BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17344_g1_i1 len=764 path=[1111:0-499 1611:500-763]

Length=764
                                                                      Score     E

ref|XP_009794726.1|  PREDICTED: polygalacturonase-1 non-catalytic...    327   4e-104   
gb|AHC69823.1|  polygalacturonase isoenzyme 1 beta subunit              325   3e-103   
ref|XP_009596009.1|  PREDICTED: polygalacturonase-1 non-catalytic...    323   2e-102   
ref|XP_011086565.1|  PREDICTED: polygalacturonase-1 non-catalytic...    322   5e-102   
emb|CDP00165.1|  unnamed protein product                                318   1e-100   
ref|XP_004238668.1|  PREDICTED: polygalacturonase non-catalytic s...    316   5e-100   
ref|XP_004238667.1|  PREDICTED: polygalacturonase non-catalytic s...    312   2e-98    
gb|KCW59875.1|  hypothetical protein EUGRSUZ_H02608                     311   3e-98    
ref|XP_010023570.1|  PREDICTED: probable polygalacturonase non-ca...    311   3e-98    
ref|XP_002266341.1|  PREDICTED: probable polygalacturonase non-ca...    311   4e-98    Vitis vinifera
ref|NP_001234835.1|  polygalacturonase-1 non-catalytic subunit be...    311   6e-98    
ref|XP_006365231.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    311   6e-98    
ref|XP_006365227.1|  PREDICTED: polygalacturonase-1 non-catalytic...    310   2e-97    
ref|XP_006365228.1|  PREDICTED: polygalacturonase non-catalytic s...    309   3e-97    
ref|XP_010100469.1|  hypothetical protein L484_027781                   306   2e-96    
gb|EPS67761.1|  polygalacturonase-1 non-catalytic subunit beta          306   3e-96    
gb|EYU22487.1|  hypothetical protein MIMGU_mgv1a002927mg                305   1e-95    
ref|XP_011071083.1|  PREDICTED: polygalacturonase-1 non-catalytic...    303   4e-95    
ref|XP_011034135.1|  PREDICTED: probable polygalacturonase non-ca...    303   1e-94    
ref|XP_002311777.2|  hypothetical protein POPTR_0008s19430g             303   1e-94    Populus trichocarpa [western balsam poplar]
ref|XP_002266815.1|  PREDICTED: probable polygalacturonase non-ca...    300   7e-94    Vitis vinifera
ref|XP_010242994.1|  PREDICTED: probable polygalacturonase non-ca...    300   8e-94    
ref|XP_004514684.1|  PREDICTED: polygalacturonase-1 non-catalytic...    300   9e-94    
ref|XP_007044636.1|  Polygalacturonase 2                                301   1e-93    
gb|KFK41456.1|  hypothetical protein AALP_AA2G132700                    297   1e-92    
gb|AAL08244.1|  At1g70370/F17O7_9                                       294   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002314620.2|  hypothetical protein POPTR_0010s05000g             297   1e-92    Populus trichocarpa [western balsam poplar]
ref|XP_010251282.1|  PREDICTED: probable polygalacturonase non-ca...    296   3e-92    
ref|XP_011009539.1|  PREDICTED: probable polygalacturonase non-ca...    295   5e-92    
gb|KDO82433.1|  hypothetical protein CISIN_1g036311mg                   295   6e-92    
ref|XP_003517743.1|  PREDICTED: probable polygalacturonase non-ca...    295   7e-92    
ref|XP_006438394.1|  hypothetical protein CICLE_v10030947mg             295   7e-92    
ref|NP_177194.1|  polygalacturonase 2                                   294   2e-91    Arabidopsis thaliana [mouse-ear cress]
gb|KHG01313.1|  Polygalacturonase non-catalytic subunit protein         293   2e-91    
ref|XP_002525383.1|  Polygalacturonase-1 non-catalytic subunit be...    293   3e-91    Ricinus communis
ref|XP_003519820.2|  PREDICTED: probable polygalacturonase non-ca...    293   3e-91    
ref|XP_002888771.1|  hypothetical protein ARALYDRAFT_894840             293   4e-91    
ref|XP_003613234.1|  Polygalacturonase-1 non-catalytic subunit beta     293   4e-91    
ref|XP_006300881.1|  hypothetical protein CARUB_v10019971mg             292   7e-91    
gb|AAB39546.1|  polygalacturonase isoenzyme 1 beta subunit homolog      292   9e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009596020.1|  PREDICTED: polygalacturonase-1 non-catalytic...    291   2e-90    
ref|XP_007157462.1|  hypothetical protein PHAVU_002G071500g             291   3e-90    
ref|XP_010555103.1|  PREDICTED: probable polygalacturonase non-ca...    288   1e-89    
ref|XP_004173618.1|  PREDICTED: probable polygalacturonase non-ca...    288   1e-89    
ref|XP_004142981.1|  PREDICTED: probable polygalacturonase non-ca...    288   2e-89    
gb|KDP26581.1|  hypothetical protein JCGZ_17739                         288   3e-89    
ref|XP_008444317.1|  PREDICTED: probable polygalacturonase non-ca...    288   4e-89    
ref|XP_007223063.1|  hypothetical protein PRUPE_ppa003712mg             285   6e-89    
gb|EYU31262.1|  hypothetical protein MIMGU_mgv1a002697mg                288   7e-89    
ref|XP_008221810.1|  PREDICTED: probable polygalacturonase non-ca...    287   7e-89    
ref|XP_010471031.1|  PREDICTED: probable polygalacturonase non-ca...    286   1e-88    
ref|XP_010471032.1|  PREDICTED: probable polygalacturonase non-ca...    286   1e-88    
ref|XP_010415713.1|  PREDICTED: probable polygalacturonase non-ca...    286   2e-88    
emb|CDY59986.1|  BnaC06g43610D                                          285   2e-88    
ref|XP_009794727.1|  PREDICTED: polygalacturonase-1 non-catalytic...    286   3e-88    
emb|CDY57845.1|  BnaA07g38770D                                          285   4e-88    
ref|XP_008389645.1|  PREDICTED: probable polygalacturonase non-ca...    285   7e-88    
gb|KHG24447.1|  Polygalacturonase non-catalytic subunit protein         285   7e-88    
ref|XP_009363553.1|  PREDICTED: probable polygalacturonase non-ca...    284   1e-87    
ref|XP_009105700.1|  PREDICTED: probable polygalacturonase non-ca...    284   1e-87    
ref|XP_010427809.1|  PREDICTED: probable polygalacturonase non-ca...    283   4e-87    
ref|XP_006390895.1|  hypothetical protein EUTSA_v10018277mg             282   6e-87    
gb|KCW86731.1|  hypothetical protein EUGRSUZ_B03343                     279   7e-86    
ref|XP_010044636.1|  PREDICTED: polygalacturonase-1 non-catalytic...    279   1e-85    
emb|CDP12374.1|  unnamed protein product                                279   1e-85    
ref|XP_008340027.1|  PREDICTED: probable polygalacturonase non-ca...    277   6e-85    
ref|XP_006303930.1|  hypothetical protein CARUB_v10008588mg             276   2e-84    
ref|XP_004238669.1|  PREDICTED: polygalacturonase-1 non-catalytic...    275   2e-84    
gb|KDO82432.1|  hypothetical protein CISIN_1g044596mg                   275   3e-84    
ref|XP_006438392.1|  hypothetical protein CICLE_v10030930mg             275   3e-84    
ref|XP_004509821.1|  PREDICTED: probable polygalacturonase non-ca...    275   4e-84    
ref|XP_004298578.1|  PREDICTED: probable polygalacturonase non-ca...    275   5e-84    
ref|XP_010682558.1|  PREDICTED: probable polygalacturonase non-ca...    275   7e-84    
ref|XP_009363551.1|  PREDICTED: probable polygalacturonase non-ca...    275   7e-84    
ref|XP_006365226.1|  PREDICTED: polygalacturonase-1 non-catalytic...    274   8e-84    
gb|KEH20007.1|  polygalacturonase non-catalytic protein                 274   9e-84    
ref|XP_010498883.1|  PREDICTED: probable polygalacturonase non-ca...    274   9e-84    
ref|XP_002511417.1|  Polygalacturonase-1 non-catalytic subunit be...    274   1e-83    Ricinus communis
ref|XP_010460151.1|  PREDICTED: probable polygalacturonase non-ca...    273   1e-83    
ref|XP_006483847.1|  PREDICTED: probable polygalacturonase non-ca...    274   2e-83    
ref|XP_010551569.1|  PREDICTED: probable polygalacturonase non-ca...    273   2e-83    
ref|NP_173788.1|  putative polygalacturonase non-catalytic subuni...    273   3e-83    Arabidopsis thaliana [mouse-ear cress]
gb|KFK44451.1|  hypothetical protein AALP_AA1G258600                    272   3e-83    
ref|XP_006300871.1|  hypothetical protein CARUB_v10019963mg             272   4e-83    
emb|CDY53059.1|  BnaA09g14240D                                          272   4e-83    
emb|CDX68345.1|  BnaA07g23850D                                          272   5e-83    
ref|XP_002279813.2|  PREDICTED: probable polygalacturonase non-ca...    272   5e-83    Vitis vinifera
ref|XP_010477679.1|  PREDICTED: probable polygalacturonase non-ca...    271   6e-83    
gb|KDP31113.1|  hypothetical protein JCGZ_11489                         272   6e-83    
emb|CCD74525.1|  polygalacturonase 1                                    271   1e-82    
dbj|BAE99852.1|  putative polygalacuronase isoenzyme 1 beta subunit     271   1e-82    Arabidopsis thaliana [mouse-ear cress]
gb|AAB39538.1|  aromatic rich glycoprotein JP630                        271   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006345047.1|  PREDICTED: probable polygalacturonase non-ca...    271   1e-82    
ref|NP_176242.1|  polygalacturonase 1                                   270   4e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113216.1|  PREDICTED: probable polygalacturonase non-ca...    269   4e-82    
ref|XP_002890594.1|  hypothetical protein ARALYDRAFT_472637             269   5e-82    
ref|XP_011071835.1|  PREDICTED: probable polygalacturonase non-ca...    270   5e-82    
ref|XP_008346742.1|  PREDICTED: probable polygalacturonase non-ca...    269   8e-82    
ref|XP_002886622.1|  hypothetical protein ARALYDRAFT_475291             268   1e-81    
ref|XP_010473218.1|  PREDICTED: probable polygalacturonase non-ca...    268   1e-81    
emb|CDY47228.1|  BnaC09g14770D                                          268   2e-81    
ref|XP_007036187.1|  Polygalacturonase 2, putative                      267   3e-81    
ref|XP_006392169.1|  hypothetical protein EUTSA_v10023352mg             267   3e-81    
ref|XP_003552018.1|  PREDICTED: probable polygalacturonase non-ca...    265   2e-80    
ref|XP_006844960.1|  hypothetical protein AMTR_s00058p00173800          264   2e-80    
ref|XP_009775426.1|  PREDICTED: probable polygalacturonase non-ca...    265   3e-80    
ref|XP_010925453.1|  PREDICTED: BURP domain-containing protein 12...    265   3e-80    
ref|XP_003532010.1|  PREDICTED: probable polygalacturonase non-ca...    264   4e-80    
ref|XP_004236111.1|  PREDICTED: probable polygalacturonase non-ca...    263   9e-80    
ref|XP_010417970.1|  PREDICTED: probable polygalacturonase non-ca...    263   9e-80    
ref|XP_010510953.1|  PREDICTED: probable polygalacturonase non-ca...    263   1e-79    
ref|XP_009415276.1|  PREDICTED: BURP domain-containing protein 12...    263   2e-79    
emb|CDY23501.1|  BnaC06g24700D                                          261   4e-79    
ref|XP_008453099.1|  PREDICTED: probable polygalacturonase non-ca...    262   5e-79    
ref|XP_002318036.2|  hypothetical protein POPTR_0012s08060g             261   5e-79    Populus trichocarpa [western balsam poplar]
ref|XP_010924225.1|  PREDICTED: BURP domain-containing protein 12...    261   6e-79    
gb|EPS60630.1|  polygalacturonase-1 non-catalytic subunit beta          260   8e-79    
ref|XP_011044316.1|  PREDICTED: probable polygalacturonase non-ca...    261   9e-79    
ref|XP_004138283.1|  PREDICTED: probable polygalacturonase non-ca...    261   2e-78    
ref|XP_004973305.1|  PREDICTED: BURP domain-containing protein 12...    260   2e-78    
ref|XP_004166494.1|  PREDICTED: probable polygalacturonase non-ca...    260   5e-78    
ref|XP_008800877.1|  PREDICTED: BURP domain-containing protein 12...    259   6e-78    
ref|XP_004300895.1|  PREDICTED: probable polygalacturonase non-ca...    259   7e-78    
ref|XP_009593470.1|  PREDICTED: probable polygalacturonase non-ca...    258   8e-78    
ref|XP_006659367.1|  PREDICTED: BURP domain-containing protein 12...    254   3e-77    
ref|XP_008221868.1|  PREDICTED: probable polygalacturonase non-ca...    255   8e-77    
ref|XP_006365229.1|  PREDICTED: polygalacturonase non-catalytic s...    254   1e-76    
ref|XP_008776735.1|  PREDICTED: BURP domain-containing protein 12...    255   2e-76    
ref|XP_007224206.1|  hypothetical protein PRUPE_ppa017408mg             253   5e-76    
ref|NP_001061692.1|  Os08g0380100                                       253   6e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009393062.1|  PREDICTED: BURP domain-containing protein 12...    254   6e-76    
ref|XP_007153633.1|  hypothetical protein PHAVU_003G052000g             253   1e-75    
gb|EEC83505.1|  hypothetical protein OsI_29064                          253   1e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_010553600.1|  PREDICTED: probable polygalacturonase non-ca...    253   1e-75    
gb|EEE68602.1|  hypothetical protein OsJ_27135                          254   2e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006476763.1|  PREDICTED: probable polygalacturonase non-ca...    251   4e-75    
ref|XP_008374449.1|  PREDICTED: probable polygalacturonase non-ca...    249   2e-74    
ref|XP_009394250.1|  PREDICTED: BURP domain-containing protein 12...    249   3e-74    
ref|XP_010028282.1|  PREDICTED: probable polygalacturonase non-ca...    248   1e-73    
ref|XP_010101197.1|  hypothetical protein L484_015001                   247   2e-73    
ref|XP_008239752.1|  PREDICTED: probable polygalacturonase non-ca...    246   2e-73    
ref|XP_004501939.1|  PREDICTED: probable polygalacturonase non-ca...    246   3e-73    
ref|XP_007210277.1|  hypothetical protein PRUPE_ppa003003mg             246   3e-73    
ref|XP_002444270.1|  hypothetical protein SORBIDRAFT_07g019310          246   4e-73    Sorghum bicolor [broomcorn]
ref|XP_006365230.1|  PREDICTED: polygalacturonase-1 non-catalytic...    243   4e-72    
ref|XP_010678748.1|  PREDICTED: probable polygalacturonase non-ca...    243   8e-72    
gb|KHN00353.1|  Polygalacturonase-1 non-catalytic subunit beta          238   9e-72    
gb|ACG28762.1|  polygalacturonase-1 non-catalytic beta subunit pr...    242   2e-71    Zea mays [maize]
ref|NP_001146063.1|  uncharacterized protein LOC100279594 precursor     241   3e-71    Zea mays [maize]
gb|ACN34141.1|  unknown                                                 241   3e-71    Zea mays [maize]
emb|CBI15046.3|  unnamed protein product                                240   4e-71    
emb|CAN81758.1|  hypothetical protein VITISV_043391                     239   4e-71    Vitis vinifera
ref|XP_006578624.1|  PREDICTED: polygalacturonase-1 non-catalytic...    240   8e-71    
dbj|BAK05386.1|  predicted protein                                      239   1e-70    
gb|KHG12475.1|  Polygalacturonase non-catalytic subunit protein         240   1e-70    
ref|XP_010520580.1|  PREDICTED: probable polygalacturonase non-ca...    238   3e-70    
ref|XP_006439797.1|  hypothetical protein CICLE_v10019363mg             236   1e-69    
ref|XP_004509826.1|  PREDICTED: probable polygalacturonase non-ca...    236   3e-69    
ref|XP_003528153.1|  PREDICTED: polygalacturonase-1 non-catalytic...    234   1e-68    
ref|XP_003601289.1|  Polygalacturonase-1 non-catalytic subunit beta     234   1e-68    
ref|XP_010936822.1|  PREDICTED: BURP domain-containing protein 12...    233   2e-68    
ref|XP_007141610.1|  hypothetical protein PHAVU_008G210500g             233   2e-68    
gb|EMS58973.1|  hypothetical protein TRIUR3_16136                       230   4e-68    
dbj|BAJ92348.1|  predicted protein                                      233   4e-68    
ref|XP_004956601.1|  PREDICTED: BURP domain-containing protein 14...    234   5e-68    
emb|CDP00166.1|  unnamed protein product                                231   6e-68    
ref|XP_003574428.1|  PREDICTED: BURP domain-containing protein 12       232   7e-68    
ref|XP_006438393.1|  hypothetical protein CICLE_v10033917mg             232   8e-68    
gb|KDP26582.1|  hypothetical protein JCGZ_17740                         232   9e-68    
gb|ABR16440.1|  unknown                                                 232   2e-67    Picea sitchensis
gb|KEH20006.1|  polygalacturonase non-catalytic protein                 231   3e-67    
gb|KHN27021.1|  Putative polygalacturonase non-catalytic subunit        221   3e-66    
gb|EPS68955.1|  hypothetical protein M569_05812                         227   4e-66    
ref|XP_007138090.1|  hypothetical protein PHAVU_009G179500g             227   7e-66    
ref|XP_006484316.1|  PREDICTED: probable polygalacturonase non-ca...    226   1e-65    
gb|AAB38497.1|  female sex protein                                      214   3e-65    Mercurialis annua [annual mercury]
gb|EEC84370.1|  hypothetical protein OsI_30914                          225   4e-65    Oryza sativa Indica Group [Indian rice]
ref|NP_001062896.2|  Os09g0329000                                       225   6e-65    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD23622.1|  polygalacturonase isoenzyme 1 beta subunit-like        225   6e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008652571.1|  PREDICTED: BURP domain-containing protein 14...    225   7e-65    
ref|XP_002460065.1|  hypothetical protein SORBIDRAFT_02g022220          225   7e-65    Sorghum bicolor [broomcorn]
gb|EEE69479.1|  hypothetical protein OsJ_28904                          226   1e-64    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003576424.1|  PREDICTED: BURP domain-containing protein 14...    225   3e-64    
dbj|BAJ97940.1|  predicted protein                                      221   5e-63    
gb|KDO69698.1|  hypothetical protein CISIN_1g0378482mg                  215   1e-62    
gb|KHN30893.1|  Polygalacturonase-1 non-catalytic subunit beta          202   3e-57    
dbj|BAH57586.1|  BURP domain-containing protein                         185   2e-54    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57597.1|  BURP domain-containing protein                         184   6e-54    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57598.1|  BURP domain-containing protein                         183   1e-53    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57589.1|  BURP domain-containing protein                         183   1e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003610588.1|  BURP domain-containing protein                     188   3e-53    
dbj|BAH57596.1|  BURP domain-containing protein                         182   5e-53    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57581.1|  BURP domain-containing protein                         176   8e-51    Arabidopsis lyrata [lyrate rockcress]
gb|EMT30231.1|  hypothetical protein F775_20363                         173   4e-47    
gb|KDO38689.1|  hypothetical protein CISIN_1g045773mg                   167   4e-46    
gb|EMT26618.1|  hypothetical protein F775_18544                         171   1e-45    
gb|KEH20005.1|  polygalacturonase non-catalytic protein                 153   4e-40    
emb|CAN67205.1|  hypothetical protein VITISV_037214                     145   1e-38    Vitis vinifera
emb|CAN66340.1|  hypothetical protein VITISV_018557                     143   7e-38    Vitis vinifera
gb|KCW86723.1|  hypothetical protein EUGRSUZ_B03334                     134   4e-34    
ref|XP_010100467.1|  hypothetical protein L484_027779                   132   9e-34    
ref|XP_010046646.1|  PREDICTED: BURP domain-containing protein 16...    134   9e-33    
gb|KCW86729.1|  hypothetical protein EUGRSUZ_B03340                     127   2e-31    
gb|KCW86722.1|  hypothetical protein EUGRSUZ_B03333                     126   4e-31    
ref|XP_010046642.1|  PREDICTED: polygalacturonase non-catalytic s...    128   6e-31    
gb|KCW86730.1|  hypothetical protein EUGRSUZ_B03341                     126   8e-31    
ref|XP_010046648.1|  PREDICTED: polygalacturonase non-catalytic s...    126   4e-30    
ref|XP_006661124.1|  PREDICTED: LOW QUALITY PROTEIN: BURP domain-...    122   1e-28    
ref|XP_010044627.1|  PREDICTED: polygalacturonase non-catalytic s...    121   2e-28    
gb|AEN81139.1|  AT1G60390-like protein                                  117   2e-28    
gb|AEN81134.1|  AT1G60390-like protein                                  116   3e-28    
gb|AEN81136.1|  AT1G60390-like protein                                  116   3e-28    
gb|AEN81138.1|  AT1G60390-like protein                                  115   1e-27    
gb|AEN81137.1|  AT1G60390-like protein                                  115   1e-27    
ref|XP_010044626.1|  PREDICTED: polygalacturonase non-catalytic s...    118   2e-27    
gb|EMS64687.1|  hypothetical protein TRIUR3_01269                       119   3e-27    
gb|AEN81140.1|  AT1G60390-like protein                                  114   3e-27    
gb|KCW86720.1|  hypothetical protein EUGRSUZ_B03328                     114   8e-27    
ref|XP_010046641.1|  PREDICTED: polygalacturonase non-catalytic s...    116   1e-26    
ref|XP_010044635.1|  PREDICTED: probable polygalacturonase non-ca...    113   1e-25    
gb|KCW86721.1|  hypothetical protein EUGRSUZ_B03330                     110   2e-25    
ref|XP_010046644.1|  PREDICTED: polygalacturonase-1 non-catalytic...    111   2e-25    
gb|KCW86727.1|  hypothetical protein EUGRSUZ_B03337                     108   6e-25    
ref|XP_008348846.1|  PREDICTED: probable polygalacturonase non-ca...    103   1e-23    
ref|XP_010030785.1|  PREDICTED: polygalacturonase-1 non-catalytic...  90.1    7e-19    
ref|XP_006586545.1|  PREDICTED: probable polygalacturonase non-ca...  93.6    1e-18    
ref|XP_010046643.1|  PREDICTED: polygalacturonase-1 non-catalytic...  87.8    2e-17    
gb|KCW86724.1|  hypothetical protein EUGRSUZ_B03335                   87.4    3e-17    
gb|KHN27019.1|  Putative polygalacturonase non-catalytic subunit      84.7    4e-16    
ref|XP_010030786.1|  PREDICTED: polygalacturonase-1 non-catalytic...  81.6    4e-16    
ref|XP_003610589.1|  Polygalacturonase-1 non-catalytic subunit beta   79.7    1e-14    
ref|NP_001064572.1|  Os10g0409400                                     79.0    9e-14    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002525381.1|  Polygalacturonase non-catalytic subunit AroG...  79.7    1e-13    Ricinus communis
gb|AES96108.2|  BURP domain protein                                   78.2    2e-13    
ref|XP_003613150.1|  Polygalacturonase-1 non-catalytic subunit beta   78.2    3e-13    
dbj|BAF01101.1|  hypothetical protein                                 74.7    5e-13    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003613149.1|  Polygalacturonase-1 non-catalytic subunit beta   78.2    6e-13    
emb|CDP10830.1|  unnamed protein product                              62.4    5e-08    
gb|EEC77314.1|  hypothetical protein OsI_15976                        59.3    2e-07    Oryza sativa Indica Group [Indian rice]
emb|CDP10831.1|  unnamed protein product                              58.9    5e-07    
gb|AAN60310.1|  unknown                                               57.0    2e-06    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011074238.1|  PREDICTED: BURP domain-containing protein 16...  57.8    2e-06    
emb|CDP18474.1|  unnamed protein product                              57.0    4e-06    
ref|XP_009367928.1|  PREDICTED: BURP domain-containing protein 3-...  56.6    5e-06    
ref|XP_003613151.1|  Polygalacturonase-1 non-catalytic subunit beta   55.5    6e-06    
emb|CBI28514.3|  unnamed protein product                              55.8    7e-06    
gb|KHN15367.1|  Dehydration-responsive protein RD22                   55.8    1e-05    
ref|NP_001238316.1|  BURP domain-containing protein precursor         55.8    1e-05    
gb|ACU20207.1|  unknown                                               55.8    1e-05    Glycine max [soybeans]
ref|XP_009338715.1|  PREDICTED: BURP domain-containing protein 3-...  55.5    1e-05    
ref|XP_007140998.1|  hypothetical protein PHAVU_008G158600g           55.5    1e-05    
ref|XP_009338716.1|  PREDICTED: dehydration-responsive protein RD...  55.5    2e-05    
ref|XP_007200832.1|  hypothetical protein PRUPE_ppa025935mg           55.5    2e-05    
ref|XP_009338717.1|  PREDICTED: BURP domain-containing protein 3-...  55.5    2e-05    
ref|XP_009367929.1|  PREDICTED: dehydration-responsive protein RD...  55.1    2e-05    
ref|XP_010100466.1|  hypothetical protein L484_027778                 53.1    2e-05    
ref|XP_009367927.1|  PREDICTED: dehydration-responsive protein RD...  54.7    3e-05    
gb|EYU36709.1|  hypothetical protein MIMGU_mgv1a024306mg              53.9    4e-05    
ref|XP_003613152.1|  Polygalacturonase-1 non-catalytic subunit beta   53.1    4e-05    
ref|XP_004498543.1|  PREDICTED: dehydration-responsive protein RD...  53.5    5e-05    
ref|XP_008236869.1|  PREDICTED: BURP domain-containing protein 9-...  53.5    7e-05    
ref|XP_010098486.1|  hypothetical protein L484_025922                 52.8    9e-05    
ref|XP_008361290.1|  PREDICTED: BURP domain-containing protein 11...  53.1    9e-05    
ref|XP_010276358.1|  PREDICTED: dehydration-responsive protein RD...  53.1    9e-05    
ref|XP_001766061.1|  predicted protein                                53.1    9e-05    
ref|XP_008361298.1|  PREDICTED: BURP domain-containing protein 11...  53.1    1e-04    
ref|XP_007012036.1|  BURP domain-containing protein isoform 1         52.8    1e-04    
ref|XP_007012037.1|  BURP domain-containing protein, putative iso...  52.4    1e-04    
ref|XP_009798351.1|  PREDICTED: BURP domain-containing protein 3-...  52.4    1e-04    
gb|AAT66913.1|  dehydration-induced protein RD22-like protein 2       52.4    2e-04    Gossypium arboreum [tree cotton]
ref|XP_003606871.1|  BURP domain-containing protein                   52.0    2e-04    
ref|XP_009607060.1|  PREDICTED: BURP domain-containing protein 3-...  52.0    2e-04    
ref|XP_010648542.1|  PREDICTED: dehydration-responsive protein RD...  51.6    2e-04    
gb|AFK43537.1|  unknown                                               51.6    2e-04    
ref|XP_010648541.1|  PREDICTED: dehydration-responsive protein RD...  51.2    2e-04    
ref|XP_006833278.1|  hypothetical protein AMTR_s00109p00021460        51.6    3e-04    
ref|XP_009628253.1|  PREDICTED: dehydration-responsive protein RD...  51.6    3e-04    
ref|XP_002509472.1|  Dehydration-responsive protein RD22 precurso...  51.6    3e-04    Ricinus communis
ref|XP_009628254.1|  PREDICTED: dehydration-responsive protein RD...  51.6    3e-04    
ref|XP_010049078.1|  PREDICTED: dehydration-responsive protein RD22   51.6    3e-04    
ref|XP_007224866.1|  hypothetical protein PRUPE_ppa022737mg           51.2    3e-04    
emb|CDP21057.1|  unnamed protein product                              51.2    3e-04    
gb|ACU24326.1|  unknown                                               51.2    3e-04    
ref|XP_003537889.1|  PREDICTED: BURP domain-containing protein 3-...  51.2    3e-04    
ref|XP_010667774.1|  PREDICTED: dehydration-responsive protein RD...  51.2    3e-04    
ref|XP_010667747.1|  PREDICTED: dehydration-responsive protein RD...  51.2    4e-04    
ref|NP_001174278.1|  Os05g0215066                                     50.4    4e-04    
gb|EYU36708.1|  hypothetical protein MIMGU_mgv1a009279mg              50.8    4e-04    
ref|XP_004299100.1|  PREDICTED: BURP domain-containing protein 3-...  50.8    4e-04    
ref|XP_008457933.1|  PREDICTED: dehydration-responsive protein RD...  50.4    4e-04    
ref|XP_003588551.1|  BURP domain-containing protein                   50.8    5e-04    
gb|ADD54599.1|  dehydration-responsive protein RD22 precursor         49.7    5e-04    
ref|XP_006487170.1|  PREDICTED: BURP domain-containing protein 17...  50.4    5e-04    
ref|XP_006419189.1|  hypothetical protein CICLE_v10030447mg           50.1    6e-04    
ref|XP_004500818.1|  PREDICTED: BURP domain-containing protein 17...  50.4    6e-04    
ref|XP_009762320.1|  PREDICTED: dehydration-responsive protein RD22   50.4    6e-04    
ref|XP_004148868.1|  PREDICTED: dehydration-responsive protein RD...  50.1    6e-04    
ref|XP_006487162.1|  PREDICTED: BURP domain-containing protein 17...  50.1    6e-04    
gb|KGN61783.1|  hypothetical protein Csa_2G245470                     50.1    6e-04    
ref|XP_006487164.1|  PREDICTED: BURP domain-containing protein 17...  50.1    6e-04    
ref|XP_006423241.1|  hypothetical protein CICLE_v10029064mg           50.1    6e-04    
ref|XP_011019672.1|  PREDICTED: dehydration-responsive protein RD...  50.4    7e-04    
emb|CDP21280.1|  unnamed protein product                              50.4    7e-04    
dbj|BAB69453.1|  A2-134                                               50.1    8e-04    
emb|CDP18475.1|  unnamed protein product                              49.7    0.001    



