BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17344_g2_i1 len=578 path=[556:0-577]

Length=578
                                                                      Score     E

emb|CAN67205.1|  hypothetical protein VITISV_037214                     229   4e-72   Vitis vinifera
ref|XP_009794727.1|  PREDICTED: polygalacturonase-1 non-catalytic...    240   5e-72   
gb|KDO82432.1|  hypothetical protein CISIN_1g044596mg                   239   2e-71   
ref|XP_009794726.1|  PREDICTED: polygalacturonase-1 non-catalytic...    238   3e-71   
ref|XP_006483847.1|  PREDICTED: probable polygalacturonase non-ca...    239   3e-71   
ref|XP_006438392.1|  hypothetical protein CICLE_v10030930mg             239   3e-71   
emb|CAN66340.1|  hypothetical protein VITISV_018557                     226   6e-71   Vitis vinifera
gb|KDP26581.1|  hypothetical protein JCGZ_17739                         237   1e-70   
gb|KDO82433.1|  hypothetical protein CISIN_1g036311mg                   237   1e-70   
ref|XP_009596020.1|  PREDICTED: polygalacturonase-1 non-catalytic...    237   1e-70   
ref|XP_006365226.1|  PREDICTED: polygalacturonase-1 non-catalytic...    236   3e-70   
ref|XP_010551569.1|  PREDICTED: probable polygalacturonase non-ca...    236   3e-70   
gb|KDP26582.1|  hypothetical protein JCGZ_17740                         235   4e-70   
ref|XP_010520580.1|  PREDICTED: probable polygalacturonase non-ca...    235   4e-70   
ref|XP_009596009.1|  PREDICTED: polygalacturonase-1 non-catalytic...    235   5e-70   
gb|AHC69823.1|  polygalacturonase isoenzyme 1 beta subunit              235   5e-70   
ref|XP_002266341.1|  PREDICTED: probable polygalacturonase non-ca...    235   5e-70   Vitis vinifera
ref|XP_006438394.1|  hypothetical protein CICLE_v10030947mg             235   5e-70   
ref|XP_010023570.1|  PREDICTED: probable polygalacturonase non-ca...    235   7e-70   
gb|KCW59875.1|  hypothetical protein EUGRSUZ_H02608                     234   7e-70   
ref|XP_007044636.1|  Polygalacturonase 2                                235   1e-69   
gb|KHG24447.1|  Polygalacturonase non-catalytic subunit protein         234   2e-69   
ref|XP_010100469.1|  hypothetical protein L484_027781                   233   2e-69   
ref|XP_008389645.1|  PREDICTED: probable polygalacturonase non-ca...    233   2e-69   
gb|KHN27021.1|  Putative polygalacturonase non-catalytic subunit        225   4e-69   
ref|XP_008221810.1|  PREDICTED: probable polygalacturonase non-ca...    233   5e-69   
ref|XP_002266815.1|  PREDICTED: probable polygalacturonase non-ca...    232   6e-69   Vitis vinifera
ref|XP_009363553.1|  PREDICTED: probable polygalacturonase non-ca...    233   6e-69   
ref|XP_011086565.1|  PREDICTED: polygalacturonase-1 non-catalytic...    233   6e-69   
ref|XP_009363551.1|  PREDICTED: probable polygalacturonase non-ca...    233   7e-69   
ref|XP_008340027.1|  PREDICTED: probable polygalacturonase non-ca...    232   1e-68   
ref|XP_010477679.1|  PREDICTED: probable polygalacturonase non-ca...    231   1e-68   
ref|XP_010242994.1|  PREDICTED: probable polygalacturonase non-ca...    231   2e-68   
ref|XP_002525383.1|  Polygalacturonase-1 non-catalytic subunit be...    231   3e-68   Ricinus communis
ref|XP_006484316.1|  PREDICTED: probable polygalacturonase non-ca...    230   4e-68   
ref|XP_007223063.1|  hypothetical protein PRUPE_ppa003712mg             229   4e-68   
ref|XP_004298578.1|  PREDICTED: probable polygalacturonase non-ca...    230   4e-68   
ref|XP_006365227.1|  PREDICTED: polygalacturonase-1 non-catalytic...    230   4e-68   
ref|XP_010555103.1|  PREDICTED: probable polygalacturonase non-ca...    229   5e-68   
ref|XP_003552018.1|  PREDICTED: probable polygalacturonase non-ca...    230   5e-68   
gb|KCW86731.1|  hypothetical protein EUGRSUZ_B03343                     229   6e-68   
gb|KDO38689.1|  hypothetical protein CISIN_1g045773mg                   221   7e-68   
ref|XP_002890594.1|  hypothetical protein ARALYDRAFT_472637             229   7e-68   
ref|XP_010044636.1|  PREDICTED: polygalacturonase-1 non-catalytic...    229   8e-68   
ref|XP_002311777.2|  hypothetical protein POPTR_0008s19430g             229   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_004238668.1|  PREDICTED: polygalacturonase non-catalytic s...    228   2e-67   
ref|XP_010682558.1|  PREDICTED: probable polygalacturonase non-ca...    229   2e-67   
ref|XP_006365229.1|  PREDICTED: polygalacturonase non-catalytic s...    228   3e-67   
ref|NP_001234835.1|  polygalacturonase-1 non-catalytic subunit be...    227   5e-67   
ref|XP_004142981.1|  PREDICTED: probable polygalacturonase non-ca...    227   5e-67   
ref|XP_006365228.1|  PREDICTED: polygalacturonase non-catalytic s...    227   5e-67   
ref|XP_004173618.1|  PREDICTED: probable polygalacturonase non-ca...    227   5e-67   
ref|XP_003613234.1|  Polygalacturonase-1 non-catalytic subunit beta     227   8e-67   
ref|XP_008221868.1|  PREDICTED: probable polygalacturonase non-ca...    226   9e-67   
ref|XP_010498883.1|  PREDICTED: probable polygalacturonase non-ca...    227   9e-67   
ref|XP_006438393.1|  hypothetical protein CICLE_v10033917mg             226   9e-67   
ref|XP_004238667.1|  PREDICTED: polygalacturonase non-catalytic s...    226   1e-66   
ref|XP_007224206.1|  hypothetical protein PRUPE_ppa017408mg             226   1e-66   
ref|XP_011071083.1|  PREDICTED: polygalacturonase-1 non-catalytic...    226   1e-66   
ref|XP_008444317.1|  PREDICTED: probable polygalacturonase non-ca...    226   1e-66   
ref|XP_004238669.1|  PREDICTED: polygalacturonase-1 non-catalytic...    226   2e-66   
ref|XP_003532010.1|  PREDICTED: probable polygalacturonase non-ca...    226   2e-66   
gb|KHN00353.1|  Polygalacturonase-1 non-catalytic subunit beta          221   3e-66   
ref|XP_010460151.1|  PREDICTED: probable polygalacturonase non-ca...    225   3e-66   
gb|KDO69699.1|  hypothetical protein CISIN_1g0378481mg                  211   4e-66   
ref|XP_011009539.1|  PREDICTED: probable polygalacturonase non-ca...    225   4e-66   
ref|XP_004514684.1|  PREDICTED: polygalacturonase-1 non-catalytic...    225   4e-66   
gb|KEH20007.1|  polygalacturonase non-catalytic protein                 224   6e-66   
ref|XP_011044316.1|  PREDICTED: probable polygalacturonase non-ca...    224   6e-66   
ref|XP_006365231.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    224   7e-66   
ref|XP_003519820.2|  PREDICTED: probable polygalacturonase non-ca...    224   7e-66   
ref|XP_007036187.1|  Polygalacturonase 2, putative                      224   8e-66   
gb|KHG01313.1|  Polygalacturonase non-catalytic subunit protein         224   8e-66   
ref|XP_007141610.1|  hypothetical protein PHAVU_008G210500g             223   9e-66   
ref|XP_007153633.1|  hypothetical protein PHAVU_003G052000g             224   1e-65   
ref|XP_011034135.1|  PREDICTED: probable polygalacturonase non-ca...    224   1e-65   
ref|NP_173788.1|  putative polygalacturonase non-catalytic subuni...    223   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002314620.2|  hypothetical protein POPTR_0010s05000g             223   2e-65   Populus trichocarpa [western balsam poplar]
dbj|BAE99852.1|  putative polygalacuronase isoenzyme 1 beta subunit     223   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007157462.1|  hypothetical protein PHAVU_002G071500g             223   2e-65   
ref|XP_010427809.1|  PREDICTED: probable polygalacturonase non-ca...    223   2e-65   
gb|AAB39538.1|  aromatic rich glycoprotein JP630                        223   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010101197.1|  hypothetical protein L484_015001                   223   2e-65   
ref|XP_006476763.1|  PREDICTED: probable polygalacturonase non-ca...    222   4e-65   
ref|XP_004509821.1|  PREDICTED: probable polygalacturonase non-ca...    222   5e-65   
gb|EPS67761.1|  polygalacturonase-1 non-catalytic subunit beta          221   6e-65   
gb|EYU22487.1|  hypothetical protein MIMGU_mgv1a002927mg                221   8e-65   
gb|EYU31262.1|  hypothetical protein MIMGU_mgv1a002697mg                222   8e-65   
gb|KHG12475.1|  Polygalacturonase non-catalytic subunit protein         222   8e-65   
ref|XP_010471032.1|  PREDICTED: probable polygalacturonase non-ca...    221   9e-65   
ref|XP_010471031.1|  PREDICTED: probable polygalacturonase non-ca...    221   9e-65   
ref|XP_003517743.1|  PREDICTED: probable polygalacturonase non-ca...    221   1e-64   
ref|XP_006303930.1|  hypothetical protein CARUB_v10008588mg             221   1e-64   
ref|XP_002318036.2|  hypothetical protein POPTR_0012s08060g             221   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_010415713.1|  PREDICTED: probable polygalacturonase non-ca...    221   1e-64   
ref|XP_004509826.1|  PREDICTED: probable polygalacturonase non-ca...    221   2e-64   
ref|XP_010251282.1|  PREDICTED: probable polygalacturonase non-ca...    220   2e-64   
ref|XP_006390895.1|  hypothetical protein EUTSA_v10018277mg             219   4e-64   
ref|XP_009105700.1|  PREDICTED: probable polygalacturonase non-ca...    219   4e-64   
ref|XP_009775426.1|  PREDICTED: probable polygalacturonase non-ca...    219   4e-64   
ref|XP_006365230.1|  PREDICTED: polygalacturonase-1 non-catalytic...    219   5e-64   
ref|XP_006439797.1|  hypothetical protein CICLE_v10019363mg             218   1e-63   
ref|XP_009593470.1|  PREDICTED: probable polygalacturonase non-ca...    218   1e-63   
emb|CDP00165.1|  unnamed protein product                                218   1e-63   
ref|XP_002888771.1|  hypothetical protein ARALYDRAFT_894840             218   1e-63   
ref|XP_006300881.1|  hypothetical protein CARUB_v10019971mg             218   1e-63   
ref|XP_006300871.1|  hypothetical protein CARUB_v10019963mg             218   1e-63   
gb|KEH20006.1|  polygalacturonase non-catalytic protein                 218   2e-63   
ref|XP_003610589.1|  Polygalacturonase-1 non-catalytic subunit beta     206   2e-63   
emb|CDP12374.1|  unnamed protein product                                218   2e-63   
emb|CDY57845.1|  BnaA07g38770D                                          218   2e-63   
emb|CCD74525.1|  polygalacturonase 1                                    217   3e-63   
ref|XP_008346742.1|  PREDICTED: probable polygalacturonase non-ca...    217   3e-63   
gb|AAB39546.1|  polygalacturonase isoenzyme 1 beta subunit homolog      217   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177194.1|  polygalacturonase 2                                   217   4e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008374449.1|  PREDICTED: probable polygalacturonase non-ca...    217   5e-63   
ref|XP_004138283.1|  PREDICTED: probable polygalacturonase non-ca...    217   6e-63   
ref|NP_176242.1|  polygalacturonase 1                                   216   8e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008239752.1|  PREDICTED: probable polygalacturonase non-ca...    216   8e-63   
ref|XP_010553600.1|  PREDICTED: probable polygalacturonase non-ca...    216   1e-62   
ref|XP_004166494.1|  PREDICTED: probable polygalacturonase non-ca...    216   1e-62   
ref|XP_010510953.1|  PREDICTED: probable polygalacturonase non-ca...    215   1e-62   
ref|XP_008453099.1|  PREDICTED: probable polygalacturonase non-ca...    216   1e-62   
gb|KFK41456.1|  hypothetical protein AALP_AA2G132700                    215   2e-62   
emb|CDY23501.1|  BnaC06g24700D                                          215   2e-62   
ref|XP_011071835.1|  PREDICTED: probable polygalacturonase non-ca...    215   2e-62   
ref|XP_004501939.1|  PREDICTED: probable polygalacturonase non-ca...    214   3e-62   
ref|XP_010473218.1|  PREDICTED: probable polygalacturonase non-ca...    214   3e-62   
emb|CBI15046.3|  unnamed protein product                                214   4e-62   
ref|XP_002279813.2|  PREDICTED: probable polygalacturonase non-ca...    214   6e-62   Vitis vinifera
ref|XP_007210277.1|  hypothetical protein PRUPE_ppa003003mg             213   6e-62   
ref|XP_002525381.1|  Polygalacturonase non-catalytic subunit AroG...    212   7e-62   Ricinus communis
ref|XP_010417970.1|  PREDICTED: probable polygalacturonase non-ca...    213   7e-62   
ref|XP_008800877.1|  PREDICTED: BURP domain-containing protein 12...    213   1e-61   
ref|XP_010678748.1|  PREDICTED: probable polygalacturonase non-ca...    213   1e-61   
gb|KEH20005.1|  polygalacturonase non-catalytic protein                 207   1e-61   
ref|XP_008776735.1|  PREDICTED: BURP domain-containing protein 12...    213   2e-61   
ref|XP_006345047.1|  PREDICTED: probable polygalacturonase non-ca...    213   2e-61   
ref|XP_004236111.1|  PREDICTED: probable polygalacturonase non-ca...    212   2e-61   
ref|XP_003601289.1|  Polygalacturonase-1 non-catalytic subunit beta     212   3e-61   
ref|XP_003528153.1|  PREDICTED: polygalacturonase-1 non-catalytic...    211   5e-61   
ref|XP_010924225.1|  PREDICTED: BURP domain-containing protein 12...    211   5e-61   
gb|EPS60630.1|  polygalacturonase-1 non-catalytic subunit beta          210   6e-61   
ref|XP_010925453.1|  PREDICTED: BURP domain-containing protein 12...    211   1e-60   
ref|XP_009393062.1|  PREDICTED: BURP domain-containing protein 12...    209   3e-60   
ref|XP_004300895.1|  PREDICTED: probable polygalacturonase non-ca...    209   4e-60   
ref|XP_002886622.1|  hypothetical protein ARALYDRAFT_475291             208   5e-60   
gb|KDP31113.1|  hypothetical protein JCGZ_11489                         208   7e-60   
ref|XP_009394250.1|  PREDICTED: BURP domain-containing protein 12...    208   8e-60   
ref|XP_002511417.1|  Polygalacturonase-1 non-catalytic subunit be...    208   9e-60   Ricinus communis
ref|XP_006578624.1|  PREDICTED: polygalacturonase-1 non-catalytic...    207   1e-59   
emb|CDP00166.1|  unnamed protein product                                206   2e-59   
ref|XP_010936822.1|  PREDICTED: BURP domain-containing protein 12...    206   4e-59   
ref|XP_007138090.1|  hypothetical protein PHAVU_009G179500g             206   4e-59   
ref|XP_010028282.1|  PREDICTED: probable polygalacturonase non-ca...    206   7e-59   
gb|KCW86720.1|  hypothetical protein EUGRSUZ_B03328                     194   2e-58   
gb|KHN30893.1|  Polygalacturonase-1 non-catalytic subunit beta          202   2e-58   
gb|KFK44451.1|  hypothetical protein AALP_AA1G258600                    202   7e-58   
emb|CDY53059.1|  BnaA09g14240D                                          202   1e-57   
gb|KCW86729.1|  hypothetical protein EUGRSUZ_B03340                     192   3e-57   
ref|XP_010046642.1|  PREDICTED: polygalacturonase non-catalytic s...    195   5e-57   
ref|XP_006392169.1|  hypothetical protein EUTSA_v10023352mg             200   5e-57   
ref|XP_009113216.1|  PREDICTED: probable polygalacturonase non-ca...    200   9e-57   
ref|XP_010044627.1|  PREDICTED: polygalacturonase non-catalytic s...    194   9e-57   
emb|CDY47228.1|  BnaC09g14770D                                          198   3e-56   
gb|KCW86730.1|  hypothetical protein EUGRSUZ_B03341                     189   6e-56   
ref|XP_006659367.1|  PREDICTED: BURP domain-containing protein 12...    193   5e-55   
ref|XP_010046648.1|  PREDICTED: polygalacturonase non-catalytic s...    190   5e-55   
ref|NP_001061692.1|  Os08g0380100                                       195   6e-55   Oryza sativa Japonica Group [Japonica rice]
gb|KCW86723.1|  hypothetical protein EUGRSUZ_B03334                     186   8e-55   
ref|NP_001064572.1|  Os10g0409400                                       188   1e-54   Oryza sativa Japonica Group [Japonica rice]
gb|KCW86722.1|  hypothetical protein EUGRSUZ_B03333                     185   2e-54   
ref|XP_009415276.1|  PREDICTED: BURP domain-containing protein 12...    194   2e-54   
gb|EEC77314.1|  hypothetical protein OsI_15976                          183   2e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_010100468.1|  hypothetical protein L484_027780                   182   3e-54   
emb|CDX68345.1|  BnaA07g23850D                                          191   1e-53   
ref|XP_004973305.1|  PREDICTED: BURP domain-containing protein 12...    191   1e-53   
gb|EMT30231.1|  hypothetical protein F775_20363                         187   3e-53   
ref|XP_010046646.1|  PREDICTED: BURP domain-containing protein 16...    188   4e-53   
ref|XP_008652571.1|  PREDICTED: BURP domain-containing protein 14...    189   8e-53   
gb|EMS58973.1|  hypothetical protein TRIUR3_16136                       187   1e-52   
dbj|BAJ92348.1|  predicted protein                                      188   2e-52   
ref|XP_002460065.1|  hypothetical protein SORBIDRAFT_02g022220          188   4e-52   Sorghum bicolor [broomcorn]
ref|XP_003574428.1|  PREDICTED: BURP domain-containing protein 12       187   4e-52   
gb|EPS68955.1|  hypothetical protein M569_05812                         185   1e-51   
ref|XP_004956601.1|  PREDICTED: BURP domain-containing protein 14...    185   3e-51   
gb|ACG28762.1|  polygalacturonase-1 non-catalytic beta subunit pr...    185   3e-51   Zea mays [maize]
gb|ACN34141.1|  unknown                                                 184   4e-51   Zea mays [maize]
ref|NP_001146063.1|  uncharacterized protein LOC100279594 precursor     184   4e-51   Zea mays [maize]
ref|NP_001062896.2|  Os09g0329000                                       181   9e-50   Oryza sativa Japonica Group [Japonica rice]
gb|AAL65393.1|  polygalacturonase isoenzyme 1 beta subunit              167   1e-49   Oryza sativa [red rice]
gb|EEC84370.1|  hypothetical protein OsI_30914                          180   2e-49   Oryza sativa Indica Group [Indian rice]
dbj|BAJ97940.1|  predicted protein                                      179   5e-49   
emb|CDY59986.1|  BnaC06g43610D                                          176   3e-48   
ref|XP_002444270.1|  hypothetical protein SORBIDRAFT_07g019310          176   8e-48   Sorghum bicolor [broomcorn]
ref|XP_010046641.1|  PREDICTED: polygalacturonase non-catalytic s...    171   8e-48   
ref|XP_010044626.1|  PREDICTED: polygalacturonase non-catalytic s...    168   7e-47   
ref|XP_010044635.1|  PREDICTED: probable polygalacturonase non-ca...    168   8e-47   
ref|XP_010046647.1|  PREDICTED: polygalacturonase-1 non-catalytic...    160   7e-46   
gb|KCW86724.1|  hypothetical protein EUGRSUZ_B03335                     160   1e-45   
dbj|BAK05386.1|  predicted protein                                      166   1e-44   
gb|ABR16440.1|  unknown                                                 166   2e-44   Picea sitchensis
gb|AAL15882.1|AF417294_1  putative polygalacturonase beta subunit       153   1e-43   Castanea sativa
ref|XP_010046643.1|  PREDICTED: polygalacturonase-1 non-catalytic...    155   2e-43   
ref|XP_003576424.1|  PREDICTED: BURP domain-containing protein 14...    163   3e-43   
gb|EEC83505.1|  hypothetical protein OsI_29064                          159   4e-42   Oryza sativa Indica Group [Indian rice]
gb|EEE68602.1|  hypothetical protein OsJ_27135                          157   2e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003613151.1|  Polygalacturonase-1 non-catalytic subunit beta     145   9e-40   
ref|XP_003613152.1|  Polygalacturonase-1 non-catalytic subunit beta     145   3e-39   
gb|EMS64687.1|  hypothetical protein TRIUR3_01269                       149   8e-39   
ref|XP_006661124.1|  PREDICTED: LOW QUALITY PROTEIN: BURP domain-...    148   2e-38   
gb|AES96108.2|  BURP domain protein                                     145   5e-38   
ref|XP_003613150.1|  Polygalacturonase-1 non-catalytic subunit beta     145   6e-38   
gb|KCW86721.1|  hypothetical protein EUGRSUZ_B03330                     140   2e-37   
ref|XP_010046644.1|  PREDICTED: polygalacturonase-1 non-catalytic...    140   8e-37   
dbj|BAD23622.1|  polygalacturonase isoenzyme 1 beta subunit-like        143   3e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003613149.1|  Polygalacturonase-1 non-catalytic subunit beta     142   3e-36   
gb|EMT26618.1|  hypothetical protein F775_18544                         140   2e-35   
gb|AAT08687.1|  polygalacturonase                                       131   1e-34   Hyacinthus orientalis [common hyacinth]
gb|KCW86727.1|  hypothetical protein EUGRSUZ_B03337                     131   3e-34   
gb|EEE69479.1|  hypothetical protein OsJ_28904                          139   3e-34   Oryza sativa Japonica Group [Japonica rice]
gb|AAT08718.1|  polygalacturonase                                       128   3e-33   Hyacinthus orientalis [common hyacinth]
ref|XP_003629327.1|  Polygalacturonase-1 non-catalytic subunit beta     124   6e-33   
emb|CAN81758.1|  hypothetical protein VITISV_043391                     121   1e-28   Vitis vinifera
emb|CDP10831.1|  unnamed protein product                                116   3e-28   
ref|XP_003613159.1|  Polygalacturonase-1 non-catalytic beta subunit     112   1e-27   
emb|CDP10830.1|  unnamed protein product                                112   4e-26   
ref|XP_003613160.1|  Polygalacturonase-1 non-catalytic beta subunit     109   7e-26   
ref|XP_003613158.1|  Polygalacturonase-1 non-catalytic beta subunit     108   2e-25   
ref|XP_011091740.1|  PREDICTED: polygalacturonase-1 non-catalytic...    107   1e-24   
ref|XP_011091745.1|  PREDICTED: polygalacturonase-1 non-catalytic...    107   2e-24   
gb|ABR25612.1|  polygalacturonase-1 non-catalytic beta subunit pr...    100   6e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_010100465.1|  hypothetical protein L484_027777                 98.2    4e-23   
ref|XP_003613161.1|  Polygalacturonase-1 non-catalytic subunit beta     102   1e-22   
ref|XP_003613157.1|  Polygalacturonase-1 non-catalytic beta subunit     101   6e-22   
ref|XP_011074238.1|  PREDICTED: BURP domain-containing protein 16...  98.6    3e-21   
gb|EYU36709.1|  hypothetical protein MIMGU_mgv1a024306mg              97.1    7e-21   
gb|EYU36708.1|  hypothetical protein MIMGU_mgv1a009279mg              97.4    1e-20   
ref|XP_004241419.1|  PREDICTED: BURP domain-containing protein 16...  95.5    6e-20   
emb|CBI20911.3|  unnamed protein product                              87.4    3e-17   
ref|XP_002284368.1|  PREDICTED: dehydration-responsive protein RD22   87.0    3e-17   Vitis vinifera
dbj|BAB60849.1|  BURP domain-containing protein                       87.0    3e-17   Bruguiera gymnorhiza [Burma mangrove]
dbj|BAB60850.1|  BURP domain-containing protein                       86.7    4e-17   Bruguiera gymnorhiza [Burma mangrove]
gb|KDO79705.1|  hypothetical protein CISIN_1g018131mg                 86.7    4e-17   
dbj|BAB60848.1|  BURP domain-containing protein                       87.0    4e-17   Bruguiera gymnorhiza [Burma mangrove]
gb|KDO79703.1|  hypothetical protein CISIN_1g018131mg                 86.7    5e-17   
ref|XP_006476150.1|  PREDICTED: dehydration-responsive protein RD...  87.0    5e-17   
gb|AAL26909.1|AF319165_1  dehydration-responsive protein RD22         86.7    6e-17   Prunus persica
ref|XP_009373565.1|  PREDICTED: dehydration-responsive protein RD...  86.3    8e-17   
ref|XP_006450615.1|  hypothetical protein CICLE_v10008742mg           86.3    9e-17   
ref|XP_006450616.1|  hypothetical protein CICLE_v10008742mg           85.9    9e-17   
gb|ABK96092.1|  unknown                                               84.7    1e-16   Populus trichocarpa [western balsam poplar]
dbj|BAA92225.1|  S1-3                                                 82.8    1e-16   Vigna unguiculata
ref|XP_009373564.1|  PREDICTED: dehydration-responsive protein RD...  85.9    2e-16   
gb|KHN27019.1|  Putative polygalacturonase non-catalytic subunit      84.3    2e-16   
ref|XP_007221784.1|  hypothetical protein PRUPE_ppa005699mg           86.3    2e-16   
ref|XP_009373562.1|  PREDICTED: dehydration-responsive protein RD...  85.5    3e-16   
ref|XP_009373563.1|  PREDICTED: dehydration-responsive protein RD...  85.5    3e-16   
emb|CAN83032.1|  hypothetical protein VITISV_006147                   84.0    3e-16   Vitis vinifera
ref|XP_002324250.2|  hypothetical protein POPTR_0018s00850g           83.6    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_008348420.1|  PREDICTED: dehydration-responsive protein RD...  83.2    6e-16   
gb|AFV47141.1|  BURP domain RD22-like protein                         83.6    7e-16   
ref|XP_006833278.1|  hypothetical protein AMTR_s00109p00021460        84.0    8e-16   
ref|XP_008380463.1|  PREDICTED: dehydration-responsive protein RD...  83.2    1e-15   
ref|XP_001754733.1|  predicted protein                                79.0    1e-15   
ref|XP_009338714.1|  PREDICTED: dehydration-responsive protein RD...  81.6    1e-15   
ref|XP_010648807.1|  PREDICTED: dehydration-responsive protein RD...  80.1    1e-15   
ref|XP_008337839.1|  PREDICTED: dehydration-responsive protein RD...  82.4    1e-15   
ref|XP_003522684.1|  PREDICTED: dehydration-responsive protein RD...  82.4    1e-15   
ref|XP_006388094.1|  hypothetical protein POPTR_0343s00200g           83.2    1e-15   
ref|XP_002308621.2|  Dehydration-responsive protein RD22 precursor    83.2    2e-15   Populus trichocarpa [western balsam poplar]
gb|ABH09493.1|  RD22-like protein                                     83.2    2e-15   Knorringia sibirica
ref|XP_010648537.1|  PREDICTED: dehydration-responsive protein RD...  80.9    2e-15   
gb|ACU19496.1|  unknown                                               82.0    2e-15   Glycine max [soybeans]
ref|XP_011019672.1|  PREDICTED: dehydration-responsive protein RD...  82.8    3e-15   
ref|XP_010100464.1|  hypothetical protein L484_027776                 77.0    3e-15   
gb|KHN10237.1|  Dehydration-responsive protein RD22                   81.6    3e-15   
ref|XP_008220021.1|  PREDICTED: dehydration-responsive protein RD...  82.0    3e-15   
gb|ABK95182.1|  unknown                                               82.4    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_002284380.1|  PREDICTED: BURP domain-containing protein 3-...  80.9    4e-15   
ref|XP_006371718.1|  hypothetical protein POPTR_0018s00850g           82.4    4e-15   
ref|XP_001783704.1|  predicted protein                                80.1    5e-15   
ref|XP_003588551.1|  BURP domain-containing protein                   81.6    6e-15   
ref|NP_001268112.1|  RD22-like protein precursor                      81.3    6e-15   
gb|AFK33961.1|  unknown                                               78.2    6e-15   
emb|CAN75710.1|  hypothetical protein VITISV_004492                   81.3    6e-15   
gb|AFW85139.1|  hypothetical protein ZEAMMB73_186505                  79.3    7e-15   
ref|XP_011026571.1|  PREDICTED: dehydration-responsive protein RD...  81.3    8e-15   
ref|XP_009367927.1|  PREDICTED: dehydration-responsive protein RD...  81.3    8e-15   
gb|AFK48420.1|  unknown                                               80.9    8e-15   
ref|XP_004291216.1|  PREDICTED: dehydration-responsive protein RD...  81.3    1e-14   
ref|XP_002516581.1|  Dehydration-responsive protein RD22 precurso...  80.9    1e-14   
gb|ACD62790.1|  BURP domain-containing protein                        80.1    1e-14   
gb|AFK33381.1|  unknown                                               77.4    1e-14   
gb|EAY93151.1|  hypothetical protein OsI_14957                        79.3    1e-14   
ref|XP_003588559.1|  BURP domain-containing protein                   79.7    1e-14   
gb|AFM91990.1|  RD-22 like protein                                    78.6    1e-14   
ref|XP_003588464.1|  Dehydration-responsive protein RD22              79.7    1e-14   
ref|XP_007137164.1|  hypothetical protein PHAVU_009G105300g           79.7    1e-14   
gb|ACF84595.1|  unknown                                               78.6    1e-14   
gb|KDP34221.1|  hypothetical protein JCGZ_07792                       80.1    2e-14   
ref|XP_004498543.1|  PREDICTED: dehydration-responsive protein RD...  80.1    2e-14   
ref|NP_001235949.1|  BURP domain protein precursor                    79.3    2e-14   
ref|XP_010924753.1|  PREDICTED: BURP domain-containing protein 3-...  79.3    2e-14   
gb|AFM91994.1|  RD-22 like protein                                    77.8    3e-14   
ref|NP_001132751.1|  hypothetical protein precursor                   79.3    3e-14   
gb|ACU21473.1|  unknown                                               79.0    3e-14   
dbj|BAB60847.1|  BURP domain-containing protein                       78.2    3e-14   
ref|XP_010276358.1|  PREDICTED: dehydration-responsive protein RD...  79.0    3e-14   
gb|AES58809.2|  dehydration-responsive RD22-like protein              77.0    3e-14   
gb|AFM91991.1|  RD-22 like protein                                    77.0    4e-14   
gb|AFI80905.1|  dehydration-responsive protein                        77.4    4e-14   
emb|CAD39857.2|  OSJNBa0036B17.11                                     77.8    4e-14   
gb|AFM91998.1|  RD-22 like protein                                    76.6    4e-14   
ref|XP_007211649.1|  hypothetical protein PRUPE_ppa008874mg           78.2    5e-14   
ref|NP_001267970.1|  rd22-c protein precursor                         78.2    5e-14   
ref|XP_009367929.1|  PREDICTED: dehydration-responsive protein RD...  79.3    5e-14   
ref|XP_010925837.1|  PREDICTED: BURP domain-containing protein 3-...  77.4    5e-14   
ref|XP_010925836.1|  PREDICTED: BURP domain-containing protein 6-...  77.4    5e-14   
emb|CAH59196.1|  BURP-domain containing protein                       78.2    6e-14   
sp|Q0JEP3.2|BURP5_ORYSJ  RecName: Full=BURP domain-containing pro...  77.8    6e-14   
ref|XP_008387386.1|  PREDICTED: BURP domain-containing protein 3-...  77.4    7e-14   
gb|AFM91989.1|  RD-22 like protein                                    76.3    7e-14   
ref|XP_008226515.1|  PREDICTED: dehydration-responsive protein RD...  77.4    8e-14   
ref|XP_007012037.1|  BURP domain-containing protein, putative iso...  77.8    8e-14   
ref|XP_002523253.1|  Polygalacturonase non-catalytic subunit AroG...  78.6    9e-14   
ref|XP_006856046.1|  hypothetical protein AMTR_s00059p00082380        75.9    9e-14   
ref|NP_001052280.1|  Os04g0225700                                     77.4    9e-14   
ref|XP_010925834.1|  PREDICTED: BURP domain-containing protein 6-...  77.0    9e-14   
ref|XP_010249743.1|  PREDICTED: dehydration-responsive protein RD22   78.2    9e-14   
ref|XP_009367928.1|  PREDICTED: BURP domain-containing protein 3-...  78.2    9e-14   
ref|XP_009338716.1|  PREDICTED: dehydration-responsive protein RD...  78.2    9e-14   
ref|XP_009338715.1|  PREDICTED: BURP domain-containing protein 3-...  78.2    1e-13   
emb|CDP18476.1|  unnamed protein product                              77.8    1e-13   
ref|XP_007012036.1|  BURP domain-containing protein isoform 1         77.4    1e-13   
gb|AGV54277.1|  BURP domain-containing protein                        77.4    1e-13   
ref|XP_008457931.1|  PREDICTED: LOW QUALITY PROTEIN: BURP domain-...  77.0    1e-13   
ref|XP_008226516.1|  PREDICTED: dehydration-responsive protein RD...  77.4    1e-13   
ref|XP_009338717.1|  PREDICTED: BURP domain-containing protein 3-...  78.2    1e-13   
ref|XP_004148853.1|  PREDICTED: BURP domain-containing protein 17...  77.0    1e-13   
ref|XP_011081829.1|  PREDICTED: dehydration-responsive protein RD22   77.8    1e-13   
gb|AFM91993.1|  RD-22 like protein                                    75.5    1e-13   
ref|XP_003588552.1|  BURP domain protein                              77.0    1e-13   
ref|XP_003588558.1|  BURP domain protein                              77.0    1e-13   
ref|XP_003588556.1|  Dehydration-responsive protein RD22              77.0    1e-13   
gb|AFM91992.1|  RD-22 like protein                                    75.5    1e-13   
ref|XP_008466264.1|  PREDICTED: dehydration-responsive protein RD...  77.4    1e-13   
ref|XP_008363539.1|  PREDICTED: BURP domain-containing protein 5-...  76.3    1e-13   
ref|XP_002992608.1|  hypothetical protein SELMODRAFT_29154            73.2    1e-13   
ref|XP_002514311.1|  polygalacturonase, putative                      76.6    2e-13   
ref|NP_001141101.1|  hypothetical protein precursor                   77.8    2e-13   
gb|EPS61992.1|  hypothetical protein M569_12801                       76.3    2e-13   
ref|XP_002534535.1|  Dehydration-responsive protein RD22 precurso...  75.5    2e-13   
ref|XP_008226517.1|  PREDICTED: dehydration-responsive protein RD...  76.3    2e-13   
gb|AES58805.2|  dehydration-responsive RD22-like protein              75.5    2e-13   
ref|XP_008466262.1|  PREDICTED: dehydration-responsive protein RD...  77.0    2e-13   
gb|EPS64452.1|  hypothetical protein M569_10329                       75.9    2e-13   
gb|AFK48402.1|  unknown                                               73.6    3e-13   
ref|XP_001781225.1|  predicted protein                                74.7    3e-13   
ref|XP_009400564.1|  PREDICTED: BURP domain-containing protein 3-...  76.3    3e-13   
ref|XP_004500819.1|  PREDICTED: BURP domain-containing protein 17...  75.9    3e-13   
emb|CBI20906.3|  unnamed protein product                              72.8    3e-13   
ref|XP_003569738.1|  PREDICTED: BURP domain-containing protein 3-...  77.4    3e-13   
ref|XP_010257624.1|  PREDICTED: BURP domain-containing protein 16...  77.4    3e-13   
ref|XP_009400563.1|  PREDICTED: BURP domain-containing protein 3-...  76.3    3e-13   
gb|AAP34365.1|  putative dehydration-induced protein                  73.9    3e-13   
ref|XP_004299102.1|  PREDICTED: BURP domain-containing protein 3-...  75.1    4e-13   
gb|AES58801.2|  dehydration-responsive protein RD22                   75.1    4e-13   
ref|XP_010028578.1|  PREDICTED: BURP domain-containing protein 17     75.1    4e-13   
ref|XP_009345258.1|  PREDICTED: BURP domain-containing protein 3-...  75.1    5e-13   
ref|XP_008347810.1|  PREDICTED: dehydration-responsive protein RD...  75.1    5e-13   
ref|XP_003588550.1|  BURP domain-containing protein                   75.5    5e-13   
ref|XP_010106680.1|  BURP domain-containing protein 3                 75.1    5e-13   
ref|XP_001776362.1|  predicted protein                                74.3    5e-13   
ref|XP_003588554.1|  BURP domain-containing protein                   75.1    5e-13   
ref|XP_004299100.1|  PREDICTED: BURP domain-containing protein 3-...  74.3    6e-13   
ref|XP_009400562.1|  PREDICTED: BURP domain-containing protein 3-...  75.5    6e-13   
gb|EPS58650.1|  hypothetical protein M569_16161                       74.3    7e-13   
ref|XP_006843028.1|  hypothetical protein AMTR_s00076p00180150        72.4    8e-13   
gb|KFK27813.1|  hypothetical protein AALP_AA8G433300                  75.5    8e-13   
gb|EMS48783.1|  hypothetical protein TRIUR3_21717                     75.1    1e-12   
ref|XP_010911557.1|  PREDICTED: BURP domain-containing protein 6-...  73.9    1e-12   
ref|XP_002313054.2|  hypothetical protein POPTR_0009s11750g           73.9    1e-12   
ref|XP_009762320.1|  PREDICTED: dehydration-responsive protein RD22   75.1    1e-12   
ref|XP_010690912.1|  PREDICTED: BURP domain-containing protein 3-...  73.9    1e-12   
ref|NP_001275413.1|  BURP domain-containing protein precursor         74.7    1e-12   
ref|XP_007200547.1|  hypothetical protein PRUPE_ppa009549mg           73.6    1e-12   
gb|ABK96114.1|  unknown                                               73.6    1e-12   
ref|XP_007225010.1|  hypothetical protein PRUPE_ppa020264mg           73.2    1e-12   
ref|XP_001762649.1|  predicted protein                                72.0    1e-12   
ref|XP_011088371.1|  PREDICTED: BURP domain-containing protein 3-...  73.6    1e-12   
ref|XP_002523248.1|  Embryonic abundant protein VF30.1 precursor,...  72.8    2e-12   
gb|AGE46023.1|  dehydration-responsive protein RD22-like isoform 2    73.6    2e-12   
ref|XP_002968034.1|  hypothetical protein SELMODRAFT_440226           76.3    2e-12   
ref|XP_009374194.1|  PREDICTED: BURP domain-containing protein 17...  73.2    2e-12   
ref|XP_008792350.1|  PREDICTED: BURP domain-containing protein 3      74.3    2e-12   
ref|XP_004136300.1|  PREDICTED: dehydration-responsive protein RD...  74.3    2e-12   
ref|XP_009375835.1|  PREDICTED: BURP domain-containing protein 17...  73.2    2e-12   
gb|AGV54733.1|  dehydration-responsive protein RD22-like protein      73.6    2e-12   
ref|XP_008245942.1|  PREDICTED: BURP domain-containing protein 3-...  73.2    2e-12   
gb|AES58800.2|  dehydration-responsive protein RD22                   73.2    2e-12   
emb|CDP16137.1|  unnamed protein product                              73.2    2e-12   
ref|XP_003588548.1|  BURP domain-containing protein                   73.2    3e-12   
gb|KHN15366.1|  Dehydration-responsive protein RD22                   73.6    3e-12   
ref|XP_003631606.1|  PREDICTED: BURP domain-containing protein 17...  72.8    3e-12   
ref|XP_009111670.1|  PREDICTED: dehydration-responsive protein RD...  73.9    3e-12   
ref|XP_003588549.1|  BURP domain-containing protein                   72.8    3e-12   
emb|CDY19799.1|  BnaA09g04520D                                        73.9    3e-12   
ref|XP_007224866.1|  hypothetical protein PRUPE_ppa022737mg           72.8    3e-12   
ref|XP_010648538.1|  PREDICTED: dehydration-responsive protein RD...  70.9    3e-12   
ref|XP_007222614.1|  hypothetical protein PRUPE_ppa008481mg           73.2    3e-12   
ref|XP_007221811.1|  hypothetical protein PRUPE_ppa004101mg           73.2    3e-12   
gb|ACV60360.1|  RD22-like protein                                     73.2    3e-12   
ref|XP_010519915.1|  PREDICTED: dehydration-responsive protein RD22   73.6    4e-12   
ref|XP_003603899.1|  BURP domain-containing protein                   72.8    4e-12   
ref|XP_009628254.1|  PREDICTED: dehydration-responsive protein RD...  73.6    4e-12   
ref|XP_009628253.1|  PREDICTED: dehydration-responsive protein RD...  73.6    4e-12   
gb|AAL67991.1|  dehydration-induced protein RD22-like protein         72.8    4e-12   
gb|AFK41878.1|  unknown                                               72.0    4e-12   
ref|XP_003603902.1|  BURP domain-containing protein                   72.0    4e-12   
ref|XP_007200499.1|  hypothetical protein PRUPE_ppa009236mg           72.4    4e-12   
ref|XP_010112167.1|  hypothetical protein L484_019906                 73.9    5e-12   
ref|XP_008219773.1|  PREDICTED: dehydration-responsive protein RD...  72.0    5e-12   
ref|NP_001274155.1|  uncharacterized protein LOC101767742 precursor   73.6    5e-12   
dbj|BAC22501.1|  resistant specific protein-3                         72.0    5e-12   
ref|XP_008219775.1|  PREDICTED: dehydration-responsive protein RD...  72.0    6e-12   
gb|ACH97124.1|  BURP domain-containing protein                        72.4    6e-12   
ref|NP_001237833.1|  seed coat BURP domain protein 1 precursor        72.0    6e-12   
ref|XP_007227242.1|  hypothetical protein PRUPE_ppa018182mg           71.6    6e-12   
ref|XP_010096196.1|  hypothetical protein L484_026930                 70.9    7e-12   
gb|KHN15367.1|  Dehydration-responsive protein RD22                   72.8    7e-12   
gb|ACU20207.1|  unknown                                               72.8    7e-12   
ref|XP_010256408.1|  PREDICTED: BURP domain-containing protein 6-...  72.0    7e-12   
ref|NP_001268138.1|  rd22-b protein precursor                         72.0    7e-12   
ref|XP_008220015.1|  PREDICTED: BURP domain-containing protein 5-...  72.8    7e-12   
ref|XP_009416720.1|  PREDICTED: BURP domain-containing protein 3-...  72.8    7e-12   
gb|ACU19518.1|  unknown                                               71.6    7e-12   
ref|XP_007015178.1|  BURP domain-containing protein, putative         73.2    8e-12   
ref|XP_007221812.1|  hypothetical protein PRUPE_ppa004101mg           72.8    8e-12   
ref|XP_002456304.1|  hypothetical protein SORBIDRAFT_03g033760        73.2    9e-12   
ref|XP_009151093.1|  PREDICTED: dehydration-responsive protein RD22   72.4    9e-12   
ref|XP_007227268.1|  hypothetical protein PRUPE_ppa017769mg           72.0    9e-12   
gb|AAQ57584.1|  BURP domain-containing protein                        72.4    9e-12   
ref|XP_003577570.1|  PREDICTED: BURP domain-containing protein 13...  72.0    9e-12   
emb|CDY62417.1|  BnaA06g39340D                                        72.4    9e-12   
ref|XP_007224966.1|  hypothetical protein PRUPE_ppa020936mg           72.0    9e-12   
gb|EMT15357.1|  hypothetical protein F775_21879                       68.9    1e-11   
ref|XP_008219790.1|  PREDICTED: dehydration-responsive protein RD...  71.6    1e-11   
emb|CDX87079.1|  BnaC09g03940D                                        72.4    1e-11   
sp|Q70KG3.1|RAF1B_WHEAT  RecName: Full=Protein RAFTIN 1B; Short=T...  72.0    1e-11   
ref|XP_007225722.1|  hypothetical protein PRUPE_ppa006739mg           72.4    1e-11   
ref|XP_007225823.1|  hypothetical protein PRUPE_ppa011523mg           70.1    1e-11   
emb|CDX80529.1|  BnaC07g29150D                                        72.4    1e-11   
gb|EMT00133.1|  hypothetical protein F775_43877                       68.9    1e-11   
ref|XP_009376258.1|  PREDICTED: BURP domain-containing protein 3-...  71.6    1e-11   
ref|XP_008245628.1|  PREDICTED: dehydration-responsive protein RD...  70.9    1e-11   
emb|CDP16143.1|  unnamed protein product                              71.2    1e-11   
ref|XP_011014851.1|  PREDICTED: dehydration-responsive protein RD...  70.1    1e-11   
ref|XP_011048729.1|  PREDICTED: BURP domain-containing protein 3-...  70.9    1e-11   
gb|AAT66913.1|  dehydration-induced protein RD22-like protein 2       72.0    1e-11   
ref|XP_010493823.1|  PREDICTED: dehydration-responsive protein RD...  72.0    1e-11   
ref|XP_008451378.1|  PREDICTED: BURP domain-containing protein 5-...  70.5    1e-11   
ref|XP_010421423.1|  PREDICTED: dehydration-responsive protein RD...  72.0    1e-11   
ref|XP_008219789.1|  PREDICTED: dehydration-responsive protein RD...  71.2    1e-11   
ref|XP_010493824.1|  PREDICTED: dehydration-responsive protein RD...  72.0    1e-11   
gb|KDP22140.1|  hypothetical protein JCGZ_25971                       72.8    2e-11   
emb|CDY54896.1|  BnaC02g48560D                                        71.6    2e-11   
ref|XP_006287907.1|  hypothetical protein CARUB_v10001141mg           71.6    2e-11   
ref|NP_001236126.1|  BURP domain protein 2 precursor                  71.2    2e-11   
sp|Q70KG5.1|RAF1A_WHEAT  RecName: Full=Protein RAFTIN 1A; Short=T...  71.6    2e-11   
gb|KDP45575.1|  hypothetical protein JCGZ_17182                       72.4    2e-11   
ref|XP_008245112.1|  PREDICTED: dehydration-responsive protein RD...  71.2    2e-11   
gb|EYU20466.1|  hypothetical protein MIMGU_mgv1a020040mg              70.9    2e-11   
ref|XP_003603599.1|  BURP domain protein                              70.9    2e-11   
emb|CDP18474.1|  unnamed protein product                              70.9    2e-11   
ref|XP_007222162.1|  hypothetical protein PRUPE_ppa005767mg           71.6    2e-11   
gb|AES73702.2|  dehydration-responsive RD22-like protein              70.1    2e-11   
ref|XP_008219786.1|  PREDICTED: dehydration-responsive protein RD...  71.2    2e-11   
gb|KDP45576.1|  hypothetical protein JCGZ_17183                       72.0    2e-11   
ref|XP_008219787.1|  PREDICTED: dehydration-responsive protein RD...  71.2    2e-11   
ref|XP_003603451.1|  BURP domain-containing protein                   69.7    2e-11   
gb|KHG19017.1|  BURP domain-containing 17                             70.1    2e-11   
ref|XP_002284434.1|  PREDICTED: dehydration-responsive protein RD...  70.9    2e-11   
ref|XP_002874271.1|  hypothetical protein ARALYDRAFT_489420           71.2    2e-11   
ref|XP_004507419.1|  PREDICTED: BURP domain-containing protein 3-...  70.1    2e-11   
emb|CDP16139.1|  unnamed protein product                              70.9    2e-11   
ref|XP_010925835.1|  PREDICTED: BURP domain-containing protein 6-...  70.5    3e-11   
ref|NP_001044161.1|  Os01g0733500                                     71.2    3e-11   
ref|XP_010049078.1|  PREDICTED: dehydration-responsive protein RD22   70.9    3e-11   
gb|KDP22142.1|  hypothetical protein JCGZ_25973                       70.9    3e-11   
gb|EAZ13440.1|  hypothetical protein OsJ_03360                        71.2    3e-11   
ref|NP_197943.1|  dehydration-responsive protein RD22                 71.2    3e-11   
ref|XP_011001292.1|  PREDICTED: dehydration-responsive protein RD...  68.2    3e-11   
gb|ABK26316.1|  unknown                                               70.5    3e-11   
dbj|BAC22498.1|  resistant specific protein-1(4)                      71.2    3e-11   
dbj|BAH56805.1|  AT5G25610                                            70.9    3e-11   
ref|XP_010454906.1|  PREDICTED: dehydration-responsive protein RD...  70.9    3e-11   
emb|CDP21613.1|  unnamed protein product                              70.5    3e-11   
ref|XP_007140998.1|  hypothetical protein PHAVU_008G158600g           70.5    3e-11   
gb|KHF97444.1|  Dehydration-responsive RD22 -like protein             70.1    3e-11   



