVSGFAKVDL TGEVKK +YGD +YGGEPLFLP +
Sbjct  476  AGMVNRNMLGRKTKYAYLALAEPWPKVSGFAKVDLATGEVKKHLYGDNRYGGEPLFLPGD  535

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N      ED+GYIL FVHDEK  KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI A+
Sbjct  536  NNGG---GEDEGYILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAN  592

Query  361  DLSSQA  378
            DL  Q 
Sbjct  593  DLVKQV  598



>ref|NP_174302.1| 9-cis-epoxycarotenoid dioxygenase [Arabidopsis thaliana]
 sp|Q9C6Z1.1|NCED5_ARATH RecName: Full=Probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic; Short=AtNCED5; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG50855.1|AC074176_4 9-cis-epoxycarotenoid dioxygenase, putative [Arabidopsis thaliana]
 dbj|BAE98872.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31178.1| 9-cis-epoxycarotenoid dioxygenase [Arabidopsis thaliana]
Length=589

 Score =   195 bits (495),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL TGEVK   YG +KYGGEP FLPR 
Sbjct  467  AGMVNRNLLGRKTRYAYLAIAEPWPKVSGFAKVDLSTGEVKNHFYGGKKYGGEPFFLPRG  526

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            +   E + EDDGYI++FVHDE++ +SEL IVNA TLELEA+VKLPSRVPYGFHGTF+N+ 
Sbjct  527  L---ESDGEDDGYIMSFVHDEESWESELHIVNAVTLELEATVKLPSRVPYGFHGTFVNSA  583

Query  361  DLSSQA  378
            D+ +QA
Sbjct  584  DMLNQA  589



>ref|XP_010540581.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Tarenaya hassleriana]
Length=597

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLAIAEPWPKVSGFAKVDLFTGE K + YG  KYGGEP F+ R 
Sbjct  475  AGMVNRNRLGRKTRFAYLAIAEPWPKVSGFAKVDLFTGESKNYFYGGMKYGGEPFFVRRG  534

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            ++S   + EDDGYIL FVHDEK  KSELQIVNA  LELEA+VKLPSRVPYGFHGTF+N+ 
Sbjct  535  LDS---DGEDDGYILTFVHDEKTWKSELQIVNAVNLELEATVKLPSRVPYGFHGTFVNSA  591

Query  361  DLSSQA  378
            D+ +QA
Sbjct  592  DMVNQA  597



>ref|XP_010666721.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=602

 Score =   195 bits (495),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLAIAEPWPKVSGFAKVDL TGEVKKF+YG EKYGGEP FLPR+
Sbjct  476  AGMVNRNFLGRKTRFAYLAIAEPWPKVSGFAKVDLVTGEVKKFLYGGEKYGGEPFFLPRD  535

Query  181  -VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINA  357
              N  E   EDDGY++ FVHDE  G SEL IVNA  L+ EASVKLPSRVPYGFHGTF+ +
Sbjct  536  HSNLDEPSSEDDGYVMGFVHDENKGTSELVIVNATNLQEEASVKLPSRVPYGFHGTFVRS  595

Query  358  DDLSSQA  378
            ++L  QA
Sbjct  596  EELIHQA  602



>gb|AAS47837.1| 9-cis-epoxycarotenoid dioxygenase [Gentiana lutea]
Length=600

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+++LGRKTQ+ YLAIAEPWPKVSGFAKVDL +G+++K++YGD +YGGEP F+  +
Sbjct  473  AGMVNKSRLGRKTQFGYLAIAEPWPKVSGFAKVDLLSGDIQKYMYGDGRYGGEPFFVSSS  532

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             ++ ED++EDDGY++ FVHDEK  KSELQIV A++L+L+AS++LPSRVPYGFHGTFIN+ 
Sbjct  533  DSNSEDQDEDDGYVIVFVHDEKTWKSELQIVKAKSLKLQASIRLPSRVPYGFHGTFINSK  592

Query  361  DLSSQ  375
            DL SQ
Sbjct  593  DLESQ  597



>emb|CDX98456.1| BnaC05g39190D [Brassica napus]
Length=255

 Score =   186 bits (473),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 104/126 (83%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDLFTGEV+K +YGD++YGGEPLFLP  
Sbjct  135  AGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLFTGEVEKHLYGDDRYGGEPLFLPGE  194

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               ++D      YIL FVHDE   KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI A 
Sbjct  195  GGGEDDG-----YILCFVHDEMTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAS  249

Query  361  DLSSQA  378
            DL+ Q 
Sbjct  250  DLAKQV  255



>gb|EYU33373.1| hypothetical protein MIMGU_mgv1a003582mg [Erythranthe guttata]
Length=576

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 109/126 (87%), Gaps = 1/126 (1%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT+YAYLAIAEPWPKVSGFAKVDL TGEV++FIYGD +YGGEP F+P +
Sbjct  452  AGMVNRNRLGRKTRYAYLAIAEPWPKVSGFAKVDLSTGEVEEFIYGDRRYGGEPFFVPSD  511

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S + E ED GYIL++VHDE   KSEL +VNA +L+LEASV+LPSRVPYGFHGTFI+A 
Sbjct  512  STS-DGEGEDAGYILSYVHDENTWKSELLVVNATSLKLEASVELPSRVPYGFHGTFISAT  570

Query  361  DLSSQA  378
            DL +QA
Sbjct  571  DLENQA  576



>dbj|BAC10550.1| nine-cis-epoxycarotenoid dioxygenase2 [Pisum sativum]
Length=601

 Score =   194 bits (494),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 4/125 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVN+NKLGRKTQ+AYLA+AEPWPKVSGFAKVDLF+GEVKK++YG+ ++GGEPLFLP  
Sbjct  480  AGMVNKNKLGRKTQFAYLALAEPWPKVSGFAKVDLFSGEVKKYLYGENRFGGEPLFLP--  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              +++ E EDDGYIL FVHDEK  KSE+QIVNA  L+LEA + LPSRVPYGFHGTFI++ 
Sbjct  538  --NEDSENEDDGYILTFVHDEKEWKSEIQIVNAVNLKLEACIPLPSRVPYGFHGTFIHSK  595

Query  361  DLSSQ  375
            +L  Q
Sbjct  596  ELEKQ  600



>ref|XP_009406704.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=603

 Score =   194 bits (494),  Expect = 9e-55, Method: Composition-based stats.
 Identities = 89/126 (71%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKVDL TGEV KF++G+ +YGGEP F+PRN
Sbjct  480  AGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLSTGEVSKFLFGESRYGGEPCFVPRN  539

