BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17356_g1_i1 len=777 path=[1:0-486 488:487-548 550:549-776]

Length=777
                                                                      Score     E

ref|XP_006588839.1|  PREDICTED: uncharacterized protein LOC102670325    120   2e-30   
ref|XP_006594209.1|  PREDICTED: uncharacterized protein LOC100786697    120   2e-30   
ref|XP_004303004.1|  PREDICTED: uncharacterized protein LOC101298622    117   2e-29   
gb|KDO61094.1|  hypothetical protein CISIN_1g044600mg                   115   1e-28   
ref|XP_007145315.1|  hypothetical protein PHAVU_007G228700g             115   2e-28   
ref|XP_007203661.1|  hypothetical protein PRUPE_ppa027117mg             115   2e-28   
ref|XP_006430247.1|  hypothetical protein CICLE_v10013835mg             114   3e-28   
ref|XP_009621487.1|  PREDICTED: uncharacterized protein LOC104113099    114   4e-28   
ref|XP_008241264.1|  PREDICTED: uncharacterized protein LOC103339705    114   5e-28   
ref|XP_003520691.1|  PREDICTED: uncharacterized protein LOC100794241    113   1e-27   
gb|KHN18753.1|  hypothetical protein glysoja_021504                     113   1e-27   
ref|XP_004516192.1|  PREDICTED: uncharacterized protein LOC101513042    113   1e-27   
ref|XP_011042588.1|  PREDICTED: uncharacterized protein LOC105138239    110   2e-26   
ref|XP_009619042.1|  PREDICTED: uncharacterized protein LOC104111134    109   2e-26   
ref|XP_002320100.1|  hypothetical protein POPTR_0014s07390g             109   5e-26   Populus trichocarpa [western balsam poplar]
ref|XP_009775951.1|  PREDICTED: uncharacterized protein LOC104225788    108   6e-26   
ref|XP_010271716.1|  PREDICTED: uncharacterized protein LOC104607716    107   2e-25   
ref|XP_009148740.1|  PREDICTED: uncharacterized protein LOC103872144    107   2e-25   
ref|XP_007139917.1|  hypothetical protein PHAVU_008G069500g             107   3e-25   
ref|XP_009371265.1|  PREDICTED: uncharacterized protein LOC103960505    105   6e-25   
ref|XP_010527660.1|  PREDICTED: uncharacterized protein LOC104804968    106   6e-25   
gb|KEH42052.1|  peptidoglycan-binding LysM domain protein               106   7e-25   
ref|XP_008376509.1|  PREDICTED: uncharacterized protein LOC103439700    105   8e-25   
ref|XP_002283136.1|  PREDICTED: uncharacterized protein LOC100244252    105   9e-25   Vitis vinifera
emb|CDX95374.1|  BnaC04g27840D                                          105   1e-24   
ref|XP_003625786.1|  hypothetical protein MTR_7g104250                  103   3e-24   
ref|XP_010061666.1|  PREDICTED: uncharacterized protein LOC104449256    104   3e-24   
ref|XP_011024312.1|  PREDICTED: uncharacterized protein LOC105125525    104   3e-24   
ref|XP_004496617.1|  PREDICTED: uncharacterized protein LOC101512823    103   3e-24   
ref|XP_007220488.1|  hypothetical protein PRUPE_ppa013811mg             103   3e-24   
ref|XP_003521930.2|  PREDICTED: uncharacterized protein LOC100813243    104   3e-24   
gb|KHN04115.1|  hypothetical protein glysoja_036651                     104   3e-24   
ref|XP_008803250.1|  PREDICTED: uncharacterized protein LOC103716850    103   4e-24   
ref|XP_010919204.1|  PREDICTED: uncharacterized protein LOC105043378    103   4e-24   
ref|NP_190847.1|  peptidoglycan-binding LysM domain-containing pr...    103   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006421827.1|  hypothetical protein CICLE_v10006227mg             104   4e-24   
ref|XP_008241423.1|  PREDICTED: uncharacterized protein LOC103339846    103   4e-24   
ref|XP_007203323.1|  hypothetical protein PRUPE_ppa020004mg             103   4e-24   
gb|ACU23909.1|  unknown                                                 103   6e-24   Glycine max [soybeans]
ref|XP_008439155.1|  PREDICTED: uncharacterized protein LOC103484036    103   7e-24   
ref|XP_010101597.1|  hypothetical protein L484_015426                   103   7e-24   
ref|XP_002877887.1|  peptidoglycan-binding LysM domain-containing...    103   7e-24   
ref|XP_003528887.1|  PREDICTED: uncharacterized protein LOC100815990    103   9e-24   
emb|CDY23234.1|  BnaA04g05250D                                          103   1e-23   
ref|XP_008234307.1|  PREDICTED: uncharacterized protein LOC103333268    103   1e-23   
ref|XP_008462558.1|  PREDICTED: uncharacterized protein LOC103500889    102   1e-23   
ref|XP_006379511.1|  hypothetical protein POPTR_0008s03020g             102   1e-23   
ref|XP_002316406.2|  hypothetical protein POPTR_0010s23750g             102   1e-23   Populus trichocarpa [western balsam poplar]
ref|NP_001235917.1|  uncharacterized protein LOC100500035 precursor     102   1e-23   
gb|EYU35465.1|  hypothetical protein MIMGU_mgv1a016765mg                102   2e-23   
ref|XP_010278501.1|  PREDICTED: uncharacterized protein LOC104612680    102   2e-23   
ref|XP_009803785.1|  PREDICTED: uncharacterized protein LOC104249104    102   2e-23   
ref|XP_010317565.1|  PREDICTED: uncharacterized protein LOC101263880    102   2e-23   
ref|XP_003534586.1|  PREDICTED: uncharacterized protein LOC100778431    102   2e-23   
gb|KHN02240.1|  hypothetical protein glysoja_002264                     101   3e-23   
ref|XP_006403768.1|  hypothetical protein EUTSA_v10010832mg             101   3e-23   
ref|XP_007038563.1|  Peptidoglycan-binding LysM domain-containing...    101   3e-23   
ref|XP_003628108.1|  hypothetical protein MTR_8g043660                  101   3e-23   
ref|XP_011031601.1|  PREDICTED: uncharacterized protein LOC105130685    101   3e-23   
ref|XP_009803777.1|  PREDICTED: uncharacterized protein LOC104249093    101   3e-23   
ref|XP_002321883.2|  peptidoglycan-binding LysM domain-containing...    101   4e-23   Populus trichocarpa [western balsam poplar]
ref|XP_002511780.1|  conserved hypothetical protein                     101   4e-23   Ricinus communis
gb|AFK40764.1|  unknown                                                 101   5e-23   
gb|AFK49092.1|  unknown                                                 100   6e-23   
ref|XP_006292081.1|  hypothetical protein CARUB_v10018276mg             100   7e-23   
ref|XP_010504024.1|  PREDICTED: uncharacterized protein LOC104781129    100   9e-23   
ref|XP_004494912.1|  PREDICTED: uncharacterized protein LOC101513902  99.8    1e-22   
ref|XP_006851507.1|  hypothetical protein AMTR_s00040p00156520        99.8    1e-22   
emb|CDP05258.1|  unnamed protein product                              99.8    1e-22   
ref|XP_004150301.1|  PREDICTED: uncharacterized protein LOC101210054    100   1e-22   
ref|XP_011041736.1|  PREDICTED: uncharacterized protein LOC105137629  99.8    1e-22   
ref|XP_009626306.1|  PREDICTED: uncharacterized protein LOC104117032  99.4    2e-22   
ref|XP_010317566.1|  PREDICTED: uncharacterized protein LOC104646140  99.8    2e-22   
gb|KDP22340.1|  hypothetical protein JCGZ_26171                       99.4    2e-22   
ref|XP_010426901.1|  PREDICTED: uncharacterized protein LOC104711831  99.4    2e-22   
gb|EYU25044.1|  hypothetical protein MIMGU_mgv1a024197mg              99.4    3e-22   
ref|XP_011015875.1|  PREDICTED: uncharacterized protein LOC105119433  99.4    3e-22   
ref|XP_002270367.1|  PREDICTED: uncharacterized protein LOC100255607  99.0    3e-22   Vitis vinifera
ref|XP_011076250.1|  PREDICTED: uncharacterized protein LOC105160530  99.4    3e-22   
ref|XP_007143364.1|  hypothetical protein PHAVU_007G066300g           98.2    4e-22   
ref|XP_010049654.1|  PREDICTED: uncharacterized protein LOC104438250  98.2    5e-22   
ref|XP_009366749.1|  PREDICTED: uncharacterized protein LOC103956477  98.2    5e-22   
gb|KEH18985.1|  peptidoglycan-binding LysM domain protein             98.6    5e-22   
ref|XP_009415612.1|  PREDICTED: uncharacterized protein LOC103996414  97.8    5e-22   
ref|XP_002510858.1|  conserved hypothetical protein                   97.8    6e-22   Ricinus communis
ref|NP_001235454.1|  uncharacterized protein LOC100500258 precursor   97.8    6e-22   
gb|KHN02791.1|  hypothetical protein glysoja_016033                   97.8    6e-22   
ref|XP_010255558.1|  PREDICTED: uncharacterized protein LOC104596195  97.8    8e-22   
ref|XP_007163923.1|  hypothetical protein PHAVU_L005300g              97.8    9e-22   
ref|XP_002467624.1|  hypothetical protein SORBIDRAFT_01g031120        97.8    1e-21   Sorghum bicolor [broomcorn]
ref|XP_010515752.1|  PREDICTED: uncharacterized protein LOC104791536  97.4    1e-21   
ref|XP_003549126.1|  PREDICTED: uncharacterized protein LOC100789966  97.4    1e-21   
gb|KHN31546.1|  hypothetical protein glysoja_029681                   97.4    1e-21   
ref|XP_009626309.1|  PREDICTED: uncharacterized protein LOC104117035  97.4    1e-21   
ref|XP_009384524.1|  PREDICTED: uncharacterized protein LOC103972056  97.4    1e-21   
ref|XP_008795361.1|  PREDICTED: uncharacterized protein LOC103711121  97.1    1e-21   
gb|EPS60975.1|  hypothetical protein M569_13827                       95.1    2e-21   
ref|XP_003592328.1|  hypothetical protein MTR_1g101680                96.7    2e-21   
emb|CDX87231.1|  BnaC09g05460D                                        96.7    2e-21   
ref|XP_006353384.1|  PREDICTED: uncharacterized protein LOC102593371  96.7    2e-21   
ref|XP_010035084.1|  PREDICTED: uncharacterized protein LOC104424381  97.4    2e-21   
gb|EEC74398.1|  hypothetical protein OsI_09751                        97.1    2e-21   Oryza sativa Indica Group [Indian rice]
emb|CAN62985.1|  hypothetical protein VITISV_027722                   96.7    2e-21   Vitis vinifera
ref|XP_002302557.2|  hypothetical protein POPTR_0002s15400g           96.7    3e-21   Populus trichocarpa [western balsam poplar]
gb|EPS60868.1|  hypothetical protein M569_13934                       95.9    4e-21   
ref|XP_008801244.1|  PREDICTED: uncharacterized protein LOC103715411  95.5    5e-21   
ref|NP_001173239.1|  Os03g0118450                                     95.9    5e-21   
ref|NP_001237009.1|  uncharacterized protein LOC100306578 precursor   95.1    7e-21   
ref|XP_010546080.1|  PREDICTED: uncharacterized protein LOC104818271  94.7    7e-21   
ref|XP_007134952.1|  hypothetical protein PHAVU_010G089500g           95.1    8e-21   
ref|XP_010054124.1|  PREDICTED: uncharacterized protein LOC104442390  94.4    1e-20   
ref|XP_010536496.1|  PREDICTED: uncharacterized protein LOC104811486  94.7    1e-20   
ref|XP_007051957.1|  Peptidoglycan-binding LysM domain-containing...  95.1    1e-20   
ref|XP_010693458.1|  PREDICTED: uncharacterized protein LOC104906416  95.1    1e-20   
ref|XP_008657691.1|  PREDICTED: uncharacterized protein LOC103637226  94.7    1e-20   
emb|CDP08902.1|  unnamed protein product                              94.4    1e-20   
ref|XP_008369703.1|  PREDICTED: uncharacterized protein LOC103433248  94.0    2e-20   
ref|XP_009130195.1|  PREDICTED: uncharacterized protein LOC103854980  94.0    2e-20   
ref|NP_680740.1|  peptidoglycan-binding LysM domain-containing pr...  94.0    2e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30698.1|  BnaA02g33200D                                        96.3    2e-20   
ref|XP_006394428.1|  hypothetical protein EUTSA_v10005374mg           93.6    2e-20   
ref|XP_010933904.1|  PREDICTED: uncharacterized protein LOC105054156  93.6    2e-20   
ref|XP_009400454.1|  PREDICTED: uncharacterized protein LOC103984638  93.6    2e-20   
ref|XP_010458310.1|  PREDICTED: uncharacterized protein LOC104739594  93.2    3e-20   
ref|XP_002864773.1|  peptidoglycan-binding LysM domain-containing...  93.2    3e-20   
ref|XP_010444068.1|  PREDICTED: uncharacterized protein LOC104726820  93.2    3e-20   
ref|XP_006281367.1|  hypothetical protein CARUB_v10027425mg           93.2    3e-20   
ref|XP_009112007.1|  PREDICTED: uncharacterized protein LOC103837401  93.2    3e-20   
ref|XP_002318841.1|  peptidoglycan-binding LysM domain-containing...  93.2    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006857938.1|  hypothetical protein AMTR_s00069p00157890        93.2    5e-20   
ref|XP_011030048.1|  PREDICTED: uncharacterized protein LOC105129616  92.8    5e-20   
ref|XP_004510888.1|  PREDICTED: uncharacterized protein LOC101515289  92.8    6e-20   
gb|KGN46208.1|  hypothetical protein Csa_6G074605                     91.7    6e-20   
emb|CDP18626.1|  unnamed protein product                              92.0    7e-20   
ref|XP_003592333.1|  hypothetical protein MTR_1g101750                91.3    7e-20   
ref|XP_010483929.1|  PREDICTED: uncharacterized protein LOC104762355  92.0    7e-20   
ref|XP_002867610.1|  predicted protein                                92.4    8e-20   
ref|XP_004985957.1|  PREDICTED: uncharacterized protein LOC101757701  92.4    8e-20   
ref|XP_006445184.1|  hypothetical protein CICLE_v10022873mg           92.4    9e-20   
ref|NP_201021.1|  peptidoglycan-binding LysM domain-containing pr...  92.0    9e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KHN29393.1|  hypothetical protein glysoja_005117                   90.5    1e-19   
ref|XP_010038976.1|  PREDICTED: uncharacterized protein LOC104427606  91.7    1e-19   
ref|XP_006649282.1|  PREDICTED: uncharacterized protein LOC102715923  92.0    1e-19   
emb|CDY16794.1|  BnaA09g05880D                                        91.7    1e-19   
emb|CDX86922.1|  BnaC03g51920D                                        91.7    1e-19   
ref|XP_002468630.1|  hypothetical protein SORBIDRAFT_01g049330        91.7    1e-19   Sorghum bicolor [broomcorn]
ref|XP_010106808.1|  hypothetical protein L484_005354                 91.7    2e-19   
ref|XP_009389568.1|  PREDICTED: uncharacterized protein LOC103976101  91.3    2e-19   
gb|KEH18988.1|  peptidoglycan-binding LysM domain protein             91.3    2e-19   
ref|XP_010555323.1|  PREDICTED: uncharacterized protein LOC104824847  90.9    2e-19   
ref|NP_001065106.1|  Os10g0524300                                     90.9    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006413305.1|  hypothetical protein EUTSA_v10027278mg           90.9    3e-19   
tpg|DAA42960.1|  TPA: lysM domain containing protein                  90.5    4e-19   
ref|XP_010234929.1|  PREDICTED: uncharacterized protein LOC100821016  90.5    4e-19   
gb|AAO15285.1|  Putative dihydrodipicolinate reductase-like protein   95.9    4e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004983868.1|  PREDICTED: uncharacterized protein LOC101767984  90.5    4e-19   
ref|XP_004510887.1|  PREDICTED: uncharacterized protein LOC101514967  90.1    5e-19   
gb|EAY79264.1|  hypothetical protein OsI_34380                        89.7    6e-19   Oryza sativa Indica Group [Indian rice]
gb|KFK27946.1|  hypothetical protein AALP_AA8G451800                  89.7    6e-19   
ref|XP_009386807.1|  PREDICTED: uncharacterized protein LOC103973863  89.0    9e-19   
ref|XP_010433639.1|  PREDICTED: uncharacterized protein LOC104717722  89.4    1e-18   
ref|XP_010448436.1|  PREDICTED: uncharacterized protein LOC104730895  89.4    1e-18   
ref|XP_009139230.1|  PREDICTED: uncharacterized protein LOC103863220  90.1    1e-18   
emb|CDY57704.1|  BnaC01g41610D                                        90.1    1e-18   
ref|XP_006662531.1|  PREDICTED: uncharacterized protein LOC102721488  88.6    1e-18   
ref|XP_006284786.1|  hypothetical protein CARUB_v10006055mg           89.0    2e-18   
emb|CDY55718.1|  BnaA01g35190D                                        89.4    2e-18   
ref|XP_010438883.1|  PREDICTED: uncharacterized protein LOC104722427  88.6    2e-18   
gb|EPS65528.1|  hypothetical protein M569_09250                       86.7    2e-18   
ref|NP_001168445.1|  uncharacterized protein LOC100382217             88.6    3e-18   Zea mays [maize]
dbj|BAK05584.1|  predicted protein                                    88.6    5e-18   
emb|CAD41658.3|  OSJNBa0019K04.5                                      87.8    5e-18   
ref|XP_004976547.1|  PREDICTED: uncharacterized protein LOC101779547  87.8    5e-18   
ref|NP_001150468.1|  lysM domain containing protein                   87.0    6e-18   Zea mays [maize]
gb|EMT21183.1|  hypothetical protein F775_42636                       85.9    8e-18   
dbj|BAK03655.1|  predicted protein                                    85.9    2e-17   
ref|XP_003581545.1|  PREDICTED: uncharacterized protein LOC100838759  88.2    2e-17   
emb|CDP05257.1|  unnamed protein product                              85.5    2e-17   
dbj|BAJ90904.1|  predicted protein                                    85.1    5e-17   
ref|XP_006341799.1|  PREDICTED: uncharacterized protein LOC102605700  80.1    1e-15   
gb|ABR16814.1|  unknown                                               75.9    4e-14   Picea sitchensis
gb|ABK20943.1|  unknown                                               74.7    8e-14   Picea sitchensis
gb|KHN31547.1|  hypothetical protein glysoja_029682                   68.2    4e-11   
gb|EYU19508.1|  hypothetical protein MIMGU_mgv1a016454mg              67.8    6e-11   
ref|XP_006588249.1|  PREDICTED: uncharacterized protein LOC102662787  66.2    2e-10   
ref|XP_003613571.1|  hypothetical protein MTR_5g038200                63.9    6e-10   
ref|XP_001762542.1|  predicted protein                                62.4    2e-09   
gb|KCW90769.1|  hypothetical protein EUGRSUZ_A02840                   62.8    3e-09   
ref|XP_003622859.1|  Cell division cycle protein-like protein         56.6    7e-06   
ref|XP_003589420.1|  LysM domain containing protein                   50.1    8e-05   