>emb|CAN67205.1| hypothetical protein VITISV_037214 [Vitis vinifera]
Length=235

 Score =   229 bits (585),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT VLGRNVVVRTT++  G+KQ +MIGSVKGINGG++TKSVSCHQSLFPYL+YY
Sbjct  105  EDMIDFATTVLGRNVVVRTTQSVEGSKQNVMIGSVKGINGGQVTKSVSCHQSLFPYLLYY  164

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDPKTK  +NHGVAICH+DTS W A HGAF+ALGSGPG+IEVCHWI
Sbjct  165  CHSVPKVRVYEADLLDPKTKANVNHGVAICHLDTSDWSAGHGAFVALGSGPGRIEVCHWI  224

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  225  FENDMTWTIAD  235



>ref|XP_009794727.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana sylvestris]
Length=625

 Score =   240 bits (613),  Expect = 5e-72, Method: Composition-based stats.
 Identities = 115/131 (88%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDF+T+VLGRNVVVRTTE T G+K  IMIGSVKGINGGK+TKSVSCHQSLFPYLVYY
Sbjct  495  EDMIDFSTSVLGRNVVVRTTENTKGSKGNIMIGSVKGINGGKVTKSVSCHQSLFPYLVYY  554

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K KINHGVAICH+DTS+WGA+HGAF+ALGSGPGKIEVCHWI
Sbjct  555  CHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSWGASHGAFIALGSGPGKIEVCHWI  614

Query  361  FENDMTWTVAD  393
            FENDMTW VAD
Sbjct  615  FENDMTWAVAD  625



>gb|KDO82432.1| hypothetical protein CISIN_1g044596mg [Citrus sinensis]
Length=644

 Score =   239 bits (610),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG +V +RTT+   G+KQ IMIGSVKGINGGK+T+SVSCHQSLFPYL+YY
Sbjct  511  EDMIDFATSVLGNSVTLRTTQNVQGSKQNIMIGSVKGINGGKVTQSVSCHQSLFPYLLYY  570

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDPKTK KINHGVAICHIDTSAW  THGAFLALGSGPG+IEVCHWI
Sbjct  571  CHSVPKVRVYEADLLDPKTKAKINHGVAICHIDTSAWSQTHGAFLALGSGPGRIEVCHWI  630

Query  361  FENDMTWTVAD  393
            FEND+TWT+ D
Sbjct  631  FENDLTWTIVD  641



>ref|XP_009794726.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana sylvestris]
Length=628

 Score =   238 bits (608),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 114/131 (87%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVVRTTE T G+K+ IMIGSVKGINGGK+TKSVSCHQSLFPYL+YY
Sbjct  498  EDMIDFATSVLGRNVVVRTTENTKGSKENIMIGSVKGINGGKVTKSVSCHQSLFPYLLYY  557

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K KINHGVAICH+DTS+WG THGAF+ALGSGPGKIEVCHWI
Sbjct  558  CHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSWGPTHGAFVALGSGPGKIEVCHWI  617

Query  361  FENDMTWTVAD  393
            FENDMTW +AD
Sbjct  618  FENDMTWAIAD  628



>ref|XP_006483847.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Citrus sinensis]
Length=644

 Score =   239 bits (609),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG +V +RTT+   G+KQ IMIGSVKGINGGK+T+SVSCHQSLFPYL+YY
Sbjct  511  EDMIDFATSVLGNSVTLRTTQNVQGSKQNIMIGSVKGINGGKVTQSVSCHQSLFPYLLYY  570

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDPKTK KINHGVAICHIDTSAW  THGAFLALGSGPG+IEVCHWI
Sbjct  571  CHSVPKVRVYEADLLDPKTKAKINHGVAICHIDTSAWSQTHGAFLALGSGPGRIEVCHWI  630

Query  361  FENDMTWTVAD  393
            FEND+TWT+ D
Sbjct  631  FENDLTWTIVD  641



>ref|XP_006438392.1| hypothetical protein CICLE_v10030930mg [Citrus clementina]
 gb|ESR51632.1| hypothetical protein CICLE_v10030930mg [Citrus clementina]
Length=644

 Score =   239 bits (609),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG +V +RTT+   G+KQ IMIGSVKGINGGK+T+SVSCHQSLFPYL+YY
Sbjct  511  EDMIDFATSVLGNSVTLRTTQNVQGSKQNIMIGSVKGINGGKVTQSVSCHQSLFPYLLYY  570

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDPKTK KINHGVAICHIDTSAW  THGAFLALGSGPG+IEVCHWI
Sbjct  571  CHSVPKVRVYEADLLDPKTKAKINHGVAICHIDTSAWSQTHGAFLALGSGPGRIEVCHWI  630

Query  361  FENDMTWTVAD  393
            FEND+TWT+ D
Sbjct  631  FENDLTWTIVD  641



>emb|CAN66340.1| hypothetical protein VITISV_018557 [Vitis vinifera]
Length=226

 Score =   226 bits (577),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT VLGRNVVVRTT++  G+KQ +MIGSVKGINGG++TKSVSCHQSLFPYL+YY
Sbjct  96   EDMIDFATTVLGRNVVVRTTQSVEGSKQNVMIGSVKGINGGQVTKSVSCHQSLFPYLLYY  155

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH VPKVRVYEAD+LDPKTK  INHGVAICH+DTS W A HGAF+ALGSGPG+IEVCHWI
Sbjct  156  CHXVPKVRVYEADLLDPKTKANINHGVAICHLDTSDWSAGHGAFVALGSGPGRIEVCHWI  215

Query  361  FENDMTWTVAD  393
            FENDMTWT+ D
Sbjct  216  FENDMTWTIVD  226



>gb|KDP26581.1| hypothetical protein JCGZ_17739 [Jatropha curcas]
Length=629

 Score =   237 bits (604),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNV  RTTE   G+KQ IMIGS+KGINGGK+TKSVSCHQSL+PYL+YY
Sbjct  499  EDMIDFATSVLGRNVAARTTENVNGSKQKIMIGSIKGINGGKVTKSVSCHQSLYPYLLYY  558

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP +K KINHGVAICH+DTS+W  THGAFLALGSGPG+IEVCHWI
Sbjct  559  CHSVPKVRVYEADLLDPNSKAKINHGVAICHLDTSSWSPTHGAFLALGSGPGRIEVCHWI  618

Query  361  FENDMTWTVAD  393
            FEND+TW++AD
Sbjct  619  FENDLTWSIAD  629



>gb|KDO82433.1| hypothetical protein CISIN_1g036311mg [Citrus sinensis]
Length=632

 Score =   237 bits (604),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 113/131 (86%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT++LGRNVVVRTTE   G+K+ IMIGSVKGINGGK+TKSVSCHQSLFPYL+YY
Sbjct  502  EDMIDFATSILGRNVVVRTTENVNGSKKKIMIGSVKGINGGKVTKSVSCHQSLFPYLLYY  561

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LD  TK KINHGVAICH+DTSAW  THGAFLALGSGPGKIEVCHWI
Sbjct  562  CHSVPKVRVYEADVLDANTKAKINHGVAICHLDTSAWSPTHGAFLALGSGPGKIEVCHWI  621

Query  361  FENDMTWTVAD  393
            FENDMTWT AD
Sbjct  622  FENDMTWTTAD  632



>ref|XP_009596020.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana tomentosiformis]
Length=628

 Score =   237 bits (604),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDF+T+VLGR+VVVRTTE T G+K  IMIGSVKGINGGK+TKSVSCHQSLFPYLVYY
Sbjct  498  EDMIDFSTSVLGRDVVVRTTENTKGSKGNIMIGSVKGINGGKVTKSVSCHQSLFPYLVYY  557

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K KINHG+AICH+DTS+WGA HGAF+ALGSGPGKIEVCHWI
Sbjct  558  CHSVPKVRVYEADILDPNSKAKINHGIAICHVDTSSWGANHGAFIALGSGPGKIEVCHWI  617

Query  361  FENDMTWTVAD  393
            FENDMTW +AD
Sbjct  618  FENDMTWALAD  628



>ref|XP_006365226.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=625

 Score =   236 bits (601),  Expect = 3e-70, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDF+T+VLG+N++VRTTE   G+K  I+IGSVKGINGGK+TKS+SCHQSLFPYLVYY
Sbjct  495  EDMIDFSTSVLGQNIIVRTTENIKGSKGDILIGSVKGINGGKVTKSISCHQSLFPYLVYY  554

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K KINHGVAICH+DTS WGA HGAF+ALGSGPGKIEVCHWI
Sbjct  555  CHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSTWGANHGAFMALGSGPGKIEVCHWI  614

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  615  FENDMTWTIAD  625



>ref|XP_010551569.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=625

 Score =   236 bits (601),  Expect = 3e-70, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR++ +RTTE   G+KQ +MIG V+GINGGK+TKSVSCHQSL+PYL+YY
Sbjct  495  EDMIDFATSVLGRSLELRTTENIAGSKQKVMIGKVRGINGGKVTKSVSCHQSLYPYLLYY  554

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE+D+LDPKTK KINHGVAICHIDTSAWGA+HGAF ALGS PG+IEVCHWI
Sbjct  555  CHSVPKVRVYESDLLDPKTKSKINHGVAICHIDTSAWGASHGAFAALGSRPGQIEVCHWI  614

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  615  FENDMTWTIAD  625



>gb|KDP26582.1| hypothetical protein JCGZ_17740 [Jatropha curcas]
Length=625

 Score =   235 bits (600),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 106/131 (81%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+IDFAT+VLGRN VV TTE   G+K+ +MIG+VKG+NGGK+TKSVSCHQSL+PYL+YY
Sbjct  495  EDLIDFATSVLGRNAVVWTTENVSGSKKDVMIGTVKGMNGGKVTKSVSCHQSLYPYLLYY  554

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K+KINHGVAICH+DTS+W  THGAFLALGSGPG+IEVCHWI
Sbjct  555  CHSVPKVRVYEADILDPNSKEKINHGVAICHLDTSSWSPTHGAFLALGSGPGQIEVCHWI  614

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  615  FENDMTWTIAD  625



>ref|XP_010520580.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=614

 Score =   235 bits (599),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 106/131 (81%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRN+++R TE+T G+KQ +MIG VKGINGG++TKSVSCHQSL+PYL+YY
Sbjct  484  EDMIDFATSVLGRNIILRNTESTAGSKQEVMIGKVKGINGGEVTKSVSCHQSLYPYLLYY  543

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE+D+LDPKTK KINHGVAICHIDTSAWG  HGAF+ALGS PG+IEVCHWI
Sbjct  544  CHSVPKVRVYESDLLDPKTKSKINHGVAICHIDTSAWGPRHGAFMALGSRPGEIEVCHWI  603

Query  361  FENDMTWTVAD  393
            FEND+TWT+AD
Sbjct  604  FENDLTWTIAD  614



>ref|XP_009596009.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana tomentosiformis]
Length=629

 Score =   235 bits (600),  Expect = 5e-70, Method: Composition-based stats.
 Identities = 112/131 (85%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVVRTTE T G+K+ I+IGSVKGINGGK+TKSVSCHQSLFPYL+YY
Sbjct  499  EDMIDFATSVLGRNVVVRTTENTKGSKENIIIGSVKGINGGKVTKSVSCHQSLFPYLLYY  558

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K KINHGVAICH+DTS+WG +HGAF+ALGSGPGKIEVCHWI
Sbjct  559  CHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSWGPSHGAFVALGSGPGKIEVCHWI  618

Query  361  FENDMTWTVAD  393
            FENDMTW +AD
Sbjct  619  FENDMTWAIAD  629



>gb|AHC69823.1| polygalacturonase isoenzyme 1 beta subunit [Nicotiana tabacum]
Length=628

 Score =   235 bits (600),  Expect = 5e-70, Method: Composition-based stats.
 Identities = 112/131 (85%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVVRTTE T G+K+ I+IGSVKGINGGK+TKSVSCHQSLFPYL+YY
Sbjct  498  EDMIDFATSVLGRNVVVRTTENTKGSKENIIIGSVKGINGGKVTKSVSCHQSLFPYLLYY  557

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K KINHGVAICH+DTS+WG +HGAF+ALGSGPGKIEVCHWI
Sbjct  558  CHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSWGPSHGAFVALGSGPGKIEVCHWI  617

Query  361  FENDMTWTVAD  393
            FENDMTW +AD
Sbjct  618  FENDMTWAIAD  628



>ref|XP_002266341.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Vitis vinifera]
Length=633

 Score =   235 bits (600),  Expect = 5e-70, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT VLGRNVVVRTT++  G+KQ +MIGSVKGINGG++TKSVSCHQSLFPYL+YY
Sbjct  503  EDMIDFATTVLGRNVVVRTTQSVEGSKQNLMIGSVKGINGGQVTKSVSCHQSLFPYLLYY  562

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDPKTK  +NHGVAICH+DTS W A HGAF+ALGSGPG+IEVCHWI
Sbjct  563  CHSVPKVRVYEADLLDPKTKANVNHGVAICHLDTSDWSAGHGAFVALGSGPGRIEVCHWI  622

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  623  FENDMTWTIAD  633



>ref|XP_006438394.1| hypothetical protein CICLE_v10030947mg [Citrus clementina]
 ref|XP_006483846.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Citrus sinensis]
 gb|ESR51634.1| hypothetical protein CICLE_v10030947mg [Citrus clementina]
Length=632

 Score =   235 bits (600),  Expect = 5e-70, Method: Composition-based stats.
 Identities = 113/131 (86%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT++LGRNVVVRTTE   G+K+ I+IGSVKGINGGK+TKSVSCHQSLFPYL+YY
Sbjct  502  EDMIDFATSILGRNVVVRTTENVNGSKKKIVIGSVKGINGGKVTKSVSCHQSLFPYLLYY  561

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILD  TK KINHGVAICH+DTSAW  THGAFLALGSGPGKIEVCHWI
Sbjct  562  CHSVPKVRVYEADILDANTKAKINHGVAICHLDTSAWSPTHGAFLALGSGPGKIEVCHWI  621

Query  361  FENDMTWTVAD  393
            FENDMTWT AD
Sbjct  622  FENDMTWTTAD  632



>ref|XP_010023570.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Eucalyptus grandis]
Length=624

 Score =   235 bits (599),  Expect = 7e-70, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT++LGR+V  R+TE+T G+KQ +M+G+VKGINGG +TKSVSCHQSLFPYL+YY
Sbjct  494  EDMIDFATSILGRDVEARSTESTAGSKQEVMVGTVKGINGGMVTKSVSCHQSLFPYLLYY  553

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDPKTK KINHGVA+CHIDTSAW ATHGAFLALGS PG+IEVCHWI
Sbjct  554  CHSVPKVRVYEADLLDPKTKVKINHGVAVCHIDTSAWSATHGAFLALGSRPGQIEVCHWI  613

Query  361  FENDMTWTVAD  393
            FE+DMTWT+AD
Sbjct  614  FESDMTWTIAD  624



>gb|KCW59875.1| hypothetical protein EUGRSUZ_H02608 [Eucalyptus grandis]
Length=623