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              +     EDDGY+L F+HDE+  +SEL IVNA  + LEA+V+LPSRVPYGFHGTF+ + 
Sbjct  540  AGAL--SREDDGYVLTFMHDERTSESELLIVNAGDMRLEAAVRLPSRVPYGFHGTFVASK  597

Query  361  DLSSQA  378
            DL SQA
Sbjct  598  DLQSQA  603



>gb|AGT28471.1| 9-cis-epoxycarotenoid dioxygenase [Narcissus tazetta]
Length=600

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT+YAYLAIAEPWPKVSGFAKVDL +GEV+KFIYGD  YGGEP F+PR+
Sbjct  478  AGMVNRNRLGRKTRYAYLAIAEPWPKVSGFAKVDLQSGEVRKFIYGDNCYGGEPYFIPRD  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S+    EDDGYI+ FVH+E+  +SEL+IVNA  + LEASVKLPSRVPYGFHGTFI + 
Sbjct  538  AGSK---REDDGYIVTFVHNEETSESELRIVNAADMRLEASVKLPSRVPYGFHGTFIGSK  594

Query  361  DLSSQA  378
            +L SQA
Sbjct  595  ELQSQA  600



>ref|XP_002889190.1| hypothetical protein ARALYDRAFT_895735 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65449.1| hypothetical protein ARALYDRAFT_895735 [Arabidopsis lyrata subsp. 
lyrata]
Length=121

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 5/124 (4%)
 Frame = +1

Query  7    MVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRNVN  186
            MVNRN LG+KT++AYLA+ EPWPKVSGF KVDL TG+++K+IYGD KYGGEPLFLP    
Sbjct  1    MVNRNLLGKKTRFAYLALTEPWPKVSGFVKVDLSTGDIQKYIYGDGKYGGEPLFLPSG--  58

Query  187  SQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINADDL  366
               D EED GYI+ FVHDE+  KSELQI+NA  ++LEA+V LPSRVPYGFHGTFI+ +DL
Sbjct  59   ---DGEEDGGYIMVFVHDEEKVKSELQIINAVNMKLEATVTLPSRVPYGFHGTFISKEDL  115

Query  367  SSQA  378
            S QA
Sbjct  116  SKQA  119



>dbj|BAF42336.1| 9-cis-epoxycarotenoid dioxygenase [Raphanus sativus]
Length=597

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 3/125 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK +YGD +YGGEPLFLP  
Sbjct  475  AGMVNRNMLGRKTEFAYLALAEPWPKVSGFAKVDLSTGEVKKHLYGDGRYGGEPLFLP--  532

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               + +  EDDG+IL FVHDEK  KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI A+
Sbjct  533  -GEEGEGAEDDGHILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAN  591

Query  361  DLSSQ  375
            DL+ Q
Sbjct  592  DLAKQ  596



>emb|CDY61838.1| BnaCnng38510D [Brassica napus]
Length=589

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAE WPKVSGFAKVDL TGEVK   YG +KYGGEP FLPR 
Sbjct  467  AGMVNRNFLGRKTRYAYLAIAELWPKVSGFAKVDLSTGEVKNHFYGYKKYGGEPFFLPRG  526

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            +   E + EDDGYI++FVHDE++ KSELQIVNA TLELEA+VKLPSRVPYGFHGTF+N+ 
Sbjct  527  L---ESDGEDDGYIMSFVHDEESWKSELQIVNAVTLELEATVKLPSRVPYGFHGTFVNSA  583

Query  361  DLSSQA  378
            D+ +QA
Sbjct  584  DMVNQA  589



>gb|AEG78287.1| 9-cis-epoxycarotenoid dioxygenase [Gladiolus hybrid cultivar]
Length=611

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLAIAEPWPKVSGFAKVDL TGEV KFIYGD KYGGEP F+PR 
Sbjct  490  AGMVNRNRLGRKTRFAYLAIAEPWPKVSGFAKVDLSTGEVHKFIYGDNKYGGEPYFVPRE  549

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +++    EDDGY+LAFVHDE+  +SELQIVN   + LEA+VKLPSRVPYGFHGTFI   
Sbjct  550  GSTR----EDDGYVLAFVHDEETSESELQIVNGTDMRLEATVKLPSRVPYGFHGTFIGTK  605

Query  361  DLSSQA  378
            +L +QA
Sbjct  606  ELETQA  611



>ref|XP_010478382.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Camelina sativa]
Length=593

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL TG+VK   YG +K+GGEP FLPR 
Sbjct  471  AGMVNRNLLGRKTRYAYLAIAEPWPKVSGFAKVDLSTGKVKNHFYGGKKFGGEPFFLPRG  530

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            +   E + EDDGYI++FVHDE++ +SELQIVNA T+ELEA+VKLPSRVPYGFHGTF+N+ 
Sbjct  531  L---ESDGEDDGYIMSFVHDEESWESELQIVNAVTMELEATVKLPSRVPYGFHGTFVNSA  587

Query  361  DLSSQA  378
            D+ +QA
Sbjct  588  DMLNQA  593



>gb|AFY10513.1| 9-cis-epoxycarotenoid-dioxygenase, partial [Sisymbrium officinale]
Length=395

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 108/126 (86%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGE++K+IYG+ KYGGEPLF+P  
Sbjct  270  AGMVNRNFLGRKTRFAYLALAEPWPKVSGFAKVDLSTGEIQKYIYGNGKYGGEPLFMPE-  328

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S +D  ED GYI+ FVHDE+  KSELQI+NA +++LEA+V LPSRVPYGFHGTFI+ +
Sbjct  329  -VSGDDTTEDSGYIMVFVHDEENVKSELQIINAVSMKLEATVTLPSRVPYGFHGTFISNE  387

Query  361  DLSSQA  378
            DLS QA
Sbjct  388  DLSKQA  393



>gb|AAS68632.2| putative 9-cis-epoxycarotenoid dioxygenase [Chorispora bungeana]
Length=599

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 105/126 (83%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK +YG+ +YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLSTGEVKKHLYGENRYGGEPLFLP--  535

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                 +  EDDGYIL FVHDEK  KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI A 
Sbjct  536  --GDNEGGEDDGYILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAS  593

Query  361  DLSSQA  378
            DL+ Q 
Sbjct  594  DLAKQV  599



>ref|XP_010499525.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Camelina sativa]
Length=593

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWP+VSGFAKVDL TGEVK   YG +K+GGEP FLPR 
Sbjct  471  AGMVNRNLLGRKTRYAYLAIAEPWPRVSGFAKVDLSTGEVKNHFYGGKKFGGEPFFLPRG  530

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            +   E + EDDGYI++FVHDE++  SELQIVNA T+ELEA+VKLPSRVPYGFHGTF+N+ 
Sbjct  531  L---ESDGEDDGYIMSFVHDEESWVSELQIVNAVTMELEATVKLPSRVPYGFHGTFVNSA  587