>ref|XP_006588839.1| PREDICTED: uncharacterized protein LOC102670325 [Glycine max]
 gb|KHN13500.1| hypothetical protein glysoja_038738 [Glycine soja]
Length=112

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 72/105 (69%), Gaps = 6/105 (6%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRV---VVPPFERRCEEI  445
              T+ EK+SW C+  V L+   +     T   +D   QMM+ G V   +     + C+EI
Sbjct  7    STTLAEKISWNCSVFVALMLVLSSCESNT---SDFTSQMMLHGSVTGNISNNNNKACDEI  63

Query  446  YVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            YVVREGETLQTISEKCGDP+IVEENPHI+DPDDVFPGLVIKI PF
Sbjct  64   YVVREGETLQTISEKCGDPYIVEENPHIHDPDDVFPGLVIKINPF  108



>ref|XP_006594209.1| PREDICTED: uncharacterized protein LOC100786697 [Glycine max]
 gb|KHN24780.1| hypothetical protein glysoja_045644 [Glycine soja]
Length=108

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
               M EK+SW CA  V L+   +    + ES+       MM    V     + C+EIYVV
Sbjct  7    STAMAEKISWNCAVFVALMLVLS----SCESNTSDFTTQMMFHESVSNSNNKACDEIYVV  62

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            REGETLQTISEKCGDP+IVEENPHI+DPDDVFPGLVIKI PF
Sbjct  63   REGETLQTISEKCGDPYIVEENPHIHDPDDVFPGLVIKINPF  104



>ref|XP_004303004.1| PREDICTED: uncharacterized protein LOC101298622 [Fragaria vesca 
subsp. vesca]
Length=104

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 72/104 (69%), Gaps = 12/104 (12%)
 Frame = +2

Query  278  ATMGEKVSWYCA---ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIY  448
              M EK+SWYCA   A +L+L C         S ++   +M+ + R       + C+EIY
Sbjct  7    TAMAEKISWYCALFLALMLVLSCCQS------SESEFNSRMLQVQR---SRLHKPCDEIY  57

Query  449  VVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            VVREGETL TISEKCGDP+IVEENPHI+DPDDVFPGLVIKITP+
Sbjct  58   VVREGETLHTISEKCGDPYIVEENPHIHDPDDVFPGLVIKITPY  101



>gb|KDO61094.1| hypothetical protein CISIN_1g044600mg [Citrus sinensis]
Length=104

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 74/103 (72%), Gaps = 15/103 (15%)
 Frame = +2

Query  284  MGEKVSWYCA---ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVP-PFERRCEEIYV  451
            + EK++W+CA   A +L+L C        ESS  GG     +G+V  P    + C+EIYV
Sbjct  10   LAEKIAWHCALFMAIMLVLSC-------CESSDSGG----FMGQVTQPRNVNKPCDEIYV  58

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            VREGETL TISEKCGDP+IVE+NPHINDPDDVFPGLVIKITPF
Sbjct  59   VREGETLHTISEKCGDPYIVEQNPHINDPDDVFPGLVIKITPF  101



>ref|XP_007145315.1| hypothetical protein PHAVU_007G228700g [Phaseolus vulgaris]
 gb|ESW17309.1| hypothetical protein PHAVU_007G228700g [Phaseolus vulgaris]
Length=103

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
             A   EK+SW CA  V ++   +     T    +   Q  +  R     + + C+EIYVV
Sbjct  2    AAATAEKISWNCAVFVAVMLVLSSCESNTRDFTNQVFQENVKNR----NYNKVCDEIYVV  57

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            REGETLQTISEKCGDP+IVEENPHI+DPDDVFPGLVIKI PF
Sbjct  58   REGETLQTISEKCGDPYIVEENPHIHDPDDVFPGLVIKINPF  99



>ref|XP_007203661.1| hypothetical protein PRUPE_ppa027117mg [Prunus persica]
 gb|EMJ04860.1| hypothetical protein PRUPE_ppa027117mg [Prunus persica]
Length=108

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 72/104 (69%), Gaps = 10/104 (10%)
 Frame = +2

Query  278  ATMGEKVSWYCA---ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIY  448
            A + E++SWYCA     +L+L CF       ES +   E  +   ++ V      C+EIY
Sbjct  9    AAVAERISWYCALFLGVMLVLSCF-------ESLSSENEYRVRTIQLQVDRLNMPCDEIY  61

Query  449  VVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            VV EGETLQTISEKCGDP+IVEENPHI+DPDDVFPGLVIKITPF
Sbjct  62   VVHEGETLQTISEKCGDPYIVEENPHIHDPDDVFPGLVIKITPF  105



>ref|XP_006430247.1| hypothetical protein CICLE_v10013835mg [Citrus clementina]
 gb|ESR43487.1| hypothetical protein CICLE_v10013835mg [Citrus clementina]
Length=104

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 74/103 (72%), Gaps = 15/103 (15%)
 Frame = +2

Query  284  MGEKVSWYCA---ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVP-PFERRCEEIYV  451
            + EK++W+CA   A +L+L C        ESS  GG     +G+V  P    + C+EIYV
Sbjct  10   LAEKIAWHCALFMAIMLVLSC-------CESSDGGG----FMGQVTQPRNVNKPCDEIYV  58

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            VREGETL TISEKCGDP+IVE+NPHINDPDDVFPGLVIKITPF
Sbjct  59   VREGETLHTISEKCGDPYIVEQNPHINDPDDVFPGLVIKITPF  101



>ref|XP_009621487.1| PREDICTED: uncharacterized protein LOC104113099 [Nicotiana tomentosiformis]
Length=107

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 72/102 (71%), Gaps = 9/102 (9%)
 Frame = +2

Query  281  TMGEKVSWYCAA--TVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
             + EKVSWYC     ++L+  +   +  +E      +Q M+  R  +P     C+EIYVV
Sbjct  9    ALAEKVSWYCGLFLAIMLVLSWFDQYNESEFIVQMQQQKMV--REKMP-----CDEIYVV  61

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            REGETLQTISEKCGDPFIVEENPHI+DPDDVFPGL+IKITPF
Sbjct  62   REGETLQTISEKCGDPFIVEENPHIHDPDDVFPGLIIKITPF  103



>ref|XP_008241264.1| PREDICTED: uncharacterized protein LOC103339705 [Prunus mume]
Length=108

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 71/104 (68%), Gaps = 10/104 (10%)
 Frame = +2

Query  278  ATMGEKVSWYCA---ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIY  448
            A + EK+SWYCA     +L+L C        ES +   E  +   ++ V      C+EIY
Sbjct  9    AAVAEKISWYCALFLGVMLVLSC-------CESLSSENEYRLRTIQLQVDRLNMPCDEIY  61

Query  449  VVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            VV EGETLQTISEKCGDP+IVEENPHI+DPDDVFPGLVIKITPF
Sbjct  62   VVHEGETLQTISEKCGDPYIVEENPHIHDPDDVFPGLVIKITPF  105



>ref|XP_003520691.1| PREDICTED: uncharacterized protein LOC100794241 [Glycine max]
Length=99

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 70/102 (69%), Gaps = 9/102 (9%)
 Frame = +2

Query  284  MGEKVSWYCA---ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
            M EK+SW C    A +L+L C         S+ +   QM+M   +     ++ C+EIYVV
Sbjct  1    MAEKISWCCVLFMAIILVLSCCES------STNEFRVQMLMQRNINNNNNKKACDEIYVV  54

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            REGETLQTISEKCGDP+IVEENPHI DPDDVFPGLVIKI PF
Sbjct  55   REGETLQTISEKCGDPYIVEENPHIQDPDDVFPGLVIKINPF  96



>gb|KHN18753.1| hypothetical protein glysoja_021504 [Glycine soja]
Length=99

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 70/102 (69%), Gaps = 9/102 (9%)
 Frame = +2

Query  284  MGEKVSWYCA---ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
            M EK+SW C    A +L+L C         S+ +   QM+M   +     ++ C+EIYVV
Sbjct  1    MAEKISWCCVLFMALILVLSCCES------STNEFRVQMLMQRNINNNNNKKACDEIYVV  54

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            REGETLQTISEKCGDP+IVEENPHI DPDDVFPGLVIKI PF
Sbjct  55   REGETLQTISEKCGDPYIVEENPHIQDPDDVFPGLVIKINPF  96



>ref|XP_004516192.1| PREDICTED: uncharacterized protein LOC101513042 [Cicer arietinum]
Length=118

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 70/111 (63%), Gaps = 12/111 (11%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPP--------FER  430
               M EK+SW CA  V L+   +      ESS    E  + I  ++             +
Sbjct  8    STAMAEKISWNCALFVALMLVLS----ICESSTSDDEFNLQIQNMLQENDFSNNNNVINK  63

Query  431  RCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFI  583
             C+EIYVVREGETLQTISEKCGDP+IVEENPHI+DPDDVFPGLVIKI PF+
Sbjct  64   VCDEIYVVREGETLQTISEKCGDPYIVEENPHIHDPDDVFPGLVIKINPFM  114



>ref|XP_011042588.1| PREDICTED: uncharacterized protein LOC105138239 [Populus euphratica]
Length=120

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 70/105 (67%), Gaps = 5/105 (5%)
 Frame = +2

Query  269  WPGATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQ--MMMIGRVVVPPFERRCEE  442
            +   ++ +  +WYCA  +L L  F      + +  D      + + G  V+   +R C+E
Sbjct  11   FTSTSIADAATWYCALVLLALILFTSLREASPTYDDDHHHDIVAVKGNHVL---DRPCDE  67

Query  443  IYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            IY+V+EGETL TIS+KCGDPFIVEENPHI+DPDDVFPGLVIKITP
Sbjct  68   IYIVKEGETLHTISDKCGDPFIVEENPHIHDPDDVFPGLVIKITP  112



>ref|XP_009619042.1| PREDICTED: uncharacterized protein LOC104111134 [Nicotiana tomentosiformis]
Length=107

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
               + E +SWYC   + ++   +    T    A    +   +    +P     C+EIYVV
Sbjct  7    STILAETISWYCTLFLAIMLVLSCCESTESEFAVQMHEQQNLAMKKLP----LCDEIYVV  62

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            REGETL TISEKCGDPFIVEENPHI+DPDDVFPGLVIKITP+
Sbjct  63   REGETLHTISEKCGDPFIVEENPHIHDPDDVFPGLVIKITPY  104



>ref|XP_002320100.1| hypothetical protein POPTR_0014s07390g [Populus trichocarpa]
 gb|EEE98415.1| hypothetical protein POPTR_0014s07390g [Populus trichocarpa]
Length=120

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 70/105 (67%), Gaps = 5/105 (5%)
 Frame = +2

Query  269  WPGATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQ--MMMIGRVVVPPFERRCEE  442
            +   ++ +  +WYCA  +L L  F      + +  D      + + G  ++   +R C+E
Sbjct  11   FTSTSIADAATWYCALVLLALILFTSLREASPTYDDDHHHDFVAVKGNQIL---DRPCDE  67

Query  443  IYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            IYVV+EGETL TIS+KCGDPFIVEENPHI+DPDDV+PGLVIKITP
Sbjct  68   IYVVKEGETLHTISDKCGDPFIVEENPHIHDPDDVYPGLVIKITP  112



>ref|XP_009775951.1| PREDICTED: uncharacterized protein LOC104225788 [Nicotiana sylvestris]
Length=107

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 64/102 (63%), Gaps = 4/102 (4%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
               + E +SWYC   + ++   +    T    A    +   +    +P     C EIYVV
Sbjct  7    STVLAETISWYCTLFLAIMLVLSCCESTESEFAVQMHEQQKLAMKKLP----LCNEIYVV  62

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            +EGETL TISEKCGDPFIVEENPHI+DPDDVFPGLVIKITP+
Sbjct  63   KEGETLHTISEKCGDPFIVEENPHIHDPDDVFPGLVIKITPY  104



>ref|XP_010271716.1| PREDICTED: uncharacterized protein LOC104607716 [Nelumbo nucifera]
Length=108

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 72/101 (71%), Gaps = 9/101 (9%)
 Frame = +2

Query  278  ATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVR  457
            A++ E++SWYC+  +++L    G   ++ES +     + MI +         C+EIYVV 
Sbjct  12   ASVAERISWYCSLVLVVLL-LLGCCDSSESESLVRMNLRMISK--------PCDEIYVVE  62

Query  458  EGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            EGETL TISEKCGDPFIVEENPHI+DPDDVFPGLVIKITPF
Sbjct  63   EGETLHTISEKCGDPFIVEENPHIHDPDDVFPGLVIKITPF  103



>ref|XP_009148740.1| PREDICTED: uncharacterized protein LOC103872144 [Brassica rapa]
Length=115

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 74/117 (63%), Gaps = 11/117 (9%)
 Frame = +2

Query  248  MLRVVIRWPGATMGEKVSWYCA--ATVLLLWCFAG---GWGTTESSADGGEQMMMIGRVV  412
            M +         + EK+SWYCA  AT++LL          G+T ++       MMI R  
Sbjct  1    MAKSYTHSASMVVAEKISWYCAVFATMMLLMSCCHVEEEAGSTNTNVQKQHPSMMIARYS  60

Query  413  VPPFERR--CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
                +RR  C+EIY V+EGETLQTISEKCGDP+IVE NPHI+D DDVFPGL+I+ITP
Sbjct  61   ----DRRPACDEIYEVKEGETLQTISEKCGDPYIVEGNPHIHDHDDVFPGLLIRITP  113



>ref|XP_007139917.1| hypothetical protein PHAVU_008G069500g [Phaseolus vulgaris]
 gb|ESW11911.1| hypothetical protein PHAVU_008G069500g [Phaseolus vulgaris]
Length=116

 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 71/111 (64%), Gaps = 11/111 (10%)
 Frame = +2

Query  254  RVVIRWPGATMGEKVSWYCA---ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPF  424
            R   R     M +  SW+CA    T++LL  F+       SS    ++  + G  V   F
Sbjct  6    RKAPRSSSKVMADPASWFCACLLVTLILLCIFSDS-----SSLQEDDEGKLRGNQV---F  57

Query  425  ERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
             + C+EIYVV EGETL TIS+KCGDPFIVE+NPHI+DPDDVFPGLVIKITP
Sbjct  58   SKPCDEIYVVGEGETLHTISDKCGDPFIVEKNPHIHDPDDVFPGLVIKITP  108



>ref|XP_009371265.1| PREDICTED: uncharacterized protein LOC103960505 [Pyrus x bretschneideri]
Length=107

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERR-CEEIYVVRE  460
            + +  SWYCA  +L L  FA      E+S+      ++ G+        R C+EIYVV E
Sbjct  6    LADAASWYCATALLALILFAS---IRENSSTPDNNDLVRGKHFNDFMTNRPCDEIYVVGE  62

Query  461  GETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            GETL TIS+KCGDP+IVE NPHI+DPDDVFPGLVIKITP
Sbjct  63   GETLHTISDKCGDPYIVERNPHIHDPDDVFPGLVIKITP  101



>ref|XP_010527660.1| PREDICTED: uncharacterized protein LOC104804968 [Tarenaya hassleriana]
Length=116

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 68/104 (65%), Gaps = 8/104 (8%)
 Frame = +2

Query  284  MGEKVSWYCA---ATVLLLWCFAGGWGTTESSADGGEQ--MMMIGRVVVPPFERRCEEIY  448
            M EK+SWY A   A +L++ C       T    D      +M  G        R C+EIY
Sbjct  11   MAEKISWYSAVFAAVMLVMNCCDVAEIETVDFPDQTRSRPLMEAGS---SSSSRPCDEIY  67