 Score =   234 bits (598),  Expect = 7e-70, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT++LGR+V  R+TE+T G+KQ +M+G+VKGINGG +TKSVSCHQSLFPYL+YY
Sbjct  493  EDMIDFATSILGRDVEARSTESTAGSKQEVMVGTVKGINGGMVTKSVSCHQSLFPYLLYY  552

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDPKTK KINHGVA+CHIDTSAW ATHGAFLALGS PG+IEVCHWI
Sbjct  553  CHSVPKVRVYEADLLDPKTKVKINHGVAVCHIDTSAWSATHGAFLALGSRPGQIEVCHWI  612

Query  361  FENDMTWTVAD  393
            FE+DMTWT+AD
Sbjct  613  FESDMTWTIAD  623



>ref|XP_007044636.1| Polygalacturonase 2 [Theobroma cacao]
 gb|EOY00468.1| Polygalacturonase 2 [Theobroma cacao]
Length=682

 Score =   235 bits (599),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNV VRTTE   G+KQ I IG+V+GIN GK+TKSVSCHQSL+PYL+YY
Sbjct  551  EDMIDFATSVLGRNVEVRTTENVKGSKQNIKIGTVRGINSGKVTKSVSCHQSLYPYLLYY  610

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +++KINHGVAICH+DTSAW + HGAFLALGSGPG+IEVCHWI
Sbjct  611  CHSVPKVRVYEADILDPNSREKINHGVAICHLDTSAWSSGHGAFLALGSGPGRIEVCHWI  670

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  671  FENDMTWTIAD  681



>gb|KHG24447.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=628

 Score =   234 bits (596),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 108/131 (82%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNV VRTTE   G+KQ I IGSVKGINGGK+TKSVSCHQSL+PYL+YY
Sbjct  497  EDMIDFATSVLGRNVEVRTTENVKGSKQNIKIGSVKGINGGKVTKSVSCHQSLYPYLLYY  556

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEADILDPK+ +KINHGVAICH+DTS+W + HGAFLALGSGPG+IEVCHWI
Sbjct  557  CHSVPEVRVYEADILDPKSLEKINHGVAICHLDTSSWSSNHGAFLALGSGPGRIEVCHWI  616

Query  361  FENDMTWTVAD  393
            FENDMTWT++D
Sbjct  617  FENDMTWTISD  627



>ref|XP_010100469.1| hypothetical protein L484_027781 [Morus notabilis]
 gb|EXB82603.1| hypothetical protein L484_027781 [Morus notabilis]
Length=608

 Score =   233 bits (594),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVV RTTE+  G+K+ IMIGSVKGINGGK+T+SVSCHQSLFPYLVYY
Sbjct  478  EDMIDFATSVLGRNVVARTTESVSGSKKNIMIGSVKGINGGKVTQSVSCHQSLFPYLVYY  537

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVY ADILDP +K KINHGVAICH+DTSAW  THGAFLALGS PG+IEVCHWI
Sbjct  538  CHSVPKVRVYTADILDPNSKAKINHGVAICHLDTSAWSPTHGAFLALGSKPGRIEVCHWI  597

Query  361  FENDMTWTVAD  393
            FEND+TW+V+D
Sbjct  598  FENDLTWSVSD  608



>ref|XP_008389645.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=632

 Score =   233 bits (595),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT +LGRNVVVR+TE   GAK  +M+GSVKGINGGK+T+SVSCHQSLFPYL+YY
Sbjct  502  EDMIDFATTILGRNVVVRSTENVNGAKHDVMVGSVKGINGGKVTQSVSCHQSLFPYLLYY  561

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP +K KINHGVAICH+DTSAW  THG+FLALGSGPG+IEVCHWI
Sbjct  562  CHSVPKVRVYEADLLDPVSKAKINHGVAICHLDTSAWSPTHGSFLALGSGPGRIEVCHWI  621

Query  361  FENDMTWTVAD  393
            F+NDMTWT+AD
Sbjct  622  FQNDMTWTIAD  632



>gb|KHN27021.1| Putative polygalacturonase non-catalytic subunit [Glycine soja]
Length=340

 Score =   225 bits (574),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDF+T+VLGRNV V TTE   G+ + +M+G VKG+NGGK+TKSVSCHQSLFPYL+YY
Sbjct  210  EDMIDFSTSVLGRNVAVWTTENVKGSNKNVMVGRVKGMNGGKVTKSVSCHQSLFPYLLYY  269

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP++K KINHGVAICH+DT+AW  THGAFLALGSGPG+IEVCHWI
Sbjct  270  CHSVPKVRVYEADLLDPESKAKINHGVAICHLDTTAWSPTHGAFLALGSGPGRIEVCHWI  329

Query  361  FENDMTWTVAD  393
            FEND+TWT+AD
Sbjct  330  FENDLTWTIAD  340



>ref|XP_008221810.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=632

 Score =   233 bits (593),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT VLGRNVVVR+TE   GAK  +MIGSVKGINGGK+T+SVSCHQSLFPYL+YY
Sbjct  502  EDMIDFATTVLGRNVVVRSTENVNGAKHNVMIGSVKGINGGKVTQSVSCHQSLFPYLLYY  561

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP +K KINHGVAICH+DTSAW  THG+F+ALGSGPG+IEVCHWI
Sbjct  562  CHSVPKVRVYEADLLDPLSKAKINHGVAICHLDTSAWSPTHGSFMALGSGPGRIEVCHWI  621

Query  361  FENDMTWTVAD  393
            F+NDMTW +AD
Sbjct  622  FQNDMTWAIAD  632



>ref|XP_002266815.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Vitis vinifera]
Length=624

 Score =   232 bits (592),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT VLGRNVVVRTT++  G+KQ +MIGSVKGINGG++TKSVSCHQSLFPYL+YY
Sbjct  494  EDMIDFATTVLGRNVVVRTTQSVEGSKQNVMIGSVKGINGGQVTKSVSCHQSLFPYLLYY  553

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH VPKVRVYEAD+LDPKTK  INHGVAICH+DTS W A HGAF+ALGSGPG+IEVCHWI
Sbjct  554  CHFVPKVRVYEADLLDPKTKANINHGVAICHLDTSDWSAGHGAFVALGSGPGRIEVCHWI  613

Query  361  FENDMTWTVAD  393
            FENDMTWT+ D
Sbjct  614  FENDMTWTIVD  624



>ref|XP_009363553.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009363554.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X3 [Pyrus x bretschneideri]
Length=632

 Score =   233 bits (593),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT +LGRN+VVR+TE   GAK  +MIGSVKGINGGK+T+SVSCHQSLFPYL+YY
Sbjct  502  EDMIDFATTILGRNIVVRSTENVNGAKHDVMIGSVKGINGGKVTQSVSCHQSLFPYLLYY  561

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP +K K+NHGVAICH+DTSAW  THG+FLALGSGPG+IEVCHWI
Sbjct  562  CHSVPKVRVYEADLLDPVSKAKVNHGVAICHLDTSAWSPTHGSFLALGSGPGRIEVCHWI  621

Query  361  FENDMTWTVAD  393
            F+NDMTWT+AD
Sbjct  622  FQNDMTWTIAD  632



>ref|XP_011086565.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=634

 Score =   233 bits (593),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNV VR+TETT G+   IM+G VKGINGGK+TKSVSCHQSL+PYL+YY
Sbjct  504  EDMIDFATSVLGRNVAVRSTETTKGSNGKIMLGQVKGINGGKVTKSVSCHQSLYPYLLYY  563

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDPK+K KINHGVAICH+DTS+W   HGAF+ALGSGPGKIEVCHWI
Sbjct  564  CHSVPKVRVYEADILDPKSKAKINHGVAICHLDTSSWSPGHGAFIALGSGPGKIEVCHWI  623

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  624  FENDMTWTIAD  634



>ref|XP_009363551.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Pyrus x bretschneideri]
Length=646

 Score =   233 bits (593),  Expect = 7e-69, Method: Composition-based stats.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT +LGRN+VVR+TE   GAK  +MIGSVKGINGGK+T+SVSCHQSLFPYL+YY
Sbjct  516  EDMIDFATTILGRNIVVRSTENVNGAKHDVMIGSVKGINGGKVTQSVSCHQSLFPYLLYY  575

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP +K K+NHGVAICH+DTSAW  THG+FLALGSGPG+IEVCHWI
Sbjct  576  CHSVPKVRVYEADLLDPVSKAKVNHGVAICHLDTSAWSPTHGSFLALGSGPGRIEVCHWI  635

Query  361  FENDMTWTVAD  393
            F+NDMTWT+AD
Sbjct  636  FQNDMTWTIAD  646



>ref|XP_008340027.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=636

 Score =   232 bits (591),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT VLGRNVVVR+TE   GAK  +MIGSVKGINGGK+T+SVSCHQS+FPYL+YY
Sbjct  506  EDMIDFATTVLGRNVVVRSTENVNGAKHDVMIGSVKGINGGKVTQSVSCHQSMFPYLLYY  565

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP +K KINHGVAICH+DTSAW  THG+F+ALGSGPG+IEVCHWI
Sbjct  566  CHSVPKVRVYEADLLDPVSKAKINHGVAICHLDTSAWSPTHGSFMALGSGPGRIEVCHWI  625

Query  361  FENDMTWTVAD  393
            F+NDMTWT+AD
Sbjct  626  FQNDMTWTIAD  636



>ref|XP_010477679.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=623

 Score =   231 bits (590),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 106/131 (81%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VVVRTTE+  G+KQ +MIG+VKGINGGK+TKSVSCHQSL+PYL+YY
Sbjct  493  EDMIDFATSVLGRSVVVRTTESVAGSKQKVMIGNVKGINGGKVTKSVSCHQSLYPYLLYY  552

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDPK+K KINHG+AICH+DTSAWGA+HGAF++LGS PG+IEVCHWI
Sbjct  553  CHSVPKVRVYEADLLDPKSKAKINHGIAICHMDTSAWGASHGAFVSLGSKPGQIEVCHWI  612

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  613  FENDMNWAIAD  623



>ref|XP_010242994.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nelumbo nucifera]
Length=641

 Score =   231 bits (589),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VLG NVVVRTTE+  G+KQ +MIG+VKGINGGK+TKSVSCHQSLFP+LVYY
Sbjct  508  EDMIDFAVSVLGHNVVVRTTESVEGSKQNVMIGAVKGINGGKITKSVSCHQSLFPFLVYY  567

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+VPKVRVYEADIL+PK+K KINHGVAICH+DTSAW   HGAF+ALGS PGKIEVCHWI
Sbjct  568  CHAVPKVRVYEADILEPKSKAKINHGVAICHVDTSAWSPGHGAFVALGSSPGKIEVCHWI  627

Query  361  FENDMTWTVAD  393
            FENDMTW VAD
Sbjct  628  FENDMTWAVAD  638



>ref|XP_002525383.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
 gb|EEF37021.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
Length=631

 Score =   231 bits (588),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+IDFAT+VLGRNVV RTT    G+K+ I IGS+KGINGGK+T+SVSCHQSL+PYL+YY
Sbjct  501  EDLIDFATSVLGRNVVARTTANVNGSKKNIKIGSIKGINGGKVTESVSCHQSLYPYLLYY  560

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +  KINHGVAICH+DTS+W  THGAF+ALGSGPG+IEVCHWI
Sbjct  561  CHSVPKVRVYEADILDPNSNSKINHGVAICHLDTSSWSPTHGAFVALGSGPGRIEVCHWI  620

Query  361  FENDMTWTVAD  393
            FEND+TWT AD
Sbjct  621  FENDLTWTTAD  631



>ref|XP_006484316.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630-like 
[Citrus sinensis]
Length=632

 Score =   230 bits (587),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 105/131 (80%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG NV + TTE   G+KQ IMIG+VKGINGG++TKSVSCHQSL+PYL+YY
Sbjct  499  EDMIDFATSVLGNNVALHTTENAKGSKQDIMIGTVKGINGGEVTKSVSCHQSLYPYLLYY  558

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEADIL+PKT  KINHGVAICH+DTSAW ATHGAFL LGS PG+IEVCHWI
Sbjct  559  CHSVPEVRVYEADILEPKTMAKINHGVAICHLDTSAWSATHGAFLTLGSSPGRIEVCHWI  618

Query  361  FENDMTWTVAD  393
            FEND+TWT+AD
Sbjct  619  FENDLTWTIAD  629



>ref|XP_007223063.1| hypothetical protein PRUPE_ppa003712mg [Prunus persica]
 gb|EMJ24262.1| hypothetical protein PRUPE_ppa003712mg [Prunus persica]
Length=554

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT VLGRNVVVR+TE   GAK  +MIGSVKGINGGK+T+SVSCHQSLFPYL+YY
Sbjct  424  EDMIDFATTVLGRNVVVRSTENVNGAKHNVMIGSVKGINGGKVTQSVSCHQSLFPYLLYY  483

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP +K KINHGVAICH+DTSAW  THG+F+ALGSGPG+IEVCHWI
Sbjct  484  CHSVPKVRVYEADLLDPLSKAKINHGVAICHLDTSAWSPTHGSFMALGSGPGQIEVCHWI  543

Query  361  FENDMTWTVAD  393
            F+NDMTW +AD
Sbjct  544  FQNDMTWAIAD  554



>ref|XP_004298578.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Fragaria vesca subsp. vesca]
Length=624

 Score =   230 bits (587),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVVRTT+   GAK  I++GSVKGINGGK+T+SVSCHQSLFPYL+YY
Sbjct  494  EDMIDFATSVLGRNVVVRTTDNVSGAKGDIVVGSVKGINGGKVTQSVSCHQSLFPYLLYY  553

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP +K KINHGVAICH+DTSAW  THG+F ALGSGPG+IEVCHWI
Sbjct  554  CHSVPKVRVYEADLLDPTSKAKINHGVAICHLDTSAWSPTHGSFAALGSGPGRIEVCHWI  613

Query  361  FENDMTWTVAD  393
            F+ND+TWT+AD
Sbjct  614  FQNDLTWTIAD  624



>ref|XP_006365227.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=629

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVVRTTE T G+   IMIGSVKGINGGK+TKSVSCHQ+L+PYL+YY
Sbjct  499  EDMIDFATSVLGRNVVVRTTENTKGSNGNIMIGSVKGINGGKVTKSVSCHQTLYPYLLYY  558

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K KINHGVAICH+DTS+WG THGAF+ALGSGPGKIEVCHWI
Sbjct  559  CHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSWGPTHGAFVALGSGPGKIEVCHWI  618

Query  361  FENDMTWTVAD  393
            FENDMTW +AD
Sbjct  619  FENDMTWAIAD  629



>ref|XP_010555103.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=602

 Score =   229 bits (585),  Expect = 5e-68, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRN+V+RTTE   G+KQ +MIG V+ INGG++TKSVSCHQSL+PYL+YY
Sbjct  472  EDMIDFATSVLGRNIVLRTTENVAGSKQKMMIGKVRAINGGEVTKSVSCHQSLYPYLLYY  531

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE+D+LDP++K KINHGVAICHIDTSAWG +HGAF+ALGS PG+IEVCHWI
Sbjct  532  CHSVPKVRVYESDLLDPESKAKINHGVAICHIDTSAWGPSHGAFVALGSRPGQIEVCHWI  591

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  592  FENDMTWTIAD  602



>ref|XP_003552018.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=622

 Score =   230 bits (586),  Expect = 5e-68, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDF+T+VLGRNV V TTE   G+ + +M+G VKG+NGGK+TKSVSCHQSLFPYL+YY
Sbjct  492  EDMIDFSTSVLGRNVAVWTTENVKGSNKNVMVGRVKGMNGGKVTKSVSCHQSLFPYLLYY  551

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP++K KINHGVAICH+DT+AW  THGAFLALGSGPG+IEVCHWI
Sbjct  552  CHSVPKVRVYEADLLDPESKAKINHGVAICHLDTTAWSPTHGAFLALGSGPGRIEVCHWI  611

Query  361  FENDMTWTVAD  393
            FEND+TWT+AD
Sbjct  612  FENDLTWTIAD  622



>gb|KCW86731.1| hypothetical protein EUGRSUZ_B03343 [Eucalyptus grandis]
Length=610

 Score =   229 bits (584),  Expect = 6e-68, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT++LGRN+ VR+TE+  G+ + I+IG VKGINGG++TKSVSCHQSLFPYL+YY
Sbjct  480  EDMIDFATSILGRNMAVRSTESIEGSNRKILIGQVKGINGGEVTKSVSCHQSLFPYLLYY  539

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDPK + KINHGVAICH+DTSAW A+HGAFL LGS PG IEVCHWI
Sbjct  540  CHSVPKVRVYEADLLDPKLRTKINHGVAICHLDTSAWSASHGAFLTLGSSPGHIEVCHWI  599

Query  361  FENDMTWTVAD  393
            FENDMTWTVAD
Sbjct  600  FENDMTWTVAD  610



>gb|KDO38689.1| hypothetical protein CISIN_1g045773mg [Citrus sinensis]
Length=303

 Score =   221 bits (563),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG NV + TTE   G+KQ IMIG+VKGINGG++TKSVSCHQSL+PYL+YY
Sbjct  170  EDMIDFATSVLGNNVALHTTENAKGSKQDIMIGTVKGINGGEVTKSVSCHQSLYPYLLYY  229

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEADIL+PKT  KINHGVAICH+DTS+W ATH AFL LGS PG+IEVCHWI
Sbjct  230  CHSVPEVRVYEADILEPKTMAKINHGVAICHLDTSSWSATHEAFLTLGSSPGRIEVCHWI  289

Query  361  FENDMTWTVAD  393
            FEND+TWT+AD
Sbjct  290  FENDLTWTIAD  300



>ref|XP_002890594.1| hypothetical protein ARALYDRAFT_472637 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66853.1| hypothetical protein ARALYDRAFT_472637 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   229 bits (584),  Expect = 7e-68, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVV+RTTE+  G+KQ +MIG VKGINGG++TKSVSCHQSL+PYL+YY
Sbjct  493  EDMIDFATSVLGRNVVLRTTESVAGSKQKVMIGKVKGINGGRVTKSVSCHQSLYPYLLYY  552

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVR+YE+D+LDPK+K KINHG+AICH+DTSAWGA HGAF++LGS PG+IEVCHWI
Sbjct  553  CHSVPKVRIYESDLLDPKSKAKINHGIAICHMDTSAWGANHGAFMSLGSRPGQIEVCHWI  612

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  613  FENDMNWAIAD  623



>ref|XP_010044636.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=621

 Score =   229 bits (584),  Expect = 8e-68, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT++LGRN+ VR+TE+  G+ + I+IG VKGINGG++TKSVSCHQSLFPYL+YY
Sbjct  491  EDMIDFATSILGRNMAVRSTESIEGSNRKILIGQVKGINGGEVTKSVSCHQSLFPYLLYY  550

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDPK + KINHGVAICH+DTSAW A+HGAFL LGS PG IEVCHWI
Sbjct  551  CHSVPKVRVYEADLLDPKLRTKINHGVAICHLDTSAWSASHGAFLTLGSSPGHIEVCHWI  610

Query  361  FENDMTWTVAD  393
            FENDMTWTVAD
Sbjct  611  FENDMTWTVAD  621



>ref|XP_002311777.2| hypothetical protein POPTR_0008s19430g [Populus trichocarpa]
 gb|EEE89144.2| hypothetical protein POPTR_0008s19430g [Populus trichocarpa]
Length=633

 Score =   229 bits (583),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNV VRTT+   G+K+ IMIGS+KGINGG++T+SVSCHQ+L+PYL+YY
Sbjct  502  EDMIDFATSVLGRNVAVRTTDNVNGSKKNIMIGSIKGINGGRVTRSVSCHQTLYPYLLYY  561

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP +K  INHGVAICH+DTS+W  THGAFLALGSGPG+IEVCHWI
Sbjct  562  CHSVPKVRVYEADLLDPNSKATINHGVAICHLDTSSWSPTHGAFLALGSGPGRIEVCHWI  621

Query  361  FENDMTWTVAD  393
            FENDMTWT+A+
Sbjct  622  FENDMTWTIAE  632



>ref|XP_004238668.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2 [Solanum 
lycopersicum]
 sp|P93217.1|GP2_SOLLC RecName: Full=Polygalacturonase non-catalytic subunit AroGP2; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAB39556.1| AROGP2 [Solanum lycopersicum]
Length=629

 Score =   228 bits (582),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVVRTTE T G+K  IMIGS+KGINGGK+TKSVSCHQ+L+P L+YY
Sbjct  499  EDMIDFATSVLGRNVVVRTTENTNGSKGNIMIGSIKGINGGKVTKSVSCHQTLYPSLLYY  558

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K KINHGVAICH+DTS+WG  HGAF+ALGSGPGKIEVCHWI
Sbjct  559  CHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSWGPRHGAFIALGSGPGKIEVCHWI  618

Query  361  FENDMTWTVAD  393
            FENDMTW  AD
Sbjct  619  FENDMTWATAD  629



>ref|XP_010682558.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Beta vulgaris subsp. vulgaris]
Length=651

 Score =   229 bits (583),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VLGR+V  RT +   G+K  I+IG V+GINGGK+TKSVSCHQSL+PYL+YY
Sbjct  520  EDMIDFAVSVLGRSVEARTIDNVNGSKTDILIGKVRGINGGKITKSVSCHQSLYPYLLYY  579

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP TK KINHGVAICHIDTSAW  THGAF+ALG GPGKIEVCHWI
Sbjct  580  CHSVPKVRVYEADILDPSTKAKINHGVAICHIDTSAWSPTHGAFIALGPGPGKIEVCHWI  639

Query  361  FENDMTWTVAD  393
            FEND+TW VAD
Sbjct  640  FENDLTWAVAD  650



>ref|XP_006365229.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Solanum tuberosum]
Length=611

 Score =   228 bits (580),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVVRTTE T G+   IMIG+VKGINGGK+TKSVSCHQ+LFPYL+YY
Sbjct  481  EDMIDFATSVLGRNVVVRTTENTKGSNGNIMIGAVKGINGGKVTKSVSCHQTLFPYLLYY  540

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K  INHGVAICH+DTS WG  HGAF+ALGSGPGKIEVCHWI
Sbjct  541  CHSVPKVRVYEADILDPNSKANINHGVAICHVDTSLWGPKHGAFIALGSGPGKIEVCHWI  600

Query  361  FENDMTWTVAD  393
            FENDMTW  AD
Sbjct  601  FENDMTWATAD  611



>ref|NP_001234835.1| polygalacturonase-1 non-catalytic subunit beta precursor [Solanum 
lycopersicum]
 sp|Q40161.1|GP1_SOLLC RecName: Full=Polygalacturonase-1 non-catalytic subunit beta; 
AltName: Full=AroGP1; AltName: Full=Polygalacturonase converter; 
Short=PG converter; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34181.1| polygalacturonase isoenzyme 1 beta subunit [Solanum lycopersicum]
 gb|AAB39547.1| polygalacturonase isoenzyme 1 beta subunit [Solanum lycopersicum]
Length=630

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVVRTTE T G+   IMIGSVKGINGGK+TKSVSCHQ+L+PYL+YY
Sbjct  500  EDMIDFATSVLGRNVVVRTTEDTKGSNGNIMIGSVKGINGGKVTKSVSCHQTLYPYLLYY  559

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K KINHGVAICH+DTS+WG +HGAF+ALGSGPGKIEVCHWI
Sbjct  560  CHSVPKVRVYEADILDPNSKVKINHGVAICHVDTSSWGPSHGAFVALGSGPGKIEVCHWI  619

Query  361  FENDMTWTVAD  393
            FENDMTW +AD
Sbjct  620  FENDMTWAIAD  630



>ref|XP_004142981.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
 gb|KGN62285.1| hypothetical protein Csa_2G348230 [Cucumis sativus]
Length=623

 Score =   227 bits (579),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVV+TTE T G+K  IMIG VKG+NGGK+T+SVSCHQSLFPYL+YY
Sbjct  493  EDMIDFATSVLGRNVVVQTTENTKGSKGNIMIGKVKGMNGGKVTESVSCHQSLFPYLLYY  552

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE D+LDP TK  +NHGVAICH+DTSAW   HGAF+ALGS PG++EVCHWI
Sbjct  553  CHSVPKVRVYEVDLLDPATKATVNHGVAICHLDTSAWSPAHGAFIALGSAPGRVEVCHWI  612

Query  361  FENDMTWTVAD  393
            FENDMTWTVAD
Sbjct  613  FENDMTWTVAD  623



>ref|XP_006365228.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Solanum tuberosum]
Length=632

 Score =   227 bits (579),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDF T+VLGRNVVVRTTE T G+   IMIGSVKGINGGK+TKSVSCHQ+L+P L+YY
Sbjct  502  EDMIDFTTSVLGRNVVVRTTENTKGSNGNIMIGSVKGINGGKVTKSVSCHQTLYPSLLYY  561

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVY+ADILDP +K KINHGVAICH+DTS+WG +HGAF+ALGSGPGKIEVCHWI
Sbjct  562  CHSVPKVRVYQADILDPNSKAKINHGVAICHVDTSSWGPSHGAFIALGSGPGKIEVCHWI  621

Query  361  FENDMTWTVAD  393
            FENDMTWT AD
Sbjct  622  FENDMTWTTAD  632



>ref|XP_004173618.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like, 
partial [Cucumis sativus]
Length=612

 Score =   227 bits (578),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVV+TTE T G+K  IMIG VKG+NGGK+T+SVSCHQSLFPYL+YY
Sbjct  482  EDMIDFATSVLGRNVVVQTTENTKGSKGNIMIGKVKGMNGGKVTESVSCHQSLFPYLLYY  541

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE D+LDP TK  +NHGVAICH+DTSAW   HGAF+ALGS PG++EVCHWI
Sbjct  542  CHSVPKVRVYEVDLLDPATKATVNHGVAICHLDTSAWSPAHGAFIALGSAPGRVEVCHWI  601

Query  361  FENDMTWTVAD  393
            FENDMTWTVAD
Sbjct  602  FENDMTWTVAD  612



>ref|XP_003613234.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96192.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=630

 Score =   227 bits (578),  Expect = 8e-67, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVVRTTE   G+K+ +M+G V GINGGK+T+SVSCHQSLFPYL+YY
Sbjct  500  EDMIDFATSVLGRNVVVRTTENVNGSKKDVMVGRVNGINGGKVTRSVSCHQSLFPYLLYY  559

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVY+A++LDPK+KDKIN GVA+CH+DTS W  THGAF++LGSGPG+IEVCHWI
Sbjct  560  CHSVPKVRVYQAELLDPKSKDKINQGVAVCHLDTSDWSPTHGAFMSLGSGPGRIEVCHWI  619

Query  361  FENDMTWTVAD  393
            FEND++WTVAD
Sbjct  620  FENDLSWTVAD  630



>ref|XP_008221868.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=619

 Score =   226 bits (577),  Expect = 9e-67, Method: Composition-based stats.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG NVVVRTT+   G+   ++IGSVKGINGG +TKSVSCHQSLFPYLVYY
Sbjct  489  EDMIDFATSVLGTNVVVRTTDNVNGSSDDVLIGSVKGINGGNVTKSVSCHQSLFPYLVYY  548

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP +K KINHGVAICH+DTSAW  THGAF+ALGSGPG+IEVCHWI
Sbjct  549  CHSVPKVRVYEADLLDPISKAKINHGVAICHLDTSAWSPTHGAFVALGSGPGRIEVCHWI  608

Query  361  FENDMTWTVAD  393
            F+NDMTW VAD
Sbjct  609  FQNDMTWAVAD  619



>ref|XP_010498883.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=633

 Score =   227 bits (578),  Expect = 9e-67, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VVVRTTE+  G+KQ +MIG+VKGINGG +TKSVSCHQSL+PYL+YY
Sbjct  503  EDMIDFATSVLGRSVVVRTTESVAGSKQKVMIGNVKGINGGNVTKSVSCHQSLYPYLLYY  562

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE+D+LDPK+K KINHG+AICH+DTSAWGA+HGAF++LGS PG IEVCHWI
Sbjct  563  CHSVPKVRVYESDLLDPKSKAKINHGIAICHMDTSAWGASHGAFVSLGSKPGLIEVCHWI  622

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  623  FENDMNWAIAD  633



>ref|XP_006438393.1| hypothetical protein CICLE_v10033917mg [Citrus clementina]
 gb|ESR51633.1| hypothetical protein CICLE_v10033917mg [Citrus clementina]
Length=618

 Score =   226 bits (577),  Expect = 9e-67, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG NV + TTE   G+KQ IMIG VKGINGG++TKSVSCHQSL+PYL+YY
Sbjct  485  EDMIDFATSVLGNNVALHTTENAKGSKQDIMIGMVKGINGGEVTKSVSCHQSLYPYLLYY  544

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEADIL+PKT  KINHGVAICH+DTS+W  THGAFL LGS PG+IEVCHWI
Sbjct  545  CHSVPEVRVYEADILEPKTMAKINHGVAICHLDTSSWSTTHGAFLTLGSSPGRIEVCHWI  604

Query  361  FENDMTWTVAD  393
            FEND+TWT+AD
Sbjct  605  FENDLTWTIAD  615



>ref|XP_004238667.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP3 [Solanum 
lycopersicum]
 sp|P93218.1|GP3_SOLLC RecName: Full=Polygalacturonase non-catalytic subunit AroGP3; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAB39557.1| AROGP3 [Solanum lycopersicum]
Length=632

 Score =   226 bits (577),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVVRTTE T G+K  IMIGS+KGINGGK+TKSVSCHQ+L+P L+YY
Sbjct  502  EDMIDFATSVLGRNVVVRTTENTNGSKGNIMIGSIKGINGGKVTKSVSCHQTLYPSLLYY  561

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K KINHGVAICH+DTS+WG  HGAF+ALGSGPGKIEVCHWI
Sbjct  562  CHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSSWGPRHGAFVALGSGPGKIEVCHWI  621

Query  361  FENDMTWTVAD  393
            FENDMTW  AD
Sbjct  622  FENDMTWATAD  632



>ref|XP_007224206.1| hypothetical protein PRUPE_ppa017408mg [Prunus persica]
 gb|EMJ25405.1| hypothetical protein PRUPE_ppa017408mg [Prunus persica]
Length=620

 Score =   226 bits (576),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG NVVVRTT+   G+   ++IGSVKGINGG +TKSVSCHQSLFPYL+YY
Sbjct  489  EDMIDFATSVLGTNVVVRTTDNVNGSSHEVLIGSVKGINGGNVTKSVSCHQSLFPYLLYY  548

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP +K KINHGVAICH+DTSAW  THGAF+ALGSGPG+IEVCHWI
Sbjct  549  CHSVPKVRVYEADLLDPISKAKINHGVAICHLDTSAWSPTHGAFVALGSGPGRIEVCHWI  608

Query  361  FENDMTWTVAD  393
            F+NDMTW VAD
Sbjct  609  FQNDMTWAVAD  619



>ref|XP_011071083.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=628

 Score =   226 bits (576),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 108/131 (82%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNV VRTTE T G+   I IG VKGINGG +TKSVSCHQSLFPYLVYY
Sbjct  498  EDMIDFATSVLGRNVAVRTTENTQGSNGNITIGQVKGINGGNVTKSVSCHQSLFPYLVYY  557

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILD ++K +INHGVAICH+DTS+W   HGAF+ALGSGPGKIEVCHWI
Sbjct  558  CHSVPKVRVYEADILDAESKARINHGVAICHLDTSSWSPGHGAFIALGSGPGKIEVCHWI  617

Query  361  FENDMTWTVAD  393
            FENDMTWTVAD
Sbjct  618  FENDMTWTVAD  628



>ref|XP_008444317.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Cucumis melo]
Length=623

 Score =   226 bits (576),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVVRTTE T G+K  IMIG VKG+NGGK+T+SVSCHQSLFPYL+YY
Sbjct  493  EDMIDFATSVLGRNVVVRTTENTKGSKGNIMIGKVKGMNGGKVTESVSCHQSLFPYLLYY  552

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE D+LDP +K  INHGVAICH+DTSAW   HGAF+ALGS PG++EVCHWI
Sbjct  553  CHSVPKVRVYEVDLLDPASKATINHGVAICHLDTSAWSPAHGAFIALGSAPGRVEVCHWI  612