>ref|XP_009794726.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana sylvestris]
Length=628

 Score =   327 bits (837),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 164/258 (64%), Positives = 199/258 (77%), Gaps = 6/258 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA + FTSYG ++NV+ + F NYG++ NG    FTSY  NGN P+N FKNYGAG
Sbjct  238  YGKNGNGADSKFTSYGTDTNVIGSTFTNYGQTANGGNQNFTSYGTNGNVPENNFKNYGAG  297

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNGP +TF +YR +SNVG DSF +Y K +NA +  FVNYG++FN GTDKF+GY   ++  
Sbjct  298  GNGPTETFTNYRDQSNVGDDSFQNYIKDTNAGEANFVNYGQSFNEGTDKFTGYGKGANDP  357

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLN-ATDVTAAVGAAK-GKMVNNKRWVEPGKFFRE  240
            +V+F  YGVNNTFKDY K   TF+ Y N ++ V A++     GKMVNN RWVEPGKFFRE
Sbjct  358  KVNFKTYGVNNTFKDYVKDSATFSNYHNKSSQVLASLTEVNGGKMVNN-RWVEPGKFFRE  416

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
            KMLKSGT+MPMPDI+DKMPKRSFLPR IAA+LPFS ++IGEL+KIFHA + S +AKMI  
Sbjct  417  KMLKSGTVMPMPDIKDKMPKRSFLPRVIAAKLPFSTSKIGELKKIFHAADDSPVAKMIGD  476

Query  59   TLAECERAPSRDETKRCV  6
             L ECERAPS  ETKRC+
Sbjct  477  ALTECERAPSAGETKRCI  494



>gb|AHC69823.1| polygalacturonase isoenzyme 1 beta subunit [Nicotiana tabacum]
Length=628

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/258 (64%), Positives = 199/258 (77%), Gaps = 6/258 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA + FTSYG ++NV+ + F NYG++ NG    FTSY  NGN P+N FKNYGAG
Sbjct  238  YGKNGNGADSKFTSYGTDTNVIGSTFTNYGQTANGGNQNFTSYGTNGNVPENNFKNYGAG  297

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNGP +TF +YR +SNVG DSF +Y K +NA +  FVNYG++FN GTDKF+GY   ++  
Sbjct  298  GNGPTETFTNYRDQSNVGDDSFQNYIKDTNAGEANFVNYGQSFNEGTDKFTGYGKGANDP  357

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLN-ATDVTAAVGAAK-GKMVNNKRWVEPGKFFRE  240
            +V+F  YGVNNTFKDY K   TF+ Y N ++ V A++     GKMVNN RWVEPGKFFRE
Sbjct  358  KVNFKTYGVNNTFKDYVKDSATFSNYHNKSSQVLASLTEVNGGKMVNN-RWVEPGKFFRE  416

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
            KMLKSGTIMPMPDI+DKMPKRSFLPR IAA+LPFS ++IGE++KIFHA + S +AKMI  
Sbjct  417  KMLKSGTIMPMPDIKDKMPKRSFLPRVIAAKLPFSTSKIGEMKKIFHAGDDSPVAKMIGD  476

Query  59   TLAECERAPSRDETKRCV  6
             L ECERAPS  ETKRC+
Sbjct  477  ALTECERAPSAGETKRCI  494



>ref|XP_009596009.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana tomentosiformis]
Length=629

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/258 (63%), Positives = 199/258 (77%), Gaps = 6/258 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA + FTSYG ++NV+ + F NYG++ NG    FTSY  NGN P+N FKNYGAG
Sbjct  239  YGKNGNGADSKFTSYGTDTNVIGSTFTNYGQTANGGNQNFTSYGTNGNVPENNFKNYGAG  298

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNGP +TF +YR ++NVG D+F +Y K +NA +  FVNYG++FN GTDKF+GY   ++  
Sbjct  299  GNGPTETFTNYRDQANVGDDNFQNYIKDTNAGEANFVNYGQSFNEGTDKFTGYGKGANDP  358

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLN-ATDVTAAVGAAK-GKMVNNKRWVEPGKFFRE  240
            +V+F  YGVNNTFKDY K   TF+ Y N ++ V A++     GKMVNN RWVEPGKFFRE
Sbjct  359  KVNFKTYGVNNTFKDYVKDSATFSNYHNKSSQVLASLTEVNGGKMVNN-RWVEPGKFFRE  417

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
            KMLKSGTIMPMPDI+DKMPKRSFLPR IAA+LPFS ++IGE++KIFHA + S +AKMI  
Sbjct  418  KMLKSGTIMPMPDIKDKMPKRSFLPRVIAAKLPFSTSKIGEMKKIFHAGDDSPVAKMIGD  477

Query  59   TLAECERAPSRDETKRCV  6
             L ECERAPS  ETKRC+
Sbjct  478  ALTECERAPSAGETKRCI  495


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 65/152 (43%), Gaps = 12/152 (8%)
 Frame = -1

Query  698  DTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSF  519
            D  F NYG +  G  D F +Y+   N P ++F+ Y     G  D F++Y  + NV   SF
Sbjct  121  DKNFTNYGTTRAGGFDGFKNYSDGENIPVDSFRRYSRDSGGHDDRFSNYAPDGNVIDQSF  180

Query  518  NSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS---DRVSFNGYGVN-----NTFKDYA  363
            N+YG  +      F NYG   N    KF+ YSD+       F  Y  N      +F +Y 
Sbjct  181  NTYGTNAAGGTGKFTNYGPNVNVPNIKFTSYSDAATGRNQDFTAYSQNANAGDQSFSNYG  240

Query  362  KTG----VTFAGYLNATDVTAAVGAAKGKMVN  279
            K G      F  Y   T+V  +     G+  N
Sbjct  241  KNGNGADSKFTSYGTDTNVIGSTFTNYGQTAN  272



>ref|XP_011086565.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=634

 Score =   322 bits (824),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 167/257 (65%), Positives = 194/257 (75%), Gaps = 6/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGAA  FTSYG +SNVM + F NYGESGNG  DTFTSY  N N P+N FKNYG+ 
Sbjct  246  YGKNGNGAANEFTSYGKDSNVMGSTFNNYGESGNGANDTFTSYGTNTNVPENNFKNYGSQ  305

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   DTF +YR +SNVG DSF+SYGK SNAA + FVNYG++FN GTDKF+GY   S   
Sbjct  306  GNAATDTFKNYRDQSNVGDDSFDSYGKNSNAAKIDFVNYGQSFNEGTDKFTGYGKDSTGP  365

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLN-ATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             V F  YGVNNTFK+Y K GVTFA Y+N ++    A  AAKGKMVN  +WVEPGKFFRE 
Sbjct  366  SVGFKIYGVNNTFKEYNKKGVTFARYINDSSSSLEASLAAKGKMVN--KWVEPGKFFRES  423

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK+ TIMPMPDIRDKMPKRSFLPR I ++LPFS +++G+L+K+FH  + S+M  MI   
Sbjct  424  MLKTDTIMPMPDIRDKMPKRSFLPRVIVSKLPFSTSKLGDLKKLFHTEDNSSMTSMITDA  483

Query  56   LAECERAPSRDETKRCV  6
            L ECER PS  ETKRCV
Sbjct  484  LGECERVPSPGETKRCV  500


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 73/161 (45%), Gaps = 12/161 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    FTSY  ++NV+D +F  YG S  G    F +Y    N P+  F  Y   
Sbjct  162  YSRDSTGHNDKFTSYATDANVVDQSFNTYGTSATGGKGQFDNYNSQVNVPNLRFTAYSDN  221

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS---D  414
             NG   +F  Y  E+N G   F SYGK  N A   F +YGK  N     F+ Y +S    
Sbjct  222  SNGRQQSFTQYTDEANAGDQRFTSYGKNGNGAANEFTSYGKDSNVMGSTFNNYGESGNGA  281

Query  413  RVSFNGYGVN-----NTFKDYAKTG----VTFAGYLNATDV  318
              +F  YG N     N FK+Y   G     TF  Y + ++V
Sbjct  282  NDTFTSYGTNTNVPENNFKNYGSQGNAATDTFKNYRDQSNV  322


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 69/155 (45%), Gaps = 22/155 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYG--  591
            YG +  G    F +Y +  NV   +F+ Y     G  D FTSYA + N  D +F  YG  
Sbjct  134  YGTDRLGGTDSFKNYSDGENVPLDSFRRYSRDSTGHNDKFTSYATDANVVDQSFNTYGTS  193

Query  590  -AGGNGPVDTFNS-----------YRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
              GG G  D +NS           Y   SN    SF  Y  ++NA D  F +YGK  NG 
Sbjct  194  ATGGKGQFDNYNSQVNVPNLRFTAYSDNSNGRQQSFTQYTDEANAGDQRFTSYGKNGNGA  253

Query  446  TDKFSGYSDSDRV---SFNGY-----GVNNTFKDY  366
             ++F+ Y     V   +FN Y     G N+TF  Y
Sbjct  254  ANEFTSYGKDSNVMGSTFNNYGESGNGANDTFTSY  288


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 49/104 (47%), Gaps = 6/104 (6%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F SY N +      F NYG    G  D+F +Y+   N P ++F+ Y     G  D F SY
Sbjct  123  FASYSNKN------FTNYGTDRLGGTDSFKNYSDGENVPLDSFRRYSRDSTGHNDKFTSY  176

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD  420
              ++NV   SFN+YG  +      F NY    N    +F+ YSD
Sbjct  177  ATDANVVDQSFNTYGTSATGGKGQFDNYNSQVNVPNLRFTAYSD  220



>emb|CDP00165.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 193/264 (73%), Gaps = 12/264 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   FTSYGNNSNV+ + FKNYGE+ N   D F+SY  NGN P+N F NYG G
Sbjct  247  YGKNGNGAENDFTSYGNNSNVVGSNFKNYGETANAATDKFSSYGSNGNVPENNFNNYGPG  306

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   +TF +YR +SNVG DSF SY K SNAA   FVNYG++FN G+D+F+ Y   + S 
Sbjct  307  GNAATETFTNYRDQSNVGDDSFQSYAKGSNAATANFVNYGQSFNEGSDRFTSYGKDASSL  366

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLN--------ATDVTAAVGAAKGKMVNNKRWVEP  258
             V F  YGVNNTFK+YAK+GVTFA Y N           + A    A GK VNN RWVEP
Sbjct  367  TVGFKIYGVNNTFKEYAKSGVTFASYRNDTSGGSSSTASLAAEKAGASGKRVNN-RWVEP  425

Query  257  GKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAM  78
            GKFFREKML++GT+MPMPDI+DKMPKRSFLPR I ++LPFS ++IGEL+KIFHA + S M
Sbjct  426  GKFFREKMLRTGTVMPMPDIKDKMPKRSFLPRVILSKLPFSTSKIGELKKIFHAADDSKM  485