Query  449  VVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            VV+EGETLQTISEKCGDP+IVEENPHI+DPDDVFPGLVIKIT F
Sbjct  68   VVKEGETLQTISEKCGDPYIVEENPHIHDPDDVFPGLVIKITSF  111



>gb|KEH42052.1| peptidoglycan-binding LysM domain protein [Medicago truncatula]
Length=116

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 68/110 (62%), Gaps = 12/110 (11%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPP--------FER  430
               M EK+SW CA  V L+   +      ES+    E  + I  ++             +
Sbjct  7    STAMAEKISWNCALFVALMLVLS----FCESNTSDDELNVQIQNMLQENDFSNTHVNKNK  62

Query  431  RCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
             C+EIYVV EGETLQTISEKCGDP+IVEENPHI+DPDDVFPGLVIKI PF
Sbjct  63   VCDEIYVVGEGETLQTISEKCGDPYIVEENPHIHDPDDVFPGLVIKINPF  112



>ref|XP_008376509.1| PREDICTED: uncharacterized protein LOC103439700 [Malus domestica]
Length=103

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 66/99 (67%), Gaps = 4/99 (4%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERR-CEEIYVVRE  460
            + +  SWYCA  +L L  FA      E+S+      ++ G+        R C+EIYVV E
Sbjct  6    LADAASWYCATALLALILFAS---IRENSSTPDNDDLVRGKHFNDFMTNRPCDEIYVVGE  62

Query  461  GETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            GETL TIS+KCGDP+IVE NPHI+DPDDVFPGLVIKITP
Sbjct  63   GETLHTISDKCGDPYIVERNPHIHDPDDVFPGLVIKITP  101



>ref|XP_002283136.1| PREDICTED: uncharacterized protein LOC100244252 [Vitis vinifera]
Length=104

 Score =   105 bits (262),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 72/101 (71%), Gaps = 7/101 (7%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREG  463
            + EK+SWY A  + L+   +        SA   +++M+  R+     ++ C+EIYVVREG
Sbjct  10   LAEKISWYSALLLALMLVLSCC-----ESAQSHDEIMV--RLHKKDAKKPCDEIYVVREG  62

Query  464  ETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIY  586
            ETL TISEKCGDP+IVEENPHI+DPDDVFPGLVIKITP+ Y
Sbjct  63   ETLHTISEKCGDPYIVEENPHIHDPDDVFPGLVIKITPYNY  103



>emb|CDX95374.1| BnaC04g27840D [Brassica napus]
Length=115

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 74/117 (63%), Gaps = 11/117 (9%)
 Frame = +2

Query  248  MLRVVIRWPGATMGEKVSWYCA---ATVLLLWC--FAGGWGTTESSADGGEQMMMIGRVV  412
            M +         + EK+SWYCA   A +LL+ C       G+T ++    +  MMI    
Sbjct  1    MAKSYTHSASMVVAEKISWYCAVFAAMMLLMSCCHVEEEAGSTNTNVQKQQPSMMIAGYS  60

Query  413  VPPFERR--CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
                +RR  C+EIY V+EGETLQTISEKCGDP+IVE NPHI+D DDVFPGL+I+ITP
Sbjct  61   ----DRRPACDEIYEVKEGETLQTISEKCGDPYIVEGNPHIHDHDDVFPGLLIRITP  113



>ref|XP_003625786.1| hypothetical protein MTR_7g104250 [Medicago truncatula]
 gb|AES82004.1| peptidoglycan-binding LysM domain protein [Medicago truncatula]
Length=96

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 67/103 (65%), Gaps = 14/103 (14%)
 Frame = +2

Query  284  MGEKVSWYC----AATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYV  451
            M  ++S YC    A  +LLL C       +E + +  ++        +    + C+EIYV
Sbjct  1    MAMRISRYCVLFSAVIILLLNCCESRR--SELTVEMKQR--------IANNNKACDEIYV  50

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            VREGETL TISEKCGDPFIVEENPHI+DPDDVFPGLVIKI PF
Sbjct  51   VREGETLHTISEKCGDPFIVEENPHIHDPDDVFPGLVIKINPF  93



>ref|XP_010061666.1| PREDICTED: uncharacterized protein LOC104449256 [Eucalyptus grandis]
Length=114

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 63/100 (63%), Gaps = 11/100 (11%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVRE  460
            T+ +  +W CA +V+ L   A       SS  G   +           +  C+EIYVVRE
Sbjct  16   TIADAAAWCCAISVIALILVASMREAKVSSVRGNRLL-----------DWPCDEIYVVRE  64

Query  461  GETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            GETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKI PF
Sbjct  65   GETLHTISDKCGDPFIVERNPHIHDPDDVFPGLVIKIAPF  104



>ref|XP_011024312.1| PREDICTED: uncharacterized protein LOC105125525 [Populus euphratica]
 ref|XP_011015663.1| PREDICTED: uncharacterized protein LOC105119236 [Populus euphratica]
Length=114

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 70/105 (67%), Gaps = 12/105 (11%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAG-GWGTTESSADGGEQMMMIGRVVVPPFERR-CEEIY  448
               M EK+SWYCA  + L+   +      TE S  G  +           FE + C+EIY
Sbjct  7    STVMAEKISWYCALLMALMLVLSCCEVSETELSTVGHPRF----------FENKPCDEIY  56

Query  449  VVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFI  583
            VVREGETL +ISEKCGDP+IVEENPHI+DPDDVFPGLVIKITPFI
Sbjct  57   VVREGETLNSISEKCGDPYIVEENPHIHDPDDVFPGLVIKITPFI  101



>ref|XP_004496617.1| PREDICTED: uncharacterized protein LOC101512823 [Cicer arietinum]
Length=105

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 66/100 (66%), Gaps = 5/100 (5%)
 Frame = +2

Query  278  ATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVR  457
            AT G+  SWYCA  +L +          ES+    +   + G   +   +R C+EIYVV 
Sbjct  5    ATRGDSASWYCAIALLAMILLGS---IRESTVAELQDDFVRGNYHLG--QRPCDEIYVVG  59

Query  458  EGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  60   EGETLNTISDKCGDPFIVERNPHIHDPDDVFPGLVIKITP  99



>ref|XP_007220488.1| hypothetical protein PRUPE_ppa013811mg [Prunus persica]
 gb|EMJ21687.1| hypothetical protein PRUPE_ppa013811mg [Prunus persica]
Length=101

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 63/101 (62%), Gaps = 11/101 (11%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAG---GWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
            M +  SWYCA  +L L  FA         ++    G +  +I R         C+EIYVV
Sbjct  6    MADAASWYCATILLALILFASIRENDSMPDNDPVRGAKHFVINR--------PCDEIYVV  57

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
             EGETL TIS+KC DPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  58   GEGETLHTISDKCSDPFIVERNPHIHDPDDVFPGLVIKITP  98



>ref|XP_003521930.2| PREDICTED: uncharacterized protein LOC100813243 [Glycine max]
Length=113

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 62/101 (61%), Gaps = 8/101 (8%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVRE  460
             + +  SWYCA  ++ L           S   G   MM+          R CEEIYVV E
Sbjct  17   AIADAASWYCAFVLVALVLL--------SMFKGSSIMMLPSHANNQLLSRPCEEIYVVGE  68

Query  461  GETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFI  583
            GETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVI++TP +
Sbjct  69   GETLHTISDKCGDPFIVENNPHIHDPDDVFPGLVIEVTPLL  109



>gb|KHN04115.1| hypothetical protein glysoja_036651 [Glycine soja]
Length=115

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 62/101 (61%), Gaps = 8/101 (8%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVRE  460
             + +  SWYCA  ++ L           S   G   MM+          R CEEIYVV E
Sbjct  19   AIADAASWYCAFVLVALVLL--------SMFKGSSIMMLPSHANNQLLSRPCEEIYVVGE  70

Query  461  GETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFI  583
            GETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVI++TP +
Sbjct  71   GETLHTISDKCGDPFIVENNPHIHDPDDVFPGLVIEVTPLL  111



>ref|XP_008803250.1| PREDICTED: uncharacterized protein LOC103716850 [Phoenix dactylifera]
Length=109

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 66/98 (67%), Gaps = 7/98 (7%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREG  463
            + +  SWYCA  ++ L   +      E   D   + +  G++V     R C+EIYVV EG
Sbjct  15   IADAASWYCALAIVALILLSS---VQEIPVDDTIEPVRGGKLV----SRPCDEIYVVGEG  67

Query  464  ETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            ETL TIS+KCGDPFIVE+NPHI+DPDDVFPGLVIKITP
Sbjct  68   ETLHTISDKCGDPFIVEQNPHIHDPDDVFPGLVIKITP  105



>ref|XP_010919204.1| PREDICTED: uncharacterized protein LOC105043378 [Elaeis guineensis]
Length=110

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 69/100 (69%), Gaps = 8/100 (8%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSA-DGGEQMMMIGRVVVPPFERRCEEIYVVR  457
            ++ +  SWYCA  ++ L   +      ES A D   + +  G++V     R C+EIYVV 
Sbjct  14   SIADTASWYCALAIVALILLSS---LQESPAVDDTIEPVRGGKLV----SRPCDEIYVVG  66

Query  458  EGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            EGETL TIS+KCGDPFIVE+NPHI+DPDDVFPGLVIKITP
Sbjct  67   EGETLHTISDKCGDPFIVEQNPHIHDPDDVFPGLVIKITP  106



>ref|NP_190847.1| peptidoglycan-binding LysM domain-containing protein [Arabidopsis 
thaliana]
 emb|CAB89240.1| putative protein [Arabidopsis thaliana]
 gb|AAO24561.1| At3g52790 [Arabidopsis thaliana]
 dbj|BAF00117.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE78994.1| peptidoglycan-binding LysM domain-containing protein [Arabidopsis 
thaliana]
Length=109

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 69/103 (67%), Gaps = 7/103 (7%)
 Frame = +2

Query  281  TMGEKVSWYCA---ATVLLLWCF-AGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIY  448
             + EK+SWYCA   A +LL+  F     G+TE        MM+ G     P    C+EIY
Sbjct  8    AVAEKISWYCAVFAAMMLLMNSFQVAQEGSTEIVEKQQPSMMITGYSHRRP---ACDEIY  64

Query  449  VVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
             V+EGETLQTISEKCGDP+IVE NPHI+D DD+FPGL+I+ITP
Sbjct  65   EVKEGETLQTISEKCGDPYIVEGNPHIHDHDDLFPGLLIRITP  107



>ref|XP_006421827.1| hypothetical protein CICLE_v10006227mg [Citrus clementina]
 ref|XP_006490299.1| PREDICTED: uncharacterized protein LOC102611925 [Citrus sinensis]
 gb|ESR35067.1| hypothetical protein CICLE_v10006227mg [Citrus clementina]
 gb|KDO60138.1| hypothetical protein CISIN_1g033289mg [Citrus sinensis]
Length=122

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 64/100 (64%), Gaps = 3/100 (3%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTT-ESSADGGEQMMMIGRVVVPPFERRCEEIYV  451
             AT+ +  SWYCA  +L L       G +        + +M  G  ++    R C+EIYV
Sbjct  14   SATLADAASWYCAIVILALILIGSIRGNSLADEPHDYDHVMRPGNQLL--NRRPCDEIYV  71

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKI  571
            V EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKI
Sbjct  72   VGEGETLHTISDKCGDPFIVERNPHIHDPDDVFPGLVIKI  111



>ref|XP_008241423.1| PREDICTED: uncharacterized protein LOC103339846 [Prunus mume]
Length=107

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 71/106 (67%), Gaps = 12/106 (11%)
 Frame = +2

Query  275  GATMGEKVSWYCA---ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEI  445
               + EK+ WYCA   A +L+L C    W  +E +     +++ + R       + C+EI
Sbjct  8    STALAEKILWYCALFLALILVLSC--CEWSESEFTV----KVVQLQR---DHLNKPCDEI  58

Query  446  YVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFI  583
            Y+V EGETLQTISEKCGDP+IVEENPHI+DPDDV PGL+IKITP I
Sbjct  59   YMVGEGETLQTISEKCGDPYIVEENPHIHDPDDVIPGLLIKITPLI  104



>ref|XP_007203323.1| hypothetical protein PRUPE_ppa020004mg, partial [Prunus persica]
 gb|EMJ04522.1| hypothetical protein PRUPE_ppa020004mg, partial [Prunus persica]
Length=106

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 71/106 (67%), Gaps = 12/106 (11%)
 Frame = +2

Query  275  GATMGEKVSWYCA---ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEI  445
               + EK+ WYCA   A +L+L C    W  +E +A    +++ + R       + C+EI
Sbjct  8    STALAEKILWYCALFLALILVLSC--CEWSKSEFTA----KVVQLQR---DHLNKPCDEI  58

Query  446  YVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFI  583
            Y+V EGETLQTI EKCGDP+IVEENPHI+DPDDV PGL+IKITP I
Sbjct  59   YMVGEGETLQTIVEKCGDPYIVEENPHIHDPDDVIPGLLIKITPLI  104



>gb|ACU23909.1| unknown [Glycine max]
Length=112

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 62/106 (58%), Gaps = 14/106 (13%)
 Frame = +2

Query  281  TMGEKVSWYCA---ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYV  451
             +    SWYCA     + LL  F        S    G+ +            R CEEIYV
Sbjct  18   AIANAASWYCAFVLVALALLSMFKDSSMLIPSQHASGQLL-----------SRPCEEIYV  66

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            V EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKITP + T
Sbjct  67   VGEGETLHTISDKCGDPFIVENNPHIHDPDDVFPGLVIKITPSLRT  112



>ref|XP_008439155.1| PREDICTED: uncharacterized protein LOC103484036 [Cucumis melo]
Length=124

 Score =   103 bits (257),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 63/92 (68%), Gaps = 5/92 (5%)
 Frame = +2

Query  296  VSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGETLQ  475
            VSWYCA  +L L        T+ SS D G  +   G +V     R C+EIYVV EGETL 
Sbjct  25   VSWYCAVGLLGLILIGSIRETSSSSGDQGRSLR--GNLVT---WRPCDEIYVVGEGETLH  79

Query  476  TISEKCGDPFIVEENPHINDPDDVFPGLVIKI  571
            TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKI
Sbjct  80   TISDKCGDPFIVERNPHIHDPDDVFPGLVIKI  111



>ref|XP_010101597.1| hypothetical protein L484_015426 [Morus notabilis]
 gb|EXB88736.1| hypothetical protein L484_015426 [Morus notabilis]
Length=105

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 9/109 (8%)
 Frame = +2

Query  257  VVIRWPGATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGE-QMMMIGRVVVPPFERR  433
            +V       M E+ S YCA  + +L           S  + GE +  M+G+       R 
Sbjct  1    MVCACSATAMAERASGYCALFLAVL--------LVLSCCESGESEFAMMGQRKGINNTRP  52

Query  434  CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            C+EIYVVREGETLQTI+E+CGDP+IVEENPHI+DPDDVFPGLVIKITP+
Sbjct  53   CDEIYVVREGETLQTIAERCGDPYIVEENPHIHDPDDVFPGLVIKITPY  101



>ref|XP_002877887.1| peptidoglycan-binding LysM domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH54146.1| peptidoglycan-binding LysM domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=109

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 69/103 (67%), Gaps = 7/103 (7%)
 Frame = +2

Query  281  TMGEKVSWYCA---ATVLLLWCF-AGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIY  448
             + EK+SWYCA   A +LL+  F     G+TE        MM+ G     P    C+EIY
Sbjct  8    AVAEKISWYCAVFAAMMLLMNSFQVAEEGSTEIVEQQQPSMMITGYSDRRP---ACDEIY  64

Query  449  VVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
             V+EGETLQTISEKCGDP+IVE NPHI+D DD+FPGL+I+ITP
Sbjct  65   EVKEGETLQTISEKCGDPYIVEGNPHIHDHDDLFPGLLIRITP  107



>ref|XP_003528887.1| PREDICTED: uncharacterized protein LOC100815990 [Glycine max]
 gb|KHN04607.1| hypothetical protein glysoja_021906 [Glycine soja]
Length=112

 Score =   103 bits (256),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 62/106 (58%), Gaps = 14/106 (13%)
 Frame = +2

Query  281  TMGEKVSWYCA---ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYV  451
             +    SWYCA     + LL  F        S    G+ +            R CEEIYV
Sbjct  18   AIANAASWYCAFVLVALALLSMFKDSSMLIPSQYASGQLL-----------SRPCEEIYV  66

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            V EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKITP + T
Sbjct  67   VGEGETLHTISDKCGDPFIVENNPHIHDPDDVFPGLVIKITPSLRT  112



>emb|CDY23234.1| BnaA04g05250D [Brassica napus]
Length=115

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 72/117 (62%), Gaps = 11/117 (9%)
 Frame = +2

Query  248  MLRVVIRWPGATMGEKVSWYCA---ATVLLLWC--FAGGWGTTESSADGGEQMMMIGRVV  412
            M +         + EK+SWYCA   A +LL+ C       G+T ++       MMI    
Sbjct  1    MAKSYTHSASMVVAEKISWYCAVFAAMMLLMSCCHVEEEAGSTNTNVQKQHPSMMIAGYS  60

Query  413  VPPFERR--CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
                 RR  C+EIY V+EGETLQTISEKCGDP+IVE NPHI+D DDVFPGL+I+ITP
Sbjct  61   ----GRRPACDEIYEVKEGETLQTISEKCGDPYIVEGNPHIHDHDDVFPGLLIRITP  113



>ref|XP_008234307.1| PREDICTED: uncharacterized protein LOC103333268 [Prunus mume]
Length=122