Query  361  DLSSQA  378
            D+ +QA
Sbjct  588  DMLNQA  593



>gb|AEK99287.1| 9-cis-epoxycarotenoid dioxygenase [Pyrus pyrifolia]
Length=264

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 114/130 (88%), Gaps = 4/130 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLAIAEPWPKVSGFAKVDL TGEVKK IYG  K+GGEP FLP+ 
Sbjct  135  AGMVNRNRLGRKTRFAYLAIAEPWPKVSGFAKVDLVTGEVKKHIYGGRKFGGEPFFLPKE  194

Query  181  VNS----QEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTF  348
             NS    +E+E+ED+GYI+AFVHDE+  KSE+QIVNA  L++EA++KLPSRVPYGFHGTF
Sbjct  195  GNSGGEEEEEEDEDEGYIMAFVHDERTWKSEVQIVNAMDLKVEATIKLPSRVPYGFHGTF  254

Query  349  INADDLSSQA  378
            ++A++L +QA
Sbjct  255  VHANNLENQA  264



>dbj|BAN15740.1| 9-cis-epoxy-carotenoid dioxygenase [Dianthus caryophyllus]
Length=589

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEV K+ YG EKYGGEPLFLP  
Sbjct  467  AGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVSKYFYGGEKYGGEPLFLPCG  526

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N   +EE   G+ILAFVHDEK   SELQIVNA T++L A+V+LPSRVPYGFHGTFI   
Sbjct  527  ENVDSEEE---GHILAFVHDEKNWTSELQIVNAVTMDLVATVQLPSRVPYGFHGTFITDQ  583

Query  361  DLSSQA  378
            DL +Q 
Sbjct  584  DLLTQV  589



>emb|CDX97576.1| BnaA05g25030D [Brassica napus]
Length=597

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 6/125 (5%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK +YGD++YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLATGEVKKHLYGDDRYGGEPLFLP--  535

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                 +  EDDG+IL FVHDE   KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI A 
Sbjct  536  ----GEGAEDDGHILCFVHDEMTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAS  591

Query  361  DLSSQ  375
            DL++Q
Sbjct  592  DLANQ  596



>ref|XP_010054257.1| PREDICTED: LOW QUALITY PROTEIN: 9-cis-epoxycarotenoid dioxygenase 
NCED1, chloroplastic [Eucalyptus grandis]
Length=599

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 105/125 (84%), Gaps = 3/125 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKV+L TGEVKK+ YGD +YGGEP F P  
Sbjct  477  AGMVNRNLLGRKTKYAYLAIAEPWPKVSGFAKVNLETGEVKKYFYGDNRYGGEPFFSPAG  536

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               Q+   ED G+ILAFVHDE+A  SELQIVNA+ LELEASVKLPSRVPYGFHGTFI + 
Sbjct  537  ---QDPASEDHGHILAFVHDEEAWTSELQIVNAENLELEASVKLPSRVPYGFHGTFIESK  593

Query  361  DLSSQ  375
            DL+SQ
Sbjct  594  DLASQ  598



>gb|AGI98130.1| 9-cis-epoxycarotenoid dioxygenase [Narcissus tazetta]
Length=600

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT+YAYLAIAEPWPKVSGFAKVDL +GEV+KFIYG+  YGGEP F+PR+
Sbjct  478  AGMVNRNRLGRKTRYAYLAIAEPWPKVSGFAKVDLQSGEVRKFIYGENCYGGEPYFIPRD  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S+    EDDGYI+ FVH+E+  +SEL+IVNA  + LEASVKLPSRVPYGFHGTFI + 
Sbjct  538  AGSK---REDDGYIVTFVHNEETSESELRIVNAADMRLEASVKLPSRVPYGFHGTFIGSK  594

Query  361  DLSSQA  378
            +L SQA
Sbjct  595  ELQSQA  600



>dbj|BAN15739.1| 9-cis-epoxy-carotenoid dioxygenase [Dianthus caryophyllus]
Length=589

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKVDLFTGEV K+ YG EKYGGEPLFLP  
Sbjct  467  AGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEVSKYFYGGEKYGGEPLFLPCG  526

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             N   +EE   G+ILAFVHDEK   SELQIVNA T++L A+V+LPSRVPYGFHGTFI   
Sbjct  527  ENVDSEEE---GHILAFVHDEKNWTSELQIVNAVTMDLVATVQLPSRVPYGFHGTFITDQ  583

Query  361  DLSSQA  378
            DL +Q 
Sbjct  584  DLLTQV  589



>emb|CDX98455.1| BnaC05g39200D [Brassica napus]
Length=597

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 104/125 (83%), Gaps = 6/125 (5%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVD+ TGEVKK +YGD +YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDITTGEVKKHLYGDNRYGGEPLFLP--  535

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                 +  EDDG+IL FVHDEK  KSELQIVNA  LE+EA+VKLPSRVPYGFHGTFI A 
Sbjct  536  ----GEGAEDDGHILCFVHDEKTWKSELQIVNAVCLEVEATVKLPSRVPYGFHGTFIGAS  591

Query  361  DLSSQ  375
            DL+ Q
Sbjct  592  DLAKQ  596



>ref|XP_010941288.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic [Elaeis 
guineensis]
Length=615

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT+YAYLAIAEPWPKVSGFAKVDL TGEV KF+YG  +YGGEP F+ R+
Sbjct  493  AGMVNRNKLGRKTRYAYLAIAEPWPKVSGFAKVDLLTGEVAKFMYGGSRYGGEPYFVARD  552

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S     EDDG++LAF+HDE   +SEL IVNA  + L+ASVKLPSRVPYGFHGTFIN+ 
Sbjct  553  AAS---PREDDGHVLAFMHDETTSESELLIVNAADMRLQASVKLPSRVPYGFHGTFINSK  609

Query  361  DLSSQA  378
            DL SQA
Sbjct  610  DLESQA  615



>gb|ACD44928.1| plastid 9-cis-epoxycarotenoid dioxygenase [Crocus sativus]
Length=611

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 4/126 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN++GRKT++AYLAIAEPWPKVSGFAKVDL TGEV+K IYGD KYGGEP F+PR 
Sbjct  490  AGMVNRNRIGRKTRFAYLAIAEPWPKVSGFAKVDLSTGEVEKLIYGDGKYGGEPYFVPRE  549

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +++    EDDGY+LAFVHDE+  +SELQIVN   + LEASVKLPSRVPYGFHGTFI + 
Sbjct  550  GSTR----EDDGYVLAFVHDEETSESELQIVNGTDMRLEASVKLPSRVPYGFHGTFIGSK  605