Query  77   AKMIAGTLAECERAPSRDETKRCV  6
            A ++A +L ECERAPS  ETKRCV
Sbjct  486  AGLMADSLGECERAPSPGETKRCV  509


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 68/142 (48%), Gaps = 17/142 (12%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    FT+Y  ++NV+D +F  YG +  G A  F +Y  N N P   F +Y   
Sbjct  163  YSRDSVGHDDKFTNYALDANVVDQSFNTYGTAATGGAGDFKNYNDNSNVPGLKFTSYSDS  222

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAAD------------VG--FVNYGKTFNGG  447
             NG    F  Y   +N G + F SYGK  N A+            VG  F NYG+T N  
Sbjct  223  SNGRKQGFKGYATNANAGDEGFTSYGKNGNGAENDFTSYGNNSNVVGSNFKNYGETANAA  282

Query  446  TDKFSGYSDSDRV---SFNGYG  390
            TDKFS Y  +  V   +FN YG
Sbjct  283  TDKFSSYGSNGNVPENNFNNYG  304


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 68/150 (45%), Gaps = 20/150 (13%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG N  G    F +Y N  N+   AF+ Y     G  D FT+YA + N  D +F  YG  
Sbjct  135  YGTNRAGGVDSFKNYTNGENIPVDAFRRYSRDSVGHDDKFTNYALDANVVDQSFNTYGTA  194

Query  584  GNGPVDTFNSYRQESNVGADSFNSY-----GKK---------SNAADVGFVNYGKTFNGG  447
              G    F +Y   SNV    F SY     G+K         +NA D GF +YGK  NG 
Sbjct  195  ATGGAGDFKNYNDNSNVPGLKFTSYSDSSNGRKQGFKGYATNANAGDEGFTSYGKNGNGA  254

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAKT  357
             + F+ Y ++  V      V + FK+Y +T
Sbjct  255  ENDFTSYGNNSNV------VGSNFKNYGET  278


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 53/120 (44%), Gaps = 8/120 (7%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G  D+F +Y    N P + F+ Y     G  D F +Y  ++NV   SFN+Y
Sbjct  132  FTNYGTNRAGGVDSFKNYTNGENIPVDAFRRYSRDSVGHDDKFTNYALDANVVDQSFNTY  191

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---RVSFNGYGVN-----NTFKDYAKTG  354
            G  +      F NY    N    KF+ YSDS    +  F GY  N       F  Y K G
Sbjct  192  GTAATGGAGDFKNYNDNSNVPGLKFTSYSDSSNGRKQGFKGYATNANAGDEGFTSYGKNG  251



>ref|XP_004238668.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2 [Solanum 
lycopersicum]
 sp|P93217.1|GP2_SOLLC RecName: Full=Polygalacturonase non-catalytic subunit AroGP2; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAB39556.1| AROGP2 [Solanum lycopersicum]
Length=629

 Score =   316 bits (810),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/258 (62%), Positives = 190/258 (74%), Gaps = 6/258 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA + FTSYGN +NV  + FKNYG++ NG+   FTSY+ NGNNP N FKNYG G
Sbjct  239  YGKNGNGADSKFTSYGNETNVAASTFKNYGQNANGENQNFTSYSTNGNNPQNNFKNYGVG  298

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNGP +TF +YR ESNVG D F++Y K +NA +  F NYG++FN GTD F  Y    +  
Sbjct  299  GNGPSETFTNYRDESNVGDDKFSNYVKDANAGEANFTNYGQSFNEGTDVFITYGKGGNDP  358

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNAT--DVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
             ++F  YGVNNTFKDY K   TF+ Y N T  D+ +      GK VNN RW+EPGKFFRE
Sbjct  359  HINFKTYGVNNTFKDYVKDTATFSNYHNKTSQDLASLSEVNGGKKVNN-RWIEPGKFFRE  417

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
            KMLKSGTIMPMPDI+DKMPKRSFLPR IAA+LPFS ++I EL+KIFHA   S +AKMI  
Sbjct  418  KMLKSGTIMPMPDIKDKMPKRSFLPRAIAAKLPFSTSKIDELKKIFHAANDSQVAKMIGD  477

Query  59   TLAECERAPSRDETKRCV  6
             L+ECERAPS  ETK+CV
Sbjct  478  ALSECERAPSPGETKQCV  495


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 71/150 (47%), Gaps = 12/150 (8%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F +Y  + NV+D +F +Y  +  G +  FT+YA N N PD  F  Y   G G    F +Y
Sbjct  166  FDNYAPDGNVIDQSFNSYSTNTPGGSGQFTNYAPNTNVPDLRFTAYSDQGTGGEQEFKTY  225

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSDRVSFNGYGVN-  384
             ++ N G  SF SYGK  N AD  F +YG   N     F  Y   ++ +  +F  Y  N 
Sbjct  226  LEQGNSGGQSFKSYGKNGNGADSKFTSYGNETNVAASTFKNYGQNANGENQNFTSYSTNG  285

Query  383  ----NTFKDYAKTG----VTFAGYLNATDV  318
                N FK+Y   G     TF  Y + ++V
Sbjct  286  NNPQNNFKNYGVGGNGPSETFTNYRDESNV  315



>ref|XP_004238667.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP3 [Solanum 
lycopersicum]
 sp|P93218.1|GP3_SOLLC RecName: Full=Polygalacturonase non-catalytic subunit AroGP3; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAB39557.1| AROGP3 [Solanum lycopersicum]
Length=632

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 190/258 (74%), Gaps = 6/258 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GNGA + FT+YGNN+NV  + F NYGE+ NG+   FTSY FNGNNP ++F NYG G
Sbjct  242  YGKDGNGADSQFTTYGNNTNVDGSDFTNYGEAANGENQNFTSYGFNGNNPASSFNNYGVG  301

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNGP + FNSYR +SNVG D+F +Y K +N  +  F NYG++FN GTD F+ Y    +  
Sbjct  302  GNGPSEAFNSYRDQSNVGDDTFTTYVKDANGGEANFTNYGQSFNEGTDVFTTYGKGGNDP  361

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNAT--DVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
             ++F  YGVNNTFKDY K   TF+ Y N T  D+ +      GK VNN RW+EPGKFFRE
Sbjct  362  HINFKTYGVNNTFKDYVKDTATFSNYHNKTSQDLASLSEVNGGKKVNN-RWIEPGKFFRE  420

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
            KMLKSGTIMPMPDI+DKMPKRSFLPR IAA+LPFS ++I EL+KIFHA   S +AKMI  
Sbjct  421  KMLKSGTIMPMPDIKDKMPKRSFLPRAIAAKLPFSTSKIDELKKIFHAANDSQVAKMIGD  480

Query  59   TLAECERAPSRDETKRCV  6
             L+ECERAPS  ETK+CV
Sbjct  481  ALSECERAPSPGETKQCV  498


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 69/144 (48%), Gaps = 13/144 (9%)
 Frame = -1

Query  731  FTSYGNNSNVMD-TAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGA-GGNGPVDTFN  558
            FT+YG   + +   +FKNY E  N   ++F  Y  +  + DN F NYGA GGN PV +FN
Sbjct  126  FTNYGTKESGLGFNSFKNYTEEENFPVNSFRRYGRDSPH-DNQFDNYGAPGGNTPVQSFN  184

Query  557  SYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNT  378
            SY   +  G+  F +Y   SN  D+ F +Y     GG   F  Y +      +G     +
Sbjct  185  SYSTNTPGGSGQFTNYAPGSNVPDLHFTSYSDHGTGGEQDFKSYGN------DGNAGQQS  238

Query  377  FKDYAKTG----VTFAGYLNATDV  318
            FK Y K G      F  Y N T+V
Sbjct  239  FKSYGKDGNGADSQFTTYGNNTNV  262



>gb|KCW59875.1| hypothetical protein EUGRSUZ_H02608 [Eucalyptus grandis]
Length=623

 Score =   311 bits (798),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/256 (61%), Positives = 191/256 (75%), Gaps = 5/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+G+G+   FT Y ++SNV+++ F  Y ++GNG  DTFT+Y   GN P+N F+NYG G
Sbjct  236  YGKSGDGSPNKFTEYASDSNVINSGFNGYSQAGNGANDTFTNYGKEGNVPENNFRNYGDG  295

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNG  D F +YR +SNVG DSF SY K SN+A V F NYGK+FN GTDKF+GY   +   
Sbjct  296  GNGISDGFANYRDQSNVGDDSFQSYAKNSNSAKVNFANYGKSFNVGTDKFTGYGQGAKGQ  355

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F GYGVNNTFK+Y K+GVTFA Y NAT V A+  A  G+ VN  RWVEPGKFFRE M
Sbjct  356  KIGFKGYGVNNTFKEYGKSGVTFALYANATGVAASAMAVSGRAVN--RWVEPGKFFRESM  413

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+MPMPDI DKMPKRSFLPR I ++LPFS +++ EL++IFHA + S+M  M+A  L
Sbjct  414  LKKGTVMPMPDIGDKMPKRSFLPRTILSKLPFSTSKLPELKRIFHAGDNSSMESMMANAL  473

Query  53   AECERAPSRDETKRCV  6
            AECERAPS  ETKRCV
Sbjct  474  AECERAPSAGETKRCV  489


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 71/137 (52%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++ +G    F +YG++ N++D +F++Y     G    F +Y    N P+  F NYG+G
Sbjct  152  YSRDSSGHDDRFANYGSDGNLVDQSFQSYAGGAAGGTGEFKNYNPGVNVPNLNFNNYGSG  211

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
              G    F +Y  E+N GA+SF++YGK  + +   F  Y    N     F+GYS +    
Sbjct  212  ATGRPQNFAAYTDETNAGAESFSNYGKSGDGSPNKFTEYASDSNVINSGFNGYSQA----  267

Query  404  FNGYGVNNTFKDYAKTG  354
              G G N+TF +Y K G
Sbjct  268  --GNGANDTFTNYGKEG  282



>ref|XP_010023570.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Eucalyptus grandis]
Length=624

 Score =   311 bits (798),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/256 (61%), Positives = 191/256 (75%), Gaps = 5/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+G+G+   FT Y ++SNV+++ F  Y ++GNG  DTFT+Y   GN P+N F+NYG G
Sbjct  237  YGKSGDGSPNKFTEYASDSNVINSGFNGYSQAGNGANDTFTNYGKEGNVPENNFRNYGDG  296

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNG  D F +YR +SNVG DSF SY K SN+A V F NYGK+FN GTDKF+GY   +   
Sbjct  297  GNGISDGFANYRDQSNVGDDSFQSYAKNSNSAKVNFANYGKSFNVGTDKFTGYGQGAKGQ  356

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F GYGVNNTFK+Y K+GVTFA Y NAT V A+  A  G+ VN  RWVEPGKFFRE M
Sbjct  357  KIGFKGYGVNNTFKEYGKSGVTFALYANATGVAASAMAVSGRAVN--RWVEPGKFFRESM  414

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+MPMPDI DKMPKRSFLPR I ++LPFS +++ EL++IFHA + S+M  M+A  L
Sbjct  415  LKKGTVMPMPDIGDKMPKRSFLPRTILSKLPFSTSKLPELKRIFHAGDNSSMESMMANAL  474

Query  53   AECERAPSRDETKRCV  6
            AECERAPS  ETKRCV
Sbjct  475  AECERAPSAGETKRCV  490


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 71/137 (52%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++ +G    F +YG++ N++D +F++Y     G    F +Y    N P+  F NYG+G
Sbjct  153  YSRDSSGHDDRFANYGSDGNLVDQSFQSYAGGAAGGTGEFKNYNPGVNVPNLNFNNYGSG  212

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
              G    F +Y  E+N GA+SF++YGK  + +   F  Y    N     F+GYS +    
Sbjct  213  ATGRPQNFAAYTDETNAGAESFSNYGKSGDGSPNKFTEYASDSNVINSGFNGYSQA----  268

Query  404  FNGYGVNNTFKDYAKTG  354
              G G N+TF +Y K G
Sbjct  269  --GNGANDTFTNYGKEG  283



>ref|XP_002266341.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Vitis vinifera]
Length=633

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/256 (60%), Positives = 188/256 (73%), Gaps = 5/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG+   FTSYG++SNV+ + F  YGE+GN   DTF SY F+GN P+N FK YG G
Sbjct  246  YGKNGNGSPNEFTSYGSSSNVIGSTFTGYGETGNAANDTFKSYGFDGNVPENNFKKYGDG  305

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   DTF SYR +SNVG DSF SY K SN+A+V FVNYGK+FN GTD F+GY   + + 
Sbjct  306  GNAGTDTFISYRDQSNVGDDSFKSYAKNSNSAEVDFVNYGKSFNEGTDTFAGYGKGATNH  365

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            +++F  YGVNNTF DYAK G++F+ Y N +  T    A  G  VN  RWVEPGKFFRE M
Sbjct  366  KINFKIYGVNNTFTDYAKKGISFSRYTNKSSETMTSMAVSGSSVN--RWVEPGKFFRESM  423

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+MPMPDIRDKMPKRSFLPR I+++ PFS +++ E++KIFHA + S+M  M    L
Sbjct  424  LKKGTVMPMPDIRDKMPKRSFLPRTISSKFPFSTSKLEEMKKIFHAADNSSMEHMFTEAL  483

Query  53   AECERAPSRDETKRCV  6
             +CERAPS+ ETKRCV
Sbjct  484  DDCERAPSKGETKRCV  499


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 71/155 (46%), Gaps = 22/155 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +G G    FT Y    N+   AFK Y     G+ D F +Y   GN  D +F  YGAG
Sbjct  134  YGTDGLGGTDAFTKYSEGVNLPVDAFKRYSRDSVGNNDKFDNYGREGNVVDQSFSGYGAG  193

Query  584  GNG--------------PVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
              G              P   FNSY  + N    SF SY  ++N+ D  F +YGK  NG 
Sbjct  194  ATGGSGEFKKYNEEVNVPNLRFNSYTDDGNGRQQSFTSYTNETNSGDESFSSYGKNGNGS  253

Query  446  TDKFSGYSDSDRV---SFNGYG-----VNNTFKDY  366
             ++F+ Y  S  V   +F GYG      N+TFK Y
Sbjct  254  PNEFTSYGSSSNVIGSTFTGYGETGNAANDTFKSY  288



>ref|NP_001234835.1| polygalacturonase-1 non-catalytic subunit beta precursor [Solanum 
lycopersicum]
 sp|Q40161.1|GP1_SOLLC RecName: Full=Polygalacturonase-1 non-catalytic subunit beta; 
AltName: Full=AroGP1; AltName: Full=Polygalacturonase converter; 
Short=PG converter; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34181.1| polygalacturonase isoenzyme 1 beta subunit [Solanum lycopersicum]
 gb|AAB39547.1| polygalacturonase isoenzyme 1 beta subunit [Solanum lycopersicum]
Length=630

 Score =   311 bits (796),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 156/257 (61%), Positives = 187/257 (73%), Gaps = 4/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F SYGN++NV+ + F NYG++ NG    FTSY FNGN P+N F NYGAG
Sbjct  240  YGKNGNGANGEFVSYGNDTNVIGSTFTNYGQTANGGDQKFTSYGFNGNVPENHFTNYGAG  299

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNGP +TFNSYR +SNVG D+F +Y K +N  +  F NYG++FN GTD F+ Y    +  
Sbjct  300  GNGPSETFNSYRDQSNVGDDTFTTYVKDANGGEANFTNYGQSFNEGTDVFTTYGKGGNDP  359

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNAT-DVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             ++F  YGVNNTFKDY K   TF+ Y N T  V A++    G    N RWVEPGKFFREK
Sbjct  360  HINFKTYGVNNTFKDYVKDTATFSNYHNKTSQVLASLMEVNGGKKVNNRWVEPGKFFREK  419

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLKSGTIMPMPDI+DKMPKRSFLPR IA++LPFS ++I EL+KIFHA + S + KMI   
Sbjct  420  MLKSGTIMPMPDIKDKMPKRSFLPRVIASKLPFSTSKIAELKKIFHAGDESQVEKMIGDA  479

Query  56   LAECERAPSRDETKRCV  6
            L+ECERAPS  ETKRCV
Sbjct  480  LSECERAPSAGETKRCV  496



>ref|XP_006365231.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase non-catalytic 
subunit AroGP3-like [Solanum tuberosum]
Length=628

 Score =   311 bits (796),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/255 (62%), Positives = 187/255 (73%), Gaps = 5/255 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GNGA + FT+YGNN+NV  +AF NYG++ NG+   FTSY FNGNNP + F NYG G
Sbjct  241  YGKDGNGADSQFTTYGNNTNVDGSAFTNYGQTANGENQNFTSYGFNGNNPASNFNNYGVG  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNGP +TF SYR +SNVG D+F +Y K +N  +  F NYG++FN GTD F+ Y    +  
Sbjct  301  GNGPSETFTSYRDQSNVGDDTFTTYVKDANGGEANFTNYGQSFNEGTDVFTTYGKGGNDP  360

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             ++F  YGVNNTFKDY K   TF+ Y N T    A     GK VNN RWVEPGKFFREKM
Sbjct  361  HINFKTYGVNNTFKDYVKDTATFSNYQNKTSQVLA-SLTGGKKVNN-RWVEPGKFFREKM  418

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LKSGTIMPMPDI+DKMPKRSFLPR IA++LPFS ++I EL+KIFHA   S +AKMI   L
Sbjct  419  LKSGTIMPMPDIKDKMPKRSFLPRVIASKLPFSTSKIDELKKIFHAANDSQVAKMIGDAL  478

Query  53   AECERAPSRDETKRC  9
            +ECERAPS  ETKRC
Sbjct  479  SECERAPSAGETKRC  493


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 72/156 (46%), Gaps = 12/156 (8%)
 Frame = -1

Query  731  FTSYGNNSNVMD-TAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNS  555
            FT+YG     +   +FKNY E  N   ++F  Y  +  + DN F NYG GGN PV +FNS
Sbjct  126  FTNYGTKEFGLGFNSFKNYTEDENFPVNSFRRYGRDSPH-DNQFDNYGPGGNTPVQSFNS  184

Query  554  YRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTF  375
            Y   +  G+  F +Y   +N  D+ F +Y     GG  +F  Y +      +G     TF
Sbjct  185  YSTNTPGGSGQFTNYAPGANVPDLHFTSYSDHGTGGEQQFKSYGN------DGNAGQQTF  238

Query  374  KDYAKTG----VTFAGYLNATDVTAAVGAAKGKMVN  279
            K Y K G      F  Y N T+V  +     G+  N
Sbjct  239  KSYGKDGNGADSQFTTYGNNTNVDGSAFTNYGQTAN  274



>ref|XP_006365227.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=629

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 186/257 (72%), Gaps = 4/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F SYGN++NV+ + F NYG++ NG+   FTSY FNGN P+N F NYG G
Sbjct  239  YGKNGNGANGEFVSYGNDTNVLGSTFTNYGQTANGEDQKFTSYGFNGNVPENHFTNYGVG  298

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNGP +TF SYR +SNVG D+F +Y K +N  +  F NYG++FN GTD F+ Y    +  
Sbjct  299  GNGPSETFTSYRDQSNVGDDTFTTYVKDANGGEANFTNYGQSFNEGTDVFTTYGKGGNDP  358

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNAT-DVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             ++F  YGVNNTFKDY K   TF+ Y N T  V A++    G    N RWVEPGKFFREK
Sbjct  359  HINFKTYGVNNTFKDYVKDTATFSNYHNKTSQVLASLTEVNGGKKVNNRWVEPGKFFREK  418

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLKSGTIMPMPDI+DKMPKRSFLPR IAA+LPFS ++I EL+KIFHA + S + KMI   
Sbjct  419  MLKSGTIMPMPDIKDKMPKRSFLPRVIAAKLPFSTSKIAELKKIFHAGDDSQVEKMIGDA  478

Query  56   LAECERAPSRDETKRCV  6
            L+ECERAPS  ETK+CV
Sbjct  479  LSECERAPSAGETKQCV  495



>ref|XP_006365228.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Solanum tuberosum]
Length=632

 Score =   309 bits (791),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 186/258 (72%), Gaps = 6/258 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA + FTSYGN +NV  + F NYG++ NG+   FTSY+ NGNNP N F+NYG G
Sbjct  242  YGKNGNGADSKFTSYGNETNVAASTFTNYGQNANGENQNFTSYSTNGNNPQNNFRNYGVG  301