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 63/102 (62%), Gaps = 13/102 (13%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAGGWGTTESSADG----GEQMMMIGRVVVPPFERRCEEIYV  451
            M +  SWYCA  +L L  FA      +S  D     G +  +I R         C+EIYV
Sbjct  27   MADAASWYCATILLALILFAS-IRENDSMPDNDPVRGAKHFVINR--------PCDEIYV  77

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            V EGETL TIS+KC DPFIVE NPHI+DPDDVFPGLVIKI P
Sbjct  78   VGEGETLHTISDKCSDPFIVERNPHIHDPDDVFPGLVIKIAP  119



>ref|XP_008462558.1| PREDICTED: uncharacterized protein LOC103500889 [Cucumis melo]
Length=106

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +2

Query  422  FERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
             E  CEEIYVV EGETLQ+ISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF
Sbjct  42   LEYNCEEIYVVHEGETLQSISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  94



>ref|XP_006379511.1| hypothetical protein POPTR_0008s03020g [Populus trichocarpa]
 gb|ERP57308.1| hypothetical protein POPTR_0008s03020g [Populus trichocarpa]
Length=104

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 70/103 (68%), Gaps = 10/103 (10%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERR-CEEIYV  451
               M EK+SWYCA  + L+         +ES      ++  +G   V  FE + C+EIYV
Sbjct  7    STVMAEKISWYCALLMALML-VLSCCEVSES------ELAAVGHPRV--FEDKPCDEIYV  57

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            VREGETL TISEKC DP+IVEENPHI+DPDDVFPGLVIKITPF
Sbjct  58   VREGETLHTISEKCRDPYIVEENPHIHDPDDVFPGLVIKITPF  100



>ref|XP_002316406.2| hypothetical protein POPTR_0010s23750g [Populus trichocarpa]
 gb|EEF02577.2| hypothetical protein POPTR_0010s23750g [Populus trichocarpa]
Length=117

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 69/105 (66%), Gaps = 12/105 (11%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAG-GWGTTESSADGGEQMMMIGRVVVPPFERR-CEEIY  448
               M EK+SWYCA  + L+   +      TE S  G  +           FE + C+EIY
Sbjct  7    STVMAEKISWYCALLMALMLVLSCCEVSETELSTVGHPRF----------FENKPCDEIY  56

Query  449  VVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFI  583
            VVREGETL TISEKCGDP+IVEENPHI+DPDDVFPGLVIKITP I
Sbjct  57   VVREGETLNTISEKCGDPYIVEENPHIHDPDDVFPGLVIKITPLI  101



>ref|NP_001235917.1| uncharacterized protein LOC100500035 precursor [Glycine max]
 gb|ACU14670.1| unknown [Glycine max]
 gb|KHN15685.1| hypothetical protein glysoja_012477 [Glycine soja]
Length=101

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 68/102 (67%), Gaps = 7/102 (7%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
            G++  +  SWYCA  ++LL     G     + A+ GE +   G  +    +R C+EIYVV
Sbjct  4    GSSAADSASWYCA--MVLLATILLGSIRESTVAEEGEPIK--GNNL---LQRPCDEIYVV  56

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
             EGETL TIS+KC DPFIVE NPHI+DPDDVFPGLVIKITP 
Sbjct  57   GEGETLHTISDKCNDPFIVERNPHIHDPDDVFPGLVIKITPI  98



>gb|EYU35465.1| hypothetical protein MIMGU_mgv1a016765mg [Erythranthe guttata]
Length=108

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 66/103 (64%), Gaps = 12/103 (12%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLL----WCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYV  451
            + E VSWY A  + L+    +C     G   ++        +         ER C+EIYV
Sbjct  10   LAEAVSWYAALLLSLMLVLSYCEPCDCGEFTTATSNNNLHYVT--------ERACDEIYV  61

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            VREGETL TISEKCGDP+IVEENPHI+DPDDVFPGLVIKITPF
Sbjct  62   VREGETLHTISEKCGDPWIVEENPHIHDPDDVFPGLVIKITPF  104



>ref|XP_010278501.1| PREDICTED: uncharacterized protein LOC104612680 [Nelumbo nucifera]
Length=112

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 65/105 (62%), Gaps = 17/105 (16%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADG----GEQMMMIGRVVVPPFERRCEE  442
               + E  SWY A  +L+L   +      ESS  G    G Q M           R C+E
Sbjct  13   AVAIAEAASWYSALFLLVLMFLSS---MKESSVAGETVRGNQFM----------GRPCDE  59

Query  443  IYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            IYVV EGETL TIS+KCGDP+IVE+NPHI+DPDDVFPGLVIKITP
Sbjct  60   IYVVGEGETLHTISDKCGDPYIVEQNPHIHDPDDVFPGLVIKITP  104



>ref|XP_009803785.1| PREDICTED: uncharacterized protein LOC104249104 [Nicotiana sylvestris]
Length=121

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = +2

Query  299  SWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGETLQT  478
            SW CA +++ L   +      E++A   E  ++ G+ +     R C+EIYVV EGETL T
Sbjct  24   SWLCAISLMALVLMSS---VKENNAGNWENSVVRGKQLHLSHNRPCDEIYVVGEGETLHT  80

Query  479  ISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            IS+KCGDP+IVE NPHI+DPDDVFPGLVIK+ P
Sbjct  81   ISDKCGDPYIVERNPHIHDPDDVFPGLVIKVVP  113



>ref|XP_010317565.1| PREDICTED: uncharacterized protein LOC101263880 [Solanum lycopersicum]
Length=111

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 65/99 (66%), Gaps = 8/99 (8%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVRE  460
             + +  S+YCA  VL L   +        S DG   +M   R +     R C+EIYVV E
Sbjct  17   AIADAASFYCAIFVLGLLLISSV--KENYSTDGA--VMKGNRFL----SRPCDEIYVVGE  68

Query  461  GETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            GETL TIS+KCGDPFIVEENPHI+DPDDVFPGLVIKITP
Sbjct  69   GETLHTISDKCGDPFIVEENPHIHDPDDVFPGLVIKITP  107



>ref|XP_003534586.1| PREDICTED: uncharacterized protein LOC100778431 [Glycine max]
Length=114

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +2

Query  281  TMGEKVSWYCAATV--LLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
             + +  SW CA  +  LLL C            D G  MM    V+  P    C+EIYVV
Sbjct  15   AIADAASWCCACFLVSLLLLCIFRDISALHD--DQGNLMMRSSHVLSKP---SCDEIYVV  69

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKIT  574
             EGETL TIS+KCGDPFIVE+NPHI+DPDDVFPGLV+KIT
Sbjct  70   GEGETLHTISDKCGDPFIVEKNPHIHDPDDVFPGLVLKIT  109



>gb|KHN02240.1| hypothetical protein glysoja_002264 [Glycine soja]
Length=95

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 64/99 (65%), Gaps = 7/99 (7%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREG  463
            M EK+ W C    + L     G    ESS +     M++   +     + C+EIYVVREG
Sbjct  1    MAEKIYWCCVVVFVELVLVLSG---CESSTNEFSVPMLMQMNI----NKACDEIYVVREG  53

Query  464  ETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            ETLQTIS KCGDP+IVEENPHI DPDDVFPGLVIKI PF
Sbjct  54   ETLQTISNKCGDPYIVEENPHIQDPDDVFPGLVIKINPF  92



>ref|XP_006403768.1| hypothetical protein EUTSA_v10010832mg [Eutrema salsugineum]
 gb|ESQ45221.1| hypothetical protein EUTSA_v10010832mg [Eutrema salsugineum]
Length=116

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 74/118 (63%), Gaps = 12/118 (10%)
 Frame = +2

Query  248  MLRVVIRWPGATMGEKVSWYCA--ATVLLLW--CFAGGWGTTESSADGGEQM--MMIGRV  409
            M +         + EK+SWYCA  A ++LL   C     G TE +    +Q   MMI + 
Sbjct  1    MAKSYTHSSSMVVAEKISWYCAVFAAMMLLMNCCNVAEEGPTEITVQQQQQQPSMMIAQY  60

Query  410  VVPPFERR--CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
                  RR  CEEIY V+EGETLQTISEKCGDP+IVE NPHI+D DDVFPGL+I+ITP
Sbjct  61   S----HRRPPCEEIYEVKEGETLQTISEKCGDPYIVEGNPHIHDHDDVFPGLLIRITP  114



>ref|XP_007038563.1| Peptidoglycan-binding LysM domain-containing protein [Theobroma 
cacao]
 gb|EOY23064.1| Peptidoglycan-binding LysM domain-containing protein [Theobroma 
cacao]
Length=111

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 61/97 (63%), Gaps = 11/97 (11%)
 Frame = +2

Query  290  EKVSWYCAATVLLLWCFAGGWGTTESSAD-GGEQMMMIGRVVVPPFERRCEEIYVVREGE  466
            +  SWYCA  +L L   A     + S     G Q++           R C+EIYVV EGE
Sbjct  19   DAASWYCAVALLALILIASIRANSASDEPVRGSQLL----------NRPCDEIYVVGEGE  68

Query  467  TLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            TL TIS+KCGDPFIVE NPHI+DPDDVFPGLV+KI P
Sbjct  69   TLHTISDKCGDPFIVERNPHIHDPDDVFPGLVLKIIP  105



>ref|XP_003628108.1| hypothetical protein MTR_8g043660 [Medicago truncatula]
 ref|XP_003628115.1| hypothetical protein MTR_8g043870 [Medicago truncatula]
 gb|AET02584.1| peptidoglycan-binding LysM domain protein [Medicago truncatula]
Length=116

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 63/104 (61%), Gaps = 3/104 (3%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
               + E  SWYCA  ++ L   +    ++    +    M+     +     + C+EIYVV
Sbjct  14   SKAIAEAASWYCAIFLVALILLSIFRDSSMIPNNNDHNMIESNHFLS---SKPCDEIYVV  70

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIY  586
             EGETL TIS+KC DPFIVE NPHI+DPDDVFPGLVIKITP  Y
Sbjct  71   GEGETLNTISDKCNDPFIVENNPHIHDPDDVFPGLVIKITPSYY  114



>ref|XP_011031601.1| PREDICTED: uncharacterized protein LOC105130685 [Populus euphratica]
Length=103

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 70/103 (68%), Gaps = 10/103 (10%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERR-CEEIYV  451
               M EK+SWYCA  + L+         +ES      ++  +G   V  FE + C+EIYV
Sbjct  7    STVMAEKISWYCALLMALML-VLSCCEVSES------ELAAVGHPRV--FEDKPCDEIYV  57

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            VREGETL TISEKC DP+IVEENPHI+DPDDVFPGLVI+ITPF
Sbjct  58   VREGETLHTISEKCRDPYIVEENPHIHDPDDVFPGLVIRITPF  100



>ref|XP_009803777.1| PREDICTED: uncharacterized protein LOC104249093 [Nicotiana sylvestris]
Length=101

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 60/96 (63%), Gaps = 10/96 (10%)
 Frame = +2

Query  290  EKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGET  469
            +  S YCA  +L L  F+        S DG     +          R C+EIYVV EGET
Sbjct  12   DAASLYCAMVILGLLLFSS-LKENYYSTDGAVNHFL---------NRPCDEIYVVGEGET  61

Query  470  LQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            L TIS+KCGDP+IVE NPHI+DPDDVFPGLVIKITP
Sbjct  62   LHTISDKCGDPYIVERNPHIHDPDDVFPGLVIKITP  97



>ref|XP_002321883.2| peptidoglycan-binding LysM domain-containing family protein, 
partial [Populus trichocarpa]
 gb|EEF06010.2| peptidoglycan-binding LysM domain-containing family protein, 
partial [Populus trichocarpa]
Length=125

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 63/103 (61%), Gaps = 12/103 (12%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAG--GWGTTESSADGGEQMMMIGRVVVPPFERRCEEIY  448
               + +  SW CA  +L L        +   +     G Q+          F+R C+EIY
Sbjct  25   SVVIADVASWNCAIVLLCLILLGSIREYSVPKDQPVKGSQL----------FDRPCDEIY  74

Query  449  VVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            VV EGETL TIS+KCGDPFIVE+NPHI+DPDDVFPGLVIKITP
Sbjct  75   VVGEGETLHTISDKCGDPFIVEQNPHIHDPDDVFPGLVIKITP  117



>ref|XP_002511780.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50449.1| conserved hypothetical protein [Ricinus communis]
Length=114

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 66/98 (67%), Gaps = 7/98 (7%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREG  463
            + +  SWYCA   L+L          E+S     ++    +++    +R C+EIYVV+EG
Sbjct  16   IADVASWYCA---LVLVTLILQSSLRETSIYDPYEVFKGNQIL----DRPCDEIYVVQEG  68

Query  464  ETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            ETL TIS KCGDPFIVE+NPHI+DPDDVFPGLVIKITP
Sbjct  69   ETLHTISSKCGDPFIVEKNPHIHDPDDVFPGLVIKITP  106



>gb|AFK40764.1| unknown [Lotus japonicus]
Length=115

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 7/99 (7%)
 Frame = +2

Query  290  EKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGET  469
            +  SW+CA  +L +        +T +++DG E      R      +R C+EIYVV EGET
Sbjct  15   DSASWFCAMVLLGIILLGSIKESTSNTSDGDEVRGNNLR------DRACDEIYVVGEGET  68

Query  470  LQTISEKCGDPFIVEENPHINDPDDVFPGLVIK-ITPFI  583
            L TIS+KCGDPFIVE NPHI+DPDDVFPGLVI+ ITP +
Sbjct  69   LNTISDKCGDPFIVERNPHIHDPDDVFPGLVIRIITPMV  107



>gb|AFK49092.1| unknown [Lotus japonicus]
Length=113

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 7/99 (7%)
 Frame = +2

Query  290  EKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGET  469
            +  SW+CA  +L +        +T +++DG E      R      +R C+EIYVV EGET
Sbjct  13   DSASWFCAMVLLGIILLGSIKESTSNTSDGDEVRGNNLR------DRACDEIYVVGEGET  66

Query  470  LQTISEKCGDPFIVEENPHINDPDDVFPGLVIK-ITPFI  583
            L TIS+KCGDPFIVE NPHI+DPDDVFPGLVI+ ITP +
Sbjct  67   LNTISDKCGDPFIVERNPHIHDPDDVFPGLVIRIITPMV  105



>ref|XP_006292081.1| hypothetical protein CARUB_v10018276mg [Capsella rubella]
 gb|EOA24979.1| hypothetical protein CARUB_v10018276mg [Capsella rubella]
Length=111

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 73/104 (70%), Gaps = 9/104 (9%)
 Frame = +2

Query  284  MGEKVSWYCA--ATVLLL--WCFAGGWGTTESSADGGEQMMMIGRVVVPPFERR--CEEI  445
            + EK+SWYCA  A+++LL  +C     G+T   A   +Q      ++    +RR  C+EI
Sbjct  9    VAEKISWYCAVFASMMLLMNFCHVAEEGST---AIVQKQQPTTTMMIAGYSDRRPACDEI  65

Query  446  YVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            Y V+EGETLQTISEKCGDP+IVE NPHI+D DD+FPGL+I+ITP
Sbjct  66   YEVKEGETLQTISEKCGDPYIVEGNPHIHDHDDLFPGLLIRITP  109



>ref|XP_010504024.1| PREDICTED: uncharacterized protein LOC104781129 [Camelina sativa]
Length=109

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 68/102 (67%), Gaps = 7/102 (7%)
 Frame = +2

Query  284  MGEKVSWYC---AATVLLLWCF-AGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYV  451
            + EK SWYC   AA +LL+  F     G+TE        MM+ G    P     C+EIY 
Sbjct  9    VAEKFSWYCTVFAAMMLLMNFFHVVEEGSTEIMQKQQPSMMIAG---YPDRRPACDEIYE  65

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            V+EGETLQTISEKCGDP+IVE NPHI+D DD+FPGL+I+ITP
Sbjct  66   VKEGETLQTISEKCGDPYIVEGNPHIHDHDDLFPGLLIRITP  107



>ref|XP_004494912.1| PREDICTED: uncharacterized protein LOC101513902 [Cicer arietinum]
Length=97

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 66/103 (64%), Gaps = 15/103 (15%)
 Frame = +2

Query  284  MGEKVSWYCAA----TVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYV  451
            M  KV  YC       VL+L C    W T  +  +   QMMM         ++ C+EIYV
Sbjct  1    MAMKVLRYCVLFATINVLVLNC----WETRRNEFNV--QMMMQRN-----NKKVCDEIYV  49

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            VREGETLQTISEKC DP+IVEENPHI+DPDDVFPGLVIKI  F
Sbjct  50   VREGETLQTISEKCEDPYIVEENPHIHDPDDVFPGLVIKINSF  92



>ref|XP_006851507.1| hypothetical protein AMTR_s00040p00156520 [Amborella trichopoda]
 gb|ERN13088.1| hypothetical protein AMTR_s00040p00156520 [Amborella trichopoda]
Length=102

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 62/87 (71%), Gaps = 7/87 (8%)
 Frame = +2

Query  329  LWC--FAGGWGTTESSAD-GGEQMMMIGRVVVPPFERRCEEIYVVREGETLQTISEKCGD  499
            LWC  FA G        D GG+ ++ + +      +R C+EIYVV EGETL TISEKCGD
Sbjct  16   LWCLVFAFGAMVLMGCCDIGGQGVLKMEK----EEQRVCDEIYVVEEGETLHTISEKCGD  71

Query  500  PFIVEENPHINDPDDVFPGLVIKITPF  580
            PFIVEENPHI DPDDVFPGLVIKITPF
Sbjct  72   PFIVEENPHIQDPDDVFPGLVIKITPF  98