Query  361  DLSSQA  378
            +L +QA
Sbjct  606  ELETQA  611



>ref|XP_010428966.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic-like 
[Camelina sativa]
Length=615

 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 104/126 (83%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++ YLA+ EPWPKVSGFAKVD+ TGE++K+IYGDEKYGGEPLFLP  
Sbjct  495  AGMVNRNLLGRKTRFVYLALTEPWPKVSGFAKVDISTGEIQKYIYGDEKYGGEPLFLPSG  554

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                 D EEDDGYI+ FVHDE+  KSELQI+NA  L+LEA+V LPSRVPYGFHGTFI  +
Sbjct  555  -----DGEEDDGYIMVFVHDEEKVKSELQIINAVNLKLEATVTLPSRVPYGFHGTFITKE  609

Query  361  DLSSQA  378
            DL  QA
Sbjct  610  DLLKQA  615



>ref|XP_010460787.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Camelina sativa]
Length=593

 Score =   191 bits (486),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWP+VSGFAKVDL TGEVK   YG +K+GGEP  LPR 
Sbjct  471  AGMVNRNLLGRKTRYAYLAIAEPWPRVSGFAKVDLSTGEVKNHFYGGKKFGGEPFVLPRG  530

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            +   E + EDDGYI++FVHDE++ +SELQIVNA T+ELEA+VKLPSRVPYGFHGTF+N+ 
Sbjct  531  L---ESDGEDDGYIMSFVHDEESWESELQIVNAVTMELEATVKLPSRVPYGFHGTFVNSA  587

Query  361  DLSSQA  378
            D+ +QA
Sbjct  588  DMLNQA  593



>ref|XP_010529159.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic 
[Tarenaya hassleriana]
Length=579

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 105/125 (84%), Gaps = 2/125 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLAIAEPWPKVSG AKVDLFTGE++K+IYG +KYGGEP FLPR 
Sbjct  456  AGMVNRNRLGRKTRFAYLAIAEPWPKVSGLAKVDLFTGEIQKYIYGGKKYGGEPFFLPRG  515

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                + E EDDGYI   VHDE+  KSELQIVNA  L+LEA+V LPSRVPYGFHGTF+++ 
Sbjct  516  CG--DGENEDDGYIFCHVHDEEEWKSELQIVNAVNLQLEATVHLPSRVPYGFHGTFVDSK  573

Query  361  DLSSQ  375
            +L+ Q
Sbjct  574  ELAHQ  578



>ref|XP_010549494.1| PREDICTED: probable 9-cis-epoxycarotenoid dioxygenase NCED5, 
chloroplastic [Tarenaya hassleriana]
Length=595

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLAI EPWP+VSGFAKVDL TGE K + YG +KYGGEP F+PR 
Sbjct  473  AGMVNRNRLGRKTRFAYLAITEPWPRVSGFAKVDLLTGESKNYFYGGKKYGGEPYFVPRG  532

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            ++S   + EDDGYIL+FVHDEK  KSELQI+NA  LE  A+VKLPSRVPYGFHGTF+N+ 
Sbjct  533  LDS---DGEDDGYILSFVHDEKTWKSELQIINAVNLERAATVKLPSRVPYGFHGTFVNSS  589

Query  361  DLSSQA  378
            D+ +QA
Sbjct  590  DIVNQA  595



>ref|XP_010537673.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic-like 
[Tarenaya hassleriana]
Length=627

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LG KT++AYLA+AEPWPKVSGFAKVDL TGE+ K+IYGD KYGGEPLFLP N
Sbjct  505  AGMVNRNLLGTKTRFAYLALAEPWPKVSGFAKVDLTTGEIHKYIYGDGKYGGEPLFLPEN  564

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S    EED+G IL FVHDEK  +SELQIVNA TLELEA V+LPSRVPYGFHGTFI+++
Sbjct  565  SISG---EEDEGSILVFVHDEKRWRSELQIVNASTLELEAIVELPSRVPYGFHGTFISSE  621

Query  361  DLSSQA  378
            +L  QA
Sbjct  622  ELEKQA  627



>ref|XP_009146365.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic 
[Brassica rapa]
Length=597

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 6/126 (5%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK +YGD++YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLATGEVKKHLYGDDRYGGEPLFLP--  535

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                 +  EDDG+IL FVHDE    SELQIVNA +LE+EA+VKLPSRVPYGFHGTFI A 
Sbjct  536  ----GEGAEDDGHILCFVHDEMTWTSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAS  591

Query  361  DLSSQA  378
            DL++Q 
Sbjct  592  DLANQV  597



>ref|XP_009399013.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=617

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLAIAEPWPKVSGFAKVDL TG V KFI+GD KYGGEP F+PR+
Sbjct  495  AGMVNRNMLGRKTRYAYLAIAEPWPKVSGFAKVDLCTGAVSKFIFGDGKYGGEPYFVPRD  554

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              S     EDDGY+L+F+H+E   +SEL IVNA  ++LEA+VKLPSRVPYGFHGTFI + 
Sbjct  555  PKSS---REDDGYVLSFMHNENTSESELLIVNAADMQLEAAVKLPSRVPYGFHGTFIASR  611

Query  361  DLSSQA  378
            DL SQA
Sbjct  612  DLESQA  617



>ref|XP_010416821.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic-like 
[Camelina sativa]
Length=608

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 104/126 (83%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++ YLA+ EPWPKVSGFAKVD+ TGE++K+IYGDEKYGGEPLFLP  
Sbjct  488  AGMVNRNLLGRKTRFVYLALTEPWPKVSGFAKVDISTGEIQKYIYGDEKYGGEPLFLPSG  547

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                 D EEDD YI+ FVHDE+  KSELQI+NA  L+LEA+V LPSRVPYGFHGTFI+ +
Sbjct  548  -----DGEEDDDYIMVFVHDEEKVKSELQIINAVNLKLEATVTLPSRVPYGFHGTFISKE  602

Query  361  DLSSQA  378
            DL  QA
Sbjct  603  DLLKQA  608



>gb|EPS70455.1| hypothetical protein M569_04294 [Genlisea aurea]
Length=574

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AG VNR  LGRKT+YAYL+IAEPWPKVSGFAKVDL TG+  K+IYGDE++GGEP F+PR 
Sbjct  449  AGTVNRKFLGRKTRYAYLSIAEPWPKVSGFAKVDLTTGKTTKYIYGDERFGGEPYFVPRE  508

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                    EDDGYIL FVHDE++ +SELQI+NA  L+LEA++KLPSRVPYGFHGTFI++ 
Sbjct  509  EEKHHSCNEDDGYILVFVHDERSRRSELQIINAMNLQLEATIKLPSRVPYGFHGTFISST  568