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNGP +TF +Y  +SNVG D F +Y K +NA +  F NYG++FN GTD F+ Y    +  
Sbjct  302  GNGPSETFTNYIDQSNVGDDKFINYVKDANAGEANFTNYGQSFNEGTDVFTTYGKGGNDP  361

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAK--GKMVNNKRWVEPGKFFRE  240
             ++F  YGVNNTFKDY K   TF+ YLN T    A  +    GK VNN RWVEPGKFFRE
Sbjct  362  HINFKTYGVNNTFKDYVKDTATFSNYLNETSQVLASSSEVNGGKKVNN-RWVEPGKFFRE  420

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
            KMLKSGTIMPMPDI+DKMPKRSFLPR IAA+LPFS ++I EL KIFHA   S +AKMI  
Sbjct  421  KMLKSGTIMPMPDIKDKMPKRSFLPRTIAAKLPFSYSKIDELNKIFHAANDSQVAKMIGN  480

Query  59   TLAECERAPSRDETKRCV  6
             L+ECERAPS  E K+CV
Sbjct  481  ALSECERAPSAGEMKQCV  498


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 73/150 (49%), Gaps = 12/150 (8%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F +Y  + NV+D +F +Y  +  G +  FT+YA N N PD  F  Y   G G    F +Y
Sbjct  169  FDNYAPDGNVIDQSFNSYSTNTPGGSGKFTNYAPNTNVPDLRFTAYSDQGTGGEQEFKTY  228

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSDRVSFNGYGVN-  384
             ++ N G  SF SYGK  N AD  F +YG   N     F+ Y   ++ +  +F  Y  N 
Sbjct  229  LEQGNSGGQSFKSYGKNGNGADSKFTSYGNETNVAASTFTNYGQNANGENQNFTSYSTNG  288

Query  383  ----NTFKDYAKTG----VTFAGYLNATDV  318
                N F++Y   G     TF  Y++ ++V
Sbjct  289  NNPQNNFRNYGVGGNGPSETFTNYIDQSNV  318



>ref|XP_010100469.1| hypothetical protein L484_027781 [Morus notabilis]
 gb|EXB82603.1| hypothetical protein L484_027781 [Morus notabilis]
Length=608

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/260 (58%), Positives = 189/260 (73%), Gaps = 8/260 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GNGA   F+SYGN+SNV+ + F +Y  + NG  DTFT+YAF+GNNP N F+NYG G
Sbjct  218  YGKDGNGAENDFSSYGNSSNVIGSEFSSYQRTSNGGQDTFTAYAFDGNNPQNNFRNYGDG  277

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
             N  V+ F SYR +SNVG DSF SY K SN  ++ F NYGK+FN GTDKF+GY   +   
Sbjct  278  ANAAVEKFTSYRDQSNVGDDSFQSYAKNSNGEEIKFSNYGKSFNEGTDKFTGYGKDATGH  337

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNAT---DVTAAVGAAKGKMVNNKRWVEPGKFFR  243
             + F  YGVNNTFK+YA+ GVTF+ Y N +   + +A   A  G +V  KRWVEPGKFFR
Sbjct  338  SIGFKIYGVNNTFKEYAEDGVTFSRYTNVSSGPEESANKLAFSGSLV--KRWVEPGKFFR  395

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            E  LK G +MPMPDI+DKMP+RSFLPR I ++LPFS ++  +L+KIFHA + S M K+I 
Sbjct  396  ESKLKKGVVMPMPDIKDKMPERSFLPRVITSKLPFSTSKASDLKKIFHAADNSTMEKIIV  455

Query  62   GTLAECERAPSRDETKRCVT  3
             TLAECERAPSR ETKRCV+
Sbjct  456  DTLAECERAPSRGETKRCVS  475


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 60/133 (45%), Gaps = 20/133 (15%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y     G A  F+ Y  + NV +  F +Y    NG    F  Y+ N N+ D +F NYG  
Sbjct  162  YATKTTGGAGDFSKYAESVNVPNLRFTSYSFQTNGREQNFKGYSVNANSGDQSFSNYGKD  221

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
            GNG  + F+SY   SNV    F+SY + SN              GG D F+ Y      +
Sbjct  222  GNGAENDFSSYGNSSNVIGSEFSSYQRTSN--------------GGQDTFTAY------A  261

Query  404  FNGYGVNNTFKDY  366
            F+G    N F++Y
Sbjct  262  FDGNNPQNNFRNY  274


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 66/150 (44%), Gaps = 20/150 (13%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNY---  594
            YG +  G A  F +Y    N+   +F++Y     G  D F +YAF GN  D +F  Y   
Sbjct  106  YGTDRIGGADVFKNYSPEVNIPVNSFRSYSRHSTGHDDKFHNYAFEGNVVDQSFNTYATK  165

Query  593  ---GAGG--------NGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
               GAG         N P   F SY  ++N    +F  Y   +N+ D  F NYGK  NG 
Sbjct  166  TTGGAGDFSKYAESVNVPNLRFTSYSFQTNGREQNFKGYSVNANSGDQSFSNYGKDGNGA  225

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAKT  357
             + FS Y +S  V      + + F  Y +T
Sbjct  226  ENDFSSYGNSSNV------IGSEFSSYQRT  249


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 70/146 (48%), Gaps = 12/146 (8%)
 Frame = -1

Query  710  SNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVG  531
            S  +D  F NYG    G AD F +Y+   N P N+F++Y     G  D F++Y  E NV 
Sbjct  96   SGYVDRNFTNYGTDRIGGADVFKNYSPEVNIPVNSFRSYSRHSTGHDDKFHNYAFEGNVV  155

Query  530  ADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYS---DSDRVSFNGYGVN-----NTF  375
              SFN+Y  K+      F  Y ++ N    +F+ YS   +    +F GY VN      +F
Sbjct  156  DQSFNTYATKTTGGAGDFSKYAESVNVPNLRFTSYSFQTNGREQNFKGYSVNANSGDQSF  215

Query  374  KDYAKTG----VTFAGYLNATDVTAA  309
             +Y K G      F+ Y N+++V  +
Sbjct  216  SNYGKDGNGAENDFSSYGNSSNVIGS  241


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 57/117 (49%), Gaps = 3/117 (3%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            FT+YG +       FKNY    N   ++F SY+ +    D+ F NY   GN    +FN+Y
Sbjct  103  FTNYGTDRIGGADVFKNYSPEVNIPVNSFRSYSRHSTGHDDKFHNYAFEGNVVDQSFNTY  162

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYS---DSDRVSFNGYG  390
              ++  GA  F+ Y +  N  ++ F +Y    NG    F GYS   +S   SF+ YG
Sbjct  163  ATKTTGGAGDFSKYAESVNVPNLRFTSYSFQTNGREQNFKGYSVNANSGDQSFSNYG  219



>gb|EPS67761.1| polygalacturonase-1 non-catalytic subunit beta, partial [Genlisea 
aurea]
Length=608

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 160/264 (61%), Positives = 192/264 (73%), Gaps = 13/264 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGN AA  F+SYGNNSNV+ + F NYGESGN  +D FTSY  N N P+N FKNY AG
Sbjct  213  YGKNGNDAANSFSSYGNNSNVIGSNFNNYGESGNAGSDNFTSYGENQNVPENNFKNYAAG  272

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNG  D F+SYR ++NVG DSF+SYGK+SN A +GF NYG++FN GTDKF+GY   +   
Sbjct  273  GNGATDAFSSYRDQANVGDDSFDSYGKESNGAKLGFSNYGQSFNEGTDKFTGYGKDATGP  332

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAA----VGAAKGKMVNNKRWVEPGKFF  246
             V F  YGVNNTFK+Y K GVTF+ Y+N T    A       A GK VN  +WVEPGKFF
Sbjct  333  EVDFKIYGVNNTFKEYTKDGVTFSSYVNKTSPEEASLAAAATATGKKVN--KWVEPGKFF  390

Query  245  REKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAV----EGSAM  78
            RE MLK GTIMPMPDIRDKMPKRSFLPR I ++LPFS ++I +++K+F A     + SA+
Sbjct  391  RESMLKPGTIMPMPDIRDKMPKRSFLPRLIVSKLPFSTSKISDIKKLFRAPDDGDDDSAI  450

Query  77   AKMIAGTLAECERAPSRDETKRCV  6
            +KM++  L ECER PS  ETKRCV
Sbjct  451  SKMVSNALRECERKPSPGETKRCV  474


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 57/113 (50%), Gaps = 6/113 (5%)
 Frame = -1

Query  701  MDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADS  522
            +D  F NYG    G AD+F +Y+ N N   +TF+ Y  G  G  D F++Y   SNV   S
Sbjct  94   LDQNFTNYGSKRVGGADSFRNYSENDNVVVDTFRRYSRGSTGHDDGFSAYATSSNVIDQS  153

Query  521  FNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDYA  363
            FN+YG   N  +  F NY    N    +F+ YSD+      G G   TF +Y+
Sbjct  154  FNTYGAGGNGGEGKFSNYNSDVNVPNLRFTSYSDA------GNGRKQTFSEYS  200



>gb|EYU22487.1| hypothetical protein MIMGU_mgv1a002927mg [Erythranthe guttata]
Length=624

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 190/258 (74%), Gaps = 7/258 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGAA GFT+YG  SNVM ++F+NYGE+ NG   TFTSY  + N P+NTF+NYG  
Sbjct  235  YGKNGNGAANGFTNYGKGSNVMASSFENYGETANGGHHTFTSYGDDTNVPENTFRNYGPE  294

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS---D  414
             NG V +F SYR +SN G D+F SYGKKSNAA++GF NYG++FN G+ KF+GY +     
Sbjct  295  ENGAVVSFKSYRNDSNTGQDNFQSYGKKSNAAELGFENYGQSFNDGSSKFTGYGEHAMGQ  354

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLN-ATDVTAAVGAAKGKMVNNKRWV-EPGKFFRE  240
             V F  YG   TFK YAK GVTFA Y N ++    A  AA+GK VN  +WV EPGKFFRE
Sbjct  355  AVDFKVYGQGTTFKQYAKKGVTFASYTNESSPAVVASLAARGKKVN--KWVVEPGKFFRE  412

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
             MLKSG +MPMPDIRDK+PKRSFLPR I ++LPFS ++I E+EKIFHA + S+MA ++  
Sbjct  413  SMLKSGIVMPMPDIRDKLPKRSFLPRAIISKLPFSTSKIREMEKIFHAGQDSSMANILTN  472

Query  59   TLAECERAPSRDETKRCV  6
            TL ECER PS  ETKRCV
Sbjct  473  TLNECERKPSPHETKRCV  490


 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 62/138 (45%), Gaps = 12/138 (9%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYG--  591
            YG    G A  F +Y +  NV+   F+ Y  +     D F +YA + N PD +FK YG  
Sbjct  123  YGTGRLGGADSFKNYSDGGNVVTNNFRRYSRNSTAHTDKFAAYATDTNVPDESFKGYGTT  182

Query  590  -AGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD  414
             A G+G    F SY  ESNV   +F +Y   SN     F  Y    N G  KF+ Y    
Sbjct  183  AAAGDG---QFTSYNDESNVPNLNFAAYSDNSNGRKQTFAEYAGNANHGDQKFTSYGK--  237

Query  413  RVSFNGYGVNNTFKDYAK  360
                NG G  N F +Y K
Sbjct  238  ----NGNGAANGFTNYGK  251


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 57/124 (46%), Gaps = 12/124 (10%)
 Frame = -1

Query  731  FTSYGNNSNVMD-TAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNS  555
            FTSY     ++D   F NYG    G AD+F +Y+  GN   N F+ Y        D F +
Sbjct  110  FTSY-----LLDGQNFTNYGTGRLGGADSFKNYSDGGNVVTNNFRRYSRNSTAHTDKFAA  164

Query  554  YRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTF  375
            Y  ++NV  +SF  YG  + A D  F +Y    N     F+ YSD      N  G   TF
Sbjct  165  YATDTNVPDESFKGYGTTAAAGDGQFTSYNDESNVPNLNFAAYSD------NSNGRKQTF  218

Query  374  KDYA  363
             +YA
Sbjct  219  AEYA  222



>ref|XP_011071083.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Sesamum indicum]
Length=628

 Score =   303 bits (777),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 161/257 (63%), Positives = 184/257 (72%), Gaps = 6/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   FT+YG NSNVM + FKNYGE+GNG  DTFTSY    NNP NTFKNYGA 
Sbjct  240  YGKNGNGATNEFTNYGKNSNVMGSNFKNYGETGNGGNDTFTSYGDETNNPQNTFKNYGAE  299

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD---SD  414
            GN  V++F SYR +SNVG D F SYGK+SNAA + F  Y +    G  KFSGY +   + 
Sbjct  300  GNSAVESFKSYRSDSNVGGDDFRSYGKQSNAAQMDFATYAQDVTDGNTKFSGYGEDASAQ  359

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRW-VEPGKFFREK  237
             V F  Y +N TFK YAK GVTFA Y N +   AA  AAKGK VN  RW VEPGKFFRE+
Sbjct  360  TVDFKQYALNTTFKAYAKEGVTFASYTNESAAAAASLAAKGKKVN--RWAVEPGKFFREE  417

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLKSG++MPMPDIRDKMPKRSFLPR I  +LPFS ++I EL+ IFHA   S+M  M+  +
Sbjct  418  MLKSGSVMPMPDIRDKMPKRSFLPRAIVTKLPFSTSKIDELKNIFHAENDSSMTSMLVNS  477

Query  56   LAECERAPSRDETKRCV  6
            L ECERAPS  ETKRCV
Sbjct  478  LNECERAPSPGETKRCV  494


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 62/151 (41%), Gaps = 20/151 (13%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    FTSY    N+ D +F  YG +  G    F++Y    N P+  F  Y   
Sbjct  156  YSRDAVGHNEKFTSYATEVNMADQSFSGYGTASTGGDGEFSNYNHGVNVPNLRFNEYADN  215

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGK--------------TFNGG  447
             NG    F  Y  + N G  +F SYGK  N A   F NYGK              T NGG
Sbjct  216  SNGRKQIFTEYTTDINAGDQTFTSYGKNGNGATNEFTNYGKNSNVMGSNFKNYGETGNGG  275

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG  354
             D F+ Y D            NTFK+Y   G
Sbjct  276  NDTFTSYGDETN------NPQNTFKNYGAEG  300


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 66/151 (44%), Gaps = 20/151 (13%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYG--  591
            YG +  G    F +Y +  NV+   F+ Y     G  + FTSYA   N  D +F  YG  
Sbjct  128  YGGDRLGGVDSFKNYSDGDNVVSDNFRRYSRDAVGHNEKFTSYATEVNMADQSFSGYGTA  187

Query  590  -AGGNG-----------PVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
              GG+G           P   FN Y   SN     F  Y    NA D  F +YGK  NG 
Sbjct  188  STGGDGEFSNYNHGVNVPNLRFNEYADNSNGRKQIFTEYTTDINAGDQTFTSYGKNGNGA  247

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG  354
            T++F+ Y  +  V      + + FK+Y +TG
Sbjct  248  TNEFTNYGKNSNV------MGSNFKNYGETG  272



>ref|XP_011034135.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=636

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 184/257 (72%), Gaps = 4/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F+ YG  SNV+ + F NYGE+ NG  DTF SY F+GN P N F NYG G
Sbjct  242  YGKNGNGVPNEFSGYGTGSNVIGSDFTNYGETANGANDTFKSYGFDGNVPQNNFVNYGDG  301

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS---D  414
            GN  V +F +YR++SNVG DSF SY K SNA    F NYGK+FN GTDKFSGY +     
Sbjct  302  GNAGVHSFATYREKSNVGDDSFQSYAKNSNAEKANFANYGKSFNEGTDKFSGYGNGAMGQ  361

Query  413  RVSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
            R+ F  YGVN TFKDYA K  VTFAGY +A+   A++      +V N +W+EPGKFFRE 
Sbjct  362  RIGFKIYGVNTTFKDYANKKDVTFAGYTSASTADASMKVTSDSVVKNNKWIEPGKFFRES  421

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G++MPMPDIRDKMPKRSFLPR+I ++LPFS ++I +L++IFHA + S+M ++I   
Sbjct  422  MLKKGSVMPMPDIRDKMPKRSFLPRSIISKLPFSTSKIYQLKEIFHASDNSSMERIILDA  481

Query  56   LAECERAPSRDETKRCV  6
            L ECER+PS  ETKRCV
Sbjct  482  LEECERSPSPGETKRCV  498


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 73/168 (43%), Gaps = 25/168 (15%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG++  G    F++Y   SNV+D +F  YG S  G    F  Y    NNP+  F +Y   
Sbjct  157  YGRDAAGHGETFSNYAPESNVVDQSFNTYGASATGGTGEFKGYNVEVNNPNLRFASYSDS  216

Query  584  GNGPVDTFNSYRQESNVGA-DSFNSYGKK--------------SNAADVGFVNYGKTFNG  450
             NG    F++Y + +N G   +F SYGK               SN     F NYG+T NG
Sbjct  217  ANGKGQKFSTYTENANAGPGQAFTSYGKNGNGVPNEFSGYGTGSNVIGSDFTNYGETANG  276

Query  449  GTDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG----VTFAGYLNATDV  318
              D F  Y       F+G    N F +Y   G     +FA Y   ++V
Sbjct  277  ANDTFKSY------GFDGNVPQNNFVNYGDGGNAGVHSFATYREKSNV  318


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 69/156 (44%), Gaps = 23/156 (15%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G A  F +Y +  N+   +F+ YG    G  +TF++YA   N  D +F  YGA 
Sbjct  129  YGTDRAGGADSFKNYSDGDNIPVDSFRRYGRDAAGHGETFSNYAPESNVVDQSFNTYGAS  188

Query  584  GNG--------------PVDTFNSYRQESNVGADSFNSYGKKSNAAD-VGFVNYGKTFNG  450
              G              P   F SY   +N     F++Y + +NA     F +YGK  NG
Sbjct  189  ATGGTGEFKGYNVEVNNPNLRFASYSDSANGKGQKFSTYTENANAGPGQAFTSYGKNGNG  248

Query  449  GTDKFSGYSDSDRV---SFNGY-----GVNNTFKDY  366
              ++FSGY     V    F  Y     G N+TFK Y
Sbjct  249  VPNEFSGYGTGSNVIGSDFTNYGETANGANDTFKSY  284


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 48/91 (53%), Gaps = 0/91 (0%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG    G AD+F +Y+   N P ++F+ YG    G  +TF++Y  ESNV   SFN+Y
Sbjct  126  FTNYGTDRAGGADSFKNYSDGDNIPVDSFRRYGRDAAGHGETFSNYAPESNVVDQSFNTY  185

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDS  417
            G  +      F  Y    N    +F+ YSDS
Sbjct  186  GASATGGTGEFKGYNVEVNNPNLRFASYSDS  216



>ref|XP_002311777.2| hypothetical protein POPTR_0008s19430g [Populus trichocarpa]
 gb|EEE89144.2| hypothetical protein POPTR_0008s19430g [Populus trichocarpa]
Length=633

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 186/256 (73%), Gaps = 4/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F+ YG +SNV+ + F NYGE+ NG  DTF SY  +GN P N F NYG G
Sbjct  242  YGKNGNGAPNEFSGYGTSSNVVGSDFTNYGETANGANDTFKSYGVDGNVPQNNFVNYGDG  301

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS---D  414
            GN  VD+F +YR++SNVG DSF +Y K SNA    F NYGK+FN GTDKFSGY +     
Sbjct  302  GNAGVDSFATYREKSNVGDDSFQTYAKNSNAEKANFANYGKSFNEGTDKFSGYGNGAMGQ  361

Query  413  RVSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
            ++ F  YGVN TFKDYA K GVTFAGY +A+   A++      +V N +W+EPGKFFRE 
Sbjct  362  QIGFKIYGVNTTFKDYANKKGVTFAGYTSASTADASMKVNSDSVVKNNKWIEPGKFFRES  421

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G++MPMPDIRDKMPKRSFLPR+I ++LPFS ++I +L++IFHA + S+M ++I   
Sbjct  422  MLKKGSVMPMPDIRDKMPKRSFLPRSIISKLPFSTSKIDQLKEIFHASDNSSMERIILDA  481

Query  56   LAECERAPSRDETKRC  9
            L ECER+PS  ETKRC
Sbjct  482  LEECERSPSPGETKRC  497


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 72/160 (45%), Gaps = 23/160 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G A  F +Y +  N+   +F+ YG    G  + F+SYA + N  D +F  YGAG
Sbjct  129  YGTDRAGGADSFKNYSDGDNIPVDSFRRYGRDAAGHGELFSSYAPDSNVVDQSFNTYGAG  188