>emb|CDP05258.1| unnamed protein product [Coffea canephora]
Length=108

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 63/100 (63%), Gaps = 12/100 (12%)
 Frame = +2

Query  284  MGEKVSWYCAATV--LLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVR  457
            + +  SW+CAA +  L+L               G  Q++           R C+EIYVV 
Sbjct  14   IADGASWFCAAVIVALVLVSAVKEDSVPYEPVRGNLQLL----------NRACDEIYVVG  63

Query  458  EGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            EGETL TIS+KCGDPFIVE+NPHI+DPDDVFPGLVIKITP
Sbjct  64   EGETLHTISDKCGDPFIVEQNPHIHDPDDVFPGLVIKITP  103



>ref|XP_004150301.1| PREDICTED: uncharacterized protein LOC101210054 [Cucumis sativus]
 ref|XP_004165390.1| PREDICTED: uncharacterized LOC101210054 [Cucumis sativus]
 gb|KGN57330.1| hypothetical protein Csa_3G179200 [Cucumis sativus]
Length=120

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 65/94 (69%), Gaps = 7/94 (7%)
 Frame = +2

Query  290  EKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGET  469
            + VSWYCA  +L L    G    T SS DG    ++ G +V     R C+EIYVV EGET
Sbjct  21   DVVSWYCAVGLLGL-ILIGSIRETSSSGDG---RLLRGNLVT---WRPCDEIYVVGEGET  73

Query  470  LQTISEKCGDPFIVEENPHINDPDDVFPGLVIKI  571
            L TIS+KCGDP+IVE NPHI+DPDDVFPGLVIKI
Sbjct  74   LHTISDKCGDPYIVERNPHIHDPDDVFPGLVIKI  107



>ref|XP_011041736.1| PREDICTED: uncharacterized protein LOC105137629 [Populus euphratica]
Length=113

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 63/101 (62%), Gaps = 14/101 (14%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAGGWGTTESSAD---GGEQMMMIGRVVVPPFERRCEEIYVV  454
            + +  SW CA  VLL     G         D    G Q++          +R C+EIYVV
Sbjct  16   IADVASWNCA-IVLLCLILLGSIRENSVPKDQPVKGSQLL----------DRACDEIYVV  64

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
             EGETL TIS+KCGDPFIVE+NPHI+DPDDVFPGLVIKITP
Sbjct  65   GEGETLHTISDKCGDPFIVEQNPHIHDPDDVFPGLVIKITP  105



>ref|XP_009626306.1| PREDICTED: uncharacterized protein LOC104117032 [Nicotiana tomentosiformis]
Length=104

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 62/99 (63%), Gaps = 13/99 (13%)
 Frame = +2

Query  290  EKVSWYCAATVL---LLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVRE  460
            +  S YCA  +L   L+      + +T+ +   G   +           R C+EIYVV E
Sbjct  12   DAASLYCAMVILGLLLVSSLKENYYSTDGAVIKGNHFL----------NRPCDEIYVVGE  61

Query  461  GETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            GETL TIS+KCGDP+IVE NPHI+DPDDVFPGLVIKITP
Sbjct  62   GETLHTISDKCGDPYIVERNPHIHDPDDVFPGLVIKITP  100



>ref|XP_010317566.1| PREDICTED: uncharacterized protein LOC104646140 [Solanum lycopersicum]
Length=118

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 63/102 (62%), Gaps = 11/102 (11%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAGGWGTTESSADG---GEQMMMIGRVVVPPFERRCEEIYVV  454
            + E  SW CA +++ L   +        + D    G Q+ M          R C+EIYVV
Sbjct  18   IAELASWICAISLMALVLMSSIRENNLRNWDSVVRGNQLSM--------SHRPCDEIYVV  69

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
             EGETL TIS+KCGDP+IVE NPHI+DPDDVFPGLVIKI PF
Sbjct  70   GEGETLHTISDKCGDPYIVERNPHIHDPDDVFPGLVIKIVPF  111



>gb|KDP22340.1| hypothetical protein JCGZ_26171 [Jatropha curcas]
Length=105

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 64/102 (63%), Gaps = 13/102 (13%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSAD---GGEQMMMIGRVVVPPFERRCEEIYV  451
             + +  SWYCA  +L L         + SS      G Q++          +R C+EIYV
Sbjct  6    AIADAASWYCAIVLLGLILLGSIKEISSSSTAEPFKGNQLL----------DRHCDEIYV  55

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            V EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  56   VGEGETLHTISDKCGDPFIVERNPHIHDPDDVFPGLVIKITP  97



>ref|XP_010426901.1| PREDICTED: uncharacterized protein LOC104711831 [Camelina sativa]
Length=109

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = +2

Query  284  MGEKVSWYCA--ATVLLLWCF--AGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYV  451
            + EK SWYCA  A ++LL  F      G+TE        MM+      P     C+EIY 
Sbjct  9    VAEKFSWYCAVFAAMMLLMNFFHVTEEGSTEIVKKQQPSMMI---AEYPDRRPACDEIYE  65

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            V+EGETLQTISEKCGDP+IVE NPHI+D DD+FPGL+I+ITP
Sbjct  66   VKEGETLQTISEKCGDPYIVEGNPHIHDHDDLFPGLLIRITP  107



>gb|EYU25044.1| hypothetical protein MIMGU_mgv1a024197mg [Erythranthe guttata]
Length=123

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 70/112 (63%), Gaps = 8/112 (7%)
 Frame = +2

Query  248  MLRVVIRWPGATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVV---P  418
            +++ V  W    + +  SWYCA  +L +    G  G   +  +  E +  +G V V    
Sbjct  8    IVKTVKSW--VPIADACSWYCAVVLLGVILLGGSIGENYNYDE--ETVTQVGTVSVIRGN  63

Query  419  PFERR-CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKI  571
               RR C+EIYVV EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKI
Sbjct  64   HLRRRPCDEIYVVGEGETLHTISDKCGDPFIVERNPHIHDPDDVFPGLVIKI  115



>ref|XP_011015875.1| PREDICTED: uncharacterized protein LOC105119433 [Populus euphratica]
Length=119

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 67/100 (67%), Gaps = 4/100 (4%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMI-GRVVVPPFERRCEEIYVVR  457
            ++ +  +WYCA  +L L         + +  DG    +++ G      F R C+EIYVV+
Sbjct  15   SVADAATWYCALVLLALILLTSLREASPTYDDGRHHDVVVEGNQT---FYRPCDEIYVVK  71

Query  458  EGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            EGETL TIS+KC DPFIVEENPHI+DPDDVFPGLVIKITP
Sbjct  72   EGETLHTISDKCDDPFIVEENPHIHDPDDVFPGLVIKITP  111



>ref|XP_002270367.1| PREDICTED: uncharacterized protein LOC100255607 [Vitis vinifera]
Length=113

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 63/104 (61%), Gaps = 13/104 (13%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSAD---GGEQMMMIGRVVVPPFERRCEEI  445
               + +  S YCA  ++ L   A     +    D    G Q++           R C+EI
Sbjct  12   SVAVADAASCYCAVILVALILLASVREYSSLPTDESVKGHQLLA----------RPCDEI  61

Query  446  YVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            YVV EGETL TIS+KCGDP+IVE+NPHI+DPDDVFPGLVIKITP
Sbjct  62   YVVGEGETLHTISDKCGDPYIVEQNPHIHDPDDVFPGLVIKITP  105



>ref|XP_011076250.1| PREDICTED: uncharacterized protein LOC105160530 [Sesamum indicum]
Length=121

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREG  463
            + +  SWYCA  +L L    GG    ++  D   +     R  +    R C+EIYVV EG
Sbjct  18   IADASSWYCAIVLLALIILIGGSVGDQNHYDEEAEGAAASRGKLNHL-RPCDEIYVVGEG  76

Query  464  ETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIY  586
            ETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKITP  Y
Sbjct  77   ETLHTISDKCGDPFIVERNPHIHDPDDVFPGLVIKITPSPY  117



>ref|XP_007143364.1| hypothetical protein PHAVU_007G066300g [Phaseolus vulgaris]
 gb|ESW15358.1| hypothetical protein PHAVU_007G066300g [Phaseolus vulgaris]
Length=104

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 63/101 (62%), Gaps = 7/101 (7%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVRE  460
             + +  SWYC   +L +       G+   SA  GE   M G  +    ER C+EIYVV E
Sbjct  9    NIADSASWYCGMMLLGMILL----GSVRESAVAGEVEAMKGSNL---RERPCDEIYVVGE  61

Query  461  GETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFI  583
            GE+L TIS+KC DPFIVE NPHI+D DDV+PGLVIKI P +
Sbjct  62   GESLHTISDKCNDPFIVERNPHIHDSDDVYPGLVIKIIPIL  102



>ref|XP_010049654.1| PREDICTED: uncharacterized protein LOC104438250 [Eucalyptus grandis]
 gb|KCW89216.1| hypothetical protein EUGRSUZ_A01520 [Eucalyptus grandis]
Length=107

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 64/102 (63%), Gaps = 12/102 (12%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLW----CFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIY  448
             M E +SWYCA  V L+     C  G     E  A   E+   I R         C+EIY
Sbjct  9    AMAESISWYCALLVALMLALSCCDPGEPSLAELGAAVRERHREINRP--------CDEIY  60

Query  449  VVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKIT  574
            VVREGETLQTI +KCGDP+IVE NPHI+DPDDVFPGLVIKIT
Sbjct  61   VVREGETLQTIGDKCGDPYIVERNPHIHDPDDVFPGLVIKIT  102



>ref|XP_009366749.1| PREDICTED: uncharacterized protein LOC103956477 [Pyrus x bretschneideri]
Length=109

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = +2

Query  248  MLRVVIRWPGATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFE  427
            M+ V+       + EK++ YCA  + L+   +    +         Q+ M          
Sbjct  1    MVCVMCSSSTVILAEKIACYCALLLALVLVLSCCESSESEFTARKVQLQMDA------LN  54

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFI  583
            + C+EIYVVREGETLQTI EKCGDP+IVEENPHI+DPDDVFPGL+I+ITP I
Sbjct  55   KPCDEIYVVREGETLQTIIEKCGDPYIVEENPHIHDPDDVFPGLLIRITPPI  106



>gb|KEH18985.1| peptidoglycan-binding LysM domain protein [Medicago truncatula]
Length=116

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 62/104 (60%), Gaps = 3/104 (3%)
 Frame = +2

Query  266  RWPGATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEI  445
            +     + +  SWYC+  ++ L        +     D    ++     ++    + C+EI
Sbjct  11   KLSSKAIADATSWYCSIVLVALILLTIYRDSYMIPNDHDHNIIESNHFLL---SKPCDEI  67

Query  446  YVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            YVV EGETL TIS+KC DPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  68   YVVGEGETLNTISDKCNDPFIVENNPHIHDPDDVFPGLVIKITP  111



>ref|XP_009415612.1| PREDICTED: uncharacterized protein LOC103996414 [Musa acuminata 
subsp. malaccensis]
Length=103

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 67/99 (68%), Gaps = 9/99 (9%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREG  463
            + EKVSWYCA  ++LL           +  D  E    I R + P  +R C+EIYVV EG
Sbjct  11   VAEKVSWYCALLLILL--------LVSNCCDPDEAGAPIRRYL-PVNDRPCDEIYVVGEG  61

Query  464  ETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            ETLQTI +KCGDPF++EENPH+ D DDVFPGLVIKITPF
Sbjct  62   ETLQTIIDKCGDPFVLEENPHVQDFDDVFPGLVIKITPF  100



>ref|XP_002510858.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51460.1| conserved hypothetical protein [Ricinus communis]
Length=104

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 66/101 (65%), Gaps = 12/101 (12%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSAD--GGEQMMMIGRVVVPPFERRCEEIYVV  454
             + +  S YCA  +L L        +  S+A+   G Q++          +R C+EIYVV
Sbjct  6    AIADAASCYCAVVLLGLILLGSVIESNSSAAEPVKGSQLL----------DRPCDEIYVV  55

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
             EGETL TIS+KCGDPFIVE+NPHI+DPDDVFPGLVIKITP
Sbjct  56   GEGETLHTISDKCGDPFIVEQNPHIHDPDDVFPGLVIKITP  96



>ref|NP_001235454.1| uncharacterized protein LOC100500258 precursor [Glycine max]
 gb|ACU15280.1| unknown [Glycine max]
Length=100

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
            G++  +  SWYCA  VLL     G    +  + + GE +   G  +    +R C+EIYVV
Sbjct  2    GSSAADSASWYCA-MVLLAMILLGSIRESTMAEEEGEPIK--GNNL---RQRPCDEIYVV  55

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
             EGETL TIS+ C DPFIVE NPHI+DPDDVFPGLVIKI P 
Sbjct  56   GEGETLHTISDMCNDPFIVERNPHIHDPDDVFPGLVIKIIPI  97



>gb|KHN02791.1| hypothetical protein glysoja_016033 [Glycine soja]
Length=100

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 65/102 (64%), Gaps = 6/102 (6%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
            G++  +  SWYCA  VLL     G    +  + + GE +   G  +    +R C+EIYVV
Sbjct  2    GSSAADSASWYCA-MVLLAMILLGSIRESTVAEEEGEPIK--GNNL---RQRPCDEIYVV  55

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
             EGETL TIS+ C DPFIVE NPHI+DPDDVFPGLVIKI P 
Sbjct  56   GEGETLHTISDMCNDPFIVERNPHIHDPDDVFPGLVIKIIPI  97



>ref|XP_010255558.1| PREDICTED: uncharacterized protein LOC104596195 [Nelumbo nucifera]
Length=113

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R CEEIYVVREGETL TIS+KCGDP+IVE+NPHI+DPDDVFPGLVIKITP
Sbjct  55   RPCEEIYVVREGETLHTISDKCGDPYIVEQNPHIHDPDDVFPGLVIKITP  104



>ref|XP_007163923.1| hypothetical protein PHAVU_L005300g [Phaseolus vulgaris]
 gb|ESW35917.1| hypothetical protein PHAVU_L005300g [Phaseolus vulgaris]
Length=112

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  422  FERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            FER C+EIYVV EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  53   FERPCDEIYVVGEGETLHTISDKCGDPFIVESNPHIHDPDDVFPGLVIKITP  104



>ref|XP_002467624.1| hypothetical protein SORBIDRAFT_01g031120 [Sorghum bicolor]
 gb|EER94622.1| hypothetical protein SORBIDRAFT_01g031120 [Sorghum bicolor]
Length=127

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 71/106 (67%), Gaps = 8/106 (8%)
 Frame = +2

Query  266  RWPGATMGEKVSWYCA--ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCE  439
            RW GAT    V+ +CA  A V+++   AG     E    GG ++++ G  +     R C+
Sbjct  9    RW-GAT---DVASWCALLALVMVVGSLAGSGDDEEQYDRGGRRLVVRGARLAAA--RPCD  62

Query  440  EIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            E+YVV EGETL +IS +CGDP+I+E NPH++DPDDVFPGLVIKITP
Sbjct  63   ELYVVAEGETLHSISARCGDPYILEHNPHVHDPDDVFPGLVIKITP  108



>ref|XP_010515752.1| PREDICTED: uncharacterized protein LOC104791536 [Camelina sativa]
Length=109

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 68/108 (63%), Gaps = 7/108 (6%)
 Frame = +2

Query  266  RWPGATMGEKVSWYC---AATVLLLWCF-AGGWGTTESSADGGEQMMMIGRVVVPPFERR  433
            +     + EK S YC   AA +LL+  F     G+TE        MM+ G    P     
Sbjct  3    KSSSMVVAEKFSLYCTVFAAMMLLMNFFHVVEEGSTEIMQKQQPSMMIAG---YPDRRPA  59

Query  434  CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            C+EIY V+EGETLQTISEKCGDP+IVE NPHI+D DD+FPGL+I+ITP
Sbjct  60   CDEIYEVKEGETLQTISEKCGDPYIVEGNPHIHDHDDLFPGLLIRITP  107



>ref|XP_003549126.1| PREDICTED: uncharacterized protein LOC100789966 [Glycine max]
 gb|KHN23065.1| hypothetical protein glysoja_038890 [Glycine soja]
Length=112

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  422  FERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            FER C+EIYVV EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  48   FERPCDEIYVVGEGETLHTISDKCGDPFIVERNPHIHDPDDVFPGLVIKITP  99



>gb|KHN31546.1| hypothetical protein glysoja_029681 [Glycine soja]
Length=112

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  422  FERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            FER C+EIYVV EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  48   FERPCDEIYVVGEGETLHTISDKCGDPFIVERNPHIHDPDDVFPGLVIKITP  99



>ref|XP_009626309.1| PREDICTED: uncharacterized protein LOC104117035 [Nicotiana tomentosiformis]
Length=120

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 62/97 (64%), Gaps = 12/97 (12%)
 Frame = +2

Query  299  SWYCAATVLLLWCFA----GGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGE  466
            SW CA +++ L   +       G  E+S   G+Q+ +          R C+EIYVV EGE
Sbjct  24   SWLCAISLMALVLMSSIKENNTGNWENSVVRGKQLHL--------SHRPCDEIYVVGEGE  75

Query  467  TLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            TL TIS+KC DP+IVE NPHI+DPDDVFPGLVIKI P
Sbjct  76   TLHTISDKCDDPYIVERNPHIHDPDDVFPGLVIKIVP  112



>ref|XP_009384524.1| PREDICTED: uncharacterized protein LOC103972056 [Musa acuminata 
subsp. malaccensis]
Length=112