Query  361  DLSSQA  378
            +L  QA
Sbjct  569  ELRDQA  574



>ref|XP_010472055.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic 
[Camelina sativa]
Length=606

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 104/126 (83%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++ YLA+ EPWPKVSGFAKVD+ TGE++K+IYGD KYGGEPLFLP  
Sbjct  486  AGMVNRNLLGRKTRFVYLALTEPWPKVSGFAKVDISTGEIQKYIYGDGKYGGEPLFLPSG  545

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                 D EEDDGYI+ FVHDE+  KSELQI+NA  L+LEA+V LPSRVPYGFHGTFI+ +
Sbjct  546  -----DGEEDDGYIMVFVHDEEKVKSELQIINAVNLKLEATVTLPSRVPYGFHGTFISKE  600

Query  361  DLSSQA  378
            DL  QA
Sbjct  601  DLLKQA  606



>ref|XP_010487252.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=605

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 106/125 (85%), Gaps = 4/125 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLA+AEPWPKVSGFAKVDL TGEVKK++YGD +YGGEPLFLP  
Sbjct  484  AGMVNRNMLGRKTKYAYLALAEPWPKVSGFAKVDLTTGEVKKYLYGDNRYGGEPLFLPGE  543

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +EDE     +IL FVHDEK  KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI AD
Sbjct  544  GGEEEDEG----HILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAD  599

Query  361  DLSSQ  375
            DL+ Q
Sbjct  600  DLAKQ  604



>gb|EPS69338.1| 9-cis-epoxycarotenoid dioxygenase 3, partial [Genlisea aurea]
Length=506

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 100/117 (85%), Gaps = 5/117 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRNKLGRKT++AYLAIAEPWP+VSGFAKVDL TGEVKK  YGD KYGGEPLFLP N
Sbjct  394  AGMVNRNKLGRKTRFAYLAIAEPWPRVSGFAKVDLSTGEVKKIFYGDAKYGGEPLFLPGN  453

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFI  351
             +S     EDDG+IL F HDEK+ KSELQI+NA  L+L ASV+LPSRVPYGFHGTFI
Sbjct  454  SDS-----EDDGHILVFTHDEKSSKSELQIINAANLKLHASVQLPSRVPYGFHGTFI  505



>ref|NP_177960.1| 9-cis-epoxycarotenoid dioxygenase [Arabidopsis thaliana]
 sp|Q9M9F5.1|NCED9_ARATH RecName: Full=9-cis-epoxycarotenoid dioxygenase NCED9, chloroplastic; 
Short=AtNCED9; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF71797.1|AC013430_6 F3F9.10 [Arabidopsis thaliana]
 gb|AEE36100.1| 9-cis-epoxycarotenoid dioxygenase [Arabidopsis thaliana]
Length=657

 Score =   189 bits (481),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 105/126 (83%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLA+ EPWPKVSGFAKVDL TGE++K+IYG+ KYGGEPLFLP  
Sbjct  535  AGMVNRNLLGRKTRYAYLALTEPWPKVSGFAKVDLSTGEIRKYIYGEGKYGGEPLFLPSG  594

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                 D EED GYI+ FVHDE+  KSELQ++NA  ++LEA+V LPSRVPYGFHGTFI+ +
Sbjct  595  -----DGEEDGGYIMVFVHDEEKVKSELQLINAVNMKLEATVTLPSRVPYGFHGTFISKE  649

Query  361  DLSSQA  378
            DLS QA
Sbjct  650  DLSKQA  655



>ref|XP_010487250.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010487251.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=599

 Score =   189 bits (480),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 106/125 (85%), Gaps = 4/125 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLA+AEPWPKVSGFAKVDL TGEVKK++YGD +YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTKYAYLALAEPWPKVSGFAKVDLTTGEVKKYLYGDNRYGGEPLFLPGE  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +EDE     +IL FVHDEK  KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI AD
Sbjct  538  GGEEEDEG----HILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAD  593

Query  361  DLSSQ  375
            DL+ Q
Sbjct  594  DLAKQ  598



>ref|XP_006650343.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase 1, chloroplastic-like 
[Oryza brachyantha]
Length=605

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +1

Query  4    GMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRNV  183
            GMVNRN LGRKT+YAYLA+AEPWPKVSGFAKVDL TGE+ KF YG  ++GGEP F+P + 
Sbjct  481  GMVNRNLLGRKTRYAYLAVAEPWPKVSGFAKVDLVTGELTKFDYGPGRFGGEPCFVPMDP  540

Query  184  NSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINADD  363
            ++     EDDGYIL+FVH+E+AG SEL +VNA  + LEA+V+LPSRVPYGFHGTFI A +
Sbjct  541  STAPPRGEDDGYILSFVHNERAGTSELLVVNAADMRLEATVQLPSRVPYGFHGTFITAGE  600

Query  364  LSSQA  378
            LSSQA
Sbjct  601  LSSQA  605



>dbj|BAC10551.1| nine-cis-epoxycarotenoid dioxygenase3 [Pisum sativum]
Length=608

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 106/127 (83%), Gaps = 2/127 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLP--  174
            AGMVNRN+LGRKT++AYLA+AEPWPKVSGFAKVDL +GEVKK  YGD ++GGEP FLP  
Sbjct  482  AGMVNRNRLGRKTRFAYLAVAEPWPKVSGFAKVDLESGEVKKHSYGDGRFGGEPFFLPTR  541

Query  175  RNVNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFIN  354
            R+   + + EED GYI+A VHDE+  KSELQIVNA  LE+EA+VKLPSRVPYGFHGTF+ 
Sbjct  542  RSGRCEYENEEDGGYIMALVHDERRCKSELQIVNAVNLEVEATVKLPSRVPYGFHGTFVE  601

Query  355  ADDLSSQ  375
            A DL+ Q
Sbjct  602  AKDLTFQ  608



>gb|AAY82459.1| putative 9-cis-epoxycarotenoid dioxygenase 2 [Cuscuta reflexa]
Length=636

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNR+KLGRKT+YAYLA+AEPWPKVSGFAKVDLFTG+VKKF+YGDEKYGGEPLF P +
Sbjct  511  AGMVNRHKLGRKTRYAYLAVAEPWPKVSGFAKVDLFTGQVKKFMYGDEKYGGEPLFFPGD  570

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
            ++S+E++E+   Y+LAFVHDE+  +SELQIVNAQ+LELEASVK   RVPYGFHGTFI ++
Sbjct  571  LDSEEEDEDGG-YVLAFVHDERRWESELQIVNAQSLELEASVKFTIRVPYGFHGTFITSN  629