Query  584  G--------------NGPVDTFNSYRQESNVGADSFNSYGKKSNAAD-VGFVNYGKTFNG  450
                           N P   F SY   +N     F++Y + +NA     F +YGK  NG
Sbjct  189  ATGGAGEFKGYNVEVNNPNLRFVSYSDSANGKGQKFSTYTENANAGPGQAFTSYGKNGNG  248

Query  449  GTDKFSGYSDSDRV---SFNGY-----GVNNTFKDYAKTG  354
              ++FSGY  S  V    F  Y     G N+TFK Y   G
Sbjct  249  APNEFSGYGTSSNVVGSDFTNYGETANGANDTFKSYGVDG  288


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 68/145 (47%), Gaps = 23/145 (16%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG    G AD+F +Y+   N P ++F+ YG    G  + F+SY  +SNV   SFN+Y
Sbjct  126  FSNYGTDRAGGADSFKNYSDGDNIPVDSFRRYGRDAAGHGELFSSYAPDSNVVDQSFNTY  185

Query  509  GK--------------KSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFK  372
            G               + N  ++ FV+Y  + NG   KFS Y+++        G    F 
Sbjct  186  GAGATGGAGEFKGYNVEVNNPNLRFVSYSDSANGKGQKFSTYTENANA-----GPGQAFT  240

Query  371  DYAKTG----VTFAGYLNATDVTAA  309
             Y K G      F+GY  +++V  +
Sbjct  241  SYGKNGNGAPNEFSGYGTSSNVVGS  265



>ref|XP_002266815.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Vitis vinifera]
Length=624

 Score =   300 bits (768),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 183/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKN  G+   FTSYG N+NV+ + F  YG + N   D FTSY F GN P N FK+YG G
Sbjct  237  YGKNSQGSPNEFTSYGENTNVIGSTFTGYGRTANAANDKFTSYGFGGNVPVNNFKSYGDG  296

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  +DTF SYR +SNVG DSF SY K S++A+V F NYG++FN GTD F+GY   +   
Sbjct  297  GNSGIDTFKSYRNQSNVGDDSFRSYAKNSHSAEVNFANYGQSFNEGTDTFTGYGKGATGH  356

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  YGVNNTF DYAK G++F+ Y N +  T    AA G  VN  RW+EPGKFFRE M
Sbjct  357  KIGFKFYGVNNTFTDYAKKGISFSRYTNKSSETMISTAANGSSVN--RWIEPGKFFRESM  414

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+MPMPDIRDKMPKRSFLPR+I+++LPFS +++ E++KIFHA + S+M  M    L
Sbjct  415  LKKGTVMPMPDIRDKMPKRSFLPRSISSKLPFSTSKLEEMKKIFHAADNSSMEHMFTEAL  474

Query  53   AECERAPSRDETKRCV  6
             +CERAPS+ ET+RCV
Sbjct  475  DDCERAPSKGETRRCV  490


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 69/164 (42%), Gaps = 18/164 (11%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F +YG   N MD +F  YG         F  Y+   N P+  F +Y + 
Sbjct  153  YSRDSAGHNDNFDNYGPEGNTMDLSFNGYGSGATRGVGEFKKYSEESNVPNVRFNSYSSD  212

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKS--------------NAADVGFVNYGKTFNGG  447
            GN    +F SY  ESN G   F SYGK S              N     F  YG+T N  
Sbjct  213  GNTRKQSFRSYSTESNAGDQYFTSYGKNSQGSPNEFTSYGENTNVIGSTFTGYGRTANAA  272

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAKTGV-TFAGYLNATDV  318
             DKF+ Y     V  N +    ++ D   +G+ TF  Y N ++V
Sbjct  273  NDKFTSYGFGGNVPVNNF---KSYGDGGNSGIDTFKSYRNQSNV  313


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 64/142 (45%), Gaps = 19/142 (13%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG  G+G    F +Y +   V   +F+ Y     G  D F +Y   GN  D +F  YG+G
Sbjct  127  YGTGGHGGTDSFKNYTDYFPV--DSFRRYSRDSAGHNDNFDNYGPEGNTMDLSFNGYGSG  184

Query  584  G--------------NGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                           N P   FNSY  + N    SF SY  +SNA D  F +YGK   G 
Sbjct  185  ATRGVGEFKKYSEESNVPNVRFNSYSSDGNTRKQSFRSYSTESNAGDQYFTSYGKNSQGS  244

Query  446  TDKFSGYSDSDRV---SFNGYG  390
             ++F+ Y ++  V   +F GYG
Sbjct  245  PNEFTSYGENTNVIGSTFTGYG  266



>ref|XP_010242994.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nelumbo nucifera]
Length=641

 Score =   300 bits (769),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 180/258 (70%), Gaps = 5/258 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG+NGNG   GF+SYG  SNV+ + F  YGE+ NG  D+FTSY F+ NNP N FK+YG G
Sbjct  247  YGRNGNGVPVGFSSYGKESNVVGSTFTAYGETANGANDSFTSYGFDSNNPKNNFKSYGDG  306

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  +D+F+SYR  SNVG DSF SY K SN+A V F NYGK+FN GTD F GY   +   
Sbjct  307  GNAAIDSFSSYRDRSNVGDDSFLSYAKDSNSAKVNFANYGKSFNEGTDTFKGYGKGALGQ  366

Query  413  RVSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRW-VEPGKFFRE  240
             + F  YGVNNTFKDY  K  V+FAGY N +       +      +  RW VEPGKFFRE
Sbjct  367  AIGFKTYGVNNTFKDYGNKKSVSFAGYTNPSSAKTTSSSLVSSGKSPNRWLVEPGKFFRE  426

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
             MLK GT+MPMPDIRDKMP RSFLPR+I ++LPFS++ I EL++IFHA E S M  ++  
Sbjct  427  AMLKEGTVMPMPDIRDKMPPRSFLPRSITSKLPFSSSRISELKQIFHATENSTMEXILRN  486

Query  59   TLAECERAPSRDETKRCV  6
            TL ECERAPSR ETK+CV
Sbjct  487  TLEECERAPSRGETKKCV  504


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 71/145 (49%), Gaps = 8/145 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +   G    F++Y  N NV+D +F  YG S  G +  FT+Y    N P+  F +Y + 
Sbjct  163  YSRGSTGHNDKFSNYAPNGNVVDQSFNTYGSSATGGSGDFTNYNQLVNIPNLRFTSYESD  222

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS---D  414
             NG   +F SY  E+N G +SF SYG+  N   VGF +YGK  N     F+ Y ++    
Sbjct  223  ANGRKQSFTSYTDETNSGDESFTSYGRNGNGVPVGFSSYGKESNVVGSTFTAYGETANGA  282

Query  413  RVSFNGYGVN-----NTFKDYAKTG  354
              SF  YG +     N FK Y   G
Sbjct  283  NDSFTSYGFDSNNPKNNFKSYGDGG  307


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 76/163 (47%), Gaps = 18/163 (11%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F SY N +      F NYG S  G  D+F +Y+ N N P ++F+ Y  G  G  D F++Y
Sbjct  124  FASYSNRN------FTNYGTSQLGGVDSFKNYSDNINVPVDSFRRYSRGSTGHNDKFSNY  177

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY-SDSD--RVSFNGY----  393
                NV   SFN+YG  +      F NY +  N    +F+ Y SD++  + SF  Y    
Sbjct  178  APNGNVVDQSFNTYGSSATGGSGDFTNYNQLVNIPNLRFTSYESDANGRKQSFTSYTDET  237

Query  392  -GVNNTFKDYAKTG----VTFAGYLNATDVTAAVGAAKGKMVN  279
               + +F  Y + G    V F+ Y   ++V  +   A G+  N
Sbjct  238  NSGDESFTSYGRNGNGVPVGFSSYGKESNVVGSTFTAYGETAN  280



>ref|XP_004514684.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
isoform X1 [Cicer arietinum]
 ref|XP_004514685.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
isoform X2 [Cicer arietinum]
Length=630

 Score =   300 bits (768),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 150/260 (58%), Positives = 189/260 (73%), Gaps = 7/260 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    FTSYG +SNV+ + F NY E+ N   D+F +Y  + NNP NTF NY  G
Sbjct  237  YGKNGNGPTEEFTSYGTSSNVVGSGFSNYAETSNAANDSFKAYGVDMNNPTNTFTNYANG  296

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG + TF++YR+ +NVGADSF SY K +NAA VGF NYGK+FN GTD F+ Y+ S    
Sbjct  297  GNGAIQTFSTYRETANVGADSFTSYAKTANAAKVGFNNYGKSFNEGTDIFTSYAKSSNGE  356

Query  413  -RVSFNGYGVNNTFKDYAKTGVTFAGYLNATD-VTAAVGAAKGKMVNN--KRWVEPGKFF  246
              V+F  YGVNNTFK+Y+K GV+FA Y N +  ++A+V   K  +  N  K WVEPGKFF
Sbjct  357  TEVNFKVYGVNNTFKEYSKEGVSFAKYTNVSSTLSASVEEKKNAVSGNLVKNWVEPGKFF  416

Query  245  REKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMI  66
            REKMLK GT+MPMPDIRDKMP+RSFLPR+I A+LPFS ++I E++++F A +  +M KM+
Sbjct  417  REKMLKEGTVMPMPDIRDKMPERSFLPRSILAKLPFSTSKIYEMKRLFKASDNGSMEKMM  476

Query  65   AGTLAECERAPSRDETKRCV  6
              +L ECER PSR ETKRCV
Sbjct  477  RDSLGECERVPSRGETKRCV  496


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 81/174 (47%), Gaps = 12/174 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    FT+Y  + NV+D +F  YG    G A  F +YA   N P+  F +Y   
Sbjct  153  YSRDSAGHKDSFTNYAKDGNVVDQSFHTYGAGATGGAGEFNNYAEETNVPNLVFTSYSDD  212

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV-  408
             NG   +F SY +  N G  SF+SYGK  N     F +YG + N     FS Y+++    
Sbjct  213  SNGRKQSFTSYSENGNAGEQSFSSYGKNGNGPTEEFTSYGTSSNVVGSGFSNYAETSNAA  272

Query  407  --SFNGYGVN-----NTFKDYAKTG----VTFAGYLNATDVTAAVGAAKGKMVN  279
              SF  YGV+     NTF +YA  G     TF+ Y    +V A    +  K  N
Sbjct  273  NDSFKAYGVDMNNPTNTFTNYANGGNGAIQTFSTYRETANVGADSFTSYAKTAN  326


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 56/124 (45%), Gaps = 8/124 (6%)
 Frame = -1

Query  701  MDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADS  522
             D  F NYG S  G  D+F +Y+   N P N F+ Y     G  D+F +Y ++ NV   S
Sbjct  118  QDKNFTNYGTSRPGGVDSFKNYSDGENIPVNDFRRYSRDSAGHKDSFTNYAKDGNVVDQS  177

Query  521  FNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---RVSFNGYGVN-----NTFKDY  366
            F++YG  +      F NY +  N     F+ YSD     + SF  Y  N      +F  Y
Sbjct  178  FHTYGAGATGGAGEFNNYAEETNVPNLVFTSYSDDSNGRKQSFTSYSENGNAGEQSFSSY  237

Query  365  AKTG  354
             K G
Sbjct  238  GKNG  241



>ref|XP_007044636.1| Polygalacturonase 2 [Theobroma cacao]
 gb|EOY00468.1| Polygalacturonase 2 [Theobroma cacao]
Length=682

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 183/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F+SYG  +NV+ + F  YGES NG  DTFTSY F+ N P NTFK+YG G
Sbjct  294  YGKNGNGVPNDFSSYGKGANVVGSGFSGYGESANGANDTFTSYGFDSNVPLNTFKSYGDG  353

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VD+F+SYR +SNVG DSF SY K SNAA V F NYG++FN GTDKF+GY   ++  
Sbjct  354  GNAAVDSFSSYRDQSNVGDDSFQSYAKNSNAAKVDFNNYGQSFNEGTDKFTGYGQGAEGQ  413

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             + F  YG N TFKDY K GV+F  Y N +    A   A    VN  +WVEPGKFFREKM
Sbjct  414  SIGFKIYGRNTTFKDYTKKGVSFGRYNNESSAETAQVKASVSAVN--KWVEPGKFFREKM  471

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDIRDKMP+RSFLPR I ++LPFS+++IGEL++IFHA + S +  ++   L
Sbjct  472  LKRGTVLPMPDIRDKMPERSFLPRTIVSKLPFSSSKIGELKRIFHAGDNSTLETVMLDAL  531

Query  53   AECERAPSRDETKRCV  6
             ECERAPS  ETKRCV
Sbjct  532  KECERAPSAGETKRCV  547



>gb|KFK41456.1| hypothetical protein AALP_AA2G132700 [Arabis alpina]
Length=617

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 185/256 (72%), Gaps = 6/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYG ++NV+ + F NYGESGN   DTFTSY  +GN P N FKNYGA 
Sbjct  231  YGKNGNGLPNEFASYGVSANVIGSGFANYGESGNAANDTFTSYGSDGNVPQNNFKNYGAE  290

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR  +NVG DSF SY K SNA  V FVNYG++FN G++ F+ Y   + + 
Sbjct  291  GNSAVDTFTNYRDAANVGDDSFTSYAKDSNAEKVNFVNYGQSFNPGSETFTSYGKEAVNH  350

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++SF  Y  N+TFKDYAK+GV F+ Y N +  +A  G  +GK VN  +W+EPGKFFRE +
Sbjct  351  KISFKTYTPNSTFKDYAKSGVGFSKY-NVSSSSATAGMGEGKTVN--KWIEPGKFFRESV  407

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDI+DKMPKRSFLPR+I  +LPFS ++IGE++KIFHA E S M  +I   +
Sbjct  408  LKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSTSKIGEIKKIFHAGENSTMGNIITEAV  467

Query  53   AECERAPSRDETKRCV  6
             ECERAPS  ETKRCV
Sbjct  468  TECERAPSVGETKRCV  483


 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 58/123 (47%), Gaps = 11/123 (9%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G  D+F +Y+ +GN   ++F+ YG       + F  Y + SNV  ++FNSY
Sbjct  115  FTNYGNARAGGTDSFKAYSKDGNVVTDSFRRYGRNAAAHDEKFTVYAEGSNVVEENFNSY  174

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY-----AKTGVTF  345
            G         F NY    N  T +F+ YSDS      G G   +FK Y     A  G +F
Sbjct  175  GTGGTGGAGEFTNYQNGVNNPTSRFTAYSDS------GNGKTQSFKTYTHEANAGEGQSF  228

Query  344  AGY  336
              Y
Sbjct  229  TSY  231



>gb|AAL08244.1| At1g70370/F17O7_9 [Arabidopsis thaliana]
 gb|AAN18083.1| At1g70370/F17O7_9 [Arabidopsis thaliana]
Length=517

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 184/256 (72%), Gaps = 7/256 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    FTSYG +SNV+ + F NYGESGN   DTFTSY  +GN P N F NYGA 
Sbjct  241  YGKNGNGVPNEFTSYGVSSNVIGSGFSNYGESGNAANDTFTSYGSDGNVPQNNFNNYGAS  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR ++NVG DSF+SY K SN+  V FVNYG++FN G++ F+GY   ++  
Sbjct  301  GNAAVDTFANYRDKANVGDDSFSSYAKDSNSEKVNFVNYGQSFNPGSETFTGYGKGAEGS  360

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++SF  Y  N+TFKDYAK GV FA Y  +T     VG   GK VN  +W+EPGKFFRE  
Sbjct  361  KLSFKTYTPNSTFKDYAKKGVAFAKYNVSTTTANTVG--DGKTVN--KWIEPGKFFRESS  416

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDI+DKMPKRSFLPR+I  +LPFS +++GE+++IFHAVE S M  +I   +
Sbjct  417  LKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAVENSTMGGIITDAV  476

Query  53   AECERAPSRDETKRCV  6
             ECER PS  ETKRCV
Sbjct  477  TECERPPSVGETKRCV  492


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 75/156 (48%), Gaps = 23/156 (15%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +N  G    FT YG NSNV++  F +YG  G G A  FT+Y  N NNP + F  Y  G
Sbjct  156  YSRNAAGHDDKFTVYGENSNVVEEGFNSYGTFGTGGAGDFTNYQNNVNNPTSRFTAYSDG  215

Query  584  GNGPVDTFNSYRQESNVG---------------ADSFNSYGKKSNAADVGFVNYGKTFNG  450
            GNG   TF +Y  E+N G                + F SYG  SN    GF NYG++ N 
Sbjct  216  GNGRSQTFKTYTHEANAGNGQSFTSYGKNGNGVPNEFTSYGVSSNVIGSGFSNYGESGNA  275

Query  449  GTDKFSGYSDSDRV---SFNGYGVN-----NTFKDY  366
              D F+ Y     V   +FN YG +     +TF +Y
Sbjct  276  ANDTFTSYGSDGNVPQNNFNNYGASGNAAVDTFANY  311


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 58/123 (47%), Gaps = 11/123 (9%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G AD+F +Y+ +GN   ++F+ Y     G  D F  Y + SNV  + FNSY
Sbjct  125  FTNYGNARAGGADSFKNYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGENSNVVEEGFNSY  184

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY-----AKTGVTF  345
            G         F NY    N  T +F+ YSD       G G + TFK Y     A  G +F
Sbjct  185  GTFGTGGAGDFTNYQNNVNNPTSRFTAYSDG------GNGRSQTFKTYTHEANAGNGQSF  238

Query  344  AGY  336
              Y
Sbjct  239  TSY  241



>ref|XP_002314620.2| hypothetical protein POPTR_0010s05000g [Populus trichocarpa]
 gb|EEF00791.2| hypothetical protein POPTR_0010s05000g [Populus trichocarpa]
Length=633

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/257 (57%), Positives = 186/257 (72%), Gaps = 4/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F+ YG +SNV+ + F NYGE+GNG +DTF +Y  +GN P+N +KNYG G
Sbjct  241  YGKNGNGVPNEFSGYGKSSNVIGSDFSNYGEAGNGASDTFKTYGVDGNVPENNYKNYGDG  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNG VD+F +YR++SNVG DSF SY K SNA    FVNYGK+FN GTDKF+GY   +   
Sbjct  301  GNGGVDSFANYREKSNVGDDSFQSYAKNSNAQKADFVNYGKSFNEGTDKFTGYGKGAVGQ  360

Query  413  RVSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
            ++ F  YGVN TFKDYA K  VTF+ Y NA    A++        N  +WVEPGKFFRE 
Sbjct  361  QIGFKIYGVNTTFKDYARKKDVTFSKYTNAGTADASMKVTSDSSANKNKWVEPGKFFRES  420

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G+ MPMPDIRDKMPKRSFLPR+I +++PFS +++G +++IFHA + S+M ++I   
Sbjct  421  MLKEGSEMPMPDIRDKMPKRSFLPRSIISKIPFSTSKMGLIKEIFHASDNSSMERIILDA  480

Query  56   LAECERAPSRDETKRCV  6
            + ECERAPS  ETKRCV
Sbjct  481  VEECERAPSPGETKRCV  497


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 66/137 (48%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG++  G    F++Y   +NV D +F  YG    G    F  Y    N PD  F +Y  G
Sbjct  157  YGRDAAGHDETFSNYAPETNVADQSFNTYGAGATGGTGEFKGYNVRINKPDLRFVSYSDG  216

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
             NG    F++Y +++N G ++F SYGK  N     F  YGK+ N     FS Y ++    
Sbjct  217  ANGKGQKFSTYTEDANAGDEAFTSYGKNGNGVPNEFSGYGKSSNVIGSDFSNYGEA----  272

Query  404  FNGYGVNNTFKDYAKTG  354
              G G ++TFK Y   G
Sbjct  273  --GNGASDTFKTYGVDG  287


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 64/133 (48%), Gaps = 22/133 (17%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG    G AD+F +Y+   N P ++F+ YG    G  +TF++Y  E+NV   SFN+Y
Sbjct  126  FTNYGTGRAGGADSFKNYSDGVNLPVDSFRRYGRDAAGHDETFSNYAPETNVADQSFNTY  185

Query  509  GK--------------KSNAADVGFVNYGKTFNGGTDKFSGYS------DSDRVSF--NG  396
            G               + N  D+ FV+Y    NG   KFS Y+      D    S+  NG
Sbjct  186  GAGATGGTGEFKGYNVRINKPDLRFVSYSDGANGKGQKFSTYTEDANAGDEAFTSYGKNG  245