Query  361  FENDMTWTVAD  393
            FENDMTWTVAD
Sbjct  613  FENDMTWTVAD  623



>ref|XP_004238669.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum lycopersicum]
Length=622

 Score =   226 bits (575),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 108/131 (82%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDF+T+VLG+NVV+RTTE   G+K  I+IGSVK  N GK+TKSVSCHQSLFPYLVYY
Sbjct  492  EDMIDFSTSVLGQNVVLRTTENIKGSKGDILIGSVKRTNDGKVTKSVSCHQSLFPYLVYY  551

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K KINHGVAICH+DTSAWGA HGAF ALGSGPGKIEVCHWI
Sbjct  552  CHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSAWGANHGAFTALGSGPGKIEVCHWI  611

Query  361  FENDMTWTVAD  393
            FENDM W VAD
Sbjct  612  FENDMNWAVAD  622



>ref|XP_003532010.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=627

 Score =   226 bits (575),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 99/131 (76%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDF+T+VLGRNV V TTE   G+ + +M+G VKG+NGGK+T+SVSCHQSLFPY++YY
Sbjct  497  EDMIDFSTSVLGRNVAVWTTENVNGSNKNVMVGRVKGMNGGKVTQSVSCHQSLFPYMLYY  556

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVY+AD+LDP++K KINHGVAICH+DT+AW  THGAF+ALGSGPG+IEVCHWI
Sbjct  557  CHSVPKVRVYQADLLDPESKAKINHGVAICHLDTTAWSPTHGAFMALGSGPGRIEVCHWI  616

Query  361  FENDMTWTVAD  393
            FEND+TWT+AD
Sbjct  617  FENDLTWTIAD  627



>gb|KHN00353.1| Polygalacturonase-1 non-catalytic subunit beta [Glycine soja]
Length=437

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNV VRTT+   G+K+++++G V+GINGGK+T+SVSCHQSLFPYL+YY
Sbjct  307  EDMIDFATSVLGRNVAVRTTQNVNGSKKSVVVGPVRGINGGKVTQSVSCHQSLFPYLLYY  366

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+VPKVRVYEAD+LDPKTK KIN GVAICH+DTS W  THGAFL+LGS PG+IEVCHWI
Sbjct  367  CHAVPKVRVYEADLLDPKTKAKINRGVAICHLDTSDWSPTHGAFLSLGSVPGRIEVCHWI  426

Query  361  FENDMTWTVAD  393
            FENDM WT+AD
Sbjct  427  FENDMAWTIAD  437



>ref|XP_010460151.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=623

 Score =   225 bits (573),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+IDFAT+VLGR+VVVRTTE+  G+KQ +MIG+VKGINGG +TKSVSCHQSL+PYL+YY
Sbjct  493  EDIIDFATSVLGRSVVVRTTESVAGSKQKVMIGNVKGINGGNVTKSVSCHQSLYPYLLYY  552

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDPK+K KINHG+ ICH+DTSAWGA+HGAF++LGS PG+IEVCHWI
Sbjct  553  CHSVPKVRVYEADLLDPKSKAKINHGIGICHMDTSAWGASHGAFVSLGSRPGQIEVCHWI  612

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  613  FENDMNWAIAD  623



>gb|KDO69699.1| hypothetical protein CISIN_1g0378481mg, partial [Citrus sinensis]
Length=148

 Score =   211 bits (538),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVV RTT+   G+K+ + I SV GINGGK+TKSVSCHQSL+PYL+YY
Sbjct  18   EDMIDFATSVLGRNVVARTTQNANGSKRRVTISSVSGINGGKVTKSVSCHQSLYPYLLYY  77

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LD  +  KINHGVAICHIDTS+W   HGAF+ALGSGPG+IEVCHWI
Sbjct  78   CHSVPKVRVYEADVLDVVSNAKINHGVAICHIDTSSWSPGHGAFVALGSGPGQIEVCHWI  137

Query  361  FENDMTWTVAD  393
            FENDMTWT AD
Sbjct  138  FENDMTWTSAD  148



>ref|XP_011009539.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=633

 Score =   225 bits (573),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+IDF  +VLGRNV VRTT+   G+K+ + IGS+KGINGG++TKSVSCHQSL+PYL+YY
Sbjct  501  EDLIDFVISVLGRNVAVRTTDNVEGSKKNVTIGSIKGINGGRVTKSVSCHQSLYPYLLYY  560

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP +K KINHGVAICH+DTS+W  THGAFLALGSGPG+IEVCHWI
Sbjct  561  CHSVPKVRVYEADLLDPNSKTKINHGVAICHLDTSSWSPTHGAFLALGSGPGRIEVCHWI  620

Query  361  FENDMTWTVAD  393
            FENDMTWT+A+
Sbjct  621  FENDMTWTIAE  631



>ref|XP_004514684.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
isoform X1 [Cicer arietinum]
 ref|XP_004514685.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
isoform X2 [Cicer arietinum]
Length=630

 Score =   225 bits (573),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVVRTT+   G+K  +M+G V GINGGK+T+SVSCHQSLFPYL+YY
Sbjct  500  EDMIDFATSVLGRNVVVRTTKNLNGSKGNVMVGRVNGINGGKITRSVSCHQSLFPYLLYY  559

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP VRVY+ D+LDPKTK KIN GVA+CH+DTS W  +HGAFL+LGSGPG+IEVCHWI
Sbjct  560  CHSVPMVRVYQVDLLDPKTKSKINQGVAVCHLDTSDWSPSHGAFLSLGSGPGRIEVCHWI  619

Query  361  FENDMTWTVAD  393
            FENDM+WTVAD
Sbjct  620  FENDMSWTVAD  630



>gb|KEH20007.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=627

 Score =   224 bits (571),  Expect = 6e-66, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG +V VR+TE+  G+ + +M+G VKGINGGK+T+SVSCHQSLFPYL+YY
Sbjct  497  EDMIDFATSVLGHDVTVRSTESVNGSGKNVMVGRVKGINGGKVTESVSCHQSLFPYLLYY  556

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP++K KINHGVAICH+DT+AW  THGAF+ALGSGPGKIEVCHWI
Sbjct  557  CHSVPKVRVYEADLLDPESKVKINHGVAICHLDTTAWSPTHGAFMALGSGPGKIEVCHWI  616

Query  361  FENDMTWTVAD  393
            FENDMTWT  D
Sbjct  617  FENDMTWTTTD  627



>ref|XP_011044316.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=637

 Score =   224 bits (572),  Expect = 6e-66, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VLGRNV VRTTE   G+K+ +MIGSV+GINGGK+TKSVSCHQSL+PYL+YY
Sbjct  505  EDMIDFAVSVLGRNVTVRTTENINGSKKRVMIGSVEGINGGKVTKSVSCHQSLYPYLLYY  564

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEADI+D  +K+KIN GVAICH+DTSAWG+ HGAF+ALGS PGKIEVCHWI
Sbjct  565  CHSVPRVRVYEADIVDVASKEKINVGVAICHLDTSAWGSEHGAFVALGSSPGKIEVCHWI  624

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  625  FENDMTWTIAD  635



>ref|XP_006365231.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase non-catalytic 
subunit AroGP3-like [Solanum tuberosum]
Length=628

 Score =   224 bits (571),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG NVVVRTTE T G+K  IMIG+VKGINGGK+TKSVSCHQ+LFPYL+YY
Sbjct  498  EDMIDFATSVLGGNVVVRTTENTKGSKGNIMIGAVKGINGGKVTKSVSCHQTLFPYLLYY  557

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP +K KINHGVAICH+DTS WG  HGAF+ALGSGPGKIEVCHWI
Sbjct  558  CHSVPKVRVYEADILDPNSKAKINHGVAICHVDTSLWGPKHGAFIALGSGPGKIEVCHWI  617

Query  361  FENDMTWTVAD  393
            FENDMTW  AD
Sbjct  618  FENDMTWATAD  628



>ref|XP_003519820.2| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=628

 Score =   224 bits (571),  Expect = 7e-66, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNV VRTT+   G+K+++++G V+GINGGK+T+SVSCHQSLFPYL+YY
Sbjct  498  EDMIDFATSVLGRNVAVRTTQNVNGSKKSVVVGPVRGINGGKVTQSVSCHQSLFPYLLYY  557

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+VPKVRVYEAD+LDPKTK KIN GVAICH+DTS W  THGAFL+LGS PG+IEVCHWI
Sbjct  558  CHAVPKVRVYEADLLDPKTKAKINRGVAICHLDTSDWSPTHGAFLSLGSVPGRIEVCHWI  617

Query  361  FENDMTWTVAD  393
            FENDM WT+AD
Sbjct  618  FENDMAWTIAD  628



>ref|XP_007036187.1| Polygalacturonase 2, putative [Theobroma cacao]
 gb|EOY20688.1| Polygalacturonase 2, putative [Theobroma cacao]
Length=628

 Score =   224 bits (571),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT VLG NV VRTT+   G+KQ IM+G +KGINGGK+TKSVSCHQSL+PYL+YY
Sbjct  498  EDMIDFATLVLGHNVAVRTTKNVEGSKQEIMLGKIKGINGGKVTKSVSCHQSLYPYLLYY  557

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEA+ILD K+KDKINHGVAICH+DTS W  +HGAF+ALGS PG+IEVCHWI
Sbjct  558  CHSVPEVRVYEAEILDVKSKDKINHGVAICHLDTSTWSPSHGAFVALGSSPGRIEVCHWI  617

Query  361  FENDMTWTVAD  393
            F+NDMTWT+A+
Sbjct  618  FQNDMTWTIAN  628



>gb|KHG01313.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=616

 Score =   224 bits (570),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDM+DFAT+VLGRNV VRTT+   G+K+ IMIGSV  I+GGK+TKSVSCHQSL+PYL+YY
Sbjct  485  EDMVDFATSVLGRNVEVRTTQNVNGSKKNIMIGSVGKIDGGKVTKSVSCHQSLYPYLLYY  544

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEA ILDP + +KINHGVAICH+DTS+W + HGAFLALGSGPG+IEVCHWI
Sbjct  545  CHSVPKVRVYEAGILDPDSMEKINHGVAICHLDTSSWSSGHGAFLALGSGPGRIEVCHWI  604

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  605  FENDMTWTIAD  615



>ref|XP_007141610.1| hypothetical protein PHAVU_008G210500g [Phaseolus vulgaris]
 gb|ESW13604.1| hypothetical protein PHAVU_008G210500g [Phaseolus vulgaris]
Length=611

 Score =   223 bits (569),  Expect = 9e-66, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDM+DFAT VLG NVVVRTTE   G+K  +M+G V GINGG++T+SVSCHQSLFPYL+YY
Sbjct  481  EDMVDFATGVLGSNVVVRTTENVKGSKGNVMVGWVNGINGGRVTESVSCHQSLFPYLLYY  540

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDPK+K KIN GVAICH+DTSAW  +HGAFLALGSGPG+IEVCHWI
Sbjct  541  CHSVPKVRVYEADLLDPKSKAKINRGVAICHLDTSAWSPSHGAFLALGSGPGQIEVCHWI  600

Query  361  FENDMTWTVAD  393
            FENDMTWT+ D
Sbjct  601  FENDMTWTIGD  611



>ref|XP_007153633.1| hypothetical protein PHAVU_003G052000g [Phaseolus vulgaris]
 gb|ESW25627.1| hypothetical protein PHAVU_003G052000g [Phaseolus vulgaris]
Length=624

 Score =   224 bits (570),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG NV V TT+   G  + +M+G VKG+NGGK+TKSVSCHQSLFPYL+YY
Sbjct  494  EDMIDFATSVLGHNVGVWTTQNVNGFSKNVMVGRVKGMNGGKVTKSVSCHQSLFPYLLYY  553

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP++K KINHGVAICH+DT+AW  THGAF+ALGS PG+IEVCHWI
Sbjct  554  CHSVPKVRVYEADLLDPESKAKINHGVAICHLDTTAWSPTHGAFVALGSSPGRIEVCHWI  613

Query  361  FENDMTWTVAD  393
            FENDMTWTVAD
Sbjct  614  FENDMTWTVAD  624



>ref|XP_011034135.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=636

 Score =   224 bits (570),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 104/134 (78%), Positives = 120/134 (90%), Gaps = 3/134 (2%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNV VRTT+   G+K+ IMIGS+KGINGG++T+SVSCHQSL+PYL+YY
Sbjct  502  EDMIDFATSVLGRNVAVRTTDNVNGSKKNIMIGSIKGINGGRVTRSVSCHQSLYPYLLYY  561

Query  181  CHSVPKVRVYEAD---ILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVC  351
            CHSVPKVRVYEAD   +LDP +K  INHGVAICH+DTS+W  THGAFLALG GPG+IEVC
Sbjct  562  CHSVPKVRVYEADEADLLDPNSKATINHGVAICHLDTSSWSPTHGAFLALGPGPGRIEVC  621

Query  352  HWIFENDMTWTVAD  393
            HWIFENDMTWT+AD
Sbjct  622  HWIFENDMTWTIAD  635



>ref|NP_173788.1| putative polygalacturonase non-catalytic subunit JP630 [Arabidopsis 
thaliana]
 sp|P92982.2|JP630_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
JP630; AltName: Full=Aromatic-rich glycoprotein JP630; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC98031.1| Identical to gb|ATU59467 aromatic rich glycoprotein which is 
strongly similar to gb|U63373 polygalacturonase isozyme 1 from 
Arabidopsis thaliana. EST gb|AA395212 comes from this gene 
[Arabidopsis thaliana]
 gb|AEE30429.1| putative polygalacturonase non-catalytic subunit JP630 [Arabidopsis 
thaliana]
Length=622

 Score =   223 bits (569),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE+  G+K+ +MIG V GINGG++TKSVSCHQSL+PYL+YY
Sbjct  492  EDMIDFATSVLGRSVVLRTTESVAGSKEKVMIGKVNGINGGRVTKSVSCHQSLYPYLLYY  551

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE+D+LDPK+K KINHG+AICH+DTSAWGA HGAF+ LGS PG+IEVCHWI
Sbjct  552  CHSVPKVRVYESDLLDPKSKAKINHGIAICHMDTSAWGANHGAFMLLGSRPGQIEVCHWI  611

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  612  FENDMNWAIAD  622



>ref|XP_002314620.2| hypothetical protein POPTR_0010s05000g [Populus trichocarpa]
 gb|EEF00791.2| hypothetical protein POPTR_0010s05000g [Populus trichocarpa]
Length=633

 Score =   223 bits (569),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+IDF  +VLGRNV VRTT+   G+K+ + IG++KGINGG++TKSVSCHQSL+PYL+YY
Sbjct  501  EDLIDFVISVLGRNVAVRTTDNVEGSKKNVTIGTIKGINGGRVTKSVSCHQSLYPYLLYY  560

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP +K KINHGVAICH+DTS+W  THGAFLALGSGPG+IEVCHWI
Sbjct  561  CHSVPKVRVYEADLLDPNSKTKINHGVAICHLDTSSWSPTHGAFLALGSGPGRIEVCHWI  620

Query  361  FENDMTWTVAD  393
            FENDMTWT+A+
Sbjct  621  FENDMTWTLAE  631



>dbj|BAE99852.1| putative polygalacuronase isoenzyme 1 beta subunit [Arabidopsis 
thaliana]
Length=622

 Score =   223 bits (568),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE+  G+K+ +MIG V GINGG++TKSVSCHQSL+PYL+YY
Sbjct  492  EDMIDFATSVLGRSVVLRTTESVAGSKEKVMIGKVNGINGGRVTKSVSCHQSLYPYLLYY  551

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE+D+LDPK+K KINHG+AICH+DTSAWGA HGAF+ LGS PG+IEVCHWI
Sbjct  552  CHSVPKVRVYESDLLDPKSKAKINHGIAICHMDTSAWGANHGAFMLLGSRPGQIEVCHWI  611

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  612  FENDMNWAIAD  622



>ref|XP_007157462.1| hypothetical protein PHAVU_002G071500g [Phaseolus vulgaris]
 gb|ESW29456.1| hypothetical protein PHAVU_002G071500g [Phaseolus vulgaris]
Length=626

 Score =   223 bits (568),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 97/131 (74%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNV VR+TE+  G+K+++M+G V GINGGK+T+SVSCHQSLFPYL+YY
Sbjct  496  EDMIDFATSVLGRNVAVRSTESVNGSKKSVMVGPVTGINGGKVTQSVSCHQSLFPYLLYY  555

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+VPKVR+Y+AD+LDPK+K KIN G+AICH+DTS W  THGAFL+LGS PG+IEVCHWI
Sbjct  556  CHAVPKVRLYQADLLDPKSKTKINRGIAICHLDTSDWSPTHGAFLSLGSAPGRIEVCHWI  615

Query  361  FENDMTWTVAD  393
            F+NDM WT+AD
Sbjct  616  FQNDMAWTIAD  626



>ref|XP_010427809.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Camelina sativa]
 ref|XP_010427810.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Camelina sativa]
Length=625

 Score =   223 bits (568),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE   G+KQ ++IG VKGINGGK+TK+VSCHQSL+PYL+YY
Sbjct  495  EDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVKGINGGKVTKAVSCHQSLYPYLLYY  554

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADIL+  +K KINHG+AICH+DTS+WGATHGAFLALGS PG+IEVCHWI
Sbjct  555  CHSVPKVRVYEADILEIDSKKKINHGIAICHMDTSSWGATHGAFLALGSKPGRIEVCHWI  614

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  615  FENDMNWAIAD  625



>gb|AAB39538.1| aromatic rich glycoprotein JP630 [Arabidopsis thaliana]
Length=622

 Score =   223 bits (568),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE+  G+K+ +MIG V GINGG++TKSVSCHQSL+PYL+YY
Sbjct  492  EDMIDFATSVLGRSVVLRTTESVAGSKEKVMIGKVNGINGGRVTKSVSCHQSLYPYLLYY  551

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE+D+LDPK+K KINHG+AICH+DTSAWGA HGAF+ LGS PG+IEVCHWI
Sbjct  552  CHSVPKVRVYESDLLDPKSKAKINHGIAICHMDTSAWGANHGAFMLLGSRPGQIEVCHWI  611

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  612  FENDMNWAIAD  622



>ref|XP_010101197.1| hypothetical protein L484_015001 [Morus notabilis]
 gb|EXB87871.1| hypothetical protein L484_015001 [Morus notabilis]
Length=637

 Score =   223 bits (568),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VLGR+V VRTTE   G+K  +MIG V+GINGG +TKSVSCHQS FPYL+YY
Sbjct  506  EDMIDFAISVLGRDVAVRTTENVSGSKGEVMIGKVRGINGGNVTKSVSCHQSFFPYLLYY  565

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILD K+K KINHG+AICH+DTS+W  +HGAF+ALGSGPGKIEVCHWI
Sbjct  566  CHSVPKVRVYEADILDVKSKAKINHGIAICHLDTSSWAPSHGAFVALGSGPGKIEVCHWI  625

Query  361  FENDMTWTVAD  393
            FENDMTWTVAD
Sbjct  626  FENDMTWTVAD  636



>ref|XP_006476763.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390-like 
[Citrus sinensis]
Length=624

 Score =   222 bits (566),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVV RTT+   G+KQ + I SV GINGGK+TKSVSCHQSL+PYL+YY
Sbjct  494  EDMIDFATSVLGRNVVARTTQNVNGSKQRVTISSVSGINGGKVTKSVSCHQSLYPYLLYY  553

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILD ++  KINHGVAICHIDTS+W   HGAF+ALGSGPG+IEVCHWI
Sbjct  554  CHSVPKVRVYEADILDVESNAKINHGVAICHIDTSSWSPGHGAFVALGSGPGQIEVCHWI  613

Query  361  FENDMTWTVAD  393
            FENDMTWT AD
Sbjct  614  FENDMTWTSAD  624



>ref|XP_004509821.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=624

 Score =   222 bits (565),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNV VR+TE   G+ + IM+G V GINGGK+TKSV CHQSLFPYL+YY
Sbjct  494  EDMIDFATSVLGRNVTVRSTENVNGSGKNIMVGRVNGINGGKVTKSVWCHQSLFPYLLYY  553

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP++K K+NHGVAICH+DT+ W  +HGAF+ALG GPG+IEVCHWI
Sbjct  554  CHSVPKVRVYEADLLDPESKVKVNHGVAICHLDTTTWSPSHGAFMALGFGPGRIEVCHWI  613

Query  361  FENDMTWTVAD  393
            FENDMTWT AD
Sbjct  614  FENDMTWTTAD  624



>gb|EPS67761.1| polygalacturonase-1 non-catalytic subunit beta, partial [Genlisea 
aurea]
Length=608

 Score =   221 bits (564),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+V VRTT TT G+   IM+G + GINGGK+TKSVSCHQSL+PYL+YY
Sbjct  478  EDMIDFATSVLGRSVAVRTTATTAGSDGQIMLGRIAGINGGKVTKSVSCHQSLYPYLLYY  537

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP TK KINHGVAICH+DT++W   HGAF+ALG GPGKIEVCHWI
Sbjct  538  CHSVPKVRVYEADILDPNTKSKINHGVAICHLDTTSWSPDHGAFVALGPGPGKIEVCHWI  597

Query  361  FENDMTWTVAD  393
            FENDM W VAD
Sbjct  598  FENDMNWAVAD  608



>gb|EYU22487.1| hypothetical protein MIMGU_mgv1a002927mg [Erythranthe guttata]
Length=624

 Score =   221 bits (564),  Expect = 8e-65, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDF+T+VLGRNVVV TTE T G+   I IG VKG+NGGK+TKSVSCHQSLFPY++YY
Sbjct  494  EDMIDFSTSVLGRNVVVHTTENTRGSNGNITIGKVKGVNGGKVTKSVSCHQSLFPYMLYY  553

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEA ILDPK++ KIN+GVAICH+DTS+W   HGAF+ALGSGPGKIEVCHWI
Sbjct  554  CHSVPKVRVYEAVILDPKSRAKINNGVAICHLDTSSWSPGHGAFIALGSGPGKIEVCHWI  613

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  614  FENDMTWTIAD  624



>gb|EYU31262.1| hypothetical protein MIMGU_mgv1a002697mg [Erythranthe guttata]
Length=646

 Score =   222 bits (565),  Expect = 8e-65, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT VLGRNVVVRTT  T G    I++G VKG+NGGK+T+SVSCHQSL+PYL+YY
Sbjct  516  EDMIDFATTVLGRNVVVRTTANTAGHGGDILLGEVKGVNGGKVTRSVSCHQSLYPYLLYY  575

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDP TK KINHGVAICH+DTS+W   HG+F+ LGSGPGKIEVCHWI
Sbjct  576  CHSVPKVRVYEADILDPNTKTKINHGVAICHLDTSSWSPGHGSFVLLGSGPGKIEVCHWI  635

Query  361  FENDMTWTVAD  393
            FENDMTW VAD
Sbjct  636  FENDMTWAVAD  646



>gb|KHG12475.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=649

 Score =   222 bits (565),  Expect = 8e-65, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG +V VRTTE   G+KQ IMIG VKGINGG++TKSVSCHQSL+PYL+YY
Sbjct  519  EDMIDFATSVLGLSVTVRTTENVKGSKQEIMIGEVKGINGGEVTKSVSCHQSLYPYLLYY  578

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVR YEA+ILD  +K KINHGVAICH+DTSAW  THGAFLALGS PG++EVCHWI
Sbjct  579  CHSVPKVRGYEAEILDVTSKSKINHGVAICHLDTSAWSPTHGAFLALGSSPGQVEVCHWI  638

Query  361  FENDMTWTVAD  393
            FENDMTWT+ D
Sbjct  639  FENDMTWTIVD  649



>ref|XP_010471032.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Camelina sativa]
Length=624

 Score =   221 bits (563),  Expect = 9e-65, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTT+   G+KQ ++IG V GINGGK+TK+VSCHQSL+PYL+YY
Sbjct  494  EDMIDFATSVLGRSVVLRTTDNVAGSKQKVVIGKVNGINGGKVTKAVSCHQSLYPYLLYY  553

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADIL+  +K KINHG+AICH+DTS+WGATHGAFLALGS PG+IEVCHWI
Sbjct  554  CHSVPKVRVYEADILEIDSKKKINHGIAICHMDTSSWGATHGAFLALGSKPGRIEVCHWI  613

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  614  FENDMNWAIAD  624



>ref|XP_010471031.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Camelina sativa]
Length=624

 Score =   221 bits (563),  Expect = 9e-65, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTT+   G+KQ ++IG V GINGGK+TK+VSCHQSL+PYL+YY
Sbjct  494  EDMIDFATSVLGRSVVLRTTDNVAGSKQKVVIGKVNGINGGKVTKAVSCHQSLYPYLLYY  553

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADIL+  +K KINHG+AICH+DTS+WGATHGAFLALGS PG+IEVCHWI
Sbjct  554  CHSVPKVRVYEADILEIDSKKKINHGIAICHMDTSSWGATHGAFLALGSKPGRIEVCHWI  613

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  614  FENDMNWAIAD  624



>ref|XP_003517743.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=629

 Score =   221 bits (563),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 98/129 (76%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNV VRTT+   G+K+++++G V+GINGGK+T+SVSCHQSLFPYL+YY
Sbjct  499  EDMIDFATSVLGRNVAVRTTQNVNGSKKSVVVGPVRGINGGKVTQSVSCHQSLFPYLLYY  558

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+VPKVRVYEAD+LDPKTK KIN GVAICH+DTS W  THGAF++LGSGPG+IEVCHWI
Sbjct  559  CHAVPKVRVYEADLLDPKTKVKINRGVAICHLDTSDWSPTHGAFISLGSGPGRIEVCHWI  618

Query  361  FENDMTWTV  387
            FEND+ WT+
Sbjct  619  FENDVAWTI  627



>ref|XP_006303930.1| hypothetical protein CARUB_v10008588mg [Capsella rubella]
 gb|EOA36828.1| hypothetical protein CARUB_v10008588mg [Capsella rubella]
Length=623

 Score =   221 bits (563),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VVVRTTE+  G+K+ +MIG VKGINGGK+TK+VSCHQSL+PYL+YY
Sbjct  493  EDMIDFATSVLGRSVVVRTTESVAGSKEKVMIGKVKGINGGKVTKAVSCHQSLYPYLLYY  552

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE+DILD K+K KINHG+AICHIDTSAWGA HGAF++L S PG+IEVCHWI
Sbjct  553  CHSVPKVRVYESDILDLKSKAKINHGIAICHIDTSAWGANHGAFVSLRSSPGQIEVCHWI  612

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  613  FENDMNWAIAD  623



>ref|XP_002318036.2| hypothetical protein POPTR_0012s08060g [Populus trichocarpa]
 gb|EEE96256.2| hypothetical protein POPTR_0012s08060g [Populus trichocarpa]
Length=637

 Score =   221 bits (563),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VLG NV VRTTE   G+K+ +MIGSV+GINGG++TKSVSCHQSL+PYL+YY
Sbjct  505  EDMIDFAVSVLGHNVTVRTTENVNGSKKRVMIGSVEGINGGQVTKSVSCHQSLYPYLLYY  564

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEADI+D ++K+KIN GVAICH+DTSAWG  HGAF+ALGS PGKIEVCHWI
Sbjct  565  CHSVPRVRVYEADIVDVESKEKINVGVAICHVDTSAWGPEHGAFVALGSSPGKIEVCHWI  624

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  625  FENDMTWTIAD  635



>ref|XP_010415713.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Camelina sativa]
Length=624

 Score =   221 bits (562),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTT+   G+KQ ++IG V GINGGK+TK+VSCHQSL+PYL+YY
Sbjct  494  EDMIDFATSVLGRSVVLRTTDNVAGSKQKVVIGKVNGINGGKVTKAVSCHQSLYPYLLYY  553

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADIL+  +K KINHG+AICH+DTS+WGATHGAFLALGS PG+IEVCHWI
Sbjct  554  CHSVPKVRVYEADILEIDSKKKINHGIAICHMDTSSWGATHGAFLALGSKPGRIEVCHWI  613

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  614  FENDMNWAIAD  624



>ref|XP_004509826.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=636

 Score =   221 bits (562),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 98/131 (75%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT VLGRN+ VR+ E   G+ + +M+G VKGINGGK+T+SVSCHQSLFPYL+YY
Sbjct  506  EDMIDFATFVLGRNLTVRSIENVNGSGKNVMVGRVKGINGGKVTQSVSCHQSLFPYLLYY  565

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP VRVYEAD+L+PK+K KINHGV ICH+DTSAW +TH AF+ALG GPG+IEVCHWI
Sbjct  566  CHSVPDVRVYEADLLEPKSKVKINHGVVICHLDTSAWSSTHDAFVALGFGPGQIEVCHWI  625

Query  361  FENDMTWTVAD  393
            FENDMTWT  D
Sbjct  626  FENDMTWTTVD  636



>ref|XP_010251282.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nelumbo nucifera]
Length=639

 Score =   220 bits (561),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E MIDFA +VLG NVVVR+TE   G+ + +MIG+VKGINGG++TKSVSCHQSLFPYLVYY
Sbjct  509  EGMIDFAVSVLGHNVVVRSTENVNGSTKNVMIGAVKGINGGRVTKSVSCHQSLFPYLVYY  568

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILD  +K KIN+GVAICHIDTSAW   HGAF++LGS PGKIEVCHWI
Sbjct  569  CHSVPKVRVYEADILDANSKAKINNGVAICHIDTSAWSPGHGAFISLGSSPGKIEVCHWI  628

Query  361  FENDMTWTVAD  393
            FENDMTWTVAD
Sbjct  629  FENDMTWTVAD  639



>ref|XP_006390895.1| hypothetical protein EUTSA_v10018277mg [Eutrema salsugineum]
 gb|ESQ28181.1| hypothetical protein EUTSA_v10018277mg [Eutrema salsugineum]
Length=627

 Score =   219 bits (559),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE   G+KQ ++IG V GINGGKLTK+VSCHQSL+PYL+YY
Sbjct  497  EDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVNGINGGKLTKAVSCHQSLYPYLLYY  556

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+L+  +K KINHG+AICH+DTS+WG THGAFLALGS PG+IEVCHWI
Sbjct  557  CHSVPKVRVYEADLLELNSKTKINHGIAICHMDTSSWGPTHGAFLALGSKPGRIEVCHWI  616

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  617  FENDMNWAIAD  627



>ref|XP_009105700.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Brassica rapa]
Length=627

 Score =   219 bits (559),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE   G+KQ +MIG V GINGGK+TK+VSCHQSL+PYL+YY
Sbjct  497  EDMIDFATSVLGRSVVLRTTENVAGSKQKVMIGKVNGINGGKVTKAVSCHQSLYPYLMYY  556

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LD K+K KINHG+AICH+DTS+WG  HGAFLALGS PG IEVCHWI
Sbjct  557  CHSVPKVRVYEADLLDLKSKTKINHGIAICHMDTSSWGPKHGAFLALGSKPGLIEVCHWI  616

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  617  FENDMNWAIAD  627



>ref|XP_009775426.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nicotiana sylvestris]
Length=638

 Score =   219 bits (559),  Expect = 4e-64, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VLG NVVVRTT+  VG+K+ +MIG VKGINGG++T+SVSCHQSL+PYL+YY
Sbjct  508  EDMIDFAVSVLGHNVVVRTTDNVVGSKEKVMIGKVKGINGGRVTQSVSCHQSLYPYLLYY  567

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADIL+ +TK KINHGVAICHIDTSAW   HGAF+ALGSGPG+IEVCHWI
Sbjct  568  CHSVPKVRVYEADILNVETKAKINHGVAICHIDTSAWSPGHGAFVALGSGPGRIEVCHWI  627

Query  361  FENDMTWTVAD  393
            FENDMTW  AD
Sbjct  628  FENDMTWATAD  638



>ref|XP_006365230.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=627

 Score =   219 bits (558),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 105/131 (80%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VLG+NVVVRTTE T G+   IMIGSVKGINGGK+TKSVSCHQ+L+P L+YY
Sbjct  497  EDMIDFAISVLGQNVVVRTTENTKGSNGNIMIGSVKGINGGKVTKSVSCHQTLYPSLLYY  556

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE DILDP +K KINHG+AICH+DTS WG  HGAF ALGSGPGKIEVCHWI
Sbjct  557  CHSVPKVRVYEVDILDPNSKAKINHGIAICHVDTSLWGPKHGAFNALGSGPGKIEVCHWI  616