Query  361  DLSSQA  378
            DL +Q 
Sbjct  630  DLLTQV  635



>gb|AAL07104.1| putative 9-cis-epoxycarotenoid dioxygenase [Arabidopsis thaliana]
Length=599

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 104/126 (83%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK +YGD +YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLTTGEVKKHLYGDNRYGGEPLFLPGE  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +++      YIL FVHDEK  KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI AD
Sbjct  538  GGEEDEG-----YILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAD  592

Query  361  DLSSQA  378
            DL+ Q 
Sbjct  593  DLAKQV  598



>ref|NP_188062.1| 9-cis-epoxycarotenoid dioxygenase NCED3 [Arabidopsis thaliana]
 sp|Q9LRR7.1|NCED3_ARATH RecName: Full=9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic; 
Short=AtNCED3; AltName: Full=Protein SALT TOLERANT 
1; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01336.1| 9-cis-epoxycarotenoid dioxygenase [Arabidopsis thaliana]
 dbj|BAB70609.1| neoxanthin cleavage enzyme [Arabidopsis thaliana]
 gb|AEE75526.1| 9-cis-epoxycarotenoid dioxygenase NCED3 [Arabidopsis thaliana]
 gb|AFA52661.1| 9-cis-epoxycarotenoid dioxygenase (NCED3) [synthetic construct]
Length=599

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 104/126 (83%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK +YGD +YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLTTGEVKKHLYGDNRYGGEPLFLPGE  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +++      YIL FVHDEK  KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI AD
Sbjct  538  GGEEDEG-----YILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAD  592

Query  361  DLSSQA  378
            DL+ Q 
Sbjct  593  DLAKQV  598



>ref|XP_010501914.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic 
[Camelina sativa]
Length=599

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 105/125 (84%), Gaps = 4/125 (3%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLA+AEPWPKVSGFAKVDL TGEVKK +YGD +YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTKYAYLALAEPWPKVSGFAKVDLTTGEVKKHLYGDNRYGGEPLFLPGE  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +EDE     +IL FVHDEK  KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI AD
Sbjct  538  GGEEEDEG----HILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAD  593

Query  361  DLSSQ  375
            DL+ Q
Sbjct  594  DLAKQ  598



>ref|XP_009397411.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=603

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 105/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNR  +GRKT+YAYLAIAEPWPKVSGFAKVDL TGE+KKFIYGD ++GGEP FLP+ 
Sbjct  481  AGMVNRKMVGRKTRYAYLAIAEPWPKVSGFAKVDLSTGEIKKFIYGDSRFGGEPYFLPKE  540

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +S     EDDGY+L+ VH+EK  KSEL IVN   ++LEA+VK+PSRVPYGFHGTF+++ 
Sbjct  541  TDSS---GEDDGYVLSLVHNEKTTKSELLIVNGADMQLEAAVKMPSRVPYGFHGTFVSSR  597

Query  361  DLSSQA  378
            DL +QA
Sbjct  598  DLVTQA  603



>emb|CDY33218.1| BnaC01g36910D [Brassica napus]
Length=598

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 103/126 (82%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLA+AEPWPKVSGFAKVDLFTGEV+K IYGD +YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTRYAYLALAEPWPKVSGFAKVDLFTGEVEKHIYGDNRYGGEPLFLPGE  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               ++D      YIL FVHDE   KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI A 
Sbjct  538  GGGEDDG-----YILCFVHDEMTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAS  592

Query  361  DLSSQA  378
            DL+ Q 
Sbjct  593  DLAKQV  598



>emb|CAD71149.1| nine-cis-epoxycarotenoid dioxygenase [Bixa orellana]
Length=607

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 106/126 (84%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLA+ EPWPKVSGFAK+DL +GEV+K++YGD K+GGEP F+P  
Sbjct  484  AGMVNRNRLGRKTEWAYLAVGEPWPKVSGFAKLDLTSGEVQKYLYGDGKFGGEPSFIPNE  543

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
              +   E EDDGY+L FVHDE+  +SELQ++NA  L LEAS++LPSRVPYGFHGTFIN D
Sbjct  544  PGNS--EAEDDGYVLTFVHDERKSRSELQVLNAGDLRLEASLQLPSRVPYGFHGTFINGD  601

Query  361  DLSSQA  378
            +L +QA
Sbjct  602  ELCNQA  607



>ref|XP_006297265.1| hypothetical protein CARUB_v10013279mg [Capsella rubella]
 gb|EOA30163.1| hypothetical protein CARUB_v10013279mg [Capsella rubella]
Length=598

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK +YGD +YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLATGEVKKHLYGDNRYGGEPLFLPGE  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +++      +IL FVHDEK  KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI AD
Sbjct  538  GGEEDEG-----HILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAD  592

Query  361  DLSSQA  378
            DL+ QA
Sbjct  593  DLAKQA  598



>gb|EAY91193.1| hypothetical protein OsI_12802 [Oryza sativa Indica Group]
Length=608

 Score =   187 bits (476),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 86/125 (69%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +1

Query  4    GMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRNV  183
            GMVNRN LGRKT+YAYLA+AEPWPKVSGFAKVDL TGE+ KF YG+ ++GGEP F+P + 
Sbjct  484  GMVNRNLLGRKTRYAYLAVAEPWPKVSGFAKVDLATGELTKFEYGEGRFGGEPCFVPMDA  543

Query  184  NSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINADD  363
             +     EDDGYIL+FVHDE+AG SEL +VNA  + LEA+V+LPSRVPYGFHGTFI  D+
Sbjct  544  AAATPRGEDDGYILSFVHDERAGTSELLVVNAADMRLEATVQLPSRVPYGFHGTFITGDE  603

Query  364  LSSQA  378
            L++QA
Sbjct  604  LTTQA  608



>ref|XP_009116867.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic 
[Brassica rapa]
Length=598

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 104/126 (83%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLA+AEPWPKVSGFAKVDLFTGEV+K +YGD++YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTRYAYLALAEPWPKVSGFAKVDLFTGEVEKHLYGDDRYGGEPLFLPGE  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               ++D      YIL FVHDE   KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI A 
Sbjct  538  GGGEDDG-----YILCFVHDEMTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAS  592

Query  361  DLSSQA  378
            DL+ Q 
Sbjct  593  DLAKQV  598



>ref|NP_001050765.1| Os03g0645900 [Oryza sativa Japonica Group]
 gb|AAW21319.1| 9-cis-epoxycarotenoid dioxygenase 3 [Oryza sativa Japonica Group]
 gb|ABF97874.1| viviparous-14, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12679.1| Os03g0645900 [Oryza sativa Japonica Group]
 gb|EAZ27934.1| hypothetical protein OsJ_11896 [Oryza sativa Japonica Group]
Length=608