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 65/103 (63%), Gaps = 14/103 (14%)
 Frame = +2

Query  284  MGEKVSWYCAATV--LLLWCFAGGWGTTESSADG---GEQMMMIGRVVVPPFERRCEEIY  448
            + +  +W  A  V  LLL C        E  A G   G   +  GR+     ERRC+EIY
Sbjct  15   IADAAAWLLAIAVVALLLLC-----SLREGPASGEPIGGAPVRGGRL----MERRCDEIY  65

Query  449  VVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            VV EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIK+ P
Sbjct  66   VVGEGETLHTISDKCGDPFIVERNPHIHDPDDVFPGLVIKLLP  108



>ref|XP_008795361.1| PREDICTED: uncharacterized protein LOC103711121 [Phoenix dactylifera]
Length=110

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 67/99 (68%), Gaps = 6/99 (6%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVRE  460
            ++ +  SWYCA  ++ L          ES  D   + +  G++V     R C+EIYVV E
Sbjct  14   SVADAASWYCALALVAL---VLLSSLRESPVDNTIEPVRGGKLV---GRRPCDEIYVVGE  67

Query  461  GETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            GETL TIS+KCGDPFIVE+NPHI+DPDDVFPGLVIKITP
Sbjct  68   GETLHTISDKCGDPFIVEQNPHIHDPDDVFPGLVIKITP  106



>gb|EPS60975.1| hypothetical protein M569_13827, partial [Genlisea aurea]
Length=53

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +2

Query  434  CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            C+EIY+V+EGETL TISEKCGDP+IVEENPHI+DPDDVFPGLVIKITPF
Sbjct  2    CDEIYLVKEGETLHTISEKCGDPYIVEENPHIHDPDDVFPGLVIKITPF  50



>ref|XP_003592328.1| hypothetical protein MTR_1g101680 [Medicago truncatula]
 gb|AES62579.1| peptidoglycan-binding LysM domain protein [Medicago truncatula]
 gb|AFK34778.1| unknown [Medicago truncatula]
Length=104

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 65/99 (66%), Gaps = 8/99 (8%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
            G++ G+  SWYCA  +L +        +T +      ++ + G  +     + C+EIYVV
Sbjct  2    GSSRGDSASWYCAIALLGMILLGSIRESTVA------ELQVRGNSLGD--HKACDEIYVV  53

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKI  571
             EGETL TISEKCGDPFIVE NPHI+DPDDVFPGLVI+I
Sbjct  54   GEGETLNTISEKCGDPFIVERNPHIHDPDDVFPGLVIRI  92



>emb|CDX87231.1| BnaC09g05460D [Brassica napus]
Length=103

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 61/103 (59%), Gaps = 8/103 (8%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVRE  460
            T    ++ +C+A VLL            +S D                E+ CEEIYVV E
Sbjct  6    TASSDIAAWCSAVVLLSLILMLSVRENNASNDSVRGFQFS--------EKPCEEIYVVGE  57

Query  461  GETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            GETL TI +KCGDPFIVE NPHI+DPDDVFPGLV++I PF ++
Sbjct  58   GETLHTIGDKCGDPFIVERNPHIHDPDDVFPGLVLRIAPFYFS  100



>ref|XP_006353384.1| PREDICTED: uncharacterized protein LOC102593371 [Solanum tuberosum]
Length=119

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 62/103 (60%), Gaps = 12/103 (12%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFA----GGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYV  451
            + +  SW C  +++ L   +          +S    G Q+ M          R C+EIYV
Sbjct  18   IADVASWICVISLMALVLMSSVRENNLRNWDSHVVRGSQLSM--------SHRPCDEIYV  69

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            V EGETL TIS+KCGDP+IVE NPHI+DPDDVFPGLVIKI PF
Sbjct  70   VGEGETLHTISDKCGDPYIVERNPHIHDPDDVFPGLVIKIVPF  112



>ref|XP_010035084.1| PREDICTED: uncharacterized protein LOC104424381 [Eucalyptus grandis]
 gb|KCW46370.1| hypothetical protein EUGRSUZ_K00211 [Eucalyptus grandis]
Length=134

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 66/105 (63%), Gaps = 9/105 (9%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSADG------GEQMMMIGRVVVPPFERRCEE  442
             + +  S  CA  ++ L   A    + +++  G      G+   + G   +   +R C+E
Sbjct  23   AIADAASSLCALFLIALILVASNRESNDANGIGTGDRGDGQSYSLKGSQFL---DRPCDE  79

Query  443  IYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            IYVV +GETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  80   IYVVGDGETLHTISDKCGDPFIVERNPHIHDPDDVFPGLVIKITP  124



>gb|EEC74398.1| hypothetical protein OsI_09751 [Oryza sativa Indica Group]
Length=122

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +2

Query  371  ADGGEQMMMIGRVV--VPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDD  544
            A GGEQ   +  VV       R CEEIYVV EGETL +IS+KCGDP+I+E+NPH++DPDD
Sbjct  48   AAGGEQRGGVAAVVRGAALSARACEEIYVVAEGETLHSISDKCGDPYILEQNPHVHDPDD  107

Query  545  VFPGLVIKITP  577
            VFPGLVIKITP
Sbjct  108  VFPGLVIKITP  118



>emb|CAN62985.1| hypothetical protein VITISV_027722 [Vitis vinifera]
Length=113

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 63/105 (60%), Gaps = 15/105 (14%)
 Frame = +2

Query  275  GATMGEKVSWYCA----ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEE  442
               + +  S YCA    A +LL          T+ S  G + +            R C+E
Sbjct  12   SVAVADAASCYCAVILVALILLXSVREYSSLPTDESVKGXQLLA-----------RPCDE  60

Query  443  IYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            IYVV EGETL TIS+KCGDP+IVE+NPHI+DPDDVFPGLVIKITP
Sbjct  61   IYVVGEGETLHTISDKCGDPYIVEQNPHIHDPDDVFPGLVIKITP  105



>ref|XP_002302557.2| hypothetical protein POPTR_0002s15400g [Populus trichocarpa]
 gb|EEE81830.2| hypothetical protein POPTR_0002s15400g [Populus trichocarpa]
Length=127

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 4/100 (4%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMI-GRVVVPPFERRCEEIYVVR  457
            ++ +  +WYCA  +L L   A     + +  D     +++ G  ++    R C+EIYVV+
Sbjct  23   SVADAATWYCALVLLALILLASLREASPTYDDDRHHDVVVEGNQIL---YRPCDEIYVVK  79

Query  458  EGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            EGETL TIS+KC DPFIVEENPHI+DPDDVFPGLVIKITP
Sbjct  80   EGETLHTISDKCDDPFIVEENPHIHDPDDVFPGLVIKITP  119



>gb|EPS60868.1| hypothetical protein M569_13934 [Genlisea aurea]
Length=107

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 60/96 (63%), Gaps = 11/96 (11%)
 Frame = +2

Query  296  VSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGETLQ  475
             SW  AA ++ +   +G   + E +  GG              +  C+EIYVV EGETL 
Sbjct  20   ASWSFAAVLVAVILISGESYSDEETMTGGNLR-----------QATCDEIYVVGEGETLH  68

Query  476  TISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFI  583
            TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKI P +
Sbjct  69   TISDKCGDPFIVERNPHIHDPDDVFPGLVIKINPLL  104



>ref|XP_008801244.1| PREDICTED: uncharacterized protein LOC103715411 [Phoenix dactylifera]
Length=108

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 63/96 (66%), Gaps = 9/96 (9%)
 Frame = +2

Query  287  GEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGE  466
            GEKVSWYC   + LL              D GE+   + R      +R C+EIYVV EGE
Sbjct  12   GEKVSWYCTLFLALLLLMG--------CCDPGEEDPPVWRYQKI-HDRPCDEIYVVSEGE  62

Query  467  TLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKIT  574
            TL TIS+KCGDPFI+EENPHI DPDDVFPGL+IKIT
Sbjct  63   TLHTISDKCGDPFILEENPHIEDPDDVFPGLIIKIT  98



>ref|NP_001173239.1| Os03g0118450 [Oryza sativa Japonica Group]
 gb|EEE58220.1| hypothetical protein OsJ_09188 [Oryza sativa Japonica Group]
 dbj|BAH91967.1| Os03g0118450 [Oryza sativa Japonica Group]
Length=122

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +2

Query  371  ADGGEQMMMIGRVV--VPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDD  544
            A GGEQ   +  V+       R CEEIYVV EGETL +IS+KCGDP+I+E+NPH++DPDD
Sbjct  48   AAGGEQRGGVAAVLRGAALSARACEEIYVVAEGETLHSISDKCGDPYILEQNPHVHDPDD  107

Query  545  VFPGLVIKITP  577
            VFPGLVIKITP
Sbjct  108  VFPGLVIKITP  118



>ref|NP_001237009.1| uncharacterized protein LOC100306578 precursor [Glycine max]
 gb|ACU14813.1| unknown [Glycine max]
Length=110

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = +2

Query  374  DGGEQMMMIGRVVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFP  553
            D G  M+    V+  P    C+EIYVV EGE L TIS+KCGDPFIVE+NPHI+DPDDVFP
Sbjct  46   DQGNLMIRSSHVLSKP----CDEIYVVGEGEALHTISDKCGDPFIVEKNPHIHDPDDVFP  101

Query  554  GLVIKITP  577
            GLVIKITP
Sbjct  102  GLVIKITP  109



>ref|XP_010546080.1| PREDICTED: uncharacterized protein LOC104818271 [Tarenaya hassleriana]
Length=102

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  425  ERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            +R CEEIYVV EGETL TI EKCGDPFIVE NPHI+DPDDVFPGLV+KITPF
Sbjct  44   DRPCEEIYVVGEGETLHTIGEKCGDPFIVERNPHIHDPDDVFPGLVLKITPF  95



>ref|XP_007134952.1| hypothetical protein PHAVU_010G089500g [Phaseolus vulgaris]
 gb|ESW06946.1| hypothetical protein PHAVU_010G089500g [Phaseolus vulgaris]
Length=110

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R CEEIYVV EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  57   RPCEEIYVVGEGETLHTISDKCGDPFIVENNPHIHDPDDVFPGLVIKITP  106



>ref|XP_010054124.1| PREDICTED: uncharacterized protein LOC104442390 [Eucalyptus grandis]
 gb|KCW78498.1| hypothetical protein EUGRSUZ_D02639 [Eucalyptus grandis]
Length=99

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 61/104 (59%), Gaps = 8/104 (8%)
 Frame = +2

Query  278  ATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVR  457
            A+     S +C      L   +      E+ A+G  +   I        ER C+EIYVV 
Sbjct  2    ASSSRAASLFCTLVFAFLVLLSSSR-KAEALANGAVKGAQI-------LERPCDEIYVVG  53

Query  458  EGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            EGETL +IS KCGDPFIVE NPH++DPDDVFPGLV+ I P++ +
Sbjct  54   EGETLHSISAKCGDPFIVERNPHVHDPDDVFPGLVLMIAPYLRS  97



>ref|XP_010536496.1| PREDICTED: uncharacterized protein LOC104811486 [Tarenaya hassleriana]
Length=116

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  422  FERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
             ER CEEIYVV EGETL +IS+KCGDPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  54   MERPCEEIYVVGEGETLHSISDKCGDPFIVERNPHIHDPDDVFPGLVIKITP  105



>ref|XP_007051957.1| Peptidoglycan-binding LysM domain-containing protein, putative 
[Theobroma cacao]
 gb|EOX96114.1| Peptidoglycan-binding LysM domain-containing protein, putative 
[Theobroma cacao]
Length=133

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 66/103 (64%), Gaps = 13/103 (13%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAGGWGTTESSAD---GGEQMMMIGRVVVPPFERRCEEIYV  451
            ++ ++ SW C   +L L        TT  + D    G Q++          +R C+EIYV
Sbjct  34   SLADEASWCCVFVLLTLLLLNSCKETTTIANDEDVKGRQLL----------DRPCDEIYV  83

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            V EGETL +IS+KCGDPFIVE+NPHI+DPDDVFPGLVIKITP 
Sbjct  84   VGEGETLHSISDKCGDPFIVEQNPHIHDPDDVFPGLVIKITPM  126



>ref|XP_010693458.1| PREDICTED: uncharacterized protein LOC104906416 [Beta vulgaris 
subsp. vulgaris]
Length=139

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 68/114 (60%), Gaps = 9/114 (8%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFA-------GGWGTTESSADGGEQMMMIGRVVVPPFERRCEE  442
            + +  SWYC+  +++L  F          +   +        +MM G   +    R C+E
Sbjct  25   IADTASWYCSIIIVVLILFITLRAEDYNSYFDDDDDGGHNNLLMMKGTNSLD--HRPCDE  82

Query  443  IYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT*LDQK  604
            IYVV EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKI P     +++K
Sbjct  83   IYVVSEGETLHTISDKCGDPFIVERNPHIHDPDDVFPGLVIKIVPSHLNNINRK  136



>ref|XP_008657691.1| PREDICTED: uncharacterized protein LOC103637226 [Zea mays]
 tpg|DAA46007.1| TPA: hypothetical protein ZEAMMB73_211269 [Zea mays]
Length=117

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 69/110 (63%), Gaps = 14/110 (13%)
 Frame = +2

Query  266  RWPGATMGEKVSWYCA--ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVV--PPFERR  433
            RW GA     V+ +CA  A V+++   AG      S  +  EQ    G VVV  P    R
Sbjct  6    RWSGAA---DVASWCALLALVMVVGSLAG------SGKEEPEQYSRAGLVVVRGPRLAAR  56

Query  434  -CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
             C+E+YVV EGETL +IS  CGDP+I+E NPH++DPDDVFPGLVIKITP 
Sbjct  57   PCDELYVVAEGETLHSISASCGDPYILERNPHVHDPDDVFPGLVIKITPH  106



>emb|CDP08902.1| unnamed protein product [Coffea canephora]
Length=114

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  434  CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            C+EIYVV EGETL TIS+KCGDPFI+E+NPHI DPDDVFPGL+IKITP
Sbjct  60   CDEIYVVAEGETLHTISDKCGDPFIIEQNPHIQDPDDVFPGLIIKITP  107



>ref|XP_008369703.1| PREDICTED: uncharacterized protein LOC103433248 [Malus domestica]
Length=105

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREG  463
            + EK++ YCA  + L+   +    +         Q+ M          + C+EIYVV EG
Sbjct  9    LAEKIACYCALLLALVLVLSCCESSESEFTARKVQLQMDA------LNKPCDEIYVVXEG  62

Query  464  ETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFI  583
            ETLQTI EKCGDP+IVEENPHI+DPDDVFPGL+I+ITP I
Sbjct  63   ETLQTIIEKCGDPYIVEENPHIHDPDDVFPGLLIRITPPI  102



>ref|XP_009130195.1| PREDICTED: uncharacterized protein LOC103854980 [Brassica rapa]
Length=102

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  425  ERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            E+ CEEIYVV EGETL TI +KCGDPFIVE NPHI+DPDDVFPGLV++I PF ++
Sbjct  45   EKPCEEIYVVGEGETLHTIGDKCGDPFIVERNPHIHDPDDVFPGLVLRIAPFYFS  99



>ref|NP_680740.1| peptidoglycan-binding LysM domain-containing protein [Arabidopsis 
thaliana]
 gb|AAS76763.1| At4g25433 [Arabidopsis thaliana]
 dbj|BAE98768.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85057.1| peptidoglycan-binding LysM domain-containing protein [Arabidopsis 
thaliana]
Length=110

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 68/113 (60%), Gaps = 14/113 (12%)
 Frame = +2

Query  248  MLRVVIRWPGATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVV-----  412
            M+RV +     +    V+ YC   +L+L       G+ ++S  GG      GR       
Sbjct  1    MIRVTV-----SRSNTVASYCLVALLILTL----AGSVKNSNGGGSGEYYRGRNCEVWRG  51

Query  413  VPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKI  571
                ER CEE+YVV EG+TL +ISEKCGDPFIVE NPHI+DPDDVFPGL+IK+
Sbjct  52   KQMMERPCEELYVVGEGDTLHSISEKCGDPFIVERNPHIHDPDDVFPGLLIKL  104



>emb|CDY30698.1| BnaA02g33200D [Brassica napus]
Length=202

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 60/84 (71%), Gaps = 8/84 (10%)
 Frame = +2

Query  425  ERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT*LDQK  604
            E+ CEEIYVV EGETL TI +KCGDPFIVE NPHI+DPDDVFPGLV++I PF ++     
Sbjct  45   EKPCEEIYVVGEGETLHTIGDKCGDPFIVERNPHIHDPDDVFPGLVLRIAPFYFS-----  99

Query  605  TTFSFLSILCLMTNYCMEHELSPN  676
                 +S++ +++NY  E +   N
Sbjct  100  ---RKISLIVIVSNYQEECDFRLN  120



>ref|XP_006394428.1| hypothetical protein EUTSA_v10005374mg [Eutrema salsugineum]
 gb|ESQ31714.1| hypothetical protein EUTSA_v10005374mg [Eutrema salsugineum]
Length=105

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  425  ERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            E+ CEEIYVV EGETL TI +KCGDPFIVE NPHI+DPDDVFPGLV++I PF ++
Sbjct  45   EKPCEEIYVVGEGETLHTIGDKCGDPFIVERNPHIHDPDDVFPGLVLRIAPFYFS  99



>ref|XP_010933904.1| PREDICTED: uncharacterized protein LOC105054156 [Elaeis guineensis]
Length=110