Query  361  FENDMTWTVAD  393
            FENDMTW +AD
Sbjct  617  FENDMTWAIAD  627



>ref|XP_006439797.1| hypothetical protein CICLE_v10019363mg [Citrus clementina]
 gb|ESR53037.1| hypothetical protein CICLE_v10019363mg [Citrus clementina]
Length=608

 Score =   218 bits (555),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVV RTT+   G+K+ + I SV GINGGK+TKSVSCHQSL+PYL+YY
Sbjct  478  EDMIDFATSVLGRNVVARTTQNANGSKRRVTISSVSGINGGKVTKSVSCHQSLYPYLLYY  537

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LD  +  KINHGVAICHIDTS+W   HGAF+ALGSGPG+IEVCHWI
Sbjct  538  CHSVPKVRVYEADVLDVVSNAKINHGVAICHIDTSSWSPGHGAFVALGSGPGQIEVCHWI  597

Query  361  FENDMTWTVAD  393
            FENDMTWT AD
Sbjct  598  FENDMTWTSAD  608



>ref|XP_009593470.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nicotiana tomentosiformis]
Length=636

 Score =   218 bits (556),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VLG NVVVRT +  VG+K+ +MIG V+GINGG++T+SVSCHQSL+PYL+YY
Sbjct  506  EDMIDFAISVLGHNVVVRTADNVVGSKEKVMIGKVEGINGGRVTQSVSCHQSLYPYLLYY  565

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADIL+ +TK KINHGVAICHIDTSAW   HGAF+ALGSGPG+IEVCHWI
Sbjct  566  CHSVPKVRVYEADILNVETKAKINHGVAICHIDTSAWSPGHGAFVALGSGPGRIEVCHWI  625

Query  361  FENDMTWTVAD  393
            FENDMTW +AD
Sbjct  626  FENDMTWAMAD  636



>emb|CDP00165.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   218 bits (556),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 112/131 (85%), Gaps = 12/131 (9%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+            +T G+   I+IGSV+GINGGK+TKSVSCHQSLFPYL+YY
Sbjct  513  EDMIDFATS------------STQGSGGNILIGSVEGINGGKVTKSVSCHQSLFPYLLYY  560

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVY+ADILDPKTKDKINHGVAICH+DTS+W   HGAF+ALGSGPGKIEVCHWI
Sbjct  561  CHSVPKVRVYQADILDPKTKDKINHGVAICHVDTSSWSPGHGAFIALGSGPGKIEVCHWI  620

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  621  FENDMTWTIAD  631



>ref|XP_002888771.1| hypothetical protein ARALYDRAFT_894840 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65030.1| hypothetical protein ARALYDRAFT_894840 [Arabidopsis lyrata subsp. 
lyrata]
Length=626

 Score =   218 bits (555),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE   G+KQ ++IG V GINGGKLTK+VSCHQSL+PYL+YY
Sbjct  496  EDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVNGINGGKLTKAVSCHQSLYPYLLYY  555

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+L+  +K KINHG+AICH+DTS+WG +HGAFLALGS PG+IEVCHWI
Sbjct  556  CHSVPKVRVYEADLLELNSKKKINHGIAICHMDTSSWGPSHGAFLALGSKPGRIEVCHWI  615

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  616  FENDMNWAIAD  626



>ref|XP_006300881.1| hypothetical protein CARUB_v10019971mg [Capsella rubella]
 gb|EOA33779.1| hypothetical protein CARUB_v10019971mg [Capsella rubella]
Length=625

 Score =   218 bits (555),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE   G+KQ ++IG V GINGGK+TK+VSCHQSL+PYL+YY
Sbjct  495  EDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVNGINGGKVTKAVSCHQSLYPYLMYY  554

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+L+  +K KINHG+AICH+DTS+WGA+HGAFLALGS PG+IEVCHWI
Sbjct  555  CHSVPKVRVYEADLLELDSKKKINHGIAICHMDTSSWGASHGAFLALGSKPGRIEVCHWI  614

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  615  FENDMNWAIAD  625



>ref|XP_006300871.1| hypothetical protein CARUB_v10019963mg [Capsella rubella]
 gb|EOA33769.1| hypothetical protein CARUB_v10019963mg [Capsella rubella]
Length=628

 Score =   218 bits (555),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR VVVRTTE  VG+K+ I+IG V GINGG +T++VSCHQSL+PYL+YY
Sbjct  498  EDMIDFATSVLGRGVVVRTTENVVGSKKKILIGKVNGINGGNVTRAVSCHQSLYPYLLYY  557

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYE DILDP++ +KINHGVAICHIDTSAW  THGAFLALGSGPG+IEVCHWI
Sbjct  558  CHSVPRVRVYETDILDPESLEKINHGVAICHIDTSAWSPTHGAFLALGSGPGRIEVCHWI  617

Query  361  FENDMTWTVAD  393
            FENDMTW + D
Sbjct  618  FENDMTWNIVD  628



>gb|KEH20006.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=644

 Score =   218 bits (556),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 99/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG +V VR+TE   GA + +M+G VKGINGGK+T+SVSCHQSLFPYL+YY
Sbjct  514  EDMIDFATSVLGHSVTVRSTENVNGAGKDVMVGKVKGINGGKVTESVSCHQSLFPYLLYY  573

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP V VYEAD+LDP +K KINHGVAICH+DT+AW +THGAF+ALGS PG+IEVCHWI
Sbjct  574  CHSVPNVHVYEADLLDPVSKAKINHGVAICHLDTTAWSSTHGAFMALGSAPGQIEVCHWI  633

Query  361  FENDMTWTVAD  393
            FENDMTW+ AD
Sbjct  634  FENDMTWSSAD  644



>ref|XP_003610589.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES92786.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=190

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 117/132 (89%), Gaps = 1/132 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGIN-GGKLTKSVSCHQSLFPYLVY  177
            EDMIDFA +VLGRNVVVRTTE   G+K+ +M+G V GIN GGK+T++VSCHQSLF YL+Y
Sbjct  59   EDMIDFAASVLGRNVVVRTTENVNGSKKDLMVGHVSGINNGGKMTRTVSCHQSLFQYLLY  118

Query  178  YCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            YCHSVPKVRVY+A++LDPK KDKIN GVA+CH+DTS W  THGAF++LGSGPG+IEVCHW
Sbjct  119  YCHSVPKVRVYQAELLDPKIKDKINQGVAVCHLDTSDWSPTHGAFVSLGSGPGQIEVCHW  178

Query  358  IFENDMTWTVAD  393
            IFENDM+W VAD
Sbjct  179  IFENDMSWAVAD  190



>emb|CDP12374.1| unnamed protein product [Coffea canephora]
Length=654

 Score =   218 bits (555),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VLGRNVVVRTTE   G+KQ +MIG V+G+NGG++T SVSCHQSL+PYL+YY
Sbjct  524  EDMIDFAVSVLGRNVVVRTTENVRGSKQHVMIGKVQGVNGGRVTTSVSCHQSLYPYLLYY  583

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKV+VY ADILD   K KINHGVAICHIDTSAW   HGAF+ALGSGPG IEVCHWI
Sbjct  584  CHSVPKVKVYLADILDVVGKTKINHGVAICHIDTSAWSPNHGAFVALGSGPGLIEVCHWI  643

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  644  FENDMTWTIAD  654



>emb|CDY57845.1| BnaA07g38770D [Brassica napus]
Length=627

 Score =   218 bits (554),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE   G+KQ ++IG V GINGGK+TK+VSCHQSL+PYL+YY
Sbjct  497  EDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVNGINGGKVTKAVSCHQSLYPYLMYY  556

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LD K+K KINHG+AICH+DTS+WG  HGAFLALGS PG IEVCHWI
Sbjct  557  CHSVPKVRVYEADLLDLKSKTKINHGIAICHMDTSSWGPKHGAFLALGSKPGLIEVCHWI  616

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  617  FENDMNWAIAD  627



>emb|CCD74525.1| polygalacturonase 1 [Arabidopsis halleri subsp. halleri]
Length=626

 Score =   217 bits (553),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR VVVRTTE  VG+K+ I+IG V GINGG +T++VSCHQSL+PYL+YY
Sbjct  496  EDMIDFATSVLGRGVVVRTTENVVGSKKKIVIGKVNGINGGNVTRAVSCHQSLYPYLLYY  555

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEAD+LDPK+ +KINHGVAICHIDTSAW  +HGAFLALGSGPG+IEVCHWI
Sbjct  556  CHSVPRVRVYEADLLDPKSLEKINHGVAICHIDTSAWSPSHGAFLALGSGPGRIEVCHWI  615

Query  361  FENDMTWTVAD  393
            FENDMTW   D
Sbjct  616  FENDMTWNFVD  626



>ref|XP_008346742.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=630

 Score =   217 bits (553),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VL RNVVVRTT+   G+KQ +MIG+V GIN G +TKSVSCHQSL+PYL+YY
Sbjct  500  EDMIDFAVSVLDRNVVVRTTKNVSGSKQKVMIGAVSGINSGNITKSVSCHQSLYPYLLYY  559

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEADILD ++K KINHGVAICH+DTS+W   HGAF+ALGS PGKIEVCHWI
Sbjct  560  CHSVPRVRVYEADILDVESKSKINHGVAICHMDTSSWSPGHGAFVALGSSPGKIEVCHWI  619

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  620  FENDMTWTIAD  630



>gb|AAB39546.1| polygalacturonase isoenzyme 1 beta subunit homolog [Arabidopsis 
thaliana]
Length=626

 Score =   217 bits (552),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 99/131 (76%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE   G+K+ ++IG V GINGGKLTK+VSCHQSL+PYL+YY
Sbjct  496  EDMIDFATSVLGRSVVLRTTENVAGSKEKVVIGKVNGINGGKLTKAVSCHQSLYPYLLYY  555

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+L+  +K KINHG+AICH+DTS+WG +HGAFLALGS PG+IEVCHWI
Sbjct  556  CHSVPKVRVYEADLLELNSKKKINHGIAICHMDTSSWGPSHGAFLALGSKPGRIEVCHWI  615

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  616  FENDMNWAIAD  626



>ref|NP_177194.1| polygalacturonase 2 [Arabidopsis thaliana]
 ref|NP_001185361.1| polygalacturonase 2 [Arabidopsis thaliana]
 sp|P92990.2|JP650_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
JP650; AltName: Full=Aromatic-rich glycoprotein JP650; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC18803.1| Identical to polygalacuronase isoenzyme 1 beta subunit homolog 
mRNA gb|U63373. EST gb|AA404878 comes from this gene [Arabidopsis 
thaliana]
 dbj|BAE98965.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35050.1| polygalacturonase 2 [Arabidopsis thaliana]
 gb|AEE35051.1| polygalacturonase 2 [Arabidopsis thaliana]
Length=626

 Score =   217 bits (552),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 99/131 (76%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE   G+K+ ++IG V GINGGKLTK+VSCHQSL+PYL+YY
Sbjct  496  EDMIDFATSVLGRSVVLRTTENVAGSKEKVVIGKVNGINGGKLTKAVSCHQSLYPYLLYY  555

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+L+  +K KINHG+AICH+DTS+WG +HGAFLALGS PG+IEVCHWI
Sbjct  556  CHSVPKVRVYEADLLELNSKKKINHGIAICHMDTSSWGPSHGAFLALGSKPGRIEVCHWI  615

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  616  FENDMNWAIAD  626



>ref|XP_008374449.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=629

 Score =   217 bits (552),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA  VL RNVVVRTTE   G+K+ +MIG+V GINGG +TKSVSCHQSL+PYL+YY
Sbjct  499  EDMIDFAVLVLDRNVVVRTTENVSGSKRKVMIGAVSGINGGNITKSVSCHQSLYPYLLYY  558

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEADILD ++K KINHGVAICH DTS+W   HGAF+ALGS PGKIEVCHWI
Sbjct  559  CHSVPRVRVYEADILDVESKSKINHGVAICHXDTSSWSPGHGAFVALGSSPGKIEVCHWI  618

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  619  FENDMTWTIAD  629



>ref|XP_004138283.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
 gb|KGN63588.1| Polygalacturonase-1 non-catalytic subunit beta [Cucumis sativus]
Length=645

 Score =   217 bits (552),  Expect = 6e-63, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT VLG+ VVVRTT    G+K+ I IG VKGINGG LT+SVSCHQSL+PYL+YY
Sbjct  515  EDMIDFATTVLGQRVVVRTTANVNGSKEKIEIGRVKGINGGDLTRSVSCHQSLYPYLLYY  574

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVR+YEADIL  +TK+KIN GVAICHIDTS+WG  HGAF+ALGSGPG+IEVCHWI
Sbjct  575  CHSVPKVRIYEADILKMETKEKINRGVAICHIDTSSWGPEHGAFVALGSGPGQIEVCHWI  634

Query  361  FENDMTWTVAD  393
            FENDM+W VAD
Sbjct  635  FENDMSWNVAD  645



>ref|NP_176242.1| polygalacturonase 1 [Arabidopsis thaliana]
 sp|O80760.1|Y639_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
At1g60390; AltName: Full=Aromatic-rich glycoprotein At1g60390; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24065.1| Strong similarity to AR0GP2 gene gb|1762634 from Lycopersicon 
esculentum [Arabidopsis thaliana]
 dbj|BAE99558.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33681.1| polygalacturonase 1 [Arabidopsis thaliana]
Length=624

 Score =   216 bits (550),  Expect = 8e-63, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR VVVRTTE  VG+K+ ++IG V GINGG +T++VSCHQSL+PYL+YY
Sbjct  494  EDMIDFATSVLGRGVVVRTTENVVGSKKKVVIGKVNGINGGDVTRAVSCHQSLYPYLLYY  553

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYE D+LDPK+ +KINHGVAICHIDTSAW  +HGAFLALGSGPG+IEVCHWI
Sbjct  554  CHSVPRVRVYETDLLDPKSLEKINHGVAICHIDTSAWSPSHGAFLALGSGPGQIEVCHWI  613

Query  361  FENDMTWTVAD  393
            FENDMTW + D
Sbjct  614  FENDMTWNIID  624



>ref|XP_008239752.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=627

 Score =   216 bits (550),  Expect = 8e-63, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG NVVVRTTE   G+KQ +MIG V GINGG +TKSVSCHQ+L+PYL+YY
Sbjct  497  EDMIDFATSVLGHNVVVRTTENVSGSKQKVMIGMVSGINGGNVTKSVSCHQTLYPYLLYY  556

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADI+D ++K KIN GVAICHIDTS+W   HGAF+ALGS PGKIEVCHWI
Sbjct  557  CHSVPKVRVYEADIVDVESKSKINQGVAICHIDTSSWSPGHGAFMALGSSPGKIEVCHWI  616

Query  361  FENDMTWTVAD  393
            FENDMTW +AD
Sbjct  617  FENDMTWAIAD  627



>ref|XP_010553600.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Tarenaya hassleriana]
Length=626

 Score =   216 bits (549),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 98/129 (76%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT++LGR+V VRTTE+  G+K TI IG V GINGGK+T+SVSCHQ+L+PYL+YY
Sbjct  495  EDMIDFATSMLGRHVAVRTTESVAGSKGTIEIGKVNGINGGKVTRSVSCHQTLYPYLLYY  554

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYE D+LDPK++ KINHGVAICH+DTSAW   HGAFLALG GPG+IEVCHWI
Sbjct  555  CHSVPRVRVYEVDLLDPKSRVKINHGVAICHVDTSAWSPGHGAFLALGPGPGRIEVCHWI  614

Query  361  FENDMTWTV  387
            FENDMTW +
Sbjct  615  FENDMTWII  623



>ref|XP_004166494.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
Length=688

 Score =   216 bits (551),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT VLG+ VVVRTT    G+K+ I IG VKGINGG LT+SVSCHQSL+PYL+YY
Sbjct  558  EDMIDFATTVLGQRVVVRTTANVNGSKEKIEIGRVKGINGGDLTRSVSCHQSLYPYLLYY  617

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVR+YEADIL  +TK+KIN GVAICHIDTS+WG  HGAF+ALGSGPG+IEVCHWI
Sbjct  618  CHSVPKVRIYEADILKMETKEKINRGVAICHIDTSSWGPEHGAFVALGSGPGQIEVCHWI  677

Query  361  FENDMTWTVAD  393
            FENDM+W VAD
Sbjct  678  FENDMSWNVAD  688



>ref|XP_010510953.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=626

 Score =   215 bits (548),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR VVVRTTE+ +G+KQ I+IG V GINGG +T++VSCHQSL+PYL+YY
Sbjct  496  EDMIDFATSVLGRGVVVRTTESVIGSKQKIVIGKVNGINGGDVTRAVSCHQSLYPYLLYY  555

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEAD+L+P++ +KINHGVAICHIDTSAW  +HGAFLALGS PG+IEVCHWI
Sbjct  556  CHSVPRVRVYEADLLEPESLEKINHGVAICHIDTSAWSPSHGAFLALGSSPGRIEVCHWI  615

Query  361  FENDMTWTVAD  393
            FENDMTW + D
Sbjct  616  FENDMTWNIVD  626



>ref|XP_008453099.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Cucumis melo]
Length=648

 Score =   216 bits (549),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT VLGR VVVRTT    G+K+ + IG VKGINGG LT+SVSCHQSL+PYL+YY
Sbjct  518  EDMIDFATTVLGRRVVVRTTANVNGSKEKVEIGRVKGINGGNLTRSVSCHQSLYPYLLYY  577

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVR+YEADIL  +TK+KIN GVAICHIDTS+WG  HGAF+ALGS PG+IEVCHWI
Sbjct  578  CHSVPKVRIYEADILRVETKEKINRGVAICHIDTSSWGPEHGAFVALGSSPGQIEVCHWI  637

Query  361  FENDMTWTVAD  393
            FENDM+W+VAD
Sbjct  638  FENDMSWSVAD  648



>gb|KFK41456.1| hypothetical protein AALP_AA2G132700 [Arabis alpina]
Length=617

 Score =   215 bits (547),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 98/131 (75%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR VVVRTTE   G+KQ +++G V GINGGK+TK+VSCHQSL+PYL+YY
Sbjct  487  EDMIDFATSVLGRTVVVRTTENVAGSKQQVVVGKVNGINGGKVTKAVSCHQSLYPYLMYY  546

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKV+VYEAD+L+  +K KINHG+AICH+DTS+WG +HGAFLALGS PG+IEVCHWI
Sbjct  547  CHSVPKVKVYEADLLELNSKKKINHGIAICHMDTSSWGPSHGAFLALGSKPGRIEVCHWI  606

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  607  FENDMNWAIAD  617



>emb|CDY23501.1| BnaC06g24700D [Brassica napus]
Length=625

 Score =   215 bits (547),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE   G+KQ ++IG V GINGGKLTK+VSCHQSL+PYL+YY
Sbjct  495  EDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVNGINGGKLTKAVSCHQSLYPYLLYY  554

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+L+  +K KINHG+AICHIDTS+W   HGAFLALGS PG+IEVCHWI
Sbjct  555  CHSVPKVRVYEADLLELNSKTKINHGIAICHIDTSSWSPGHGAFLALGSKPGRIEVCHWI  614

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  615  FENDMNWAIAD  625



>ref|XP_011071835.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Sesamum indicum]
Length=635

 Score =   215 bits (547),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VLG +VVVRTTE   G+ Q +MIG VKGINGG++TKSVSCHQSL+PYL+YY
Sbjct  505  EDMIDFAVSVLGHDVVVRTTEGVKGSSQDVMIGKVKGINGGRVTKSVSCHQSLYPYLLYY  564

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADIL+ +TK KINHGVAICH+DTS W   HGAFLALGSGPG IEVCHWI
Sbjct  565  CHSVPKVRVYEADILEVETKTKINHGVAICHLDTSMWSPRHGAFLALGSGPGLIEVCHWI  624

Query  361  FENDMTWTVAD  393
            FENDM WT AD
Sbjct  625  FENDMNWTTAD  635



>ref|XP_004501939.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=627

 Score =   214 bits (546),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 104/130 (80%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E MI+FA +VLG NVVVRTTE+  G+K ++MIG V GI+GGK+TKSVSCHQSL+PYL+YY
Sbjct  497  EGMIEFAVSVLGPNVVVRTTESVKGSKTSVMIGKVYGIDGGKVTKSVSCHQSLYPYLLYY  556

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILD  TK KIN GVAICHIDTSAWG  HGAF ALGSGPGKIEVCHWI
Sbjct  557  CHSVPKVRVYEADILDVDTKKKINQGVAICHIDTSAWGPEHGAFSALGSGPGKIEVCHWI  616

Query  361  FENDMTWTVA  390
            FENDMTWT A
Sbjct  617  FENDMTWTTA  626



>ref|XP_010473218.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=629

 Score =   214 bits (546),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR VVVRTTE+ VG+K+ I+IG V GINGG +T++VSCHQSL+PYL+YY
Sbjct  499  EDMIDFATSVLGRGVVVRTTESVVGSKKKILIGKVNGINGGDVTRAVSCHQSLYPYLLYY  558

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEADIL+P++ +KINHGVAICH+DTSAW  +HGAFLALGS PG+IEVCHWI
Sbjct  559  CHSVPRVRVYEADILEPESLEKINHGVAICHVDTSAWSPSHGAFLALGSSPGRIEVCHWI  618

Query  361  FENDMTWTVAD  393
            FENDMTW + D
Sbjct  619  FENDMTWNIVD  629



>emb|CBI15046.3| unnamed protein product [Vitis vinifera]
Length=602

 Score =   214 bits (544),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VLG +VVVRTTETT G+KQ +M+G V+GINGGK+T+SVSCHQSL+PYL+YY
Sbjct  472  EDMIDFAVSVLGHDVVVRTTETTRGSKQRVMVGEVRGINGGKVTRSVSCHQSLYPYLLYY  531

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE DILD + K+K+N GVAICHIDTSAW  +HGAF+ALGS PG IEVCHWI
Sbjct  532  CHSVPKVRVYEVDILDVERKEKMNKGVAICHIDTSAWSQSHGAFVALGSSPGLIEVCHWI  591

Query  361  FENDMTWTVAD  393
            FENDMTWT +D
Sbjct  592  FENDMTWTTSD  602



>ref|XP_002279813.2| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Vitis vinifera]
Length=633

 Score =   214 bits (544),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VLG +VVVRTTETT G+KQ +M+G V+GINGGK+T+SVSCHQSL+PYL+YY
Sbjct  503  EDMIDFAVSVLGHDVVVRTTETTRGSKQRVMVGEVRGINGGKVTRSVSCHQSLYPYLLYY  562

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE DILD + K+K+N GVAICHIDTSAW  +HGAF+ALGS PG IEVCHWI
Sbjct  563  CHSVPKVRVYEVDILDVERKEKMNKGVAICHIDTSAWSQSHGAFVALGSSPGLIEVCHWI  622

Query  361  FENDMTWTVAD  393
            FENDMTWT +D
Sbjct  623  FENDMTWTTSD  633



>ref|XP_007210277.1| hypothetical protein PRUPE_ppa003003mg [Prunus persica]
 gb|EMJ11476.1| hypothetical protein PRUPE_ppa003003mg [Prunus persica]
Length=613

 Score =   213 bits (543),  Expect = 6e-62, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG NVVVRTTE   G+KQ +MIG + GINGG +TKSVSCHQ+L+PYL+YY
Sbjct  483  EDMIDFATSVLGHNVVVRTTENVWGSKQKVMIGMISGINGGNVTKSVSCHQTLYPYLLYY  542

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADI+D ++K KINHGVAICHIDTS+W   HGAF+ LGS PGKIEVCHWI
Sbjct  543  CHSVPKVRVYEADIVDVESKSKINHGVAICHIDTSSWSPEHGAFVVLGSSPGKIEVCHWI  602

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  603  FENDMAWAIAD  613



>ref|XP_002525381.1| Polygalacturonase non-catalytic subunit AroGP2 precursor, putative 
[Ricinus communis]
 gb|EEF37019.1| Polygalacturonase non-catalytic subunit AroGP2 precursor, putative 
[Ricinus communis]
Length=531

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+IDFAT+VLGRN VVRTT++  GAK+ I+IG VKGINGG++TKSVSCHQSL+P+L+YY
Sbjct  398  EDLIDFATSVLGRNAVVRTTQSINGAKKDILIGRVKGINGGRVTKSVSCHQSLYPHLLYY  457

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEA+ILD  +K  IN G AICH+DTSAW + HGAFLALGS PG+IEVCHWI
Sbjct  458  CHSVPKVRVYEAEILDANSKANINWGTAICHLDTSAWSSNHGAFLALGSSPGRIEVCHWI  517

Query  361  FENDMTWTVAD  393
            FENDMTWT+ D
Sbjct  518  FENDMTWTITD  528



>ref|XP_010417970.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=628

 Score =   213 bits (543),  Expect = 7e-62, Method: Composition-based stats.
 Identities = 99/131 (76%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR +VVRTTE+ VG+K+ I+IG V GINGG +T++VSCHQSL+PYL+YY
Sbjct  498  EDMIDFATSVLGRGIVVRTTESVVGSKKKIVIGKVNGINGGDVTRAVSCHQSLYPYLLYY  557

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEADIL+P++ +KINHGVAICH+DTSAW  +HGAFLALGS PG+IEVCHWI
Sbjct  558  CHSVPRVRVYEADILEPESLEKINHGVAICHVDTSAWSPSHGAFLALGSSPGRIEVCHWI  617

Query  361  FENDMTWTVAD  393
            FENDMTW + D
Sbjct  618  FENDMTWNIVD  628



>ref|XP_008800877.1| PREDICTED: BURP domain-containing protein 12-like [Phoenix dactylifera]
Length=637

 Score =   213 bits (542),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+IDFA +VLG NVVVR+TE T G+K +I+IG VKG+NGG +TKSVSCHQSLFPYLVYY
Sbjct  507  EDVIDFAVSVLGNNVVVRSTENTNGSKGSILIGEVKGVNGGSVTKSVSCHQSLFPYLVYY  566

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVY+A+IL  KTK+KINHGVAICH+DTS W   HGAF+ALG GPGKIEVCHWI
Sbjct  567  CHSVPKVRVYQAEILAVKTKEKINHGVAICHVDTSDWSPAHGAFVALGPGPGKIEVCHWI  626

Query  361  FENDMTWTVAD  393
            F+ DMTWTVAD
Sbjct  627  FQGDMTWTVAD  637



>ref|XP_010678748.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Beta vulgaris subsp. vulgaris]
Length=628

 Score =   213 bits (542),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA +VLG NVVVRTTE   G+ + ++IG V+GINGGK+TKSVSCHQSL PYL+YY
Sbjct  498  EDMIDFAISVLGDNVVVRTTENVHGSGKQVVIGLVRGINGGKVTKSVSCHQSLLPYLLYY  557

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILD + K KIN GVAICH+DTSAW A HGAFL LGSGPG IEVCHWI
Sbjct  558  CHSVPKVRVYEADILDMENKSKINQGVAICHLDTSAWSAGHGAFLTLGSGPGLIEVCHWI  617

Query  361  FENDMTWTVAD  393
            FENDMTW VAD
Sbjct  618  FENDMTWAVAD  628



>gb|KEH20005.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=374

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT++LG NV VR+TE   G+   +M+G VK INGG + +SVSCHQSLFPYL+YY
Sbjct  244  EDMIDFATSILGSNVTVRSTENVNGSNNNVMVGQVKEINGGNVMESVSCHQSLFPYLLYY  303

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP +R+YEA++LDPK+K KINHGVAICH+DT+AW  THGAF+ LG GPG+IEVCHWI
Sbjct  304  CHSVPNIRIYEANLLDPKSKVKINHGVAICHLDTTAWSPTHGAFMTLGFGPGQIEVCHWI  363

Query  361  FENDMTWTVAD  393
            FENDMTWT A+
Sbjct  364  FENDMTWTTAN  374



>ref|XP_008776735.1| PREDICTED: BURP domain-containing protein 12-like [Phoenix dactylifera]
Length=641

 Score =   213 bits (541),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+IDFA +VLG NVVVR+TE+T G+K  I++G  +G+NGGK+TKSVSCHQSLFPYLVYY
Sbjct  511  EDVIDFAVSVLGNNVVVRSTESTDGSKGNILVGDTRGVNGGKITKSVSCHQSLFPYLVYY  570

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVY+A+IL  +TK KINHGVAICH+DTS W A HGAF+ALGSGPGKIEVCHWI
Sbjct  571  CHSVPKVRVYDAEILSVQTKKKINHGVAICHLDTSDWSAGHGAFVALGSGPGKIEVCHWI  630

Query  361  FENDMTWTVAD  393
            F+ DMTWTVAD
Sbjct  631  FQGDMTWTVAD  641



>ref|XP_006345047.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Solanum tuberosum]
Length=642

 Score =   213 bits (541),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA ++LG NVVVRTT+   G+K  +MIG VKGINGG++TKSVSCHQSL+PYL+YY
Sbjct  512  EDMIDFAVSILGHNVVVRTTDNVAGSKGEVMIGKVKGINGGRVTKSVSCHQSLYPYLLYY  571

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKV+VY+ADIL+  TK KINHGVAICH+DTS+W   HGAF+ALGSGPG IEVCHWI
Sbjct  572  CHSVPKVKVYQADILNVDTKAKINHGVAICHVDTSSWSPGHGAFVALGSGPGLIEVCHWI  631

Query  361  FENDMTWTVAD  393
            FENDMTW +AD
Sbjct  632  FENDMTWAMAD  642



>ref|XP_004236111.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Solanum lycopersicum]
Length=636

 Score =   212 bits (540),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA ++LG NVVVRTT+   G+   IMIG VKGINGG++TKSVSCHQSL+PYL+YY
Sbjct  506  EDMIDFAVSILGHNVVVRTTDNVAGSMGEIMIGKVKGINGGRVTKSVSCHQSLYPYLLYY  565

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVY+ADIL+  TK KINHGVAICH+DTS+W   HGAF+ALGSGPG IEVCHWI
Sbjct  566  CHSVPKVRVYQADILNVDTKVKINHGVAICHVDTSSWSPGHGAFVALGSGPGLIEVCHWI  625

Query  361  FENDMTWTVAD  393
            FENDMTW +AD
Sbjct  626  FENDMTWAMAD  636



>ref|XP_003601289.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES71540.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=628

 Score =   212 bits (539),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E MIDF+ ++LG NVVV+TTE   G+K+T+MIG V   +GGK+ KSVSCH SL+PYL+YY
Sbjct  498  EGMIDFSVSILGPNVVVKTTENVNGSKRTVMIGKVDATDGGKVIKSVSCHPSLYPYLLYY  557

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILD  TK KINHGVAICHIDTS+WG+ HGAFLALGSGPGKIEVCHWI
Sbjct  558  CHSVPKVRVYEADILDVDTKSKINHGVAICHIDTSSWGSKHGAFLALGSGPGKIEVCHWI  617

Query  361  FENDMTWTVA  390
            FENDMTWT +
Sbjct  618  FENDMTWTTS  627



>ref|XP_003528153.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Glycine max]
Length=629

 Score =   211 bits (537),  Expect = 5e-61, Method: Composition-based stats.
 Identities = 98/131 (75%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E+MI FA +VLG NV VR+TE   G+  ++MIG V  I+GGK+TKSVSCHQSL+PYL+YY
Sbjct  499  EEMIGFAVSVLGPNVAVRSTENVNGSGSSVMIGKVYAIDGGKVTKSVSCHQSLYPYLLYY  558

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEA+ILD  TK+ INHGVAICH+DTSAWG  HGAFLALG GPGKIEVCHWI
Sbjct  559  CHSVPKVRVYEAEILDVDTKEMINHGVAICHLDTSAWGPQHGAFLALGFGPGKIEVCHWI  618

Query  361  FENDMTWTVAD  393
            FENDMTWT A+
Sbjct  619  FENDMTWTTAN  629



>ref|XP_010924225.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=636

 Score =   211 bits (538),  Expect = 5e-61, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+IDFA +VLG NVVVR+TE T G+K  I+IG V+G+NGG +TKSVSCHQSLFPYLVYY
Sbjct  506  EDVIDFAVSVLGSNVVVRSTENTGGSKGNILIGKVEGVNGGNITKSVSCHQSLFPYLVYY  565