 Score =   187 bits (476),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 86/125 (69%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +1

Query  4    GMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRNV  183
            GMVNRN LGRKT+YAYLA+AEPWPKVSGFAKVDL TGE+ KF YG+ ++GGEP F+P + 
Sbjct  484  GMVNRNLLGRKTRYAYLAVAEPWPKVSGFAKVDLATGELTKFEYGEGRFGGEPCFVPMDA  543

Query  184  NSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINADD  363
             +     EDDGYIL+FVHDE+AG SEL +VNA  + LEA+V+LPSRVPYGFHGTFI  D+
Sbjct  544  AAATPRGEDDGYILSFVHDERAGTSELLVVNAADMRLEATVQLPSRVPYGFHGTFITGDE  603

Query  364  LSSQA  378
            L++QA
Sbjct  604  LTTQA  608



>emb|CDY39117.1| BnaA01g29390D [Brassica napus]
Length=553

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 104/126 (83%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGR+T+YAYLA+AEPWPKVSGFAKVDLFTGEV+K +YGD++YGGEPLFLP  
Sbjct  433  AGMVNRNMLGRRTRYAYLALAEPWPKVSGFAKVDLFTGEVEKHLYGDDRYGGEPLFLPGE  492

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               ++D      YIL FVHDE   KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI A 
Sbjct  493  GGGEDDG-----YILCFVHDEMTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAS  547

Query  361  DLSSQA  378
            DL+ Q 
Sbjct  548  DLAKQV  553



>ref|XP_009388971.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=596

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 106/126 (84%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT+YAYLAIAEPWPKVSGFAKVDLFTGE+ KF++GD +YGGEP F+ R+
Sbjct  474  AGMVNRNRLGRKTRYAYLAIAEPWPKVSGFAKVDLFTGEMSKFVFGDGRYGGEPYFVARD  533

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             NS    +EDDG +L F+HDEK  +SEL IV+A  + LEA+VKLP RVPYGFHGTFI++ 
Sbjct  534  PNS---PKEDDGCVLTFMHDEKTSESELLIVDAADMRLEAAVKLPWRVPYGFHGTFISSR  590

Query  361  DLSSQA  378
            +L SQA
Sbjct  591  ELESQA  596



>ref|XP_006302015.1| hypothetical protein CARUB_v10019990mg, partial [Capsella rubella]
 gb|EOA34913.1| hypothetical protein CARUB_v10019990mg, partial [Capsella rubella]
Length=616

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 104/126 (83%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++ YLA+ EPWPKVSGFAKVD+ TGE++K+IYGD KYGGEPLFLP  
Sbjct  496  AGMVNRNLLGRKTRFVYLALTEPWPKVSGFAKVDISTGEIQKYIYGDGKYGGEPLFLPSG  555

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                 D EED GYI+ FVHDE+  KSELQI+NA  L+LEA+V LPSRVPYGFHGTFI+ +
Sbjct  556  -----DGEEDGGYIMVFVHDEEKVKSELQIINAVNLKLEATVALPSRVPYGFHGTFISKE  610

Query  361  DLSSQA  378
            DL +QA
Sbjct  611  DLLNQA  616



>ref|NP_193569.1| 9-cis-epoxycarotenoid dioxygenase NCED2 [Arabidopsis thaliana]
 sp|O49505.1|NCED2_ARATH RecName: Full=9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic; 
Short=AtNCED2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16715.1| neoxanthin cleavage enzyme - like protein [Arabidopsis thaliana]
 emb|CAB78837.1| neoxanthin cleavage enzyme-like protein [Arabidopsis thaliana]
 gb|ABO38778.1| At4g18350 [Arabidopsis thaliana]
 gb|AEE84030.1| 9-cis-epoxycarotenoid dioxygenase NCED2 [Arabidopsis thaliana]
Length=583

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = +1

Query  4    GMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRNV  183
            GMVNRN+LGRKT++A+LAIA PWPKVSGFAKVDL TGE+KK+IYG EKYGGEP FLP N 
Sbjct  460  GMVNRNRLGRKTRFAFLAIAYPWPKVSGFAKVDLCTGEMKKYIYGGEKYGGEPFFLPGNS  519

Query  184  NSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINADD  363
             + E E EDDGYI   VHDE+   SELQI+NA  L+LEA++KLPSRVPYGFHGTF+++++
Sbjct  520  GNGE-ENEDDGYIFCHVHDEETKTSELQIINAVNLKLEATIKLPSRVPYGFHGTFVDSNE  578

Query  364  LSSQ  375
            L  Q
Sbjct  579  LVDQ  582



>emb|CDX88443.1| BnaC06g38870D [Brassica napus]
Length=602

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+ EPWPKVSGFAKVDL TGEV+K+IYGD K+GGEPLF+P  
Sbjct  478  AGMVNRNLLGRKTRFAYLALTEPWPKVSGFAKVDLSTGEVQKYIYGDGKFGGEPLFMPEG  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                 D  ED GY++ FVHDE+  +SELQI+NA +L+LEA+V LPSRVPYGFHGTFI+ +
Sbjct  538  ---SSDATEDSGYVMVFVHDEENVRSELQIINAVSLKLEATVTLPSRVPYGFHGTFISNE  594

Query  361  DLSSQA  378
            DL  QA
Sbjct  595  DLLKQA  600



>ref|XP_002862994.1| nine-cis-epoxycarotenoid dioxygenase 9 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39253.1| nine-cis-epoxycarotenoid dioxygenase 9 [Arabidopsis lyrata subsp. 
lyrata]
Length=606

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 104/126 (83%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LG+KT++AYLA+ EPWPKVSGF KVDL TG+++K+IYGD KYGGEPLFLP  
Sbjct  484  AGMVNRNLLGKKTRFAYLALTEPWPKVSGFVKVDLSTGDIQKYIYGDGKYGGEPLFLPSG  543

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                 D EED GYI+ FVHDE+  KSELQI+NA  ++LEA+V LPSRVPYGFHGTFI+ +
Sbjct  544  -----DGEEDGGYIMVFVHDEEKVKSELQIINAVNMKLEATVTLPSRVPYGFHGTFISKE  598

Query  361  DLSSQA  378
            DLS QA
Sbjct  599  DLSKQA  604



>ref|XP_010465340.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic-like 
[Camelina sativa]
Length=600

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 104/125 (83%), Gaps = 3/125 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT+YAYLA+AEPWPKVSGFAKVDL TGEVKK +YGD +YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTKYAYLALAEPWPKVSGFAKVDLATGEVKKHLYGDNRYGGEPLFLPGE  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                E++E    +IL FVHDEK  KSELQIVNA +LE+EA+VKLPSRVPYGFHGTFI A 
Sbjct  538  GGEGEEDEG---HILCFVHDEKTWKSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAG  594