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R C+EIYVV EGETL TIS+KCGDPFIVE+NPHI+DPDDVFPGLVIKITP
Sbjct  57   RPCDEIYVVGEGETLHTISDKCGDPFIVEQNPHIHDPDDVFPGLVIKITP  106



>ref|XP_009400454.1| PREDICTED: uncharacterized protein LOC103984638 [Musa acuminata 
subsp. malaccensis]
Length=113

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  380  GEQMMMIGRVVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGL  559
             E++    R   P   R C+EIYVV EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGL
Sbjct  44   AEELNEPARGGGPLVARPCDEIYVVGEGETLHTISDKCGDPFIVERNPHIHDPDDVFPGL  103

Query  560  VIKITP  577
            VIKITP
Sbjct  104  VIKITP  109



>ref|XP_010458310.1| PREDICTED: uncharacterized protein LOC104739594 [Camelina sativa]
Length=102

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  425  ERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            E+ CEEIYVV EGETL TI +KCGDPFIVE NPHI+DPDDVFPGLV+KI P+ ++
Sbjct  45   EKPCEEIYVVGEGETLHTIGDKCGDPFIVERNPHIHDPDDVFPGLVLKIAPYYFS  99



>ref|XP_002864773.1| peptidoglycan-binding LysM domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41032.1| peptidoglycan-binding LysM domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=102

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  434  CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            CEEIYVV EGETL TI +KCGDPFIVE NPHI+DPDDVFPGLV+KI PF ++
Sbjct  48   CEEIYVVGEGETLHTIGDKCGDPFIVERNPHIHDPDDVFPGLVLKIAPFYFS  99



>ref|XP_010444068.1| PREDICTED: uncharacterized protein LOC104726820 [Camelina sativa]
Length=103

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  434  CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            CEEIYVV EGETL TI +KCGDPFIVE NPHI+DPDDVFPGLV+KI PF ++
Sbjct  49   CEEIYVVGEGETLHTIGDKCGDPFIVERNPHIHDPDDVFPGLVLKIAPFYFS  100



>ref|XP_006281367.1| hypothetical protein CARUB_v10027425mg [Capsella rubella]
 gb|EOA14265.1| hypothetical protein CARUB_v10027425mg [Capsella rubella]
Length=103

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  434  CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            CEEIYVV EGETL TI +KCGDPFIVE NPHI+DPDDVFPGLV+KI PF ++
Sbjct  49   CEEIYVVGEGETLHTIGDKCGDPFIVERNPHIHDPDDVFPGLVLKIAPFYFS  100



>ref|XP_009112007.1| PREDICTED: uncharacterized protein LOC103837401 [Brassica rapa]
Length=103

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = +2

Query  311  AATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPF-ERRCEEIYVVREGETLQTISE  487
            A++ +  WC A G  +        E       V    F E+ CEEIY+V EGETL TI +
Sbjct  7    ASSDITAWCSAVGLLSLILLLSVRENNASNDSVRGFQFSEKPCEEIYIVGEGETLHTIGD  66

Query  488  KCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            KCGDPFIVE NPHI+DPDDVFPGLV++I PF ++
Sbjct  67   KCGDPFIVERNPHIHDPDDVFPGLVLRIAPFYFS  100



>ref|XP_002318841.1| peptidoglycan-binding LysM domain-containing family protein [Populus 
trichocarpa]
 gb|EEE97061.1| peptidoglycan-binding LysM domain-containing family protein [Populus 
trichocarpa]
Length=113

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  422  FERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKIT  574
            F+R C+EIYVV EGETL TISEKC DPFIVE+NPHI+DPDDV+PGLVIKIT
Sbjct  53   FDRPCDEIYVVGEGETLNTISEKCDDPFIVEQNPHIHDPDDVYPGLVIKIT  103



>ref|XP_006857938.1| hypothetical protein AMTR_s00069p00157890 [Amborella trichopoda]
 gb|ERN19405.1| hypothetical protein AMTR_s00069p00157890 [Amborella trichopoda]
Length=112

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 60/96 (63%), Gaps = 14/96 (15%)
 Frame = +2

Query  296  VSWYCAATVLLLWCFAGGWGTT--ESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGET  469
             SWY   T+LL+     G+     E++  G E+             R C+EIYVV EGET
Sbjct  24   ASWYF--TLLLVSLIVLGFLRLDWEATTKGAERH----------HRRTCDEIYVVEEGET  71

Query  470  LQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            L TI EKCGDP+IVE NPHI DPDDVFPGLVIKITP
Sbjct  72   LHTIGEKCGDPYIVETNPHIQDPDDVFPGLVIKITP  107



>ref|XP_011030048.1| PREDICTED: uncharacterized protein LOC105129616 [Populus euphratica]
Length=113

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 59/100 (59%), Gaps = 13/100 (13%)
 Frame = +2

Query  281  TMGEKVSWYCAATVLLLWCFAG--GWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
             + +  S YCA  +L L           TE    G +            F R C+EIYVV
Sbjct  15   AVADAASCYCAIVLLCLILLGSIRESSITEEPVKGNQF-----------FGRPCDEIYVV  63

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKIT  574
             EGETL TISEKC DPFIVE+NPHI+DPDDV+PGLVIKIT
Sbjct  64   GEGETLNTISEKCDDPFIVEQNPHIHDPDDVYPGLVIKIT  103



>ref|XP_004510888.1| PREDICTED: uncharacterized protein LOC101515289 [Cicer arietinum]
Length=118

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 60/101 (59%), Gaps = 1/101 (1%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
               + +  SWYCA  ++ L        T+ +          +    +    + C+EIYVV
Sbjct  15   SKNIADVASWYCAIVLIALILVTIVRDTSMNIIPNHVHNNFMENNHLFSI-KPCDEIYVV  73

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
             EGETL TIS+KC DPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  74   GEGETLHTISDKCDDPFIVENNPHIHDPDDVFPGLVIKITP  114



>gb|KGN46208.1| hypothetical protein Csa_6G074605 [Cucumis sativus]
Length=83

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  407  VVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            VV     R C++IYVV+EGETL TIS KCGDPFIV+ NPHI D DDVFPGL+I+ITP
Sbjct  17   VVASAESRPCDDIYVVKEGETLHTISAKCGDPFIVDNNPHIQDSDDVFPGLLIQITP  73



>emb|CDP18626.1| unnamed protein product [Coffea canephora]
Length=93

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 59/103 (57%), Gaps = 19/103 (18%)
 Frame = +2

Query  272  PGATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYV  451
            P   + E V WYCA  + L    +    T E                   FE  C+EI+ 
Sbjct  7    PSTALAEIVFWYCALFLALKLVLSCCESTEEE------------------FEP-CDEIHA  47

Query  452  VREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            VREGETL TIS KCGDP+I E+NPHI+DPDDVFP LVIKITPF
Sbjct  48   VREGETLHTISGKCGDPYIFEQNPHIHDPDDVFPELVIKITPF  90



>ref|XP_003592333.1| hypothetical protein MTR_1g101750 [Medicago truncatula]
 gb|AES62584.1| peptidoglycan-binding LysM domain protein [Medicago truncatula]
Length=66

 Score = 91.3 bits (225),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIK-ITP  577
            + C+EIYVV EGETL TISEKCGDPFIVE NPHI+DPDDVFPGLVI+ ITP
Sbjct  7    KACDEIYVVGEGETLNTISEKCGDPFIVERNPHIHDPDDVFPGLVIRIITP  57



>ref|XP_010483929.1| PREDICTED: uncharacterized protein LOC104762355 [Camelina sativa]
Length=103

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +2

Query  434  CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            CEEIYVV EGETL TI +KCGDPFIVE NPHI+DPDDVFPGLV+KI P+ ++
Sbjct  49   CEEIYVVGEGETLHTIGDKCGDPFIVERNPHIHDPDDVFPGLVLKIAPYYFS  100



>ref|XP_002867610.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43869.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=114

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 69/117 (59%), Gaps = 18/117 (15%)
 Frame = +2

Query  248  MLRVVIRWPGATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGG--EQMMMIGRVV---  412
            M+RV +     +    V+ YC   +L+L       G+ ++S  GG  E     GR     
Sbjct  1    MMRVTV-----SRSHTVASYCLVALLILTL----AGSVKNSHGGGRRENFRAAGRGRNCE  51

Query  413  ----VPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKI  571
                    ER CEE+YVV EG+TL +ISEKCGDPFIVE NPHI+DPDDVFPGL+IK+
Sbjct  52   VWRGKQMMERPCEELYVVGEGDTLHSISEKCGDPFIVERNPHIHDPDDVFPGLLIKL  108



>ref|XP_004985957.1| PREDICTED: uncharacterized protein LOC101757701 [Setaria italica]
Length=112

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R CEEIYVV EGETL +IS+KCGDP+I+E+NPH++DPDDVFPGLVIKITP
Sbjct  59   RPCEEIYVVAEGETLHSISDKCGDPYILEQNPHVHDPDDVFPGLVIKITP  108



>ref|XP_006445184.1| hypothetical protein CICLE_v10022873mg [Citrus clementina]
 ref|XP_006490984.1| PREDICTED: uncharacterized protein LOC102618293 [Citrus sinensis]
 gb|ESR58424.1| hypothetical protein CICLE_v10022873mg [Citrus clementina]
 gb|KDO85951.1| hypothetical protein CISIN_1g035523mg [Citrus sinensis]
Length=125

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 4/63 (6%)
 Frame = +2

Query  404  RVVVPPFE--RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKIT-  574
            R+V+  +E  R C+EIYVV EGETL TIS+KCGDPFIVE NPHI+DPDD+FPGLVIKIT 
Sbjct  63   RMVLNKYEYSRPCDEIYVVGEGETLHTISDKCGDPFIVEHNPHIHDPDDLFPGLVIKITA  122

Query  575  -PF  580
             PF
Sbjct  123  PPF  125



>ref|NP_201021.1| peptidoglycan-binding LysM domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAB10177.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAS99656.1| At5g62150 [Arabidopsis thaliana]
 gb|AAT41795.1| At5g62150 [Arabidopsis thaliana]
 gb|AED97570.1| peptidoglycan-binding LysM domain-containing protein [Arabidopsis 
thaliana]
Length=102

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  434  CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            CEEIY+V EGETL TI +KCGDPFIVE NPHI+DPDDVFPGLV+KI PF + 
Sbjct  48   CEEIYIVGEGETLHTIGDKCGDPFIVERNPHIHDPDDVFPGLVLKIAPFYFN  99



>gb|KHN29393.1| hypothetical protein glysoja_005117 [Glycine soja]
Length=64

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 50/62 (81%), Gaps = 3/62 (5%)
 Frame = +2

Query  389  MMMIGRVVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIK  568
            MM    V+  P    C+EIYVV EGETL TIS+KCGDPFIVE+NPHI+DPDDVFPGLV+K
Sbjct  1    MMRSSHVLSKP---SCDEIYVVGEGETLHTISDKCGDPFIVEKNPHIHDPDDVFPGLVLK  57

Query  569  IT  574
            IT
Sbjct  58   IT  59



>ref|XP_010038976.1| PREDICTED: uncharacterized protein LOC104427606 [Eucalyptus grandis]
 gb|KCW48341.1| hypothetical protein EUGRSUZ_K02057 [Eucalyptus grandis]
Length=104

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 64/99 (65%), Gaps = 2/99 (2%)
 Frame = +2

Query  284  MGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREG  463
            M E+    C A ++ L    G   T++S    GE+ +    ++    +  C+EIYVVREG
Sbjct  1    MAERKCSCCLALLVALALLLGYSQTSKSEFVVGEETLANANII--NGDMPCDEIYVVREG  58

Query  464  ETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            ETLQTIS KC DPFI+E NPHI DPDDV+PGLVI ITPF
Sbjct  59   ETLQTISAKCEDPFILENNPHIYDPDDVYPGLVITITPF  97



>ref|XP_006649282.1| PREDICTED: uncharacterized protein LOC102715923 [Oryza brachyantha]
Length=115

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R CEEIYVV EGETL +IS+KCGDP+I+E+NPH++DPDDVFPGLVIKITP
Sbjct  62   RPCEEIYVVAEGETLHSISDKCGDPYILEQNPHVHDPDDVFPGLVIKITP  111



>emb|CDY16794.1| BnaA09g05880D [Brassica napus]
Length=103

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  425  ERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            ++ CEEIY+V EGETL TI +KCGDPFIVE NPHI+DPDDVFPGLV++I PF ++
Sbjct  46   DKPCEEIYIVGEGETLHTIGDKCGDPFIVERNPHIHDPDDVFPGLVLRIAPFYFS  100



>emb|CDX86922.1| BnaC03g51920D [Brassica napus]
Length=102

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  425  ERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIY  586
            E+ CE+IYVV EGETL TI +KCGDPFI E NPHI+DPDDVFPGLVI+I PF +
Sbjct  45   EKTCEDIYVVGEGETLHTIDDKCGDPFIAERNPHIHDPDDVFPGLVIRIAPFYF  98



>ref|XP_002468630.1| hypothetical protein SORBIDRAFT_01g049330 [Sorghum bicolor]
 gb|EER95628.1| hypothetical protein SORBIDRAFT_01g049330 [Sorghum bicolor]
Length=116

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R CEEIYVV EGETL +IS++CGDPFI+E NPH++DPDDVFPGLVI+ITP
Sbjct  63   RPCEEIYVVAEGETLHSISDRCGDPFILERNPHVHDPDDVFPGLVIRITP  112



>ref|XP_010106808.1| hypothetical protein L484_005354 [Morus notabilis]
 gb|EXC11893.1| hypothetical protein L484_005354 [Morus notabilis]
Length=117

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  422  FERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
             +R C+EIY+V EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  63   LDRPCDEIYIVGEGETLHTISDKCGDPFIVERNPHIHDPDDVFPGLVIKITP  114



>ref|XP_009389568.1| PREDICTED: uncharacterized protein LOC103976101 [Musa acuminata 
subsp. malaccensis]
Length=110

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = +2

Query  401  GRVVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            GR+V     R C+EIYVV EGETL TIS+KC DPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  52   GRLVA----RPCDEIYVVGEGETLHTISDKCRDPFIVERNPHIHDPDDVFPGLVIKITP  106



>gb|KEH18988.1| peptidoglycan-binding LysM domain protein [Medicago truncatula]
Length=116

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 60/101 (59%), Gaps = 3/101 (3%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
               + +  SWYCA  +  L        +     D    ++     ++    + C+EIYVV
Sbjct  14   SKAIADAASWYCAILLAELILLTIFRDSYMIPNDHDYNIIESNHFLL---SKPCDEIYVV  70

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
             EGETL TIS+KC DPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  71   GEGETLNTISDKCNDPFIVENNPHIHDPDDVFPGLVIKITP  111



>ref|XP_010555323.1| PREDICTED: uncharacterized protein LOC104824847 [Tarenaya hassleriana]
Length=103

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  425  ERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            +R CEEIY+V EGETL TI EKCGDPFIVE NPHI+DPDDVFPGL++ I PF  T
Sbjct  45   DRPCEEIYIVGEGETLHTIGEKCGDPFIVERNPHIHDPDDVFPGLILNIIPFYPT  99



>ref|NP_001065106.1| Os10g0524300 [Oryza sativa Japonica Group]
 gb|AAO00717.2| expressed protein [Oryza sativa Japonica Group]
 gb|ABB47912.1| LysM domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27020.1| Os10g0524300 [Oryza sativa Japonica Group]
 dbj|BAG88607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=108

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R CEEIYVV EGETL +IS++CGDP+I+E+NPH++DPDDVFPGLVIKITP
Sbjct  53   RPCEEIYVVEEGETLHSISDRCGDPYILEQNPHVHDPDDVFPGLVIKITP  102



>ref|XP_006413305.1| hypothetical protein EUTSA_v10027278mg [Eutrema salsugineum]
 gb|ESQ54758.1| hypothetical protein EUTSA_v10027278mg [Eutrema salsugineum]
Length=119

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +2

Query  341  AGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEEN  520
             GG     ++AD  +  +  G+   P  ER CEE+YVV EGETL +IS+KCGDPFIVE N
Sbjct  36   GGGGENFPAAADKRDGEVRRGK---PMMERPCEELYVVSEGETLHSISDKCGDPFIVERN  92

Query  521  PHINDPDDVFPGLVIKI  571
            PHI+DPDDVFPGL+I+I
Sbjct  93   PHIHDPDDVFPGLLIRI  109



>tpg|DAA42960.1| TPA: lysM domain containing protein [Zea mays]
Length=112

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R CEEIYVV EGETL +IS+KCGDP I+E NPH++DPDDVFPGLVI+ITP
Sbjct  59   RPCEEIYVVAEGETLHSISDKCGDPLILERNPHVHDPDDVFPGLVIRITP  108



>ref|XP_010234929.1| PREDICTED: uncharacterized protein LOC100821016 [Brachypodium 
distachyon]
Length=116

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 64/106 (60%), Gaps = 11/106 (10%)
 Frame = +2

Query  290  EKVSWYCAATVLLLWCFA----GGWGTTESSADGGEQMMMIGRVVV--PPFERR--CEEI  445
             + +   AA     WCFA         +   A  GE+    G VVV  P  + R  CEEI
Sbjct  7    RRRTGLVAAADAASWCFALSVVALLLVSSLGAGAGEER---GAVVVRGPRLQSRGPCEEI  63

Query  446  YVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFI  583
            YVV EGETL  IS++CGDP+I+E NPH++DPDDVFPGLVI ITP +
Sbjct  64   YVVGEGETLHGISDRCGDPYILEHNPHVHDPDDVFPGLVINITPRL  109