Query  395  YGVNNTFKDYAKT  357
             GV N F  Y K+
Sbjct  246  NGVPNEFSGYGKS  258



>ref|XP_010251282.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nelumbo nucifera]
Length=639

 Score =   296 bits (758),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/257 (58%), Positives = 178/257 (69%), Gaps = 4/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG NGNG    F SYG +SNVM ++FK YGE GNG  D+FTSY  NGN P+N F +YG G
Sbjct  249  YGNNGNGLPLEFKSYGKDSNVMGSSFKAYGEEGNGANDSFTSYGVNGNVPENKFVSYGDG  308

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VD+F++YR +SNVG DSF SY K SN+A V F NYGK+FN G+D F GY   +   
Sbjct  309  GNAGVDSFSTYRDQSNVGDDSFQSYAKNSNSAKVNFANYGKSFNEGSDTFKGYGKGAVGQ  368

Query  413  RVSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             + F  YGVNNTFKDY  K  ++FA Y N +   A       K   NK   EPGKFFRE 
Sbjct  369  AIGFKTYGVNNTFKDYDNKKAISFAAYTNPSSAKATSSLVGSKKPTNKWLAEPGKFFRES  428

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G +MPMPDIRDKMP RSFLPR+I ++LPFS++ I EL++IFHA E S M +++  T
Sbjct  429  MLKEGIVMPMPDIRDKMPPRSFLPRSITSKLPFSSSRISELKQIFHAAENSTMERVLQNT  488

Query  56   LAECERAPSRDETKRCV  6
            L ECERAPSR ETK+CV
Sbjct  489  LEECERAPSRGETKKCV  505



>ref|XP_011009539.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=633

 Score =   295 bits (756),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/257 (57%), Positives = 186/257 (72%), Gaps = 4/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F+ YG +SNV+ + F NYGE+GNG +DTF +Y  +GN P+N +KNYG G
Sbjct  241  YGKNGNGVPNEFSGYGKSSNVIGSDFSNYGEAGNGASDTFKTYGVDGNVPENNYKNYGDG  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNG VD+F +YR++SNVG DSF SY K SNA    FVNYGK+FN GTDKF+GY   +   
Sbjct  301  GNGGVDSFANYREKSNVGDDSFQSYAKNSNAQKADFVNYGKSFNEGTDKFTGYGKGAVGQ  360

Query  413  RVSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
            ++ F  YGVN TFK+YA K  VTF+ Y NA    A++        N  +WVEPGKFFRE 
Sbjct  361  QIGFKIYGVNTTFKEYARKKDVTFSKYTNAGTADASMKVTSDSSANKNKWVEPGKFFRES  420

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G+ MPMPDIRDKMPKRSFLPR+I +++PFS +++G +++IFHA + S+M ++I   
Sbjct  421  MLKEGSEMPMPDIRDKMPKRSFLPRSIISKIPFSTSKMGLIKEIFHASDNSSMERIILDA  480

Query  56   LAECERAPSRDETKRCV  6
            + ECERAPS  ETKRCV
Sbjct  481  VEECERAPSPGETKRCV  497


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 66/137 (48%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG++  G    F++Y   +NV D +F  YG    G    F  Y    N PD  F +Y  G
Sbjct  157  YGRDAAGHDETFSNYAPETNVADQSFNTYGAGATGGTGEFKGYNVRINKPDLRFVSYSDG  216

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
             NG    F++Y +++N G ++F SYGK  N     F  YGK+ N     FS Y ++    
Sbjct  217  ANGKGQKFSTYTEDANAGDEAFTSYGKNGNGVPNEFSGYGKSSNVIGSDFSNYGEA----  272

Query  404  FNGYGVNNTFKDYAKTG  354
              G G ++TFK Y   G
Sbjct  273  --GNGASDTFKTYGVDG  287


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 66/137 (48%), Gaps = 22/137 (16%)
 Frame = -1

Query  701  MDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADS  522
            ++  F NYG    G AD+F +Y+   N P ++F+ YG    G  +TF++Y  E+NV   S
Sbjct  122  LNKNFTNYGTGRAGGADSFKNYSDGINLPVDSFRRYGRDAAGHDETFSNYAPETNVADQS  181

Query  521  FNSYGK--------------KSNAADVGFVNYGKTFNGGTDKFSGYS------DSDRVSF  402
            FN+YG               + N  D+ FV+Y    NG   KFS Y+      D    S+
Sbjct  182  FNTYGAGATGGTGEFKGYNVRINKPDLRFVSYSDGANGKGQKFSTYTEDANAGDEAFTSY  241

Query  401  --NGYGVNNTFKDYAKT  357
              NG GV N F  Y K+
Sbjct  242  GKNGNGVPNEFSGYGKS  258



>gb|KDO82433.1| hypothetical protein CISIN_1g036311mg [Citrus sinensis]
Length=632

 Score =   295 bits (756),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 183/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKN NGA   FT YG  +NV+ + F NYGE  NG  D+FTSY  +GN P+N F NYGAG
Sbjct  245  YGKNANGAPNAFTGYGKETNVIGSGFSNYGEGANGANDSFTSYGEDGNVPNNRFNNYGAG  304

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
            GN  V++F++YR ++NVG DSF SYGK S +  V F NYG +FN GTD F GY ++ R  
Sbjct  305  GNAAVESFSNYRDQANVGDDSFQSYGKDSKSGKVNFANYGNSFNEGTDVFKGYGEAARGQ  364

Query  410  -VSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             V F  YGVNNTFKDYAK GVTFA Y N +     +    G ++N  RWVEPGKFFRE +
Sbjct  365  TVGFKMYGVNNTFKDYAKNGVTFAKYNNDSSGVQNIKKPSGSLLN--RWVEPGKFFRESV  422

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK G++M MPDI+DKMPKRSFLPR I ++LPFS+++I ++++IFHAV+ S+M  +I   L
Sbjct  423  LKKGSVMAMPDIQDKMPKRSFLPRTIVSKLPFSSSKIKDMKEIFHAVDNSSMESIIKEAL  482

Query  53   AECERAPSRDETKRCV  6
             +CERAPS  ETKRCV
Sbjct  483  GDCERAPSAGETKRCV  498


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 70/159 (44%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G A  F +Y +  N+   +F+ Y     G  D F++YA   N  D +F  YGA 
Sbjct  133  YGTSRVGGADSFKNYSDGDNLPVDSFRRYSRDAVGHQDKFSNYAPGSNVADQSFNTYGAS  192

Query  584  G--------------NGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                           N P   F SY  E N  A SF +Y +K+N+    F NYGK  NG 
Sbjct  193  ASGGAGSFKNYNEEVNVPHLRFTSYASEGNGRAHSFTAYAEKTNSGSEEFANYGKNANGA  252

Query  446  TDKFSGYSDSDRVSFNGY--------GVNNTFKDYAKTG  354
             + F+GY     V  +G+        G N++F  Y + G
Sbjct  253  PNAFTGYGKETNVIGSGFSNYGEGANGANDSFTSYGEDG  291



>ref|XP_003517743.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=629

 Score =   295 bits (755),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 187/262 (71%), Gaps = 11/262 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    FTSYG  SNV+ + F NY E+ N   DTF  Y  + NNP NTF NY  G
Sbjct  236  YGKNGNGPTNVFTSYGTESNVVGSGFSNYVETANAANDTFKGYGVDMNNPTNTFSNYAGG  295

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG V+ F+SYR ++NVGADSF SY K +NAAD+GF NYGK+FN GTD F+ Y+ S    
Sbjct  296  GNGAVERFSSYRDKANVGADSFTSYAKSANAADIGFSNYGKSFNEGTDTFTSYAKSSDGE  355

Query  413  -RVSFNGYGVNNTFKDYAKTG--VTFAGYLN---ATDVTAAVGAAKGKMVNNKRWVEPGK  252
             +V F  YGVNNTFKDY K G  V+FA Y N       +A+  +  G  VN  +WVEPGK
Sbjct  356  TKVGFTSYGVNNTFKDYEKKGTTVSFARYTNISTTLSASASASSLSGSFVN--KWVEPGK  413

Query  251  FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAK  72
            FFREKMLK GT+MPMPDI+DK+P+RSFLPR+I ++LPFS ++I EL+++F A +  +M K
Sbjct  414  FFREKMLKEGTVMPMPDIKDKLPERSFLPRSILSKLPFSVSKIDELKQVFKASDNGSMEK  473

Query  71   MIAGTLAECERAPSRDETKRCV  6
            M+  +LAECERAPSR ETKRCV
Sbjct  474  MMRDSLAECERAPSRGETKRCV  495


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 64/170 (38%), Gaps = 36/170 (21%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNT-------  606
            YG    G    F +Y    N+    F+ Y     G  D F SY  +GN    +       
Sbjct  124  YGTGRPGGLDSFKNYSEGENIPVNDFRRYSRDSAGHKDGFLSYGTSGNVVQQSFHTYAAG  183

Query  605  -------FKNYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                   FK Y    N P   F SY   +N    SF SY +  NA +  F +YGK  NG 
Sbjct  184  ATGGAGEFKRYADETNVPNLGFTSYSDNANGRTQSFTSYSENGNAGEQTFTSYGKNGNGP  243

Query  446  TDKFSGYSDSDRV-----------------SFNGYGVN-----NTFKDYA  363
            T+ F+ Y     V                 +F GYGV+     NTF +YA
Sbjct  244  TNVFTSYGTESNVVGSGFSNYVETANAANDTFKGYGVDMNNPTNTFSNYA  293


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 54/129 (42%), Gaps = 20/129 (16%)
 Frame = -1

Query  698  DTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSF  519
            D  F NYG    G  D+F +Y+   N P N F+ Y     G  D F SY    NV   SF
Sbjct  118  DKNFTNYGTGRPGGLDSFKNYSEGENIPVNDFRRYSRDSAGHKDGFLSYGTSGNVVQQSF  177

Query  518  NS--------------YGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNN  381
            ++              Y  ++N  ++GF +Y    NG T  F+ YS+      NG     
Sbjct  178  HTYAAGATGGAGEFKRYADETNVPNLGFTSYSDNANGRTQSFTSYSE------NGNAGEQ  231

Query  380  TFKDYAKTG  354
            TF  Y K G
Sbjct  232  TFTSYGKNG  240



>ref|XP_006438394.1| hypothetical protein CICLE_v10030947mg [Citrus clementina]
 ref|XP_006483846.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Citrus sinensis]
 gb|ESR51634.1| hypothetical protein CICLE_v10030947mg [Citrus clementina]
Length=632

 Score =   295 bits (755),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 183/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKN NGA   FT YG  +NV+ + F NYGE  NG  D+FTSY  +GN P+N F NYGAG
Sbjct  245  YGKNANGAPNAFTGYGKETNVIGSGFSNYGEGANGANDSFTSYGEDGNVPNNRFNNYGAG  304

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
            GN  V++F++YR ++NVG DSF SYGK S +  V F NYG +FN GTD F GY ++ R  
Sbjct  305  GNAAVESFSNYRDQANVGDDSFQSYGKDSKSGKVNFANYGNSFNEGTDVFKGYGEAARGQ  364

Query  410  -VSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             V F  YGVNNTFKDYAK GVTFA Y N +     +    G ++N  RWVEPGKFFRE +
Sbjct  365  TVGFKMYGVNNTFKDYAKNGVTFAKYNNDSSGVQNIKKPSGSLLN--RWVEPGKFFRESV  422

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK G++M MPDI+DKMPKRSFLPR I ++LPFS+++I ++++IFHAV+ S+M  +I   L
Sbjct  423  LKKGSVMAMPDIQDKMPKRSFLPRTIVSKLPFSSSKIKDMKEIFHAVDNSSMESIIKEAL  482

Query  53   AECERAPSRDETKRCV  6
             +CERAPS  ETKRCV
Sbjct  483  GDCERAPSAGETKRCV  498


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 70/159 (44%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G A  F +Y +  N+   +F+ Y     G  D F++YA   N  D +F  YGA 
Sbjct  133  YGTSRVGGADSFKNYSDGDNLPVDSFRRYSRDAVGHHDKFSNYAPGSNVADQSFNTYGAS  192

Query  584  G--------------NGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                           N P   F SY  E N  A SF +Y +K+N+    F NYGK  NG 
Sbjct  193  ASGGAGSFKNYNEEVNVPHLRFTSYASEGNGRAHSFTTYAEKTNSGSEEFANYGKNANGA  252

Query  446  TDKFSGYSDSDRVSFNGY--------GVNNTFKDYAKTG  354
             + F+GY     V  +G+        G N++F  Y + G
Sbjct  253  PNAFTGYGKETNVIGSGFSNYGEGANGANDSFTSYGEDG  291



>ref|NP_177194.1| polygalacturonase 2 [Arabidopsis thaliana]
 ref|NP_001185361.1| polygalacturonase 2 [Arabidopsis thaliana]
 sp|P92990.2|JP650_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
JP650; AltName: Full=Aromatic-rich glycoprotein JP650; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC18803.1| Identical to polygalacuronase isoenzyme 1 beta subunit homolog 
mRNA gb|U63373. EST gb|AA404878 comes from this gene [Arabidopsis 
thaliana]
 dbj|BAE98965.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35050.1| polygalacturonase 2 [Arabidopsis thaliana]
 gb|AEE35051.1| polygalacturonase 2 [Arabidopsis thaliana]
Length=626

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 184/256 (72%), Gaps = 7/256 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    FTSYG +SNV+ + F NYGESGN   DTFTSY  +GN P N F NYGA 
Sbjct  241  YGKNGNGVPNEFTSYGVSSNVIGSGFSNYGESGNAANDTFTSYGSDGNVPQNNFNNYGAS  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR ++NVG DSF+SY K SN+  V FVNYG++FN G++ F+GY   ++  
Sbjct  301  GNAAVDTFANYRDKANVGDDSFSSYAKDSNSEKVNFVNYGQSFNPGSETFTGYGKGAEGS  360

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++SF  Y  N+TFKDYAK GV FA Y  +T     VG   GK VN  +W+EPGKFFRE  
Sbjct  361  KLSFKTYTPNSTFKDYAKKGVAFAKYNVSTTTANTVG--DGKTVN--KWIEPGKFFRESS  416

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDI+DKMPKRSFLPR+I  +LPFS +++GE+++IFHAVE S M  +I   +
Sbjct  417  LKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAVENSTMGGIITDAV  476

Query  53   AECERAPSRDETKRCV  6
             ECER PS  ETKRCV
Sbjct  477  TECERPPSVGETKRCV  492


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 75/156 (48%), Gaps = 23/156 (15%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +N  G    FT YG NSNV++  F +YG  G G A  FT+Y  N NNP + F  Y  G
Sbjct  156  YSRNAAGHDDKFTVYGENSNVVEEGFNSYGTFGTGGAGDFTNYQNNVNNPTSRFTAYSDG  215

Query  584  GNGPVDTFNSYRQESNVG---------------ADSFNSYGKKSNAADVGFVNYGKTFNG  450
            GNG   TF +Y  E+N G                + F SYG  SN    GF NYG++ N 
Sbjct  216  GNGRSQTFKTYTHEANAGNGQSFTSYGKNGNGVPNEFTSYGVSSNVIGSGFSNYGESGNA  275

Query  449  GTDKFSGYSDSDRV---SFNGYGVN-----NTFKDY  366
              D F+ Y     V   +FN YG +     +TF +Y
Sbjct  276  ANDTFTSYGSDGNVPQNNFNNYGASGNAAVDTFANY  311


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 58/123 (47%), Gaps = 11/123 (9%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G AD+F +Y+ +GN   ++F+ Y     G  D F  Y + SNV  + FNSY
Sbjct  125  FTNYGNARAGGADSFKNYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGENSNVVEEGFNSY  184

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY-----AKTGVTF  345
            G         F NY    N  T +F+ YSD       G G + TFK Y     A  G +F
Sbjct  185  GTFGTGGAGDFTNYQNNVNNPTSRFTAYSDG------GNGRSQTFKTYTHEANAGNGQSF  238

Query  344  AGY  336
              Y
Sbjct  239  TSY  241



>gb|KHG01313.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=616

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 182/256 (71%), Gaps = 10/256 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    FTSYG +SNVM + F  YG++ NG  DTFTSYAF+ NNP N FK+YG G
Sbjct  233  YGKNGNGVPNDFTSYGKDSNVMGSDFSGYGKTANGAKDTFTSYAFDSNNPVNGFKSYGDG  292

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VD+F+SYR +SNVG  SF SY K SN A V F NYG++FN GT+KF+GY   +D  
Sbjct  293  GNAAVDSFSSYRDQSNVGDSSFQSYAKSSNGAKVDFDNYGQSFNEGTEKFTGYGQGADGQ  352

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             + F  YG N TFKDY K GVTF+ Y N +  T       GK+V +K WVEPGKFFREKM
Sbjct  353  SIGFKIYGRNTTFKDYTKKGVTFSRYSNESSTTL------GKVVISK-WVEPGKFFREKM  405

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK G ++PMPDI+DKMP RSFLPR I +++PFS++EI +L++IFHA + S +  ++   L
Sbjct  406  LKRGMVIPMPDIKDKMPARSFLPRTILSKIPFSSSEIDQLKRIFHAGDNSTLGTIMLDAL  465

Query  53   AECERAPSRDETKRCV  6
             ECER PS  ETKRCV
Sbjct  466  KECERLPSPGETKRCV  481


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 63/147 (43%), Gaps = 10/147 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +       F +Y  N NV+  +F+ Y     G  D F++YA   N  D +F  YG  
Sbjct  121  YGSDRLAGLDSFKNYSENDNVVIDSFRRYSRDSAGHKDQFSNYASASNVVDQSFNTYGGD  180

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
              G  + FN+Y  E NV    F SY   SN     F +Y +  N G   FS Y       
Sbjct  181  ATGGSENFNNYNHEVNVPNLRFTSYSDDSNGHGQTFTHYTEETNAGQQSFSNYGK-----  235

Query  404  FNGYGVNNTFKDYAK----TGVTFAGY  336
             NG GV N F  Y K     G  F+GY
Sbjct  236  -NGNGVPNDFTSYGKDSNVMGSDFSGY  261



>ref|XP_002525383.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
 gb|EEF37021.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
Length=631

 Score =   293 bits (751),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 183/259 (71%), Gaps = 8/259 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG  T F  YG NSNV+ + F NYGE+ N + D FTSY FNGN P+N FKNYGAG
Sbjct  241  YGKNGNGVPTNFKGYGENSNVIGSDFNNYGETANAEFDNFTSYGFNGNVPENKFKNYGAG  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNG    F SYR +SNVG DSF SY K+SN  +V F NYGK+FN GTD F GY   +++ 
Sbjct  301  GNGGGSGFTSYRDQSNVGDDSFQSYAKESNGQEVNFNNYGKSFNEGTDTFKGYGQGANAH  360

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAA---VGAAKGKMVNNKRWVEPGKFFR  243
            ++ F  YGVNNTFK+YAK GV+FA Y N T   +A      A G +VN  RWVEPGKFFR
Sbjct  361  KIGFKMYGVNNTFKEYAKLGVSFAKYTNITATPSAETTAMKASGSLVN--RWVEPGKFFR  418

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            E  LK GT+MPMPDIRDKMPKRSFLPR+I ++LPFS +   +L++ FHA + S M  ++ 
Sbjct  419  ESKLKKGTVMPMPDIRDKMPKRSFLPRSITSKLPFSTSNFAQLKQTFHAFDNSTMETLML  478

Query  62   GTLAECERAPSRDETKRCV  6
              L ECERAPS  ETKRC+
Sbjct  479  DALTECERAPSPGETKRCI  497



>ref|XP_003519820.2| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=628

 Score =   293 bits (751),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 184/259 (71%), Gaps = 7/259 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYG  SNV+ + F NY E+ N   DTF  Y  + NNP NTF NY AG
Sbjct  237  YGKNGNGPTNVFASYGTESNVVGSGFSNYAETANAANDTFKGYGIDMNNPTNTFSNYAAG  296

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG V+ F+SYR ++NVGADSF SY K +NAAD+GF NYGK+FN GTD F+ Y+ S    
Sbjct  297  GNGAVERFSSYRDKANVGADSFTSYAKAANAADIGFSNYGKSFNEGTDTFTTYAKSSDGE  356