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRV+EADIL  KTK+KINHGVAICH+DTS W   HGAF+ALGSGPG+IEVCHWI
Sbjct  566  CHSVPKVRVHEADILAVKTKEKINHGVAICHLDTSDWSPAHGAFVALGSGPGQIEVCHWI  625

Query  361  FENDMTWTVAD  393
            F+ DMTWTVAD
Sbjct  626  FQGDMTWTVAD  636



>gb|EPS60630.1| polygalacturonase-1 non-catalytic subunit beta, partial [Genlisea 
aurea]
Length=595

 Score =   210 bits (535),  Expect = 6e-61, Method: Composition-based stats.
 Identities = 98/127 (77%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRN   RTT TT G+   I IG VKGI GG++TKSVSCHQSL+PYL+YY
Sbjct  468  EDMIDFATSVLGRNSAARTTATTAGSGGEIKIGEVKGIAGGRVTKSVSCHQSLYPYLLYY  527

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+L PKT  KINHGVAICHIDT++W   HGAF+ALG GPGKIEVCHWI
Sbjct  528  CHSVPKVRVYEADLLHPKTDSKINHGVAICHIDTTSWSPDHGAFIALGPGPGKIEVCHWI  587

Query  361  FENDMTW  381
            F+NDMTW
Sbjct  588  FQNDMTW  594



>ref|XP_010925453.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=636

 Score =   211 bits (536),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+IDFA +VLG NV+VR+TE+T G+K  I++G V G+NGGK+TKSVSCHQSLFPYLVYY
Sbjct  506  EDVIDFAVSVLGNNVIVRSTESTSGSKGNILLGDVTGVNGGKITKSVSCHQSLFPYLVYY  565

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVY+A+IL  +TK KINHGVAICH+DTS W A HGAF+ALG GPGKIEVCHWI
Sbjct  566  CHSVPKVRVYQAEILSVQTKKKINHGVAICHLDTSDWSAGHGAFVALGYGPGKIEVCHWI  625

Query  361  FENDMTWTVAD  393
            F+ DMTWTVAD
Sbjct  626  FQGDMTWTVAD  636



>ref|XP_009393062.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=651

 Score =   209 bits (533),  Expect = 3e-60, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+IDFA +VLG +VVVR+T TT G+   ++IG V G NGGK+T+SVSCHQSLFPYLVYY
Sbjct  521  EDVIDFAVSVLGSDVVVRSTATTAGSNADVLIGRVSGANGGKVTRSVSCHQSLFPYLVYY  580

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADIL   +K KINHGVAICH+DTSAW  THGAF+ALGS PGKIEVCHWI
Sbjct  581  CHSVPKVRVYEADILAVHSKQKINHGVAICHLDTSAWSPTHGAFVALGSAPGKIEVCHWI  640

Query  361  FENDMTWTVAD  393
            FE DMTWTVAD
Sbjct  641  FEGDMTWTVAD  651



>ref|XP_004300895.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Fragaria vesca subsp. vesca]
Length=634

 Score =   209 bits (531),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 98/131 (75%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDF+ +VLG NVVVRTTE   G+K+ +MIG V GINGG++T+SVSCHQSL+PYL+YY
Sbjct  503  EDMIDFSVSVLGHNVVVRTTENVRGSKKNVMIGKVIGINGGRVTESVSCHQSLYPYLLYY  562

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADI+D ++++KINH VAICH+DTSAW   HGAF+ALGS PG  EVCHWI
Sbjct  563  CHSVPKVRVYEADIVDVESRNKINHAVAICHLDTSAWSPGHGAFVALGSSPGNTEVCHWI  622

Query  361  FENDMTWTVAD  393
            FENDMTWTVAD
Sbjct  623  FENDMTWTVAD  633



>ref|XP_002886622.1| hypothetical protein ARALYDRAFT_475291 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62881.1| hypothetical protein ARALYDRAFT_475291 [Arabidopsis lyrata subsp. 
lyrata]
Length=625

 Score =   208 bits (530),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG  VVVRTTE  VG+K+ ++IG V  INGG  T++VSCHQSL+PYL+YY
Sbjct  495  EDMIDFATSVLGSGVVVRTTENVVGSKKKVVIGKVNRINGGDETRAVSCHQSLYPYLLYY  554

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYE D+LDPK+ +KINHGVAICHIDTSAW  +HGAFLALGSGPG+IEVCHWI
Sbjct  555  CHSVPRVRVYETDLLDPKSLEKINHGVAICHIDTSAWSPSHGAFLALGSGPGRIEVCHWI  614

Query  361  FENDMTWTVAD  393
            FENDMTW + D
Sbjct  615  FENDMTWNIID  625



>gb|KDP31113.1| hypothetical protein JCGZ_11489 [Jatropha curcas]
Length=627

 Score =   208 bits (529),  Expect = 7e-60, Method: Composition-based stats.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDM+DFA +VL  NVVVRTTE   G+K+ + IG+VKGINGG +TKSVSCHQSL+PYL+YY
Sbjct  497  EDMVDFAVSVLSHNVVVRTTENVHGSKKNVTIGTVKGINGGAVTKSVSCHQSLYPYLLYY  556

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEA+IL+ ++K KIN GVAICHIDTSAW   HGAF+ALGS PG+IEVCHWI
Sbjct  557  CHSVPKVRVYEAEILEVESKAKINVGVAICHIDTSAWSPDHGAFVALGSSPGQIEVCHWI  616

Query  361  FENDMTWTVAD  393
            FENDMTWT+AD
Sbjct  617  FENDMTWTIAD  627



>ref|XP_009394250.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=646

 Score =   208 bits (530),  Expect = 8e-60, Method: Composition-based stats.
 Identities = 97/131 (74%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+IDFA A+LG NVV R+TE+T G+K T++IG V+G+NGG +T+SVSCHQSLFPYLVYY
Sbjct  516  EDVIDFAVAMLGSNVVGRSTESTAGSKGTVLIGKVRGVNGGGVTRSVSCHQSLFPYLVYY  575

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVY ADIL  +TK++IN GVAICH+DTS W A+HGAFL+LGS PG+IEVCHWI
Sbjct  576  CHSVPRVRVYVADILAVQTKERINRGVAICHLDTSDWSASHGAFLSLGSAPGRIEVCHWI  635

Query  361  FENDMTWTVAD  393
            FE DMTWTVAD
Sbjct  636  FERDMTWTVAD  646



>ref|XP_002511417.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
 gb|EEF52019.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
Length=637

 Score =   208 bits (529),  Expect = 9e-60, Method: Composition-based stats.
 Identities = 98/131 (75%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMI+FA +VLG NVVVRTTE   G+ + +MIG VKGINGG++TKSVSCHQSL+PYL+YY
Sbjct  507  EDMIEFAVSVLGHNVVVRTTENVHGSSKNVMIGRVKGINGGEVTKSVSCHQSLYPYLLYY  566

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEA+ILD ++K++IN GVAICHIDTSAW   HGAF+AL S PG+IEVCHWI
Sbjct  567  CHSVPRVRVYEAEILDVESKERINLGVAICHIDTSAWSPNHGAFVALESSPGQIEVCHWI  626

Query  361  FENDMTWTVAD  393
            FENDM+WTVAD
Sbjct  627  FENDMSWTVAD  637



>ref|XP_006578624.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Glycine max]
Length=631

 Score =   207 bits (528),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 97/130 (75%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E+MI FA +VLG NV VR+TE   G+  ++MIG V  I+GGK+TKSVSCHQSL+PYL+YY
Sbjct  501  EEMIGFAVSVLGPNVAVRSTENLNGSGSSVMIGKVHSIDGGKVTKSVSCHQSLYPYLLYY  560

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEA+ILD  T +KINHGVAICH+DTSAWG  HGAFLALG GPGKIEVCHWI
Sbjct  561  CHSVPKVRVYEAEILDVDTLEKINHGVAICHLDTSAWGPQHGAFLALGFGPGKIEVCHWI  620

Query  361  FENDMTWTVA  390
            FEND+TWT A
Sbjct  621  FENDLTWTTA  630



>emb|CDP00166.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 116/131 (89%), Gaps = 3/131 (2%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGRNVVVRTTE T G++  I+IGSVKGINGGK+TKSVSCH+SL P L+YY
Sbjct  445  EDMIDFATSVLGRNVVVRTTENTRGSRGNILIGSVKGINGGKVTKSVSCHRSLLPCLLYY  504

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADILDPKTKDK+N GVAICH+DTS+W   HGAF+ALGSGPGKIEVC   
Sbjct  505  CHSVPKVRVYEADILDPKTKDKVNRGVAICHVDTSSWSPGHGAFIALGSGPGKIEVC---  561

Query  361  FENDMTWTVAD  393
             +NDMTW VAD
Sbjct  562  LKNDMTWAVAD  572



>ref|XP_010936822.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=615

 Score =   206 bits (524),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 99/132 (75%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGR-NvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            EDM+DFA ++LG  NVVVR+TE   G+   I++G+V GINGGK+T+SVSCHQSLFPYLVY
Sbjct  484  EDMVDFAASMLGDDNVVVRSTENVRGSGGNILVGNVTGINGGKVTRSVSCHQSLFPYLVY  543

Query  178  YCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            YCHSVPKVR YEADILD +T ++INHGVAICH+DTS W   HGAF+ALGSGPGKIEVCHW
Sbjct  544  YCHSVPKVRAYEADILDVETGERINHGVAICHLDTSDWSPGHGAFVALGSGPGKIEVCHW  603

Query  358  IFENDMTWTVAD  393
            IFE DMTWTVAD
Sbjct  604  IFEGDMTWTVAD  615



>ref|XP_007138090.1| hypothetical protein PHAVU_009G179500g [Phaseolus vulgaris]
 gb|ESW10084.1| hypothetical protein PHAVU_009G179500g [Phaseolus vulgaris]
Length=627

 Score =   206 bits (524),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 94/128 (73%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E+MI+FA +VLG +VVVR+TE   G+  ++MIG V  ++GGK+TKSVSCHQSL+PYL+YY
Sbjct  499  EEMIEFAASVLGPSVVVRSTENVNGSGSSVMIGKVYPVDGGKVTKSVSCHQSLYPYLLYY  558

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYEADIL+ +TK+ +NHGVAICH+DTS+WG  HGAFLALGSGPGKIEVCHWI
Sbjct  559  CHSVPQVRVYEADILNVETKENMNHGVAICHLDTSSWGPEHGAFLALGSGPGKIEVCHWI  618

Query  361  FENDMTWT  384
            FENDMTWT
Sbjct  619  FENDMTWT  626



>ref|XP_010028282.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Eucalyptus grandis]
 gb|KCW83445.1| hypothetical protein EUGRSUZ_B00367 [Eucalyptus grandis]
Length=643

 Score =   206 bits (523),  Expect = 7e-59, Method: Composition-based stats.
 Identities = 93/131 (71%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDM+DFA+++LGR++ VRTTE   G+KQ ++IGSV+GI GG+ TKSVSCHQSL+PYL+YY
Sbjct  513  EDMVDFASSILGRSITVRTTENVNGSKQKVVIGSVRGIKGGEPTKSVSCHQSLYPYLLYY  572

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+VPKV+VYEADIL+   + +INHGVAICH+DTS+W   HGAF+ALGS PG+IEVCHWI
Sbjct  573  CHAVPKVKVYEADILNFVGRSRINHGVAICHLDTSSWSPDHGAFVALGSRPGQIEVCHWI  632

Query  361  FENDMTWTVAD  393
            FENDMTWTV D
Sbjct  633  FENDMTWTVVD  643



>gb|KCW86720.1| hypothetical protein EUGRSUZ_B03328 [Eucalyptus grandis]
Length=212

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMID AT+VLG +V+VR+TE+  G+KQ ++IG VK I+G +++K V+CHQ LFPY VYY
Sbjct  81   EDMIDLATSVLGHDVMVRSTESAGGSKQEVLIGVVKRIDGSEVSKPVACHQILFPYAVYY  140

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+ P VR+YEADILDPK+K KINHGVAICH+DTSAWG T+ AFL LGSGPG+IEVCHWI
Sbjct  141  CHAFPNVRIYEADILDPKSKAKINHGVAICHMDTSAWGPTYEAFLLLGSGPGQIEVCHWI  200

Query  361  FENDMTWTVA  390
            +EN+M WT+A
Sbjct  201  YENNMIWTIA  210



>gb|KHN30893.1| Polygalacturonase-1 non-catalytic subunit beta [Glycine soja]
Length=541

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E+MI FA +VLG NV VR+TE   G+  ++MIG V  I+GGK+TKSVSCHQSL+PYL+YY
Sbjct  411  EEMIGFAVSVLGPNVAVRSTENLNGSGSSVMIGKVHSIDGGKVTKSVSCHQSLYPYLLYY  470

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEA+ILD  T +KINHGVAICH+DTSAWG  HGAFLALG GPGKIEVCHWI
Sbjct  471  CHSVPKVRVYEAEILDVDTLEKINHGVAICHLDTSAWGPQHGAFLALGFGPGKIEVCHWI  530

Query  361  FENDMTWTVA  390
            FEND+TWT A
Sbjct  531  FENDLTWTTA  540



>gb|KFK44451.1| hypothetical protein AALP_AA1G258600 [Arabis alpina]
Length=621

 Score =   202 bits (515),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 99/131 (76%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR VV+RTT++  G+K+ ++IG VKGINGG +TKSVSCHQSL+PYL+YY
Sbjct  491  EDMIDFATSVLGRRVVLRTTKSVAGSKKKVVIGKVKGINGGNVTKSVSCHQSLYPYLLYY  550

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYE+D+LDPK+K KINHG+AICH+DTSAWGA HGAF++LGS PG+IE+CHWI
Sbjct  551  CHSVPKVRVYESDLLDPKSKVKINHGIAICHMDTSAWGANHGAFVSLGSRPGQIEICHWI  610

Query  361  FENDMTWTVAD  393
            FENDM W++AD
Sbjct  611  FENDMNWSIAD  621



>emb|CDY53059.1| BnaA09g14240D [Brassica napus]
Length=623

 Score =   202 bits (513),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 105/131 (80%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG  VVVRTTE  VG+K+ I+IG VKGINGG LT++VSCHQSL+PYL+YY
Sbjct  493  EDMIDFATSVLGHGVVVRTTENVVGSKKKIVIGKVKGINGGDLTRAVSCHQSLYPYLLYY  552

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP++ +KINHG+AICHIDTSAW A+HGAFLALGSGPG+IEVCHWI
Sbjct  553  CHSVPKVRVYEADLLDPESSEKINHGIAICHIDTSAWSASHGAFLALGSGPGRIEVCHWI  612

Query  361  FENDMTWTVAD  393
            FENDMTWT  D
Sbjct  613  FENDMTWTTVD  623



>gb|KCW86729.1| hypothetical protein EUGRSUZ_B03340 [Eucalyptus grandis]
Length=256

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDF T+VLG +V+VR+TE+  G+KQ ++IG VK I G +++K V+CHQSLFPY+VYY
Sbjct  125  EDMIDFTTSVLGHDVMVRSTESARGSKQEVLIGVVKRIEGSEVSKPVACHQSLFPYIVYY  184

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+ P VRVYEADILDPK+K KINHGVAICH++TS W  TH +FL LGSGPG+IEVCHWI
Sbjct  185  CHTFPNVRVYEADILDPKSKAKINHGVAICHMNTSTWSPTHESFLLLGSGPGQIEVCHWI  244

Query  361  FENDMTWTVA  390
            +EN + WT+A
Sbjct  245  YENSLIWTIA  254



>ref|XP_010046642.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=367

 Score =   195 bits (495),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMID AT+VLG +V+VR+TE+  G+KQ ++IG VK I+G +++K V+CHQ LFPY VYY
Sbjct  236  EDMIDLATSVLGHDVMVRSTESAGGSKQEVLIGVVKRIDGSEVSKPVACHQILFPYAVYY  295

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+ P VR+YEADILDPK+K KINHGVAICH+DTSAWG T+ AFL LGSGPG+IEVCHWI
Sbjct  296  CHAFPNVRIYEADILDPKSKAKINHGVAICHMDTSAWGPTYEAFLLLGSGPGQIEVCHWI  355

Query  361  FENDMTWTVA  390
            +EN+M WT+A
Sbjct  356  YENNMIWTIA  365



>ref|XP_006392169.1| hypothetical protein EUTSA_v10023352mg [Eutrema salsugineum]
 gb|ESQ29455.1| hypothetical protein EUTSA_v10023352mg [Eutrema salsugineum]
Length=622

 Score =   200 bits (509),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR VVVRTTE  VG+K+ I+IG VKGINGG LT++VSCHQSL+PYL+YY
Sbjct  492  EDMIDFATSVLGRGVVVRTTENVVGSKKKIVIGKVKGINGGNLTRAVSCHQSLYPYLLYY  551

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VRVYE DILDP+  +KINHGVAICHIDTSAW  +HGAFLALGS PG+IEVCHWI
Sbjct  552  CHSVPRVRVYETDILDPENLEKINHGVAICHIDTSAWSPSHGAFLALGSSPGRIEVCHWI  611

Query  361  FENDMTWTVAD  393
            FENDMTWT+ D
Sbjct  612  FENDMTWTIVD  622



>ref|XP_009113216.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Brassica rapa]
Length=623

 Score =   200 bits (508),  Expect = 9e-57, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG  VVVRTTE  VG+K+ I+IG VKGINGG LT++VSCHQSL+PYL+YY
Sbjct  493  EDMIDFATSVLGHGVVVRTTENVVGSKKKIVIGKVKGINGGDLTRAVSCHQSLYPYLLYY  552

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP++ +KINHG+AICHIDTSAW A+HGAF+ALGSGPG+IEVCHWI
Sbjct  553  CHSVPKVRVYEADLLDPESSEKINHGIAICHIDTSAWSASHGAFVALGSGPGRIEVCHWI  612

Query  361  FENDMTWTVAD  393
            FENDMTWT  D
Sbjct  613  FENDMTWTTVD  623



>ref|XP_010044627.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010044628.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
isoform X2 [Eucalyptus grandis]
Length=372

 Score =   194 bits (494),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG +V+VR+TE+  G+KQ ++IG V+ I G + +K V+CHQSLFPY+VYY
Sbjct  242  EDMIDFATSVLGHDVMVRSTESARGSKQEVLIGVVRRIEGSEGSKPVACHQSLFPYIVYY  301

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+ P VRVYEADILDPK+K KINHGVAICH+DTS W   HG+FL LGSGPG+IEVCHWI
Sbjct  302  CHAFPNVRVYEADILDPKSKAKINHGVAICHMDTSTWSPAHGSFLLLGSGPGQIEVCHWI  361

Query  361  FENDMTWTVA  390
             EN+M WT+A
Sbjct  362  NENNMMWTIA  371



>emb|CDY47228.1| BnaC09g14770D [Brassica napus]
Length=623

 Score =   198 bits (504),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG  VVVRTTE  VG+K+ I+IG VKGINGG LT++VSCHQSL+PYL+YY
Sbjct  493  EDMIDFATSVLGHGVVVRTTENVVGSKKKIVIGKVKGINGGDLTRAVSCHQSLYPYLLYY  552

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LDP++ +KINHG+AICHIDTSAW A+H AFLALGSGPG+IEVCHWI
Sbjct  553  CHSVPKVRVYEADLLDPESSEKINHGIAICHIDTSAWSASHVAFLALGSGPGRIEVCHWI  612

Query  361  FENDMTWTVAD  393
            FENDMTWT  D
Sbjct  613  FENDMTWTTVD  623



>gb|KCW86730.1| hypothetical protein EUGRSUZ_B03341 [Eucalyptus grandis]
Length=272

 Score =   189 bits (480),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG +V+VR+TE+  G+KQ ++IG VK I G +++K V+CH+ LFPY+VYY
Sbjct  141  EDMIDFATSVLGHDVMVRSTESARGSKQEVLIGVVKRIEGSEVSKPVACHEILFPYIVYY  200

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+ P VRVYEADILDPK+K KINHGVAICH+DTS W   HG+F  LGSGPG+IEVCHWI
Sbjct  201  CHTFPNVRVYEADILDPKSKAKINHGVAICHMDTSTWSPAHGSFQLLGSGPGQIEVCHWI  260

Query  361  FENDMTWTVA  390
            ++N++ WT+A
Sbjct  261  YDNNLIWTIA  270



>ref|XP_006659367.1| PREDICTED: BURP domain-containing protein 12-like, partial [Oryza 
brachyantha]
Length=495

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  +LG ++VVR+T +T G+ + I +G+V G++GGK+T+SVSCHQSLFPYLVYY
Sbjct  365  EDIVDFAVEMLGNDIVVRSTASTAGSGEEIRLGNVTGVDGGKVTRSVSCHQSLFPYLVYY  424

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADI+   +  +INHGVAICH+DTS W  THGAF+ALG  PG++EVCHWI
Sbjct  425  CHSVPKVRVYEADIMAADSDQQINHGVAICHLDTSDWSPTHGAFIALGGKPGEVEVCHWI  484

Query  361  FENDMTWTVAD  393
            FE DMTWTVAD
Sbjct  485  FEGDMTWTVAD  495



>ref|XP_010046648.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=383

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG +V+VR+TE+  G+KQ ++IG VK I G +++K V+CH+ LFPY+VYY
Sbjct  252  EDMIDFATSVLGHDVMVRSTESARGSKQEVLIGVVKRIEGSEVSKPVACHEILFPYIVYY  311

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+ P VRVYEADILDPK+K KINHGVAICH+DTS W   HG+F  LGSGPG+IEVCHWI
Sbjct  312  CHTFPNVRVYEADILDPKSKAKINHGVAICHMDTSTWSPAHGSFQLLGSGPGQIEVCHWI  371

Query  361  FENDMTWTVA  390
            ++N++ WT+A
Sbjct  372  YDNNLIWTIA  381



>ref|NP_001061692.1| Os08g0380100 [Oryza sativa Japonica Group]
 sp|Q6ZA27.1|BURPC_ORYSJ RecName: Full=BURP domain-containing protein 12; Short=OsBURP12; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD05416.1| putative polygalacturonase isoenzyme 1 beta subunit homolog [Oryza 
sativa Japonica Group]
 dbj|BAF23606.1| Os08g0380100 [Oryza sativa Japonica Group]
 dbj|BAG95253.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96203.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   195 bits (495),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 90/131 (69%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  +LG ++VVR+T +T G+   I +G+V G++GGK+T+SVSCHQSLFPYLVYY
Sbjct  497  EDIVDFAVEMLGNDIVVRSTASTAGSGGQIRLGNVTGVDGGKVTRSVSCHQSLFPYLVYY  556

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEADI+   +  KINHGVAICH+DTS W  THGAF+ALG  PG++EVCHWI
Sbjct  557  CHSVPKVRVYEADIMAADSDQKINHGVAICHLDTSDWSPTHGAFIALGGKPGEVEVCHWI  616

Query  361  FENDMTWTVAD  393
            FE DMTWTVAD
Sbjct  617  FEGDMTWTVAD  627



>gb|KCW86723.1| hypothetical protein EUGRSUZ_B03334 [Eucalyptus grandis]
Length=260

 Score =   186 bits (472),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG +V+VR+TE+  G+KQ ++IG VK I G +++K V+CH+ LFPY+VYY
Sbjct  129  EDMIDFATSVLGHDVMVRSTESARGSKQEVLIGVVKRIEGSEVSKPVACHRRLFPYIVYY  188

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHS P VR YEADILDPK+K KINHGVAICH++TS W   H +FL LGSGPG+IEVCHWI
Sbjct  189  CHSFPNVRSYEADILDPKSKAKINHGVAICHMNTSTWSPIHESFLLLGSGPGQIEVCHWI  248

Query  361  FENDMTWTVA  390
            +EN+  WT+A
Sbjct  249  YENNPIWTIA  258



>ref|NP_001064572.1| Os10g0409400 [Oryza sativa Japonica Group]
 sp|Q7XES5.1|BURPG_ORYSJ RecName: Full=BURP domain-containing protein 16; Short=OsBURP16; 
AltName: Full=Protein WGP1; Short=OsWGP1; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAP53713.1| BURP domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26486.1| Os10g0409400 [Oryza sativa Japonica Group]
 gb|EAZ16044.1| hypothetical protein OsJ_31485 [Oryza sativa Japonica Group]
 gb|ABR23532.1| cell wall protein WGP1 [Oryza sativa Japonica Group]
 dbj|BAG99870.1| unnamed protein product [Oryza sativa Japonica Group]
Length=344

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA A+LG ++VVR+T    G  ++IMIG VKGINGGK+T SVSCH+ LFPY+VYY
Sbjct  212  EDMIDFAVAMLGDDIVVRSTVLPNGPGESIMIGKVKGINGGKITSSVSCHEYLFPYMVYY  271

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPK+RVYEA+IL  +TK+KIN GVAICHIDTSAW A H AF+ALG  PG+ +VCHWI
Sbjct  272  CHSVPKIRVYEAEILSVQTKEKINSGVAICHIDTSAWNAGHPAFVALGGKPGQNKVCHWI  331

Query  361  FENDMTWTVAD  393
            F   MTW +AD
Sbjct  332  FNGSMTWVIAD  342



>gb|KCW86722.1| hypothetical protein EUGRSUZ_B03333 [Eucalyptus grandis]
Length=249

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG +V+VR+T +  G+KQ ++IG VK I G +++K V+CHQSLFPY+VYY
Sbjct  121  EDMIDFATSVLGHDVLVRSTGSARGSKQEVLIGVVKRIEGSEVSKPVACHQSLFPYVVYY  180

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+   VRVYEADILDPK+K KINHGVAICH+DTS W  TH +FL LGSGPG+IEVCHWI
Sbjct  181  CHTFSNVRVYEADILDPKSKAKINHGVAICHMDTSTWSPTHESFLLLGSGPGQIEVCHWI  240

Query  361  FENDM  375
            +EN++
Sbjct  241  YENEI  245



>ref|XP_009415276.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   194 bits (492),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+IDFA +VLG +VVVR+T  T G+K  I+IG V G+NGGK+TKSVSCHQSLFPYLVYY
Sbjct  517  EDVIDFAVSVLGSDVVVRSTANTTGSKGNILIGKVGGVNGGKITKSVSCHQSLFPYLVYY  576

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEA+IL  ++K+KINHG+AICH+DTS W A+HGAF+ALGS PGKIEVCHWI
Sbjct  577  CHSVPKVRVYEAEILAVESKEKINHGIAICHLDTSDWSASHGAFVALGSAPGKIEVCHWI  636

Query  361  FENDMTWTVAD  393
            FE DMTWTVAD
Sbjct  637  FEGDMTWTVAD  647



>gb|EEC77314.1| hypothetical protein OsI_15976 [Oryza sativa Indica Group]
Length=202

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA A+LG ++VVR+T    G+ ++IMIG VKGIN GK+T SVSCH+ LFPY+VY 
Sbjct  70   EDMIDFAVAMLGDDIVVRSTVLPNGSGESIMIGKVKGINSGKITSSVSCHEYLFPYMVYS  129

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPK+RVYEA+IL  +TK+KIN GVA+CHIDTSAW A H AF+ALG  PG+ EVCHWI
Sbjct  130  CHSVPKIRVYEAEILSVQTKEKINSGVAVCHIDTSAWSAGHPAFVALGGKPGQNEVCHWI  189

Query  361  FENDMTWTVAD  393
            +   MTW +AD
Sbjct  190  YNGSMTWVIAD  200



>ref|XP_010100468.1| hypothetical protein L484_027780 [Morus notabilis]
 gb|EXB82602.1| hypothetical protein L484_027780 [Morus notabilis]
Length=180

 Score =   182 bits (461),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 115/181 (64%), Gaps = 53/181 (29%)
 Frame = +1

Query  7    MIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYYCH  186
            MIDFAT+VLG+NV+VR+TE   G+K+ IMIGSVKGINGGK + + SCHQSLFPYLVYYCH
Sbjct  1    MIDFATSVLGQNVIVRSTENVSGSKKYIMIGSVKGINGGK-SHNQSCHQSLFPYLVYYCH  59

Query  187  SVPKVRVYEADILDPKTKDKINHGVAIC--------------------------------  270
            SVP VRV EADILDP +K KINHGVAIC                                
Sbjct  60   SVPTVRVCEADILDPNSKAKINHGVAICRLFVGVAIRVACRIRIVDPILTRTSFFSTLTR  119

Query  271  --------------------HIDTSAWGATHGAFLALGSGPGKIEVCHWIFENDMTWTVA  390
                                H+DTSAW  THGAFLA GSGPG+IEVCHWIF+ND+TWTVA
Sbjct  120  KIRVVFESCCRVVTHIVGPSHLDTSAWSPTHGAFLAFGSGPGQIEVCHWIFKNDLTWTVA  179

Query  391  D  393
            D
Sbjct  180  D  180



>emb|CDX68345.1| BnaA07g23850D [Brassica napus]
Length=618

 Score =   191 bits (485),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 93/131 (71%), Positives = 111/131 (85%), Gaps = 7/131 (5%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE+  G+KQ ++IG V GINGGKLT++VSCHQSL+PYL+YY
Sbjct  495  EDMIDFATSVLGRSVVLRTTESVAGSKQKVVIGKVNGINGGKLTEAVSCHQSLYPYLLYY  554

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+L+  +K KINHG+AICHIDTS+W  THGAFLALGS PG+I      
Sbjct  555  CHSVPKVRVYEADLLELNSKTKINHGIAICHIDTSSWSPTHGAFLALGSKPGRI------  608

Query  361  FENDMTWTVAD  393
             ENDM W +AD
Sbjct  609  -ENDMNWAIAD  618



>ref|XP_004973305.1| PREDICTED: BURP domain-containing protein 12-like [Setaria italica]
Length=647

 Score =   191 bits (486),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 92/135 (68%), Positives = 112/135 (83%), Gaps = 4/135 (3%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  +LG +VVVR+T +T G+   I +G+V G++GGK+T+SVSCHQSLFPYLVYY
Sbjct  513  EDIVDFAVEMLGNDVVVRSTASTAGSGGDIRLGAVTGVDGGKVTQSVSCHQSLFPYLVYY  572

Query  181  CHSVPKVRVYEADIL----DPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEV  348
            CHSVPKVRVYEADI+    D  + +KINHGVAICH+DTS W  THGAF+ALG  PG++EV
Sbjct  573  CHSVPKVRVYEADIMSAAADGGSGEKINHGVAICHLDTSDWSPTHGAFVALGGKPGEVEV  632

Query  349  CHWIFENDMTWTVAD  393
            CHWIFE DMTWTVAD
Sbjct  633  CHWIFEGDMTWTVAD  647



>gb|EMT30231.1| hypothetical protein F775_20363 [Aegilops tauschii]
Length=444

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  +LG ++VV +T +T G+   I +G+V G++GGK+T+ VSCHQSLFPYLVYY
Sbjct  314  EDIVDFAVEMLGSDIVVHSTASTAGSGADIRLGNVTGVHGGKVTRPVSCHQSLFPYLVYY  373

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPK RVYEADI    +  KINHGVAICH+DTS W   HGAF+ALG  PGKIEVCHWI
Sbjct  374  CHSVPKARVYEADITAADSGQKINHGVAICHLDTSDWSPAHGAFIALGGKPGKIEVCHWI  433

Query  361  FENDMTWTVAD  393
            FE DMTWTVAD
Sbjct  434  FEGDMTWTVAD  444



>ref|XP_010046646.1| PREDICTED: BURP domain-containing protein 16-like [Eucalyptus 
grandis]
Length=538

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLG +V+VR+TE+  G+KQ ++IG VK I G +++K V+CH+ LFPY+VYY
Sbjct  233  EDMIDFATSVLGHDVMVRSTESARGSKQEVLIGVVKRIEGSEVSKPVACHRRLFPYIVYY  292

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHS P VR YEADILDPK+K KINHGVAICH++TS W   H +FL LGSGPG+IEVCHWI
Sbjct  293  CHSFPNVRSYEADILDPKSKAKINHGVAICHMNTSTWSPIHESFLLLGSGPGQIEVCHWI  352