Query  361  DLSSQ  375
            DL+ Q
Sbjct  595  DLAKQ  599



>ref|XP_009136923.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic 
[Brassica rapa]
Length=583

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  4    GMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPR-N  180
            GMVNRN+LGRKT++A+LAIA+PWPKVSGFAKVDLFTGE++K+IYG EKYGGEP FLP  +
Sbjct  457  GMVNRNRLGRKTRFAFLAIADPWPKVSGFAKVDLFTGEIEKYIYGGEKYGGEPFFLPSGS  516

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +    E EDDGYI + VHDE+   SELQI+NA  L+LEA++KLPSRVPYGFHGTF+++ 
Sbjct  517  FDGNGGENEDDGYIFSHVHDEEKETSELQIINAVNLKLEATIKLPSRVPYGFHGTFVDSS  576

Query  361  DLSSQA  378
            +L  Q+
Sbjct  577  ELVDQS  582



>emb|CDY55629.1| BnaA03g58230D [Brassica napus]
Length=583

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  4    GMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPR-N  180
            GMVNRN+LGRKT++A+LAIA+PWPKVSGFAKVDLFTGE++K+IYG EKYGGEP FLP  +
Sbjct  457  GMVNRNRLGRKTRFAFLAIADPWPKVSGFAKVDLFTGEIEKYIYGGEKYGGEPFFLPSGS  516

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             +    E EDDGYI + VHDE+   SELQI+NA  L+LEA++KLPSRVPYGFHGTF+++ 
Sbjct  517  FDGNGGENEDDGYIFSHVHDEEKETSELQIINAVNLKLEATIKLPSRVPYGFHGTFVDSS  576

Query  361  DLSSQA  378
            +L  Q+
Sbjct  577  ELVDQS  582



>gb|KFK42225.1| hypothetical protein AALP_AA2G227500 [Arabis alpina]
Length=561

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 103/126 (82%), Gaps = 6/126 (5%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++ YLA+AEPWPKVSGFAKVDL TGEV K++YGD KYGGEPLFLP  
Sbjct  441  AGMVNRNYLGRKTRFTYLALAEPWPKVSGFAKVDLSTGEVYKYVYGDGKYGGEPLFLPSG  500

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
                  + ED GYIL FVHDE+  KSEL+IVNA T++LEA+V LPSRVPYGFHGTFI+ +
Sbjct  501  ------DGEDGGYILVFVHDEERVKSELEIVNAVTMKLEATVTLPSRVPYGFHGTFISKE  554

Query  361  DLSSQA  378
            DL  QA
Sbjct  555  DLLKQA  560



>ref|XP_002885045.1| nine-cis-epoxycarotenoid dioxygenase3 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61304.1| nine-cis-epoxycarotenoid dioxygenase3 [Arabidopsis lyrata subsp. 
lyrata]
Length=599

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 103/126 (82%), Gaps = 5/126 (4%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN LGRKT++AYLA+AEPWPKVSGFAKVDL TGEVKK +YGD +YGGEPLFLP  
Sbjct  478  AGMVNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLTTGEVKKHLYGDNRYGGEPLFLPGE  537

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
               +++      +IL FVHDEK   SELQIVNA +LE+EA+VKLPSRVPYGFHGTFI AD
Sbjct  538  GGEEDEG-----HILCFVHDEKTWTSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGAD  592

Query  361  DLSSQA  378
            DL+ Q 
Sbjct  593  DLAKQV  598



>ref|XP_002870052.1| nine-cis-epoxycarotenoid dioxygenase 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46311.1| nine-cis-epoxycarotenoid dioxygenase 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=576

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +1

Query  4    GMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRNV  183
            GMVNRN+LGRKT++A+LAIA+PWPKVSGFAKVDL TGE+KK+IYG EKYGGEP FLP + 
Sbjct  453  GMVNRNRLGRKTRFAFLAIADPWPKVSGFAKVDLCTGEMKKYIYGGEKYGGEPFFLPGSS  512

Query  184  NSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINADD  363
             + E E EDDGYI   VHDE+   SELQI+NA  L LEA++KLPSRVPYGFHGTF+++ +
Sbjct  513  GNGE-ENEDDGYIFCHVHDEEKKTSELQIINAVNLNLEATIKLPSRVPYGFHGTFVDSSE  571

Query  364  LSSQ  375
            L  Q
Sbjct  572  LVDQ  575



>gb|AAK00623.1| 9-cis-epoxycarotenoid dioxygenase [Persea americana]
Length=625

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 105/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  1    AGMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN  180
            AGMVNRN+LGRKT++AYLAIAEPWPKVSG AKVDL TGEV +F+YG+ ++GGEP F+PR 
Sbjct  502  AGMVNRNRLGRKTRFAYLAIAEPWPKVSGIAKVDLGTGEVNRFVYGERQFGGEPYFIPRE  561

Query  181  VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFINAD  360
             ++     EDDGY+++F+HDEK  +SEL I+NA  + LEASV LPSRVPYGFHGTFI++ 
Sbjct  562  PSTS--GREDDGYVVSFMHDEKTSRSELLILNAMNMRLEASVMLPSRVPYGFHGTFISSR  619

Query  361  DLSSQA  378
            DL+ QA
Sbjct  620  DLAKQA  625



>ref|XP_006664750.1| PREDICTED: 9-cis-epoxycarotenoid dioxygenase 1, chloroplastic-like, 
partial [Oryza brachyantha]
Length=440

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 102/128 (80%), Gaps = 3/128 (2%)
 Frame = +1

Query  4    GMVNRNKLGRKTQYAYLAIAEPWPKVSGFAKVDLFTGEVKKFIYGDEKYGGEPLFLPRN-  180
            GMVNRN LGRKT+YAYLA+AEPWPKVSGFA+VDL TGE+ KF YG  ++GGEP F+P + 
Sbjct  313  GMVNRNMLGRKTRYAYLAVAEPWPKVSGFARVDLVTGELTKFDYGPGRFGGEPCFVPMDG  372

Query  181  --VNSQEDEEEDDGYILAFVHDEKAGKSELQIVNAQTLELEASVKLPSRVPYGFHGTFIN  354
                +     EDDGYIL+FV DE AG SEL +VNA  + LEA+V+LPSRVPYGFHGTFIN
Sbjct  373  AGAAASPARGEDDGYILSFVRDEAAGTSELLVVNAADMRLEATVQLPSRVPYGFHGTFIN  432

Query  355  ADDLSSQA  378
            A +LSSQA
Sbjct  433  AGELSSQA  440



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 742397556606