Query  413  -RVSFNGYGVNNTFKDYAKTG--VTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFR  243
             +V F  YGVNNTFKDY K G  V+FA Y N +   +   ++    + NK WVEPGKFFR
Sbjct  357  TKVGFTSYGVNNTFKDYEKKGTTVSFARYTNISTTLSVSASSVSGSLVNK-WVEPGKFFR  415

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            EKM+K GT+MPMPDI+DKMP+RSFLPR+I ++LPFS ++I EL+++F A +  +M KM+ 
Sbjct  416  EKMMKEGTVMPMPDIKDKMPERSFLPRSILSKLPFSVSKIDELKQVFKASDNGSMEKMMK  475

Query  62   GTLAECERAPSRDETKRCV  6
             +L ECERAPS  ETKRCV
Sbjct  476  DSLEECERAPSSGETKRCV  494


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 54/129 (42%), Gaps = 20/129 (16%)
 Frame = -1

Query  698  DTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSF  519
            D  F NYG    G  D+F +Y+   N P N F+ Y     G  D F SY    NV   SF
Sbjct  119  DNNFTNYGTGRPGGLDSFKNYSEGENIPVNDFRRYSRDSAGHKDGFLSYGTNGNVVQQSF  178

Query  518  NS--------------YGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNN  381
            ++              Y  ++N  ++GF +Y    NG T  FS YS+      NG     
Sbjct  179  HTYAAGATGGTGEFKHYADETNVPNLGFTSYSDNANGRTQSFSSYSE------NGNAGEQ  232

Query  380  TFKDYAKTG  354
            TF  Y K G
Sbjct  233  TFTSYGKNG  241



>ref|XP_002888771.1| hypothetical protein ARALYDRAFT_894840 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65030.1| hypothetical protein ARALYDRAFT_894840 [Arabidopsis lyrata subsp. 
lyrata]
Length=626

 Score =   293 bits (750),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 186/256 (73%), Gaps = 7/256 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F SYG +SNV+ + F NYGESGN   DTFTSY  +GN P N FKNYGA 
Sbjct  241  YGKNGNGAPNEFASYGVSSNVIGSGFSNYGESGNAANDTFTSYGSDGNVPQNNFKNYGAS  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR ++NVG DSF+SY K SN+  V FVNYG++FN G++ F+GY   ++ +
Sbjct  301  GNAAVDTFANYRDKANVGDDSFSSYAKDSNSEKVNFVNYGQSFNPGSETFTGYGKGAEGN  360

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++SF  Y  N+TFKDY K GV FA Y NA+ +TA      GK VN  +W+EPGKFFRE  
Sbjct  361  KISFKTYTPNSTFKDYTKNGVAFAKY-NASTITANT-VGDGKTVN--KWIEPGKFFRESS  416

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDI+DKMPKRSFLPR+I  +LPFS +++GE+++IFHA E S M  +I   +
Sbjct  417  LKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAGENSTMEGIITDAV  476

Query  53   AECERAPSRDETKRCV  6
             ECER PS  ETKRCV
Sbjct  477  TECERPPSVGETKRCV  492


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 84/162 (52%), Gaps = 13/162 (8%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +N  G    FT YG+NSNV++  F +YG  G G A  FT+Y  N NNP + F  Y  G
Sbjct  156  YSRNAAGHDDKFTVYGDNSNVVEEGFNSYGTFGTGGAGVFTNYQNNVNNPTSRFTAYSDG  215

Query  584  GNGPVDTFNSYRQESNVG-ADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV  408
            GNG   +F +Y  ++N G   SF+SYGK  N A   F +YG + N     FS Y +S   
Sbjct  216  GNGRSQSFKTYTHDANAGNGQSFSSYGKNGNGAPNEFASYGVSSNVIGSGFSNYGESGNA  275

Query  407  ---SFNGYGVN-----NTFKDYAKTG----VTFAGYLNATDV  318
               +F  YG +     N FK+Y  +G     TFA Y +  +V
Sbjct  276  ANDTFTSYGSDGNVPQNNFKNYGASGNAAVDTFANYRDKANV  317


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 58/123 (47%), Gaps = 11/123 (9%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G AD+F +Y+ +GN   ++F+ Y     G  D F  Y   SNV  + FNSY
Sbjct  125  FTNYGNARAGGADSFKNYSRDGNVVTDSFRRYSRNAAGHDDKFTVYGDNSNVVEEGFNSY  184

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY-----AKTGVTF  345
            G         F NY    N  T +F+ YSD       G G + +FK Y     A  G +F
Sbjct  185  GTFGTGGAGVFTNYQNNVNNPTSRFTAYSDG------GNGRSQSFKTYTHDANAGNGQSF  238

Query  344  AGY  336
            + Y
Sbjct  239  SSY  241



>ref|XP_003613234.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96192.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=630

 Score =   293 bits (750),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 146/262 (56%), Positives = 189/262 (72%), Gaps = 11/262 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    FTSYG +SN   + F NY E+ N   D+F SY  + NNP N+F NY  G
Sbjct  237  YGKNGNGPTEEFTSYGTSSNTAGSGFSNYAETSNAGNDSFKSYGVDMNNPTNSFSNYANG  296

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG   TF++YR++SNVGADSF SY K +NAA +GF NYGK+FN GTD F+ Y+ +    
Sbjct  297  GNGATQTFSTYREKSNVGADSFTSYAKTANAAKIGFDNYGKSFNDGTDTFTSYAKTSTGE  356

Query  413  -RVSFNGYGVNNTFKDYAKTGVTFAGYLN-ATDVTAAV----GAAKGKMVNNKRWVEPGK  252
             +V F GYGV N FK+Y+K GV+FA Y N ++ ++A+V     AA G +V  K+WVEPGK
Sbjct  357  TKVGFKGYGVKNDFKEYSKEGVSFAKYTNVSSSLSASVKVNKNAASGSLV--KKWVEPGK  414

Query  251  FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAK  72
            FFREKMLK GT+MPMPDIRDK+PKRSFLPR+I A+LPFS ++I E++ +F A +  +M K
Sbjct  415  FFREKMLKEGTVMPMPDIRDKLPKRSFLPRSILAKLPFSTSKIDEMKGLFKASDNGSMEK  474

Query  71   MIAGTLAECERAPSRDETKRCV  6
            M+  +L +CER P++ ETKRCV
Sbjct  475  MMRDSLGDCERVPAKGETKRCV  496



>ref|XP_006300881.1| hypothetical protein CARUB_v10019971mg [Capsella rubella]
 gb|EOA33779.1| hypothetical protein CARUB_v10019971mg [Capsella rubella]
Length=625

 Score =   292 bits (748),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 186/256 (73%), Gaps = 8/256 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYG +SNV+ + F NYGESGN   DTFTSY  +GN P N FKNYGA 
Sbjct  241  YGKNGNGLPNKFASYGASSNVIGSGFSNYGESGNAANDTFTSYGTDGNVPQNNFKNYGAS  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR ++NVG DSF+SY K SN+  V FVNYG++FN G++ F+GY   +++ 
Sbjct  301  GNSAVDTFANYRDKANVGDDSFSSYAKDSNSEKVNFVNYGQSFNPGSETFTGYGKGAENH  360

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++SF  Y  N+TFKDY K GV FA Y NA+  T +VG   GK VN  +W+EPGKFFRE  
Sbjct  361  KISFKTYTPNSTFKDYNKNGVAFAKY-NASSATNSVG--DGKTVN--KWIEPGKFFREAS  415

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDI+DKMPKRSFLPR+I  +LPFS +++GE+++IFHA E S M  +I   +
Sbjct  416  LKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAGENSTMGGIITDAV  475

Query  53   AECERAPSRDETKRCV  6
             ECER PS  ETKRCV
Sbjct  476  TECERPPSVGETKRCV  491


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 81/162 (50%), Gaps = 13/162 (8%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +N  G    FT YG +SNV++  F +YG  G G A  FT+Y  N NNP + F  Y  G
Sbjct  156  YSRNAAGHDDKFTVYGESSNVVEEGFNSYGTFGTGGAGEFTNYQNNVNNPTSRFTAYSDG  215

Query  584  GNGPVDTFNSYRQESNVG-ADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV  408
            GNG   +F +Y  ++N G   SF SYGK  N     F +YG + N     FS Y +S   
Sbjct  216  GNGRSQSFKTYTHDANAGEGQSFTSYGKNGNGLPNKFASYGASSNVIGSGFSNYGESGNA  275

Query  407  ---SFNGYGVN-----NTFKDYAKTG----VTFAGYLNATDV  318
               +F  YG +     N FK+Y  +G     TFA Y +  +V
Sbjct  276  ANDTFTSYGTDGNVPQNNFKNYGASGNSAVDTFANYRDKANV  317


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 56/123 (46%), Gaps = 11/123 (9%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG    G AD+F +Y+ + N   ++F+ Y     G  D F  Y + SNV  + FNSY
Sbjct  125  FTNYGSGRAGGADSFKNYSKDANVVTDSFRRYSRNAAGHDDKFTVYGESSNVVEEGFNSY  184

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY-----AKTGVTF  345
            G         F NY    N  T +F+ YSD       G G + +FK Y     A  G +F
Sbjct  185  GTFGTGGAGEFTNYQNNVNNPTSRFTAYSDG------GNGRSQSFKTYTHDANAGEGQSF  238

Query  344  AGY  336
              Y
Sbjct  239  TSY  241



>gb|AAB39546.1| polygalacturonase isoenzyme 1 beta subunit homolog [Arabidopsis 
thaliana]
Length=626

 Score =   292 bits (747),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 183/256 (71%), Gaps = 7/256 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNG    FTSYG +SNV+ + F NYGESGN   DTFTSY  +GN P N F NYGA 
Sbjct  241  YAKNGNGVPNEFTSYGVSSNVIGSGFSNYGESGNAANDTFTSYGSDGNVPQNNFNNYGAS  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR ++NVG DSF+SY K SN+  V FVNYG++FN G++ F+GY   ++  
Sbjct  301  GNAAVDTFANYRDKANVGDDSFSSYAKDSNSEKVNFVNYGQSFNPGSETFTGYGKGAEGS  360

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++SF  Y  N+TFKDYAK GV FA Y  +T     VG   GK VN  +W+EPGKFFRE  
Sbjct  361  KLSFKTYTPNSTFKDYAKKGVAFAKYNVSTTTANTVG--DGKTVN--KWIEPGKFFRESS  416

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDI+DKMPKRSFLPR+I  +LPFS +++GE+++IFHAVE S M  +I   +
Sbjct  417  LKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSTSKLGEIKRIFHAVENSTMGGIITDAV  476

Query  53   AECERAPSRDETKRCV  6
             ECER PS  ETKRCV
Sbjct  477  TECERPPSVGETKRCV  492


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 75/156 (48%), Gaps = 23/156 (15%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +N  G    FT YG NSNV++  F +YG  G G A  FT+Y  N NNP + F  Y  G
Sbjct  156  YSRNAAGHDDKFTVYGENSNVVEEGFNSYGTFGTGGAGDFTNYQNNVNNPTSRFTAYSDG  215

Query  584  GNGPVDTFNSYRQESNVG---------------ADSFNSYGKKSNAADVGFVNYGKTFNG  450
            GNG   TF +Y  E+N G                + F SYG  SN    GF NYG++ N 
Sbjct  216  GNGRSQTFKTYTHEANAGNGQSFTSYAKNGNGVPNEFTSYGVSSNVIGSGFSNYGESGNA  275

Query  449  GTDKFSGYSDSDRV---SFNGYGVN-----NTFKDY  366
              D F+ Y     V   +FN YG +     +TF +Y
Sbjct  276  ANDTFTSYGSDGNVPQNNFNNYGASGNAAVDTFANY  311


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 58/123 (47%), Gaps = 11/123 (9%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G AD+F +Y+ +GN   ++F+ Y     G  D F  Y + SNV  + FNSY
Sbjct  125  FTNYGNARAGGADSFKNYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGENSNVVEEGFNSY  184

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY-----AKTGVTF  345
            G         F NY    N  T +F+ YSD       G G + TFK Y     A  G +F
Sbjct  185  GTFGTGGAGDFTNYQNNVNNPTSRFTAYSDG------GNGRSQTFKTYTHEANAGNGQSF  238

Query  344  AGY  336
              Y
Sbjct  239  TSY  241



>ref|XP_009596020.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana tomentosiformis]
Length=628

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/258 (59%), Positives = 181/258 (70%), Gaps = 5/258 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKN NGA   FTSY NNSNV+ + F NYGESGNG  +TF SY  N N P+N+FKNYG  
Sbjct  237  YGKNSNGAVNDFTSYANNSNVIGSTFTNYGESGNGGGNTFKSYGSNANVPENSFKNYGVD  296

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SDS  417
            GN P +TF +YR +SNVG D F SY    NA    F NYG++F  G+D FS Y    +D+
Sbjct  297  GNAPFETFINYRDKSNVGDDKFTSYVDDPNAGKANFENYGQSFGEGSDTFSKYGSGITDA  356

Query  416  DRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNK-RWVEPGKFFRE  240
              V F  YGVN TFK+Y KT VTFA Y N T    +V ++     N K +W+EPGKFFRE
Sbjct  357  QTVGFKTYGVNTTFKEYGKTVVTFADYKNKTINQVSVSSSLVSDKNAKNKWIEPGKFFRE  416

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
            KMLK+GTIMPMPDIRDKMPKRSFLPR IA++LPFS ++I +L+ IFHA + S M KM++ 
Sbjct  417  KMLKTGTIMPMPDIRDKMPKRSFLPRVIASKLPFSTSKISDLKTIFHARDDSQMGKMMSD  476

Query  59   TLAECERAPSRDETKRCV  6
             L ECER+PS  ETKRCV
Sbjct  477  ALTECERSPSAGETKRCV  494


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 68/145 (47%), Gaps = 23/145 (16%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYG----AGG------  582
            F  Y  N N+   +F+ Y   G G  D F++YA NGN  D +F  YG    AGG      
Sbjct  135  FKKYAENDNLPVNSFRQYSRGGAGHDDKFSTYAPNGNVVDQSFNTYGTGLSAGGVSEFKN  194

Query  581  -----NGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS  417
                 N P   F +Y  E      SF SY K +N+ D  F +YGK  NG  + F+ Y+++
Sbjct  195  YAPNVNVPNLRFTTYSTEVAGRKQSFTSYTKDTNSGDQSFTSYGKNSNGAVNDFTSYANN  254

Query  416  DRV---SFNGYGVN-----NTFKDY  366
              V   +F  YG +     NTFK Y
Sbjct  255  SNVIGSTFTNYGESGNGGGNTFKSY  279


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 70/145 (48%), Gaps = 18/145 (12%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGN-GDADTFTSYAFNGNNPDNTFKNYGA  588
            Y + G G    F++Y  N NV+D +F  YG   + G    F +YA N N P+  F  Y  
Sbjct  152  YSRGGAGHDDKFSTYAPNGNVVDQSFNTYGTGLSAGGVSEFKNYAPNVNVPNLRFTTYST  211

Query  587  GGNGPVDTFNSYRQESNVGADSFNSYGKKSNAAD------------VG--FVNYGKTFNG  450
               G   +F SY +++N G  SF SYGK SN A             +G  F NYG++ NG
Sbjct  212  EVAGRKQSFTSYTKDTNSGDQSFTSYGKNSNGAVNDFTSYANNSNVIGSTFTNYGESGNG  271

Query  449  GTDKFSGYSDSDRV---SFNGYGVN  384
            G + F  Y  +  V   SF  YGV+
Sbjct  272  GGNTFKSYGSNANVPENSFKNYGVD  296



>ref|XP_007157462.1| hypothetical protein PHAVU_002G071500g [Phaseolus vulgaris]
 gb|ESW29456.1| hypothetical protein PHAVU_002G071500g [Phaseolus vulgaris]
Length=626

 Score =   291 bits (744),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/260 (57%), Positives = 189/260 (73%), Gaps = 9/260 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYG  SNV+ + F NY E+ N   DTF  Y  + NNP NTF NY AG
Sbjct  235  YGKNGNGPTNAFASYGTESNVVGSGFSNYAENTNAANDTFKGYGVDMNNPTNTFSNYAAG  294

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG V+ F++YR ++NVGAD+F SY K +NA D+GF NYGK+FN GTD FS Y+ S    
Sbjct  295  GNGAVERFSNYRDKANVGADTFASYAKSANAGDIGFSNYGKSFNEGTDTFSSYAKSSNGE  354

Query  413  -RVSFNGYGVNNTFKDYAKTG--VTFAGYLN-ATDVTAAVGAAKGKMVNNKRWVEPGKFF  246
             +V F  YGVNNTFK+Y+K G  V+FA Y N +T ++ +  AA  +MVN  +WVE GKFF
Sbjct  355  TKVGFTSYGVNNTFKEYSKEGTTVSFAKYTNVSTTLSVSASAASSRMVN--KWVEAGKFF  412

Query  245  REKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMI  66
            REKM+K GT+MPMPDIRDKMP+RSFLPR+I ++LPFS +++ +L+++F A +  +M +M+
Sbjct  413  REKMMKEGTVMPMPDIRDKMPQRSFLPRSILSKLPFSVSKMDDLKRVFRASDNGSMERMM  472

Query  65   AGTLAECERAPSRDETKRCV  6
              +L ECERAPSR ETKRCV
Sbjct  473  RESLEECERAPSRGETKRCV  492


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 80/174 (46%), Gaps = 12/174 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F SYG + NV+  +F  YG    G    F  Y+   N P+  F +Y   
Sbjct  151  YSRDSAGHKDNFLSYGTDGNVVQQSFHTYGAGATGGTGEFKRYSDQTNVPNLDFTSYSDD  210

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV-  408
             NG   TF+SY +  N G  +F+SYGK  N     F +YG   N     FS Y+++    
Sbjct  211  ANGRTQTFSSYSENGNAGEQTFSSYGKNGNGPTNAFASYGTESNVVGSGFSNYAENTNAA  270

Query  407  --SFNGYGVN-----NTFKDYAKTG----VTFAGYLNATDVTAAVGAAKGKMVN  279
              +F GYGV+     NTF +YA  G      F+ Y +  +V A   A+  K  N
Sbjct  271  NDTFKGYGVDMNNPTNTFSNYAAGGNGAVERFSNYRDKANVGADTFASYAKSAN  324


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 54/129 (42%), Gaps = 20/129 (16%)
 Frame = -1

Query  698  DTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSF  519
            D  F NYG    G  D+F +Y+   N P N F+ Y     G  D F SY  + NV   SF
Sbjct  117  DKNFTNYGTGRPGGVDSFKNYSEGENIPVNDFRRYSRDSAGHKDNFLSYGTDGNVVQQSF  176

Query  518  NS--------------YGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNN  381
            ++              Y  ++N  ++ F +Y    NG T  FS YS+      NG     
Sbjct  177  HTYGAGATGGTGEFKRYSDQTNVPNLDFTSYSDDANGRTQTFSSYSE------NGNAGEQ  230

Query  380  TFKDYAKTG  354
            TF  Y K G
Sbjct  231  TFSSYGKNG  239



>ref|XP_010555103.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=602

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 183/256 (71%), Gaps = 8/256 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GNGAA  F+SY  +SNV+ + F NY E GNG  DTFTSY  +GN P N F+NYGA 
Sbjct  218  YGKHGNGAANEFSSYAVSSNVVGSGFSNYAEHGNGANDTFTSYGSDGNVPQNNFRNYGAA  277

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  V+ F++YR  +NVG DSF+SY K SNA  V FVNYGKTFN G+D FSGY   ++S 
Sbjct  278  GNAGVEAFSNYRDTANVGDDSFSSYAKNSNAEKVNFVNYGKTFNPGSDTFSGYGKGAESQ  337

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            +V+F  YGVN TFKDYAKTGV FA Y     +++   A  GK VN  RWVE GKFFRE  
Sbjct  338  KVAFKSYGVNTTFKDYAKTGVEFARYNQTMPISS---AGDGKSVN--RWVEAGKFFREAK  392

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++ MPDIRDKMPKRSFLPR+I ++LPFS  +I ++++IF   + S M  +I+  L
Sbjct  393  LKEGTVITMPDIRDKMPKRSFLPRSIISKLPFSILKIADIKRIFRVSDNSTMEGIISDAL  452

Query  53   AECERAPSRDETKRCV  6
            ++CER P+  ETKRCV
Sbjct  453  SDCERPPTAGETKRCV  468


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 68/141 (48%), Gaps = 16/141 (11%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNT------FKNYGAGGNGPV  570
            FT+YG +      +FKNY   GN  AD+F  Y+ N     +       F NY  G N P 
Sbjct  125  FTNYGTSRAGGVDSFKNYSLDGNVVADSFRRYSRNSTCGRSATGGGGDFSNYQTGVNNPT  184