>gb|AAO15285.1| Putative dihydrodipicolinate reductase-like protein [Oryza sativa 
Japonica Group]
Length=463

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 55/71 (77%), Gaps = 2/71 (3%)
 Frame = +2

Query  371  ADGGEQMMMIGRVV--VPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDD  544
            A GGEQ   +  V+       R CEEIYVV EGETL +IS+KCGDP+I+E+NPH++DPDD
Sbjct  48   AAGGEQRGGVAAVLRGAALSARACEEIYVVAEGETLHSISDKCGDPYILEQNPHVHDPDD  107

Query  545  VFPGLVIKITP  577
            VFPGLVIKITP
Sbjct  108  VFPGLVIKITP  118



>ref|XP_004983868.1| PREDICTED: uncharacterized protein LOC101767984 [Setaria italica]
Length=111

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 61/97 (63%), Gaps = 10/97 (10%)
 Frame = +2

Query  290  EKVSWYCA-ATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGE  466
            E  SW C  A VLL+    G     E     G  ++   R+   P    CEE+YVV EGE
Sbjct  13   EVASWCCVLALVLLVGSLVG-----EEERGVGPAVVRGARLAARP----CEELYVVAEGE  63

Query  467  TLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            TL +IS +CGDP+I+E NPH++DPDDVFPGLVI+ITP
Sbjct  64   TLHSISARCGDPYILERNPHVHDPDDVFPGLVIRITP  100



>ref|XP_004510887.1| PREDICTED: uncharacterized protein LOC101514967 [Cicer arietinum]
Length=118

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 60/101 (59%), Gaps = 1/101 (1%)
 Frame = +2

Query  275  GATMGEKVSWYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVV  454
               + + VSW CA  ++ L        T+ +          +    +    + C+EIYVV
Sbjct  15   SKNIADVVSWCCAIVLIALILVTIFRDTSMNIIPNHVHNNFMENNHLFSI-KPCDEIYVV  73

Query  455  REGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
             EGETL TIS+KC DPFIVE NPHI+DPDDVFPGLVIKITP
Sbjct  74   GEGETLHTISDKCDDPFIVENNPHIHDPDDVFPGLVIKITP  114



>gb|EAY79264.1| hypothetical protein OsI_34380 [Oryza sativa Indica Group]
 gb|EAZ16736.1| hypothetical protein OsJ_32213 [Oryza sativa Japonica Group]
Length=106

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R CEEIYVV EGETL +IS++CGDP+I+E+NPH++DPDDVFPGLVIKITP
Sbjct  51   RPCEEIYVVEEGETLHSISDRCGDPYILEQNPHVHDPDDVFPGLVIKITP  100



>gb|KFK27946.1| hypothetical protein AALP_AA8G451800 [Arabis alpina]
Length=101

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  425  ERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            ++ CEEIYVV EGETL TI  KCGDPFIVE NPHI+DPDDVFPGLV+KI P+
Sbjct  47   QKPCEEIYVVGEGETLHTIGNKCGDPFIVERNPHIHDPDDVFPGLVLKIVPY  98



>ref|XP_009386807.1| PREDICTED: uncharacterized protein LOC103973863 [Musa acuminata 
subsp. malaccensis]
Length=99

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +2

Query  425  ERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            ++ C+EIYVVR+GETLQTISEKC DP+I+EENPHI D DDV+PGLV+KITPF
Sbjct  44   DQPCDEIYVVRDGETLQTISEKCDDPYILEENPHIQDFDDVYPGLVLKITPF  95



>ref|XP_010433639.1| PREDICTED: uncharacterized protein LOC104717722 [Camelina sativa]
Length=111

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 10/64 (16%)
 Frame = +2

Query  380  GEQMMMIGRVVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGL  559
            G+QMM          ER CEE+Y+V EGETL +ISEKCGDPFIVE NPHI+DPDDVFPGL
Sbjct  52   GKQMM----------ERPCEELYIVGEGETLHSISEKCGDPFIVERNPHIHDPDDVFPGL  101

Query  560  VIKI  571
            +IK+
Sbjct  102  LIKL  105



>ref|XP_010448436.1| PREDICTED: uncharacterized protein LOC104730895 [Camelina sativa]
Length=111

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 10/64 (16%)
 Frame = +2

Query  380  GEQMMMIGRVVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGL  559
            G+QMM          ER CEE+Y+V EGETL +ISEKCGDPFIVE NPHI+DPDDVFPGL
Sbjct  52   GKQMM----------ERPCEELYIVGEGETLHSISEKCGDPFIVERNPHIHDPDDVFPGL  101

Query  560  VIKI  571
            +IK+
Sbjct  102  LIKL  105



>ref|XP_009139230.1| PREDICTED: uncharacterized protein LOC103863220 [Brassica rapa]
Length=149

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 10/64 (16%)
 Frame = +2

Query  380  GEQMMMIGRVVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGL  559
            G+QMM          ER CEEIY+V EGETL +IS+KCGDPFIVE NPHI+DPDDVFPGL
Sbjct  89   GKQMM----------ERPCEEIYMVEEGETLHSISDKCGDPFIVERNPHIHDPDDVFPGL  138

Query  560  VIKI  571
            +IKI
Sbjct  139  LIKI  142



>emb|CDY57704.1| BnaC01g41610D [Brassica napus]
Length=149

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 10/64 (16%)
 Frame = +2

Query  380  GEQMMMIGRVVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGL  559
            G+QMM          ER CEEIY+V EGETL +IS+KCGDPFIVE NPHI+DPDDVFPGL
Sbjct  89   GKQMM----------ERPCEEIYMVEEGETLHSISDKCGDPFIVERNPHIHDPDDVFPGL  138

Query  560  VIKI  571
            +IKI
Sbjct  139  LIKI  142



>ref|XP_006662531.1| PREDICTED: uncharacterized protein LOC102721488 [Oryza brachyantha]
Length=105

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R CEEIYVV EGETL +IS+KCGDP+I+E+NPH++DPDDVFPGLVI+ITP
Sbjct  50   RPCEEIYVVGEGETLHSISDKCGDPYILEQNPHVHDPDDVFPGLVIRITP  99



>ref|XP_006284786.1| hypothetical protein CARUB_v10006055mg [Capsella rubella]
 gb|EOA17684.1| hypothetical protein CARUB_v10006055mg [Capsella rubella]
Length=116

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 10/64 (16%)
 Frame = +2

Query  380  GEQMMMIGRVVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGL  559
            G+QMM          ER CEE+YVV EG+TL +ISEKCGDPFIVE NPHI+DPDDVFPGL
Sbjct  57   GKQMM----------ERPCEELYVVGEGDTLHSISEKCGDPFIVERNPHIHDPDDVFPGL  106

Query  560  VIKI  571
            +IK+
Sbjct  107  LIKL  110



>emb|CDY55718.1| BnaA01g35190D [Brassica napus]
Length=142

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 10/64 (16%)
 Frame = +2

Query  380  GEQMMMIGRVVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGL  559
            G+QMM          ER CEEIY+V EGETL +IS+KCGDPFIVE NPHI+DPDDVFPGL
Sbjct  82   GKQMM----------ERPCEEIYMVEEGETLHSISDKCGDPFIVERNPHIHDPDDVFPGL  131

Query  560  VIKI  571
            +I+I
Sbjct  132  LIRI  135



>ref|XP_010438883.1| PREDICTED: uncharacterized protein LOC104722427 [Camelina sativa]
Length=111

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 10/64 (16%)
 Frame = +2

Query  380  GEQMMMIGRVVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGL  559
            G+QMM          ER CEE+Y+V EGETL +ISEKCGDPFIVE NPHI+DPDDVFPGL
Sbjct  52   GKQMM----------ERPCEELYIVGEGETLHSISEKCGDPFIVERNPHIHDPDDVFPGL  101

Query  560  VIKI  571
            +IK+
Sbjct  102  LIKL  105



>gb|EPS65528.1| hypothetical protein M569_09250, partial [Genlisea aurea]
Length=57

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
            R C+EIYVV  GETLQTI EKCGDPF+VE NPHINDPDDVFPGLVI+I  +
Sbjct  6    RGCDEIYVVGVGETLQTIGEKCGDPFVVERNPHINDPDDVFPGLVIRIAKY  56



>ref|NP_001168445.1| uncharacterized protein LOC100382217 [Zea mays]
 gb|ACN28256.1| unknown [Zea mays]
 gb|AFW59143.1| hypothetical protein ZEAMMB73_281794 [Zea mays]
Length=130

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  419  PFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            P  R CEE+YVV EGETL +IS++CGDPFIVE NPHI+DPDDVFPGLVI + P   T
Sbjct  74   PAARPCEEVYVVGEGETLHSISDRCGDPFIVERNPHIHDPDDVFPGLVIALCPTRNT  130



>dbj|BAK05584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=156

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  362  ESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPD  541
            +   +GG      G  +     R C+E+YVV EGETL TIS+KCGDPFIVE NPH++DPD
Sbjct  81   DDDGEGGAAAYFRGPRLGGAAARPCDEVYVVGEGETLHTISDKCGDPFIVERNPHVHDPD  140

Query  542  DVFPGLVIKITPFIYT  589
            DVFPGLVI + P   T
Sbjct  141  DVFPGLVIALRPTKNT  156



>emb|CAD41658.3| OSJNBa0019K04.5 [Oryza sativa Japonica Group]
 emb|CAH66956.1| OSIGBa0147H17.4 [Oryza sativa Indica Group]
 gb|EAZ31697.1| hypothetical protein OsJ_15845 [Oryza sativa Japonica Group]
Length=119

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R CEE+YVV EGETL TIS+KCGDPFIVE NPHI+DPDDVFPGLVI + P
Sbjct  65   RPCEEVYVVGEGETLHTISDKCGDPFIVERNPHIHDPDDVFPGLVIALRP  114



>ref|XP_004976547.1| PREDICTED: uncharacterized protein LOC101779547 [Setaria italica]
Length=127

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R CEE+YVV +GETL +IS+KCGDPFIVE NPHI+DPDDVFPGLVI ++P
Sbjct  74   RPCEEVYVVGDGETLHSISDKCGDPFIVERNPHIHDPDDVFPGLVIALSP  123



>ref|NP_001150468.1| lysM domain containing protein [Zea mays]
 gb|ACG39202.1| lysM domain containing protein [Zea mays]
Length=113

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R CEEIYVV EGETL +IS+KCGDP I+E NPH++D DDVFPGLVI+ITP
Sbjct  60   RPCEEIYVVAEGETLHSISDKCGDPLILERNPHVHDXDDVFPGLVIRITP  109



>gb|EMT21183.1| hypothetical protein F775_42636 [Aegilops tauschii]
Length=80

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            R CEE+YVV EGETL  IS++CGDP+I+E NPH++DPDDVFPGLV++ITP
Sbjct  20   RPCEEMYVVAEGETLHGISDRCGDPYILERNPHVHDPDDVFPGLVLRITP  69



>dbj|BAK03655.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=120

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  425  ERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
             R C+EIYVV E ETL +IS++CGDP+I+E NPH++DPDDVFPGLVIKITP
Sbjct  62   RRPCDEIYVVAEEETLHSISDRCGDPYILEHNPHVHDPDDVFPGLVIKITP  112



>ref|XP_003581545.1| PREDICTED: uncharacterized protein LOC100838759 [Brachypodium 
distachyon]
Length=208

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +2

Query  302  WYCAATVLLLWCFAGGWGTTESSADGGEQMMMIGRVVVPPFERRCEEIYVVREGETLQTI  481
            W+CA  ++ L          ++ ADGGE +   G  +     R CEE+YVV EGETL +I
Sbjct  114  WWCAVALVALVLLGALRADYDADADGGEAVYFRGARLGG-GRRPCEEVYVVGEGETLHSI  172

Query  482  SEKCGDPFIVEENPHINDPDDVFPGLVIKITPFIYT  589
            S+KCGDPFIVE NPH++DPDDVFPGLV+ + P   T
Sbjct  173  SDKCGDPFIVERNPHVHDPDDVFPGLVLALRPTKNT  208



>emb|CDP05257.1| unnamed protein product [Coffea canephora]
Length=100

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  422  FERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
              R C+EIYVV EGETL TIS KCGD FI+E NPHI DPDDVFPGLV+ I P
Sbjct  49   INRPCDEIYVVGEGETLHTISVKCGDAFILERNPHIYDPDDVFPGLVLNILP  100



>dbj|BAJ90904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=124

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKIT  574
            R CEEIYVV EGETL  IS++CGDP+I+E NPH++DPDDVFPGLV++IT
Sbjct  61   RPCEEIYVVAEGETLHGISDRCGDPYILERNPHVHDPDDVFPGLVLRIT  109



>ref|XP_006341799.1| PREDICTED: uncharacterized protein LOC102605700 [Solanum tuberosum]
Length=101

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  434  CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKIT  574
            C+EIY+V EGETLQTISEKCGD FI+ EN HIND DD++PGLV+KIT
Sbjct  53   CDEIYIVGEGETLQTISEKCGDLFILVENTHINDDDDIYPGLVLKIT  99



>gb|ABR16814.1| unknown [Picea sitchensis]
Length=97

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  407  VVVPPFERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
             +V    R CEEIY+V EGETLQTISEKC  PFI+ +NPHI D DD++ GL +KIT  
Sbjct  37   TIVNRHNRPCEEIYIVGEGETLQTISEKCNAPFILFDNPHIQDTDDIYEGLPLKITSL  94



>gb|ABK20943.1| unknown [Picea sitchensis]
Length=89

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  425  ERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKIT  574
            E +CEEIY+V EGETLQTISEKC  PFI+ +NPHI D DD++ G+ +KIT
Sbjct  37   EYQCEEIYIVGEGETLQTISEKCNAPFILFDNPHIQDTDDIYEGVPLKIT  86



>gb|KHN31547.1| hypothetical protein glysoja_029682 [Glycine soja]
Length=122

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  422  FERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
             E  C+E Y VR+GETL +I+EKC DP I   NPH+ DPDDV+PG+++++ P
Sbjct  69   LEEPCKEFYEVRQGETLYSIAEKCRDPHIWLWNPHVEDPDDVYPGVIVRLKP  120



>gb|EYU19508.1| hypothetical protein MIMGU_mgv1a016454mg [Erythranthe guttata]
Length=121

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -1

Query  579  KGVILITKPGKTSSGSLM*GFSSTMKGSPHFSLIVCNVSPSRTT*ISSH  433
            +G IL+T+PGKTSSGS + GF STM GSPHFSLIV +VSPS TT ISSH
Sbjct  25   RGTILMTRPGKTSSGSCICGFLSTMYGSPHFSLIVLSVSPSPTTYISSH  73



>ref|XP_006588249.1| PREDICTED: uncharacterized protein LOC102662787 [Glycine max]
 gb|KHN23064.1| hypothetical protein glysoja_038889 [Glycine soja]
Length=121

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  422  FERRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITPF  580
             E  C E Y VREGETL +I+EKC DP I   NPH+ DPDDV+PG+++++  F
Sbjct  67   LEEPCSEFYEVREGETLYSIAEKCRDPQIWLWNPHVEDPDDVYPGVIVRLNLF  119



>ref|XP_003613571.1| hypothetical protein MTR_5g038200 [Medicago truncatula]
 gb|AES96529.1| carbohydrate-binding module family 50 protein [Medicago truncatula]
Length=74

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  428  RRCEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDV  547
            + C+E YVVREG+T  +I+EKC DPFI+  NPH+ DP D+
Sbjct  35   KECDEFYVVREGDTFYSIAEKCNDPFILLSNPHVRDPQDI  74



>ref|XP_001762542.1| predicted protein [Physcomitrella patens]
 gb|EDQ72665.1| predicted protein [Physcomitrella patens]
Length=59

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  434  CEEIYVVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKI  571
            C   YVVR GE+LQ ISEKC D FI+E NPHI D DD+F G ++K+
Sbjct  10   CGPTYVVRGGESLQMISEKCNDQFILENNPHIVDHDDLFEGQLLKM  55



>gb|KCW90769.1| hypothetical protein EUGRSUZ_A02840 [Eucalyptus grandis]
Length=101

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  564  ITKPGKTSSGSLM*GFSSTMKGSPHFSLIVCNVSPSRTT*ISSH  433
            +T+PGKTSSGS + GF STM GSPH SLIV +VSPSRTT ISS 
Sbjct  1    MTRPGKTSSGSWICGFRSTMNGSPHLSLIVWSVSPSRTTYISSQ  44



>ref|XP_003622859.1| Cell division cycle protein-like protein [Medicago truncatula]
 gb|AES79077.1| transducin family protein/WD-40 repeat protein [Medicago truncatula]
Length=496

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  470  LQTISEKCGDPFIVEENPHINDPDDVFPGLVIK  568
            L T S+KC  PFIV+ NPHI+DPDDVFPGLVI 
Sbjct  461  LSTNSDKCDGPFIVKNNPHIHDPDDVFPGLVIN  493



>ref|XP_003589420.1| LysM domain containing protein [Medicago truncatula]
 ref|XP_003606807.1| LysM domain containing protein [Medicago truncatula]
 gb|KEH26223.1| transmembrane protein, putative [Medicago truncatula]
Length=72

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  449  VVREGETLQTISEKCGDPFIVEENPHINDPDDVFPGLVIKITP  577
            +V+EGET  +I+EKC D  I+  NP+++D +D+ PG++++I P
Sbjct  28   MVKEGETYYSIAEKCDDQSILFSNPNVHDSEDIVPGVILRINP  70



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1389194222792