Query  361  FENDMTWTVA  390
            +EN+  WT+A
Sbjct  353  YENNPIWTIA  362



>ref|XP_008652571.1| PREDICTED: BURP domain-containing protein 14-like [Zea mays]
 tpg|DAA61067.1| TPA: hypothetical protein ZEAMMB73_635092 [Zea mays]
Length=679

 Score =   189 bits (481),  Expect = 8e-53, Method: Composition-based stats.
 Identities = 86/131 (66%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDM+DFA  +LG N+ VR+TE+T G+ + + +G + GI GG +T+SVSCHQSLFPYLVYY
Sbjct  549  EDMLDFAVEMLGSNIAVRSTESTAGSGRDVRLGKITGIAGGSVTRSVSCHQSLFPYLVYY  608

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VR+YEADILD  +  KINHGVAICH++TS W   HGAF+ALG  PG+IEVCHWI
Sbjct  609  CHSVPRVRLYEADILDVDSNRKINHGVAICHLETSDWSPNHGAFVALGGKPGQIEVCHWI  668

Query  361  FENDMTWTVAD  393
            FE DM WT+ D
Sbjct  669  FEGDMAWTLVD  679



>gb|EMS58973.1| hypothetical protein TRIUR3_16136 [Triticum urartu]
Length=514

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  +LG ++VV +T +T G+   I +G+V G++GGK+T+ VSCHQSLFPYLVYY
Sbjct  384  EDIVDFAVEMLGSDIVVHSTASTAGSGADIRLGNVTGVHGGKVTRPVSCHQSLFPYLVYY  443

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPK RVYEADI    +  KINHGVAICH+DTS W   HGAF+ALG  PGKIEVCHWI
Sbjct  444  CHSVPKARVYEADITAADSGQKINHGVAICHLDTSDWSPAHGAFIALGGKPGKIEVCHWI  503

Query  361  FENDMTWTVAD  393
            FE DMTWTVAD
Sbjct  504  FEGDMTWTVAD  514



>dbj|BAJ92348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   188 bits (477),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 87/131 (66%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  +LG ++VV +T +T G+   I +G+V G++GGK+T+ VSCHQSLFPYLVYY
Sbjct  494  EDIVDFAVEMLGSDIVVHSTASTAGSGADIRLGNVTGVHGGKVTRPVSCHQSLFPYLVYY  553

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPK RVYEA+I    +  KINHGVAICH+DTS W   HGAF+ALG  PGKIEVCHWI
Sbjct  554  CHSVPKARVYEAEITAADSGQKINHGVAICHLDTSDWSPAHGAFVALGGKPGKIEVCHWI  613

Query  361  FENDMTWTVAD  393
            FE DMTWTVAD
Sbjct  614  FEGDMTWTVAD  624



>ref|XP_002460065.1| hypothetical protein SORBIDRAFT_02g022220 [Sorghum bicolor]
 gb|EER96586.1| hypothetical protein SORBIDRAFT_02g022220 [Sorghum bicolor]
Length=691

 Score =   188 bits (477),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 86/131 (66%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDM+DFA  +LG N+ VR+TE+T G    + +G + GI GG +T+SVSCHQSLFPYLVYY
Sbjct  561  EDMLDFAVEMLGSNIAVRSTESTAGGGGDVRLGKITGIAGGSVTRSVSCHQSLFPYLVYY  620

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP+VR+YEADILD  +  KINHGVAICH++TS W  +HGAF+ALG  PG+IEVCHWI
Sbjct  621  CHSVPRVRLYEADILDVDSNRKINHGVAICHLETSDWSPSHGAFVALGGKPGQIEVCHWI  680

Query  361  FENDMTWTVAD  393
            FE DM WT+ D
Sbjct  681  FEGDMAWTLVD  691



>ref|XP_003574428.1| PREDICTED: BURP domain-containing protein 12 [Brachypodium distachyon]
Length=623

 Score =   187 bits (475),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 86/131 (66%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  +LG ++VV +T +  G+   I +GSV G++GGK+T+SVSCHQSLFPYLVYY
Sbjct  493  EDIVDFAVEMLGNDIVVHSTASPAGSGGDIRLGSVTGVDGGKVTRSVSCHQSLFPYLVYY  552

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVY A+I+   +  KINHGVAICH+DTS W   HGAF+ALG  PG+ EVCHWI
Sbjct  553  CHSVPKVRVYAAEIMAVDSDQKINHGVAICHLDTSDWSPAHGAFVALGGKPGETEVCHWI  612

Query  361  FENDMTWTVAD  393
            FE DMTWTVAD
Sbjct  613  FEGDMTWTVAD  623



>gb|EPS68955.1| hypothetical protein M569_05812, partial [Genlisea aurea]
Length=592

 Score =   185 bits (470),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 88/132 (67%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFA + LG ++ VRTT  T G+ +T+ + +V+ I+GGK TKSVSCHQ+L+PYL+YY
Sbjct  461  EDMIDFAVSTLGPSIAVRTTANTNGSGRTVQLKNVEPIDGGKSTKSVSCHQTLYPYLLYY  520

Query  181  CHSVPKVRVYEADILDPK-TKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            CHSVP VRVYEADI +    ++KIN GVAICH+DT++W   HGAF+ALGS PG IEVCHW
Sbjct  521  CHSVPDVRVYEADIHETAGRREKINRGVAICHLDTASWSPNHGAFIALGSRPGLIEVCHW  580

Query  358  IFENDMTWTVAD  393
            IFENDMTWTVAD
Sbjct  581  IFENDMTWTVAD  592



>ref|XP_004956601.1| PREDICTED: BURP domain-containing protein 14-like [Setaria italica]
Length=683

 Score =   185 bits (470),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 86/132 (65%), Positives = 107/132 (81%), Gaps = 1/132 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGR-NvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            EDM+DFA  +LG  N+ VR+TE+T G+ + + +G + G+ GG +T+SVSCHQSLFPYLVY
Sbjct  552  EDMVDFAVEMLGSSNIAVRSTESTAGSGRDVRLGKITGVAGGGVTRSVSCHQSLFPYLVY  611

Query  178  YCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            YCHSVP+VR+YEADILD  +  +INHGVAICH+DTS W   HGAF+ALG  PG+IEVCHW
Sbjct  612  YCHSVPRVRLYEADILDVDSNRRINHGVAICHLDTSDWSPNHGAFVALGGKPGEIEVCHW  671

Query  358  IFENDMTWTVAD  393
            IFE DMTWT+ D
Sbjct  672  IFEGDMTWTLVD  683



>gb|ACG28762.1| polygalacturonase-1 non-catalytic beta subunit precursor [Zea 
mays]
Length=642

 Score =   185 bits (469),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 88/132 (67%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  VLG ++VVR+T +T G    + +G+V G++GG++T+SVSCHQSLFPYLVYY
Sbjct  511  EDVVDFAVEVLGDDIVVRSTASTAGGGGRVQLGAVAGMDGGRVTRSVSCHQSLFPYLVYY  570

Query  181  CHSVPKVRVYEADILDPK-TKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            CHSVPKVRVYEADIL    + +KIN GVAICH+DTS W   HGAF+ALG  PG++EVCHW
Sbjct  571  CHSVPKVRVYEADILAADGSGEKINRGVAICHLDTSDWSPAHGAFVALGGKPGEVEVCHW  630

Query  358  IFENDMTWTVAD  393
            IFE DMTWTVAD
Sbjct  631  IFEGDMTWTVAD  642



>gb|ACN34141.1| unknown [Zea mays]
Length=643

 Score =   184 bits (468),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 88/134 (66%), Positives = 108/134 (81%), Gaps = 3/134 (2%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  VLG ++VVR+T +T G    + +G+V G++GG++T+SVSCHQSLFPYLVYY
Sbjct  510  EDVVDFAVEVLGDDIVVRSTASTAGGGGRVQLGAVAGVDGGRVTRSVSCHQSLFPYLVYY  569

Query  181  CHSVPKVRVYEADILDPK---TKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVC  351
            CHSVPKVRVYEADIL      + +KIN GVAICH+DTS W   HGAF+ALG  PG++EVC
Sbjct  570  CHSVPKVRVYEADILAADGSGSGEKINRGVAICHLDTSDWSPAHGAFVALGGKPGEVEVC  629

Query  352  HWIFENDMTWTVAD  393
            HWIFE DMTWTVAD
Sbjct  630  HWIFEGDMTWTVAD  643



>ref|NP_001146063.1| uncharacterized protein LOC100279594 precursor [Zea mays]
 gb|ACL53138.1| unknown [Zea mays]
 gb|ACN33667.1| unknown [Zea mays]
 gb|AFW62083.1| polygalacturonase-1 non-catalytic beta subunit [Zea mays]
Length=643

 Score =   184 bits (468),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 88/134 (66%), Positives = 108/134 (81%), Gaps = 3/134 (2%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  VLG ++VVR+T +T G    + +G+V G++GG++T+SVSCHQSLFPYLVYY
Sbjct  510  EDVVDFAVEVLGDDIVVRSTASTAGGGGRVQLGAVAGVDGGRVTRSVSCHQSLFPYLVYY  569

Query  181  CHSVPKVRVYEADILDPK---TKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVC  351
            CHSVPKVRVYEADIL      + +KIN GVAICH+DTS W   HGAF+ALG  PG++EVC
Sbjct  570  CHSVPKVRVYEADILAADGSGSGEKINRGVAICHLDTSDWSPAHGAFVALGGKPGEVEVC  629

Query  352  HWIFENDMTWTVAD  393
            HWIFE DMTWTVAD
Sbjct  630  HWIFEGDMTWTVAD  643



>ref|NP_001062896.2| Os09g0329000 [Oryza sativa Japonica Group]
 sp|Q6K2M1.2|BURPE_ORYSJ RecName: Full=BURP domain-containing protein 14; Short=OsBURP14; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAF24810.2| Os09g0329000 [Oryza sativa Japonica Group]
Length=690

 Score =   181 bits (459),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 87/132 (66%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGI-NGGKLTKSVSCHQSLFPYLVY  177
            ED++DFA  +LG NVV R TE+T G    + +G V G+  GG +T+SVSCHQSLFPYLVY
Sbjct  559  EDVVDFAVEMLGDNVVARATESTAGGGGDVRLGRVAGVPAGGNVTRSVSCHQSLFPYLVY  618

Query  178  YCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            YCHSVP VRVYEADIL   +  KINHGVAICH+DTS W   HGAF+ALG  PG++EVCHW
Sbjct  619  YCHSVPTVRVYEADILAVDSNQKINHGVAICHLDTSDWSPNHGAFIALGGKPGEMEVCHW  678

Query  358  IFENDMTWTVAD  393
            IF+ DMTWTVA+
Sbjct  679  IFQGDMTWTVAN  690



>gb|AAL65393.1| polygalacturonase isoenzyme 1 beta subunit [Oryza sativa Japonica 
Group]
Length=112

 Score =   167 bits (424),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +1

Query  73   GAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDPKTKDKIN  252
            G  ++IMIG VKGINGGK+T SVSCH+ LFPY+VYYCHSVPK+RVYEA+IL  +TK+KIN
Sbjct  4    GPGESIMIGKVKGINGGKITSSVSCHEYLFPYMVYYCHSVPKIRVYEAEILSVQTKEKIN  63

Query  253  HGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWIFENDMTWTVAD  393
             GVAICHIDTSAW A H AF+ALG  PG+ +VCHWIF   MTW +AD
Sbjct  64   SGVAICHIDTSAWNAGHPAFVALGGKPGQNKVCHWIFNGSMTWVIAD  110



>gb|EEC84370.1| hypothetical protein OsI_30914 [Oryza sativa Indica Group]
Length=658

 Score =   180 bits (457),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 86/132 (65%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGI-NGGKLTKSVSCHQSLFPYLVY  177
            ED++DFA  +LG NVV R TE+T G    + +G V G+  GG +T+SVSCHQSLFPYLVY
Sbjct  527  EDVVDFAVEMLGDNVVARATESTAGGGGDVRLGRVAGVPAGGNVTRSVSCHQSLFPYLVY  586

Query  178  YCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            YCHSVP VRVYEADIL   +  +INHGVAICH+DTS W   HGAF+ALG  PG++EVCHW
Sbjct  587  YCHSVPTVRVYEADILAVDSNQRINHGVAICHLDTSDWSPNHGAFIALGGKPGEMEVCHW  646

Query  358  IFENDMTWTVAD  393
            IF+ DMTWTVA+
Sbjct  647  IFQGDMTWTVAN  658



>dbj|BAJ97940.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   179 bits (455),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 84/131 (64%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDM+DFA  +LG NV VR+TE+  G+   I +G V G+ GG  T+SVSCHQS+FPYLVYY
Sbjct  622  EDMLDFAVEMLGDNVAVRSTESAAGSGGDIRVGRVAGVAGGHATRSVSCHQSMFPYLVYY  681

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP VRVYEA+IL   +  +IN GVAICH+DTS W   HGAF ALG  PG++EVCHWI
Sbjct  682  CHSVPSVRVYEAEILAVDSGRRINRGVAICHLDTSEWSPGHGAFAALGGKPGEMEVCHWI  741

Query  361  FENDMTWTVAD  393
            F+ DM WTVAD
Sbjct  742  FQGDMVWTVAD  752



>emb|CDY59986.1| BnaC06g43610D [Brassica napus]
Length=611

 Score =   176 bits (447),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 88/131 (67%), Positives = 103/131 (79%), Gaps = 16/131 (12%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT+VLGR+VV+RTTE   G+KQ ++IG V GINGGK+TK+VSCHQSL+PYL+YY
Sbjct  497  EDMIDFATSVLGRSVVLRTTENVAGSKQKVVIGKVNGINGGKVTKAVSCHQSLYPYLMYY  556

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVPKVRVYEAD+LD K+K KINHG+AI                +LGS PG IEVCHWI
Sbjct  557  CHSVPKVRVYEADLLDLKSKTKINHGIAI----------------SLGSKPGLIEVCHWI  600

Query  361  FENDMTWTVAD  393
            FENDM W +AD
Sbjct  601  FENDMNWAIAD  611



>ref|XP_002444270.1| hypothetical protein SORBIDRAFT_07g019310 [Sorghum bicolor]
 gb|EES13765.1| hypothetical protein SORBIDRAFT_07g019310 [Sorghum bicolor]
Length=658

 Score =   176 bits (445),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 89/143 (62%), Positives = 109/143 (76%), Gaps = 12/143 (8%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA   LG ++VVR+T +T G+   + +G+V G++GGK+T+SVSCHQSLFPYLVYY
Sbjct  516  EDVVDFAVETLGDDIVVRSTASTAGSGGDVRLGTVTGVDGGKVTRSVSCHQSLFPYLVYY  575

Query  181  CHSVPKVRVYEADILDPKT------------KDKINHGVAICHIDTSAWGATHGAFLALG  324
            CHSVPKVRVYEADI+                K+ INHGVAICH+DTS W  THGAF+ALG
Sbjct  576  CHSVPKVRVYEADIMAAAAAADDDGGSDAGEKEIINHGVAICHLDTSDWSPTHGAFVALG  635

Query  325  SGPGKIEVCHWIFENDMTWTVAD  393
              PG++EVCHWIFE DMTWTVAD
Sbjct  636  GKPGEVEVCHWIFEGDMTWTVAD  658



>ref|XP_010046641.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=364

 Score =   171 bits (433),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT++LG ++ + + ++  G+K+ I+IG VK I G KL+  V+CH SLFPY+VY 
Sbjct  234  EDMIDFATSILGHDIKLHSPKSDEGSKRDILIGRVKRIGGSKLSAPVACHDSLFPYMVYN  293

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+VP + VYE DILDP +K KIN+GVA+CH+DTSAW   H AFLALGSGPG+IE CHWI
Sbjct  294  CHAVPTLHVYEVDILDPVSKAKINNGVAVCHMDTSAWNPNHEAFLALGSGPGRIEACHWI  353

Query  361  FENDMTWTVAD  393
            + +   WT A+
Sbjct  354  YGDYAVWTRAN  364



>ref|XP_010044626.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
 gb|KCW86719.1| hypothetical protein EUGRSUZ_B03326 [Eucalyptus grandis]
Length=364

 Score =   168 bits (426),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDMIDFAT++LG ++ + +T++  G+K  I+IG VK I G KL+  V+CH SLFPY+VY 
Sbjct  234  EDMIDFATSILGHDIKLHSTKSDEGSKHDILIGRVKRIGGSKLSVPVACHDSLFPYMVYN  293

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+VP + VYE DILDP +K KIN+GVA+CH+DTSAW   H AF+ALGSGPG+IE CHWI
Sbjct  294  CHAVPTLHVYEVDILDPVSKAKINNGVAVCHMDTSAWNPNHEAFIALGSGPGRIEACHWI  353

Query  361  FENDMTWTVAD  393
            +     WT A+
Sbjct  354  YGEYAVWTRAN  364



>ref|XP_010044635.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Eucalyptus grandis]
Length=358

 Score =   168 bits (425),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E MIDFAT++LG ++ + +TE+  G+K+ I+IG VK ++G K +  V+CH+++FPY+VYY
Sbjct  228  EGMIDFATSILGHDIQLHSTESVEGSKREILIGRVKRLDGSKSSAPVACHETIFPYMVYY  287

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+ P +R+YEADILDP +K KINHG+A+CH+DTS W   H AFLALGS PG+IE CHW+
Sbjct  288  CHTFPTLRIYEADILDPVSKAKINHGIALCHMDTSIWSPNHEAFLALGSSPGRIEACHWV  347

Query  361  FENDMTWTVAD  393
            F +   WT A+
Sbjct  348  FGDYGVWTGAN  358



>ref|XP_010046647.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=159

 Score =   160 bits (404),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E MIDFAT++LG ++ + +TE+  G+K+ I+IG VK + G K +  V+CH+++FPY+VYY
Sbjct  29   EGMIDFATSILGHDIQLHSTESVEGSKREILIGRVKRLEGSKSSAPVACHETIFPYMVYY  88

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+ P +R+YEADILDP +K KINHG+A+CH+DTS W   H AFLALGS PG+IE CH +
Sbjct  89   CHTFPTLRIYEADILDPMSKAKINHGIALCHMDTSIWSPNHVAFLALGSSPGQIEACHCV  148

Query  361  FENDMTWT  384
            F +   WT
Sbjct  149  FGDYGVWT  156



>gb|KCW86724.1| hypothetical protein EUGRSUZ_B03335 [Eucalyptus grandis]
Length=207

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E MIDFAT++LG ++ + +TE+  G+K+ I+IG VK + G K +  V+CH+++FPY+VYY
Sbjct  77   EGMIDFATSILGHDIQLHSTESVEGSKREILIGRVKRLEGSKSSAPVACHETIFPYMVYY  136

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+ P +R+YEADILDP +K KINHG+A+CH+DTS W   H AFLALGS PG+IE CH +
Sbjct  137  CHTFPTLRIYEADILDPMSKAKINHGIALCHMDTSIWSPNHVAFLALGSSPGQIEACHCV  196

Query  361  FENDMTWT  384
            F +   WT
Sbjct  197  FGDYGVWT  204



>dbj|BAK05386.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=625

 Score =   166 bits (421),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 83/133 (62%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  +LG ++VVR+T +T G+   + +G V    GGK  ++VSCHQSLFPYLVYY
Sbjct  496  EDVVDFAVEMLGDDIVVRSTASTAGSGAGVRLGDV---TGGKAARAVSCHQSLFPYLVYY  552

Query  181  CHSVPKVRVYEADIL--DPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCH  354
            CHSVPK RVYEADI+  D     KIN GVAICH+DTS W  +HGAF+ LG  PGK EVCH
Sbjct  553  CHSVPKARVYEADIMAADAGGGRKINRGVAICHLDTSDWSPSHGAFVLLGGEPGKTEVCH  612

Query  355  WIFENDMTWTVAD  393
            WIFE DMTWT AD
Sbjct  613  WIFEGDMTWTAAD  625



>gb|ABR16440.1| unknown [Picea sitchensis]
Length=666

 Score =   166 bits (419),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 77/137 (56%), Positives = 99/137 (72%), Gaps = 10/137 (7%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E M +FA  +LG+ V V TT +T G+ + + +G V G +GG++T+SVSCHQS+FPYLVYY
Sbjct  526  EGMAEFAVGILGKKVEVLTTASTAGSGERVQVGEVNGKDGGRVTRSVSCHQSMFPYLVYY  585

Query  181  CHSVPKVRVYEADIL----------DPKTKDKINHGVAICHIDTSAWGATHGAFLALGSG  330
            CHSVPKV+VYEA +L            +  +KIN GVAICH+DT+ W A H AF+ALG  
Sbjct  586  CHSVPKVKVYEAALLRNSNSNPSSNQKEKIEKINDGVAICHLDTTQWSAGHAAFVALGHK  645

Query  331  PGKIEVCHWIFENDMTW  381
            PG+IEVCHWIFEND+ W
Sbjct  646  PGQIEVCHWIFENDLIW  662



>gb|AAL15882.1|AF417294_1 putative polygalacturonase beta subunit [Castanea sativa]
Length=121

 Score =   153 bits (386),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +1

Query  76   AKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDPKTKDKINH  255
            A Q IMIGSV+GINGGK+T+ VSCHQ+LFPYL+Y+CHSVPKVRVYE DILDP +K KINH
Sbjct  13   AGQNIMIGSVRGINGGKVTQIVSCHQTLFPYLLYHCHSVPKVRVYEVDILDPNSKAKINH  72

Query  256  GVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWIFENDMTWTVAD  393
            GVA CH+ TS       A L + SGPG+I+ CHW+ EN + WT+AD
Sbjct  73   GVASCHMHTSDSNPNQ-AELTIASGPGQIKACHWVVENHLIWTIAD  117



>ref|XP_010046643.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=211

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E MIDFAT++LG ++ + +TE+  G+K+ I+IG VK + G K +  V+CH+++FPY+VYY
Sbjct  81   EGMIDFATSILGHDIQLHSTESVEGSKREILIGRVKRLEGSKSSAPVACHETIFPYMVYY  140

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+   +RVYEADILDP +K KINHG+A+ H+DTS W   H AFLAL S PG+IE CHW+
Sbjct  141  CHTFLTLRVYEADILDPVSKAKINHGIALYHMDTSIWSPNHEAFLALRSSPGQIETCHWV  200

Query  361  FENDMTWT  384
            F +   WT
Sbjct  201  FGDYGVWT  208



>ref|XP_003576424.1| PREDICTED: BURP domain-containing protein 14-like [Brachypodium 
distachyon]
Length=775

 Score =   163 bits (413),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 82/131 (63%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  +LG N+ VR+TE+  G    + +G V G+ GG +T+SVSCHQSLFPYLVYY
Sbjct  643  EDVLDFAVEMLGDNIAVRSTESPAGGGGDVRLGRVGGVAGGGVTRSVSCHQSLFPYLVYY  702

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHSVP VRVYEA+I+   +  +IN GVAICH+DTS W   HGAF+ALG  PG++EVCHWI
Sbjct  703  CHSVPSVRVYEAEIMAVDSGQRINRGVAICHLDTSDWSPDHGAFVALGGKPGEMEVCHWI  762

Query  361  FENDMTWTVAD  393
            F+ DMTWTVAD
Sbjct  763  FQGDMTWTVAD  773



>gb|EEC83505.1| hypothetical protein OsI_29064 [Oryza sativa Indica Group]
Length=623

 Score =   159 bits (403),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  +LG ++VVR+T +T G+   I +G+V G++GGK+T+SVSCHQSLFPYLVYY
Sbjct  466  EDIVDFAVEMLGNDIVVRSTASTAGSGGQIRLGNVTGVDGGKVTRSVSCHQSLFPYLVYY  525

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEV  348
            CHSVPKVRVYEADI+   +  KINHGVAICH+DTS W  THGAF+ALG  PG++EV
Sbjct  526  CHSVPKVRVYEADIMAADSDQKINHGVAICHLDTSDWSPTHGAFIALGGKPGEVEV  581



>gb|EEE68602.1| hypothetical protein OsJ_27135 [Oryza sativa Japonica Group]
Length=703

 Score =   157 bits (398),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 76/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED++DFA  +LG ++VVR+T +T G+   I +G+V G++GGK+T+SVSCHQSLFPYLVYY
Sbjct  473  EDIVDFAVEMLGNDIVVRSTASTAGSGGQIRLGNVTGVDGGKVTRSVSCHQSLFPYLVYY  532

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEV  348
            CHSVPKVRVYEADI+   +  KINHGVAICH+DTS W  THGAF+ALG  PG++EV
Sbjct  533  CHSVPKVRVYEADIMAADSDQKINHGVAICHLDTSDWSPTHGAFIALGGKPGEVEV  588



>ref|XP_003613151.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96109.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=203

 Score =   145 bits (366),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ++M  FA+++LG  VV+R T    G+ + +M+G V  I GG +T+SV+CHQ +FP ++Y+
Sbjct  73   DEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTESVTCHQEVFPVMLYF  132

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH +P VRVY  +IL  + + KIN  V +CHIDTS+W  +H AFL LGS PG+IEVCHWI
Sbjct  133  CHYIPMVRVYNVEILTLQ-RIKINQAVDVCHIDTSSWSRSHPAFLELGSAPGEIEVCHWI  191

Query  361  FENDMTWT  384
            F+ND++WT
Sbjct  192  FQNDISWT  199



>ref|XP_003613152.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96110.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=225

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ++M  FA+++LG  VV+R T    G+ + +M+G V  I GG +T+SV+CHQ +FP ++Y+
Sbjct  95   DEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTESVTCHQEVFPVMLYF  154

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH +P VRVY  +IL  + + KIN  V +CHIDTS+W  +H AFL LGS PG+IEVCHWI
Sbjct  155  CHYIPMVRVYNVEILTLQ-RIKINQAVDVCHIDTSSWSRSHPAFLELGSAPGEIEVCHWI  213

Query  361  FENDMTWT  384
            F+ND++WT
Sbjct  214  FQNDISWT  221



>gb|EMS64687.1| hypothetical protein TRIUR3_01269 [Triticum urartu]
Length=487

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +1

Query  130  TKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGA  309
            T+SVSCHQS+FPYLVYYCHSVP VRVYEA+IL  +T  KIN GVAICH+DTS W   HGA
Sbjct  400  TRSVSCHQSMFPYLVYYCHSVPSVRVYEAEILAVETGRKINRGVAICHLDTSDWSPGHGA  459

Query  310  FLALGSGPGKIEVCHWIFENDMTWTVAD  393
            F ALG  PG++EVCHWIF+ DM WTVAD
Sbjct  460  FAALGGKPGEMEVCHWIFQGDMVWTVAD  487



>ref|XP_006661124.1| PREDICTED: LOW QUALITY PROTEIN: BURP domain-containing protein 
14-like [Oryza brachyantha]
Length=505

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +1

Query  100  SVKGINGGKLTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDPKTKDKINHGVAICHID  279
            +V G  G      VSCHQSLFPYLVYYCHSVP V VYEADIL   +  +INHGVA+CH+D
Sbjct  408  AVGGGAGNATRPVVSCHQSLFPYLVYYCHSVPAVHVYEADILAVDSGHRINHGVAVCHLD  467

Query  280  TSAWGATHGAFLALGSGPGKIEVCHWIFENDMTWTVAD  393
            TS W   HGAF+ALG  PG+IEVCHWIFE DMTWTVA+
Sbjct  468  TSDWSPNHGAFIALGGKPGEIEVCHWIFEGDMTWTVAN  505



>gb|AES96108.2| BURP domain protein [Medicago truncatula]
Length=382

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ++M  FA+++LG  VV+R T    G+ + +M+G V  I GG +T+SV+CHQ +FP ++Y+
Sbjct  252  DEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTESVTCHQEVFPVMLYF  311

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH +P VRVY  +IL  + + KIN  V +CHIDTS+W  +H AFL LGS PG+IEVCHWI
Sbjct  312  CHYIPMVRVYNVEILTLQ-RIKINQAVDVCHIDTSSWSRSHPAFLELGSAPGEIEVCHWI  370

Query  361  FENDMTWT  384
            F+ND++WT
Sbjct  371  FQNDISWT  378


 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ++M  FA+++LG  VV+R T    G+ + +M+G V  I GG +T+SV+CHQ +FP ++Y+
Sbjct  44   DEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTESVTCHQEVFPVMLYF  103

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGP  333
            CH +P VRVY  +IL  + K KIN  V +CHIDTS+W  +H AFL LGS P
Sbjct  104  CHYIPMVRVYNVEILTLQ-KIKINQVVGVCHIDTSSWSRSHPAFLELGSAP  153



>ref|XP_003613150.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
Length=413

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ++M  FA+++LG  VV+R T    G+ + +M+G V  I GG +T+SV+CHQ +FP ++Y+
Sbjct  283  DEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTESVTCHQEVFPVMLYF  342

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH +P VRVY  +IL  + + KIN  V +CHIDTS+W  +H AFL LGS PG+IEVCHWI
Sbjct  343  CHYIPMVRVYNVEILTLQ-RIKINQAVDVCHIDTSSWSRSHPAFLELGSAPGEIEVCHWI  401

Query  361  FENDMTWT  384
            F+ND++WT
Sbjct  402  FQNDISWT  409


 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ++M  FA+++LG  VV+R T    G+ + +M+G V  I GG +T+SV+CHQ +FP ++Y+
Sbjct  75   DEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTESVTCHQEVFPVMLYF  134

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGP  333
            CH +P VRVY  +IL  + K KIN  V +CHIDTS+W  +H AFL LGS P
Sbjct  135  CHYIPMVRVYNVEILTLQ-KIKINQVVGVCHIDTSSWSRSHPAFLELGSAP  184



>gb|KCW86721.1| hypothetical protein EUGRSUZ_B03330 [Eucalyptus grandis]
Length=227

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 90/131 (69%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+ DFAT +L  N+ +   ++  G+K+ I+IG VK I G +L+  V+CH SLFP +VY 
Sbjct  97   EDITDFATLILSHNIKLHAMKSDEGSKRDILIGRVKRIGGSQLSAPVACHDSLFPCMVYN  156

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+VP  + ++  ILDP  K KIN+GVA+ H+DTS     H AFLALGSGPG+IE CHWI
Sbjct  157  CHAVPTPQFHKVGILDPVCKSKINNGVAVYHMDTSIGNPNHEAFLALGSGPGRIEACHWI  216

Query  361  FENDMTWTVAD  393
            + +   WT A+
Sbjct  217  YGDYAVWTRAN  227



>ref|XP_010046644.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=283

 Score =   140 bits (352),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 90/131 (69%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ED+ DFAT +L  N+ +   ++  G+K+ I+IG VK I G +L+  V+CH SLFP +VY 
Sbjct  153  EDITDFATLILSHNIKLHAMKSDEGSKRDILIGRVKRIGGSQLSAPVACHDSLFPCMVYN  212

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH+VP  + ++  ILDP  K KIN+GVA+ H+DTS     H AFLALGSGPG+IE CHWI
Sbjct  213  CHAVPTPQFHKVGILDPVCKSKINNGVAVYHMDTSIGNPNHEAFLALGSGPGRIEACHWI  272

Query  361  FENDMTWTVAD  393
            + +   WT A+
Sbjct  273  YGDYAVWTRAN  283



>dbj|BAD23622.1| polygalacturonase isoenzyme 1 beta subunit-like [Oryza sativa 
Japonica Group]
 dbj|BAD29397.1| polygalacturonase isoenzyme 1 beta subunit-like [Oryza sativa 
Japonica Group]
Length=690

 Score =   143 bits (361),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 74/114 (65%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGI-NGGKLTKSVSCHQSLFPYLVY  177
            ED++DFA  +LG NVV R TE+T G    + +G V G+  GG +T+SVSCHQSLFPYLVY
Sbjct  559  EDVVDFAVEMLGDNVVARATESTAGGGGDVRLGRVAGVPAGGNVTRSVSCHQSLFPYLVY  618

Query  178  YCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGK  339
            YCHSVP VRVYEADIL   +  KINHGVAICH+DTS W   HGAF+ALG  PGK
Sbjct  619  YCHSVPTVRVYEADILAVDSNQKINHGVAICHLDTSDWSPNHGAFIALGGKPGK  672



>ref|XP_003613149.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96107.1| BURP domain protein [Medicago truncatula]
Length=621

 Score =   142 bits (359),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 66/128 (52%), Positives = 93/128 (73%), Gaps = 1/128 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ++M  FA+++LG  VV+R T    G+ + +M+G V  I GG +T+SV+CHQ +FP ++Y+
Sbjct  491  DEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTESVTCHQEVFPVMLYF  550

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CH +P VRVY  +IL  + + KIN  V +CHIDTS+   +H AFL LGS PG+IEVCHWI
Sbjct  551  CHYIPMVRVYNVEILTLQ-RIKINQVVVVCHIDTSSSSRSHPAFLELGSAPGEIEVCHWI  609

Query  361  FENDMTWT  384
            F+NDM+WT
Sbjct  610  FQNDMSWT  617


 Score =   113 bits (283),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ++M  FA+++LG  VV+R T    G+ + +M+G V  I GG +T+SV+CHQ +FP ++Y+
Sbjct  75   DEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTESVTCHQEVFPVMLYF  134

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            CH +P VRVY  +IL  + K KIN  V +CHIDTS+W  +H AFL LGS P   +   W
Sbjct  135  CHYIPMVRVYNVEILTLQ-KIKINQAVGVCHIDTSSWSRSHPAFLELGSAPDGRKWAKW  192


 Score =   113 bits (283),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            ++M  FA+++LG  VV+R T    G+ + +M+G V  I GG +T+SV+CHQ +FP ++Y+
Sbjct  283  DEMEIFASSMLGPKVVLRKTLNVKGSGKNVMVGRVSRIQGGNVTESVTCHQEVFPVMLYF  342

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            CH +P VRVY  +IL  + K KIN  V +CHIDTS+W  +H AFL LGS P   +   W
Sbjct  343  CHYIPMVRVYNVEILTLQ-KIKINQAVGVCHIDTSSWSRSHPAFLELGSAPDGRKWAKW  400



>gb|EMT26618.1| hypothetical protein F775_18544 [Aegilops tauschii]
Length=560

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            EDM+DFA  +L  NV VR+TE+  G+   I IG V G+ GG  T+SVSCHQS+FPYLVYY
Sbjct  440  EDMLDFAVEMLWDNVAVRSTESAAGSSWDIRIGRVAGVAGGHATRSVSCHQSMFPYLVYY  499

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIE  345
            CHSVP +RVYEA+IL   +  KIN GVAICH+DTS W   HGAF ALG  PG++E
Sbjct  500  CHSVPSMRVYEAEILATDSGWKINRGVAICHLDTSDWSPGHGAFAALGGKPGEME  554



>gb|AAT08687.1| polygalacturonase [Hyacinthus orientalis]
Length=171

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 91/132 (69%), Gaps = 3/132 (2%)
 Frame = +1

Query  1    EDMIDF-ATAVLGR-NvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLV  174
            EDMID+ AT+++ + N+  R+T+ ++     ++IG VK  NGGKL   VSCHQ+ FPYL+
Sbjct  39   EDMIDYLATSLVAKINITARSTDNSIQLGGNVLIGEVKAANGGKLGHVVSCHQAAFPYLL  98

Query  175  YYCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCH  354
            Y CHSVP+ ++YE +ILDP+TK KI+   AICH DTS W   H AF+ALG   G +E+C 
Sbjct  99   YRCHSVPETKLYEVEILDPETKAKISAATAICHFDTSVWSRDHVAFMALGYERG-MEICQ  157

Query  355  WIFENDMTWTVA  390
            W+F   + WT A
Sbjct  158  WVFPGAIAWTAA  169



>gb|KCW86727.1| hypothetical protein EUGRSUZ_B03337 [Eucalyptus grandis]
Length=212

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = +1

Query  28   VLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYYCHSVPKVRV  207
            +LG N+ +  T++  G+K+ I+IG VK I G K +  V+ H SLFP +VY CH+VPK  V
Sbjct  93   ILGHNIKLHATKSDEGSKRDILIGRVKRIGGSKSSAPVADHDSLFPCMVYNCHAVPKPHV  152

Query  208  YEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWIFENDMTW  381
            +E  ILDP  K KIN+GVA+CH+DTSA    H AFLALGSGPG+IE CHWI+ +   W
Sbjct  153  HEVGILDPVCKSKINNGVAVCHMDTSAGNPNHEAFLALGSGPGRIEACHWIYGDYAVW  210



>gb|EEE69479.1| hypothetical protein OsJ_28904 [Oryza sativa Japonica Group]
Length=837

 Score =   139 bits (349),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 73/114 (64%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGI-NGGKLTKSVSCHQSLFPYLVY  177
            ED++DFA  +LG NVV R TE+T G    + +G V G+  GG +T+SVSCHQSLFPYLVY
Sbjct  515  EDVVDFAVEMLGDNVVARATESTAGGGGDVRLGRVAGVPAGGNVTRSVSCHQSLFPYLVY  574

Query  178  YCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGK  339
            YCHSVP VRVYEADIL   +  KINHGVAICH+DTS W   HGAF+AL   PGK
Sbjct  575  YCHSVPTVRVYEADILAVDSNQKINHGVAICHLDTSDWSPNHGAFIAL---PGK  625



>gb|AAT08718.1| polygalacturonase [Hyacinthus orientalis]
Length=194

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 83/132 (63%), Gaps = 3/132 (2%)
 Frame = +1

Query  1    EDMIDFATAVLG--RNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLV  174
            EDMID+  + LG   ++  ++T  + G    ++IG VK   GG+L + VSCH + FPYL+
Sbjct  62   EDMIDYVVSSLGAKSSLTAKSTSNSNGLGSDVLIGEVKAAGGGELGRVVSCHHTTFPYLM  121

Query  175  YYCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCH  354
            Y CHSVPK  +Y+ +ILDP+TK +IN   AICH DTS W   H  F AL    G ++ CH
Sbjct  122  YRCHSVPKTVLYDVEILDPETKGRINLAAAICHFDTSVWSPRHATFQALVYERG-MDACH  180

Query  355  WIFENDMTWTVA  390
            W+F  DM WT A
Sbjct  181  WVFPMDMAWTAA  192



>ref|XP_003629327.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AET03803.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=87

 Score =   124 bits (311),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +1

Query  94   IGSVKGINGGKLTKSVSCHQSLFPYLVYYCHSVPKVRVYEADILDPKTKDKINHGVAICH  273
            +G V  +NGG ++KS++CH  LFPY VYYCH +P VR+Y+ DI DP+TK KIN  +AICH
Sbjct  1    MGQVLKVNGGNVSKSITCHSLLFPYQVYYCHEIPNVRLYQVDIQDPETKVKINRAIAICH  60

Query  274  IDTSAWGATHGAFLALGSGPGKIEVCH  354
            +DTS W   H AF+ LGSGPG IE CH
Sbjct  61   LDTSNWNPGHAAFMVLGSGPGLIEACH  87



>emb|CAN81758.1| hypothetical protein VITISV_043391 [Vitis vinifera]
Length=574

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  190  VPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWIFEN  369
            +PKVRVYE DILD + K+K+N GVAICHIDTSAW  +HGAF+ALGS PG IEVCHWIFEN
Sbjct  507  IPKVRVYEVDILDVERKEKMNKGVAICHIDTSAWSQSHGAFVALGSSPGLIEVCHWIFEN  566

Query  370  DMTWTVAD  393
            DMTWT +D
Sbjct  567  DMTWTTSD  574



>emb|CDP10831.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 82/132 (62%), Gaps = 4/132 (3%)
 Frame = +1

Query  1    EDMIDFATAVLGRN-vvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            EDM++FA A +G N VV  TT+ T G+ +  ++G V+ +   K  K VSCH+   P+  Y
Sbjct  108  EDMVEFAKAAIGTNHVVPLTTKNTEGSGKEFIVGHVEKL---KFKKIVSCHEFFLPFATY  164

Query  178  YCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            +CH + K   Y  D+L+PKTK  IN  + ICH+DTS W   H AF  L S PGK+  CHW
Sbjct  165  FCHLLSKTEAYAVDVLEPKTKLPINTVMVICHMDTSNWSPNHVAFKLLKSSPGKVVACHW  224

Query  358  IFENDMTWTVAD  393
            +F+ND+ +  A+
Sbjct  225  VFQNDLLFVSAE  236



>ref|XP_003613159.1| Polygalacturonase-1 non-catalytic beta subunit [Medicago truncatula]
 gb|AES96117.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=121

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 65/91 (71%), Gaps = 2/91 (2%)
 Frame = +1

Query  115  NGGKLTKSVSCHQSLFPY-LVYYCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAW  291
            N     +SV CHQ +FP+ L+Y+CH +P VR YE +ILD + K  IN  V +CH++ S+W
Sbjct  20   NSQWKNESVICHQEMFPFMLLYFCHYIPMVRFYEVEILDLQ-KIMINQAVDVCHLNISSW  78

Query  292  GATHGAFLALGSGPGKIEVCHWIFENDMTWT  384
               H AFL LGS PG+IEVCHWI++NDM+WT
Sbjct  79   SRNHPAFLELGSTPGEIEVCHWIYKNDMSWT  109



>emb|CDP10830.1| unnamed protein product [Coffea canephora]
Length=336

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = +1

Query  1    EDMIDFATAVLGRN-vvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            EDM++FA    G N +V  T++ T G+ + +++G +K +  GK   +VSCH+   P+  Y
Sbjct  206  EDMVEFAKTATGNNHLVALTSKNTKGSGKDLIVGQMKKLKFGK---TVSCHELFLPFSTY  262

Query  178  YCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            +CH + K  VY  D+L+PKTK  IN    ICH+DTS W   H AF  L + PG+ E CHW
Sbjct  263  FCHLLSKTEVYAVDVLEPKTKIPINTVTVICHMDTSDWSPNHVAFKVLKTSPGQSEACHW  322

Query  358  IFENDMTW  381
            I +ND+ +
Sbjct  323  ISQNDLIF  330



>ref|XP_003613160.1| Polygalacturonase-1 non-catalytic beta subunit [Medicago truncatula]
 gb|AES96118.1| BURP domain protein [Medicago truncatula]
Length=200

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = +1

Query  130  TKSVSCHQSLFPY-LVYYCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHG  306
             +SV+CHQ +FP+ L+Y+CH +P  R YE ++LD + K  IN  V + H++TS+W   H 
Sbjct  112  NESVTCHQEMFPFMLLYFCHYIPMARFYEVEVLDLQ-KIMINQAVDVYHLNTSSWSRNHP  170

Query  307  AFLALGSGPGKIEVCHWIFENDMTWT  384
             FL LGS PG+IEVCHWI+ENDM+WT
Sbjct  171  TFLELGSTPGEIEVCHWIYENDMSWT  196


 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 62/90 (69%), Gaps = 2/90 (2%)
 Frame = +1

Query  115  NGGKLTKSVSCHQSLFPY-LVYYCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAW  291
            N     +SV CHQ +FP+ L+Y+CH +P VR YE +ILD +    IN  V +CH++ S+W
Sbjct  20   NSQWKNESVICHQEMFPFMLLYFCHYIPMVRFYEVEILDLQNI-MINQAVDVCHLNISSW  78

Query  292  GATHGAFLALGSGPGKIEVCHWIFENDMTW  381
               H AFL  GS PG+IEVCHWI++NDM+W
Sbjct  79   SRNHPAFLEFGSTPGEIEVCHWIYKNDMSW  108



>ref|XP_003613158.1| Polygalacturonase-1 non-catalytic beta subunit [Medicago truncatula]
 gb|AES96116.1| BURP domain protein [Medicago truncatula]
Length=226

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = +1

Query  130  TKSVSCHQSLFPY-LVYYCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHG  306
             +SV+CHQ +FP+ L+Y+CH +P  R YE ++LD + K  IN  V +CH++TS+W   H 
Sbjct  13   NESVTCHQEMFPFMLLYFCHYIPMARFYEVEVLDLQ-KIMINQAVDVCHLNTSSWSRNHP  71

Query  307  AFLALGSGPGKIEVCHWIFENDMTWT  384
             FL LGS PG+IEV HWI++NDM+WT
Sbjct  72   TFLELGSTPGEIEVRHWIYKNDMSWT  97


 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +1

Query  190  VPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWIFEN  369
            + + R + A + + + +   +  V +CH++TS+W   H AFL LGS PG+IEVCHWI++N
Sbjct  145  IERQRTFLAKMKNQEQEHDHDQAVDVCHLNTSSWSRNHPAFLELGSTPGEIEVCHWIYKN  204

Query  370  DMTW  381
            DM+W
Sbjct  205  DMSW  208



>ref|XP_011091740.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=281

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 76/127 (60%), Gaps = 2/127 (2%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E+MI F+ + LG+N ++  T  +     + +   +K I    + K V+CH+   P+  Y+
Sbjct  152  EEMISFSKSALGKNKLLALTSKSTKGSASEL--KIKRIKQYDVEKIVACHEMYLPFATYF  209

Query  181  CHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWI  360
            CHS+P  ++Y  D+++P T   +N  VAICH+DTSAW   H AF  +  GPG+ EVCHW+
Sbjct  210  CHSLPSSKIYAVDVVEPSTGAPVNTVVAICHMDTSAWPEEHVAFKIVKLGPGQGEVCHWL  269

Query  361  FENDMTW  381
             E D+ W
Sbjct  270  SEIDVAW  276



>ref|XP_011091745.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=336

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 85/136 (63%), Gaps = 5/136 (4%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvr-ttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            E+MI+F+ + LG+N ++  T+++T G+ + + I  +K  +  K+   V+CH+   P+  Y
Sbjct  205  EEMINFSKSALGKNKLLALTSKSTRGSGEELKIEKIKQFDVEKI---VACHEMYLPFATY  261

Query  178  YCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            +CHS+P  R+Y  D ++PK+   +N  +A+CH+DTS W A H AF  L  GPG+ E CHW
Sbjct  262  FCHSLPSSRIYSVDFVEPKSGAPVNTVLAMCHMDTSPWPADHVAFQILKFGPGQGEACHW  321

Query  358  IFENDMTWTVAD*SNM  405
              E D+ W +A   NM
Sbjct  322  SNEIDLAW-IAGGENM  336



>gb|ABR25612.1| polygalacturonase-1 non-catalytic beta subunit precursor [Oryza 
sativa Indica Group]
Length=68

 Score =   100 bits (249),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +1

Query  196  KVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHWIFENDM  375
            K+RVYEA+IL  +TK+KIN GVA+CHIDTSAW A H AF+ALG  PG+ EVCHWI+   M
Sbjct  1    KIRVYEAEILSVQTKEKINSGVAVCHIDTSAWSAGHPAFVALGGKPGQNEVCHWIYNGSM  60

Query  376  TWTVAD  393
            TW +AD
Sbjct  61   TWVIAD  66



>ref|XP_010100465.1| hypothetical protein L484_027777 [Morus notabilis]
 gb|EXB82599.1| hypothetical protein L484_027777 [Morus notabilis]
Length=66

 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = +1

Query  7    MIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYYCH  186
            MIDFAT+VLG N+VVR+TE   G K  I+IGSVKGINGGK+T+SVSCHQSLFPYLVYYCH
Sbjct  1    MIDFATSVLGHNIVVRSTENVNGLKD-ILIGSVKGINGGKVTESVSCHQSLFPYLVYYCH  59

Query  187  SVPKVRV  207
            SVPKVRV
Sbjct  60   SVPKVRV  66



>ref|XP_003613161.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96119.1| BURP domain protein [Medicago truncatula]
Length=305

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = +1

Query  148  HQSLFPY-LVYYCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALG  324
            HQ +FP+ L+Y+CH +P  R YE +ILD + K  IN  V +CH+ TS+W   H AF+ LG
Sbjct  223  HQEMFPFMLLYFCHYIPMARFYEVEILDLQ-KIMINQAVDVCHLTTSSWSRNHPAFVELG  281

Query  325  SGPGKIEVCHWIFENDMTWTV  387
            S P +IEVCHWI+ENDM+WT 
Sbjct  282  STPREIEVCHWIYENDMSWTA  302



>ref|XP_003613157.1| Polygalacturonase-1 non-catalytic beta subunit [Medicago truncatula]
 gb|AES96115.1| BURP domain protein [Medicago truncatula]
Length=406

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = +1

Query  145  CHQSLFPY-LVYYCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLAL  321
            CHQ +FP+ L+Y+CH +P  R  E +ILD + K  IN  V +CH++TS+W   H AF+ L
Sbjct  315  CHQEMFPFMLLYFCHYIPMARFCEVEILDLQ-KIMINQVVDVCHLNTSSWSRNHPAFVEL  373

Query  322  GSGPGKIEVCHWIFENDMTWTV  387
            GS PG+IEVCHWI++ND++WT 
Sbjct  374  GSTPGEIEVCHWIYKNDLSWTA  395


 Score = 62.8 bits (151),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +1

Query  148  HQSLFPY-LVYYCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALG  324
            HQ +FP+ L+Y+CH +P  R YE +ILD + K  IN  V +CH++TS+W   H A L L 
Sbjct  181  HQEMFPFMLLYFCHYIPMGRFYEVEILDLQ-KIMINQAVDVCHLNTSSWCHNHPALLNLA  239

Query  325  SGPGK  339
              P K
Sbjct  240  RLPVK  244


 Score = 25.8 bits (55),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +2

Query  317  HLGRVRVRLRCAIGSLRMT*HG  382
            +L R+ V+ +CA G  RMT HG
Sbjct  237  NLARLPVKSKCATGYTRMTCHG  258



>ref|XP_011074238.1| PREDICTED: BURP domain-containing protein 16-like [Sesamum indicum]
Length=334

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 76/128 (59%), Gaps = 4/128 (3%)
 Frame = +1

Query  1    EDMIDFATAVLG-RNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            E+M+ FATA LG   ++  T++ + G+   ++IG +K       TK V+CH++  P+  Y
Sbjct  204  EEMVGFATASLGGTKLLALTSKNSRGSGAEMIIGKMKHYGA---TKIVACHEAFLPFAAY  260

Query  178  YCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
             CHS+    +Y  +++DPK    +N  +AICH+DTSAW   H AF  L  GPG+ E CHW
Sbjct  261  VCHSLSSTGLYAVEVVDPKGGAAVNTLLAICHMDTSAWPKNHVAFEILKFGPGEGEACHW  320

Query  358  IFENDMTW  381
              + D+ W
Sbjct  321  FTQLDLAW  328



>gb|EYU36709.1| hypothetical protein MIMGU_mgv1a024306mg [Erythranthe guttata]
Length=267

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 75/133 (56%), Gaps = 6/133 (5%)
 Frame = +1

Query  1    EDMIDFATAVLG-----RNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFP  165
            E+M+ FA   LG     + VV  T+++TVG+     IG +K   GG   K V+CH++  P
Sbjct  131  EEMVGFARVTLGGGGDKKKVVALTSKSTVGSNSIAKIGKIKEYGGGAGEKIVACHEAFLP  190

Query  166  YLVYYCHSVPKVRVYEADILDPKTKDK-INHGVAICHIDTSAWGATHGAFLALGSGPGKI  342
            +  YYCH +   R+Y  D +D +T  K +N  + ICH+DTS W   H AF  L  GPG+ 
Sbjct  191  FAAYYCHLLTSTRLYMVDFVDRETGSKVVNMMLGICHMDTSHWPKEHVAFKILKFGPGEG  250

Query  343  EVCHWIFENDMTW  381
            E CHW  + D+ W
Sbjct  251  EACHWFTQLDLAW  263



>gb|EYU36708.1| hypothetical protein MIMGU_mgv1a009279mg [Erythranthe guttata]
Length=347

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 81/134 (60%), Gaps = 6/134 (4%)
 Frame = +1

Query  1    EDMIDFATAVLG-RNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            E+M+ FA + LG + VV  TT+ T G+   + IG +K   GGK  K V+CH++  P+  Y
Sbjct  216  EEMVGFAKSTLGGKKVVALTTKNTRGSNSAVRIGKIKEYGGGK--KIVACHEAFLPFAAY  273

Query  178  YCHSVPKVRVYEADIL-DPKT-KDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVC  351
            +CHS+   R+Y  D++ D +T  + +N  + ICH+DTS W   H AF  L  GPG+ E C
Sbjct  274  FCHSLSSTRLYAVDVVVDRETGSNVVNTMLGICHMDTSQWPKDHVAFQILKFGPGEGEAC  333

Query  352  HWIFENDMTWTVAD  393
            HW  + D+ W +AD
Sbjct  334  HWFTKLDLAW-IAD  346



>ref|XP_004241419.1| PREDICTED: BURP domain-containing protein 16-like [Solanum lycopersicum]
Length=408

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 72/128 (56%), Gaps = 4/128 (3%)
 Frame = +1

Query  1    EDMIDFATAVLGRN-vvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            E+MI+F+   L +N ++  TTE+  G+ Q + I     IN  +   SVSCH+   P+  Y
Sbjct  277  EEMIEFSKRSLKQNHLISLTTESIQGSGQKLKIEKFHKINSQR---SVSCHEIFLPFATY  333

Query  178  YCHSVPKVRVYEADILDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            +CH +    +Y  +++D  T   +N  + +CH+DTS+W A H  F  L   PG  EVCHW
Sbjct  334  FCHLLSSTNIYAVELVDLNTNVHVNKAMVVCHMDTSSWPADHPVFKKLNFSPGNGEVCHW  393

Query  358  IFENDMTW  381
            + + D+ W
Sbjct  394  MSQADLVW  401



>emb|CBI20911.3| unnamed protein product [Vitis vinifera]
Length=330

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (57%), Gaps = 10/129 (8%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLT-KSVSCHQSLFPYLVY  177
            E +IDF+T+ LGRNV V T E  +G+++        G+   K+  KSV CH+  +PY V+
Sbjct  174  ESLIDFSTSKLGRNVNVLTNEVRMGSQEFEF-----GVRMKKVADKSVVCHKMNYPYAVF  228

Query  178  YCHSVPKVRVYEADIL-DPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCH  354
            YCH+  K R Y   ++ D  +K K    +A CH DTSAW   H AF  L   PG + +CH
Sbjct  229  YCHTFAKTRTYMIPLVGDDGSKAK---AMAACHSDTSAWHPQHVAFQVLKIKPGTVPICH  285

Query  355  WIFENDMTW  381
            ++  N M W
Sbjct  286  FLHNNAMVW  294



>ref|XP_002284368.1| PREDICTED: dehydration-responsive protein RD22 [Vitis vinifera]
Length=297

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (57%), Gaps = 10/129 (8%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLT-KSVSCHQSLFPYLVY  177
            E +IDF+T+ LGRNV V T E  +G+++        G+   K+  KSV CH+  +PY V+
Sbjct  174  ESLIDFSTSKLGRNVNVLTNEVRMGSQEFEF-----GVRMKKVADKSVVCHKMNYPYAVF  228

Query  178  YCHSVPKVRVYEADIL-DPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCH  354
            YCH+  K R Y   ++ D  +K K    +A CH DTSAW   H AF  L   PG + +CH
Sbjct  229  YCHTFAKTRTYMIPLVGDDGSKAK---AMAACHSDTSAWHPQHVAFQVLKIKPGTVPICH  285

Query  355  WIFENDMTW  381
            ++  N M W
Sbjct  286  FLHNNAMVW  294



>dbj|BAB60849.1| BURP domain-containing protein [Bruguiera gymnorhiza]
Length=336

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 69/129 (53%), Gaps = 8/129 (6%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvv-rttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            E M+DF+T+ LG+++    T       +Q   I  VK I G K    V CH+  +PY V+
Sbjct  211  ESMVDFSTSKLGKDIQAISTEVEKQTGRQKYTIAGVKKIAGDKC---VVCHKQNYPYAVF  267

Query  178  YCHSVPKVRVYEADILDPKTKDKIN-HGVAICHIDTSAWGATHGAFLALGSGPGKIEVCH  354
            YCHS+   R Y   ++  K  D+     VAICH +TSAW   H AF  L   PG + +CH
Sbjct  268  YCHSIQSTRAY---LVQLKGVDRTRLQAVAICHTNTSAWNPKHPAFQVLAVKPGTVPICH  324

Query  355  WIFENDMTW  381
            ++ ++ + W
Sbjct  325  FLPQSHVVW  333



>dbj|BAB60850.1| BURP domain-containing protein [Bruguiera gymnorhiza]
Length=307

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 68/129 (53%), Gaps = 8/129 (6%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvv-rttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            E M+DF+T+ LG++V    T       +Q   I  VK I G K    V CH+  +PY V+
Sbjct  182  ESMVDFSTSKLGKDVQAISTEVEKQTGRQKYTIAGVKKIAGDKC---VVCHKQNYPYAVF  238

Query  178  YCHSVPKVRVYEADILDPKTKDKIN-HGVAICHIDTSAWGATHGAFLALGSGPGKIEVCH  354
            YCHS+   R Y   ++  K  D+     VAICH +TSAW   H AF  L   PG +  CH
Sbjct  239  YCHSIQSTRAY---LVQLKGVDRTRLQAVAICHTNTSAWNPKHPAFQVLAVKPGTVPTCH  295

Query  355  WIFENDMTW  381
            ++ ++ + W
Sbjct  296  FLPQSHVVW  304



>gb|KDO79705.1| hypothetical protein CISIN_1g018131mg [Citrus sinensis]
Length=323

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 70/129 (54%), Gaps = 7/129 (5%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAK-QTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            E MIDF+T+ LG++V   +TE   G K QT  I +  G+      KSV CH+  +PY V+
Sbjct  192  ESMIDFSTSKLGKSVQAISTEVKKGTKMQTYTIAA--GVKQMAADKSVVCHKQNYPYAVF  249

Query  178  YCHSVPKVRVYEADILDPK-TKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCH  354
            YCH+    R Y   +     TK K     A+CH DTSAW   H AF  L   PG + +CH
Sbjct  250  YCHATQTTRAYMVPLEGADGTKAK---AAAVCHTDTSAWNPKHLAFQVLKVKPGTVPICH  306

Query  355  WIFENDMTW  381
            ++ E+ + W
Sbjct  307  FLPEDHIVW  315



>dbj|BAB60848.1| BURP domain-containing protein [Bruguiera gymnorhiza]
Length=346

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 68/129 (53%), Gaps = 8/129 (6%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvv-rttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            E M+DF+T+ LG+++    T       +Q   I  VK   G K   SV CH+  +PY V+
Sbjct  221  ESMVDFSTSKLGKDIQAISTEVEKQTGRQQYTIAGVKKTAGDK---SVVCHKQNYPYAVF  277

Query  178  YCHSVPKVRVYEADILDPKTKDKIN-HGVAICHIDTSAWGATHGAFLALGSGPGKIEVCH  354
            YCHS    R Y   ++  K  D+     VAICH +TSAW   H AF  L   PG + +CH
Sbjct  278  YCHSTQSTRAY---LVQLKGADRTRLQAVAICHTNTSAWNPKHLAFQVLAVKPGTVPICH  334

Query  355  WIFENDMTW  381
            ++ ++ + W
Sbjct  335  FLPQSHVVW  343



>gb|KDO79703.1| hypothetical protein CISIN_1g018131mg [Citrus sinensis]
Length=332

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 70/129 (54%), Gaps = 7/129 (5%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAK-QTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            E MIDF+T+ LG++V   +TE   G K QT  I +  G+      KSV CH+  +PY V+
Sbjct  201  ESMIDFSTSKLGKSVQAISTEVKKGTKMQTYTIAA--GVKQMAADKSVVCHKQNYPYAVF  258

Query  178  YCHSVPKVRVYEADILDPK-TKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCH  354
            YCH+    R Y   +     TK K     A+CH DTSAW   H AF  L   PG + +CH
Sbjct  259  YCHATQTTRAYMVPLEGADGTKAK---AAAVCHTDTSAWNPKHLAFQVLKVKPGTVPICH  315

Query  355  WIFENDMTW  381
            ++ E+ + W
Sbjct  316  FLPEDHIVW  324



>ref|XP_006476150.1| PREDICTED: dehydration-responsive protein RD22-like [Citrus sinensis]
 gb|KDO79704.1| hypothetical protein CISIN_1g018131mg [Citrus sinensis]
Length=360

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 70/129 (54%), Gaps = 7/129 (5%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAK-QTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            E MIDF+T+ LG++V   +TE   G K QT  I +  G+      KSV CH+  +PY V+
Sbjct  229  ESMIDFSTSKLGKSVQAISTEVKKGTKMQTYTIAA--GVKQMAADKSVVCHKQNYPYAVF  286

Query  178  YCHSVPKVRVYEADILDPK-TKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVCH  354
            YCH+    R Y   +     TK K     A+CH DTSAW   H AF  L   PG + +CH
Sbjct  287  YCHATQTTRAYMVPLEGADGTKAK---AAAVCHTDTSAWNPKHLAFQVLKVKPGTVPICH  343

Query  355  WIFENDMTW  381
            ++ E+ + W
Sbjct  344  FLPEDHIVW  352



>gb|AAL26909.1|AF319165_1 dehydration-responsive protein RD22 [Prunus persica]
Length=349

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 72/131 (55%), Gaps = 11/131 (8%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGA---KQTIMIGSVKGINGGKLTKSVSCHQSLFPYL  171
            E M+DF+T+ LG N+   +TE   GA   K TI  G VK +  GK   SV CH+  +PY 
Sbjct  220  ESMVDFSTSKLGGNIQAISTEAEKGATLQKYTITPG-VKKLAAGK---SVVCHKQTYPYA  275

Query  172  VYYCHSVPKVRVYEADILDPKTKDKIN-HGVAICHIDTSAWGATHGAFLALGSGPGKIEV  348
            V+YCH+    R Y   ++  K  D +    VA+CH DTS W   H AF  L   PG + V
Sbjct  276  VFYCHATKTTRAY---VVPLKGADGLEAKAVAVCHTDTSEWNPKHLAFQVLKVKPGTVPV  332

Query  349  CHWIFENDMTW  381
            CH++ ++ + W
Sbjct  333  CHFLPKDHIVW  343



>ref|XP_009373565.1| PREDICTED: dehydration-responsive protein RD22-like isoform X4 
[Pyrus x bretschneideri]
Length=359

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 75/143 (52%), Gaps = 8/143 (6%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAKQTIMIGSVKGINGGKLTKSVSCHQSLFPYLVYY  180
            E MIDF T+ LGRNV   +T        T+ I SVK + G K   +V CH+  +PY V+Y
Sbjct  223  ESMIDFTTSKLGRNVQAFSTAVLEKGG-TMSIISVKKLVGDK---AVVCHKQNYPYAVFY  278

Query  181  CHSVPKVRVYEADILDPKTKDKIN-HGVAICHIDTSAWGATHGAFLALGSGPGKIEVCHW  357
            CH+    R Y   ++  +  D +    VAICH+DTS W   H AF  L   PG I +CH+
Sbjct  279  CHATKPTRAY---LVPLRGSDGVKAKAVAICHVDTSEWDPQHLAFQVLKVKPGTIPICHF  335

Query  358  IFENDMTWTVAD*SNMLNYVNNS  426
            +  + + W     S ++  + NS
Sbjct  336  LPSDHVVWVPTPKSMLVVELINS  358



>ref|XP_006450615.1| hypothetical protein CICLE_v10008742mg [Citrus clementina]
 gb|ESR63855.1| hypothetical protein CICLE_v10008742mg [Citrus clementina]
Length=360

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 72/130 (55%), Gaps = 9/130 (7%)
 Frame = +1

Query  1    EDMIDFATAVLGRNvvvrttettvGAK-QTIMIGSVKGINGGKLTKSVSCHQSLFPYLVY  177
            E MIDF+T+ LG++V   +TE   G K QT  I +  G+      KSV CH+  +PY V+
Sbjct  229  ESMIDFSTSKLGKSVQAISTEVKKGTKMQTYTIAA--GVKQMAADKSVVCHKQNYPYAVF  286

Query  178  YCHSVPKVRVYEADI--LDPKTKDKINHGVAICHIDTSAWGATHGAFLALGSGPGKIEVC  351
            YCH+    R Y   +  +D  TK K     A+CH DTSAW   H AF  L   PG + +C
Sbjct  287  YCHATQTTRAYIVPLEGVD-GTKAK---AAAVCHTDTSAWNPKHLAFQVLKVKPGTVPIC  342

Query  352  HWIFENDMTW  381
            H++ E+ + W
Sbjct  343  HFLPEDHIVW  352



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 657324745168