Query  569  DTFNSYRQESNVGADSFNSYGKKSNAAD-VGFVNYGKTFNGGTDKFSGYSDSDRVSFNGY  393
              F SY  +S++ + +F +Y  ++NA     F +YGK  NG  ++FS Y+ S  V  +G+
Sbjct  185  SRFTSY-SDSSIRSQTFKTYSHEANAGPGQSFTSYGKHGNGAANEFSSYAVSSNVVGSGF  243

Query  392  --------GVNNTFKDYAKTG  354
                    G N+TF  Y   G
Sbjct  244  SNYAEHGNGANDTFTSYGSDG  264



>ref|XP_004173618.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like, 
partial [Cucumis sativus]
Length=612

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 184/256 (72%), Gaps = 6/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK GNG    FT YG ++NV+ + F +YG  GNG  DTFT+Y  + NNP N F++YG G
Sbjct  226  YGKRGNGGPNEFTGYGTSANVIGSRFSSYGAEGNGANDTFTNYGNDQNNPQNNFRSYGEG  285

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS---D  414
            GNG +++F+SYR ++NVG DSF SY K SN+A V F +YGK+FN GTDKFSGY  +    
Sbjct  286  GNGAIESFSSYRDQANVGDDSFQSYSKNSNSAKVNFASYGKSFNEGTDKFSGYGQNGNGQ  345

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             V F  YGVN TFKDYAK G+ FA Y N +   A + +  G +   KRWVEPGKFFRE M
Sbjct  346  SVGFKTYGVNTTFKDYAKQGINFAKYSNVSSGGAKM-SVSGSLA--KRWVEPGKFFRESM  402

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            L+ G++M MPDIRDKMPKRSFLPR+I ++LPFS++++G +++IFHA + S+M  M+  T+
Sbjct  403  LRKGSVMAMPDIRDKMPKRSFLPRSILSKLPFSSSKLGVMKQIFHAGDNSSMETMMTETV  462

Query  53   AECERAPSRDETKRCV  6
             ECER PS  ETKRCV
Sbjct  463  RECERLPSAGETKRCV  478


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 72/155 (46%), Gaps = 22/155 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG   +G    F +Y N  NV+  +F+ Y     G  D F+ Y  + N PD +F  Y + 
Sbjct  114  YGTQRSGGIDSFKNYSNGDNVVVDSFRRYSHEALGHTDRFSVYGTDTNVPDQSFNTYASK  173

Query  584  GNGPVDTFNSYRQESNVG--------------ADSFNSYGKKSNAADVGFVNYGKTFNGG  447
              G    F +Y Q  NV               + SF SY + +NA D  FVNYGK  NGG
Sbjct  174  AIGGDGKFTTYEQSVNVPNLRFTTYSSDATGRSQSFKSYSENANAGDQSFVNYGKRGNGG  233

Query  446  TDKFSGYSDSDRV---SFNGY-----GVNNTFKDY  366
             ++F+GY  S  V    F+ Y     G N+TF +Y
Sbjct  234  PNEFTGYGTSANVIGSRFSSYGAEGNGANDTFTNY  268



>ref|XP_004142981.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
 gb|KGN62285.1| hypothetical protein Csa_2G348230 [Cucumis sativus]
Length=623

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 184/256 (72%), Gaps = 6/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK GNG    FT YG ++NV+ + F +YG  GNG  DTFT+Y  + NNP N F++YG G
Sbjct  237  YGKRGNGGPNEFTGYGTSANVIGSRFSSYGAEGNGANDTFTNYGNDQNNPQNNFRSYGEG  296

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS---D  414
            GNG +++F+SYR ++NVG DSF SY K SN+A V F +YGK+FN GTDKFSGY  +    
Sbjct  297  GNGAIESFSSYRDQANVGDDSFQSYSKNSNSAKVNFASYGKSFNEGTDKFSGYGQNGNGQ  356

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             V F  YGVN TFKDYAK G+ FA Y N +   A + +  G +   KRWVEPGKFFRE M
Sbjct  357  SVGFKTYGVNTTFKDYAKQGINFAKYSNVSSGGAKM-SVSGSLA--KRWVEPGKFFRESM  413

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            L+ G++M MPDIRDKMPKRSFLPR+I ++LPFS++++G +++IFHA + S+M  M+  T+
Sbjct  414  LRKGSVMAMPDIRDKMPKRSFLPRSILSKLPFSSSKLGVMKQIFHAGDNSSMETMMTETV  473

Query  53   AECERAPSRDETKRCV  6
             ECER PS  ETKRCV
Sbjct  474  RECERLPSAGETKRCV  489


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 72/155 (46%), Gaps = 22/155 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG   +G    F +Y N  NV+  +F+ Y     G  D F+ Y  + N PD +F  Y + 
Sbjct  125  YGTQRSGGIDSFKNYSNGDNVVVDSFRRYSHEALGHTDRFSVYGTDTNVPDQSFNTYASK  184

Query  584  GNGPVDTFNSYRQESNVG--------------ADSFNSYGKKSNAADVGFVNYGKTFNGG  447
              G    F +Y Q  NV               + SF SY + +NA D  FVNYGK  NGG
Sbjct  185  AIGGDGKFTTYEQSVNVPNLRFTTYSSDATGRSQSFKSYSENANAGDQSFVNYGKRGNGG  244

Query  446  TDKFSGYSDSDRV---SFNGY-----GVNNTFKDY  366
             ++F+GY  S  V    F+ Y     G N+TF +Y
Sbjct  245  PNEFTGYGTSANVIGSRFSSYGAEGNGANDTFTNY  279



>gb|KDP26581.1| hypothetical protein JCGZ_17739 [Jatropha curcas]
Length=629

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 179/258 (69%), Gaps = 7/258 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGN  A  F+ YG NSNV+ + F +YG  GN   DTF SY FNGN P+N FKNYG G
Sbjct  240  YGKNGNAIADEFSRYGENSNVIGSDFDSYGAKGNAANDTFKSYGFNGNVPENNFKNYGEG  299

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SD-S  417
            G     +F SYRQESNVG DSF SY K S  A   FVNYGK+FN GTD+F  Y   SD S
Sbjct  300  GTFSEASFTSYRQESNVGDDSFASYAKDSTGAKANFVNYGKSFNEGTDRFKEYGKGSDGS  359

Query  416  DRVSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
             ++ F  YGVNN+F DYA K G +FA Y + +  ++A     G +VN  +WVEPGKFFRE
Sbjct  360  QKIGFKIYGVNNSFTDYANKKGTSFAQYTSKSSASSAEMKVSGSLVN--KWVEPGKFFRE  417

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
              LK G +MPMPDIRDKMPKRSFLPR+I ++LPFS ++I +L++ FHA++ S M  +I  
Sbjct  418  SELKKGNVMPMPDIRDKMPKRSFLPRSIISKLPFSTSKISQLKETFHAIDNSTMESIILD  477

Query  59   TLAECERAPSRDETKRCV  6
             L+ECERAPS  ETKRCV
Sbjct  478  ALSECERAPSPGETKRCV  495


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 71/155 (46%), Gaps = 22/155 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G    F +Y +  N+   +F+ YG +  G  +TF +YA +GN  D +F  YG G
Sbjct  128  YGTSRAGGLDSFKNYSDGENIPVDSFRRYGRNAAGHNETFANYAHDGNVVDQSFNTYGHG  187

Query  584  GNG--------------PVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
              G              P   F SY  ++N     F SY + +N+    F +YGK  N  
Sbjct  188  ATGGTGEFKKYNEQVNVPNLRFTSYSDDANAKGQKFTSYTENTNSGSEAFKSYGKNGNAI  247

Query  446  TDKFSGYSDSDRV---SFNGYG-----VNNTFKDY  366
             D+FS Y ++  V    F+ YG      N+TFK Y
Sbjct  248  ADEFSRYGENSNVIGSDFDSYGAKGNAANDTFKSY  282


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 55/119 (46%), Gaps = 3/119 (3%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            FT+YG +      +FKNY +  N   D+F  Y  N    + TF NY   GN    +FN+Y
Sbjct  125  FTNYGTSRAGGLDSFKNYSDGENIPVDSFRRYGRNAAGHNETFANYAHDGNVVDQSFNTY  184

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD---SDRVSFNGYGVN  384
               +  G   F  Y ++ N  ++ F +Y    N    KF+ Y++   S   +F  YG N
Sbjct  185  GHGATGGTGEFKKYNEQVNVPNLRFTSYSDDANAKGQKFTSYTENTNSGSEAFKSYGKN  243



>ref|XP_008444317.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Cucumis melo]
Length=623

 Score =   288 bits (736),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 184/258 (71%), Gaps = 10/258 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK GNG    FT YG ++NV+ + F +YG  GNG  DTFT+Y  + NNP N F++YG G
Sbjct  237  YGKRGNGGPNEFTGYGTSANVVGSRFSSYGTDGNGANDTFTNYGNDQNNPQNNFRSYGEG  296

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS---D  414
            GNG +++F+SYR ++NVG DSF SY K SN+A V F +YGK+FN GTDKFSGY  +    
Sbjct  297  GNGAIESFSSYRDQANVGDDSFQSYSKNSNSAKVNFASYGKSFNEGTDKFSGYGQNGNGQ  356

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNN--KRWVEPGKFFRE  240
             V F  YGVN TFKDYAK G+ FA Y N +      G AK  +  +  KRWVEPGKFFRE
Sbjct  357  SVGFKVYGVNTTFKDYAKQGINFAKYSNVSS-----GGAKTSVSGSLAKRWVEPGKFFRE  411

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
             ML+ G++M MPDIRDKMPKRSFLPR+I ++LPFS++++G +++IFHA + S+M  M+  
Sbjct  412  SMLRKGSVMAMPDIRDKMPKRSFLPRSILSKLPFSSSKLGVMKQIFHAGDNSSMETMMTE  471

Query  59   TLAECERAPSRDETKRCV  6
            T+ ECER PS  ETKRCV
Sbjct  472  TVRECERVPSAGETKRCV  489


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 72/155 (46%), Gaps = 22/155 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG   +G    F +Y N  NV+  +F+ Y     G  D F++Y    N PD +F  Y + 
Sbjct  125  YGTQRSGGIDSFKNYSNGDNVVVDSFRRYSHEALGHTDRFSTYGTETNVPDQSFNTYASK  184

Query  584  GNGPVDTFNSYRQESNVG--------------ADSFNSYGKKSNAADVGFVNYGKTFNGG  447
              G    F +Y Q  NV               + +F SY + +NA D  FVNYGK  NGG
Sbjct  185  AIGGDGKFTTYEQSVNVPNLRFTTYSSDATGRSQAFKSYSENANAGDQSFVNYGKRGNGG  244

Query  446  TDKFSGYSDSDRV---SFNGYGV-----NNTFKDY  366
             ++F+GY  S  V    F+ YG      N+TF +Y
Sbjct  245  PNEFTGYGTSANVVGSRFSSYGTDGNGANDTFTNY  279



>ref|XP_007223063.1| hypothetical protein PRUPE_ppa003712mg [Prunus persica]
 gb|EMJ24262.1| hypothetical protein PRUPE_ppa003712mg [Prunus persica]
Length=554

 Score =   285 bits (730),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 177/257 (69%), Gaps = 6/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   FT YG +SNV+ + F  YGE+GNG  D F +Y  + NNP N FK+YG G
Sbjct  166  YSKNGNGAPNEFTGYGTSSNVVGSGFTGYGETGNGANDKFNNYGKDMNNPVNRFKSYGDG  225

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  V+TF SYR ++NVG DSF SY K SN   + F NYGK+FN G DKF+GY   +   
Sbjct  226  GNAAVETFTSYRDKANVGEDSFQSYAKNSNGEKINFANYGKSFNVGFDKFTGYGKGAQGQ  285

Query  413  RVSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             + F  YGVNN+F DYA K  V+F  Y  A+       AA G +V  KRWVEPGKFFRE 
Sbjct  286  SIGFKIYGVNNSFSDYAKKESVSFKSYTKASSGKGTRMAASGSLV--KRWVEPGKFFRES  343

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G +MPMPDI+DKMPKRSFLPR I+++LPF+ +++ EL++IFHA + S M K+I   
Sbjct  344  MLKKGVVMPMPDIQDKMPKRSFLPRTISSKLPFATSKMAELKQIFHADDNSTMEKIILDA  403

Query  56   LAECERAPSRDETKRCV  6
            L ECERAPS  ETKRCV
Sbjct  404  LQECERAPSAGETKRCV  420


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 69/157 (44%), Gaps = 22/157 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +       F +Y  + N+   +F+ Y        D FT+YA  GN  D +F +Y  G
Sbjct  54   YGTDRLAGVDSFKNYSIDENLPVDSFRRYSHDSVNHKDQFTNYASGGNVVDQSFNSYAGG  113

Query  584  G--------------NGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                           N P   FNSY  +SN  A SF SY +  NA D  F +Y K  NG 
Sbjct  114  ATSGAGEFKKYADSVNVPNLRFNSYSDDSNGRAQSFTSYTENGNAGDQSFTSYSKNGNGA  173

Query  446  TDKFSGYSDSDRV---SFNGY-----GVNNTFKDYAK  360
             ++F+GY  S  V    F GY     G N+ F +Y K
Sbjct  174  PNEFTGYGTSSNVVGSGFTGYGETGNGANDKFNNYGK  210



>gb|EYU31262.1| hypothetical protein MIMGU_mgv1a002697mg [Erythranthe guttata]
Length=646

 Score =   288 bits (736),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 152/267 (57%), Positives = 185/267 (69%), Gaps = 16/267 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK   GA   F  YG +SNVM + F NYGE G+   DTFTSY  N NNP N F+NYG  
Sbjct  248  YGKKSVGATNEFAGYGKDSNVMGSTFNNYGEKGDAANDTFTSYGTNTNNPQNNFRNYGTL  307

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            G+   ++F  YR+++NVG D+F+SYGK SNA  + FVNYGK+FN GTDKF+GY   D   
Sbjct  308  GSSATESFKGYREQANVGDDNFDSYGKNSNAGKIDFVNYGKSFNEGTDKFTGYGKKDDST  367

Query  413  ----RVSFNGYGVNNTFKDYAKTG-VTFAGYLNAT---DVTAAVGAAKGKMVNNKRW-VE  261
                 V F  YGVNNTFK+YAK G  TF+ Y N T   +  A++ A  G+ VN  +W VE
Sbjct  368  NNSPTVDFKIYGVNNTFKEYAKEGAATFSTYENKTSSAEEEASLAAVNGRKVN--KWVVE  425

Query  260  PGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVE--G  87
            PGKFFRE MLK+GT+MPMPDIRDKMPKRSFLPR I ++LPFS +++ E++KIFHA +   
Sbjct  426  PGKFFREAMLKTGTVMPMPDIRDKMPKRSFLPRTIVSKLPFSTSKLAEMKKIFHAGDDAD  485

Query  86   SAMAKMIAGTLAECERAPSRDETKRCV  6
            S MAKM+   L ECERAPS  ETKRCV
Sbjct  486  STMAKMLTDALHECERAPSPGETKRCV  512


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 71/161 (44%), Gaps = 12/161 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++G G    FT Y   +NV D +F +YG +  G    FT Y    N P+  F  Y   
Sbjct  164  YSRDGVGHNEKFTGYATEANVADQSFNSYGTAATGGGGEFTKYNSEVNVPNLRFTAYSDS  223

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
              G   +F  Y  ++N G + F SYGKKS  A   F  YGK  N     F+ Y    D+ 
Sbjct  224  TTGHSQSFTEYTNQANAGDEKFTSYGKKSVGATNEFAGYGKDSNVMGSTFNNYGEKGDAA  283

Query  413  RVSFNGYGVN-----NTFKDYAKTGV----TFAGYLNATDV  318
              +F  YG N     N F++Y   G     +F GY    +V
Sbjct  284  NDTFTSYGTNTNNPQNNFRNYGTLGSSATESFKGYREQANV  324


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 43/91 (47%), Gaps = 0/91 (0%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG    G  D F+ Y+   N P ++F+ Y   G G  + F  Y  E+NV   SFNSY
Sbjct  133  FTNYGTGRPGGVDAFSGYSEGENLPIDSFRRYSRDGVGHNEKFTGYATEANVADQSFNSY  192

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDS  417
            G  +      F  Y    N    +F+ YSDS
Sbjct  193  GTAATGGGGEFTKYNSEVNVPNLRFTAYSDS  223


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 58/145 (40%), Gaps = 8/145 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG    G    F+ Y    N+   +F+ Y   G G  + FT YA   N  D +F +YG  
Sbjct  136  YGTGRPGGVDAFSGYSEGENLPIDSFRRYSRDGVGHNEKFTGYATEANVADQSFNSYGTA  195

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
              G    F  Y  E NV    F +Y   +      F  Y    N G +KF+ Y   S   
Sbjct  196  ATGGGGEFTKYNSEVNVPNLRFTAYSDSTTGHSQSFTEYTNQANAGDEKFTSYGKKSVGA  255

Query  413  RVSFNGYG-----VNNTFKDYAKTG  354
               F GYG     + +TF +Y + G
Sbjct  256  TNEFAGYGKDSNVMGSTFNNYGEKG  280



>ref|XP_008221810.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=632

 Score =   287 bits (735),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 177/257 (69%), Gaps = 6/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   FT YG +SNV+ + F  YGE+GNG  D F +Y  + NNP N FK+YG G
Sbjct  244  YSKNGNGAPNEFTGYGTSSNVVGSGFTGYGETGNGANDKFNNYGKDMNNPVNRFKSYGDG  303

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  V+TF SYR ++NVG DSF SY K SN   + F NYGK+FN G DKF+GY   +   
Sbjct  304  GNAAVETFTSYRDKANVGEDSFQSYAKNSNGEKINFANYGKSFNVGFDKFTGYGKGAQGQ  363

Query  413  RVSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             + F  YGVNN+F DYA K  ++F  Y  A+       AA G +V  KRWVEPGKFFRE 
Sbjct  364  SIGFKIYGVNNSFSDYAKKESISFKSYTKASSGKGTTMAASGSLV--KRWVEPGKFFRES  421

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G +MPMPDI+DKMPKRSFLPR I+++LPF+ ++I EL++IFHA + S M K+I   
Sbjct  422  MLKKGVVMPMPDIQDKMPKRSFLPRAISSKLPFATSKIAELKQIFHADDNSTMEKIILDA  481

Query  56   LAECERAPSRDETKRCV  6
            L ECERAPS  ETKRCV
Sbjct  482  LQECERAPSAGETKRCV  498


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 69/157 (44%), Gaps = 22/157 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +       F +Y  + N+   +F+ Y        D FT+YA  GN  D +F +Y  G
Sbjct  132  YGTDRLAGVDSFKNYSIDENLPVDSFRRYSRDSVNHKDQFTNYASGGNVVDQSFNSYAGG  191

Query  584  G--------------NGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                           N P   FNSY  +SN  A SF SY +  NA D  F +Y K  NG 
Sbjct  192  ATSGTGEFKKYADSVNVPNLRFNSYSDDSNGRAQSFTSYTENGNAGDQSFTSYSKNGNGA  251

Query  446  TDKFSGYSDSDRV---SFNGY-----GVNNTFKDYAK  360
             ++F+GY  S  V    F GY     G N+ F +Y K
Sbjct  252  PNEFTGYGTSSNVVGSGFTGYGETGNGANDKFNNYGK  288



>ref|XP_010471031.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Camelina sativa]
Length=624

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 182/256 (71%), Gaps = 9/256 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYG +SNV+ + F NYGE+GN   DTFTSY  +GN P N FKNYGA 
Sbjct  241  YGKNGNGIPNEFASYGASSNVVGSGFSNYGENGNAANDTFTSYGTDGNVPQNNFKNYGAA  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   DTF++YR ++NVG DSF+SY K S+   V FVNYG++FN G++KF+GY   ++  
Sbjct  301  GNSADDTFSNYRDKANVGDDSFSSYAKDSSNEKVKFVNYGQSFNPGSEKFTGYGKGAEDS  360

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            R+SF  Y  N+TFKDYAK GV F+ Y    +V+ A     GK VN  +W+EPGKFFRE  
Sbjct  361  RISFKTYTPNSTFKDYAKNGVAFSKY----NVSTANTVGDGKTVN--KWIEPGKFFRESS  414

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDI+DKMPKRSFLPR I  +LPFS +++GE+++IFHA E S M  +I   +
Sbjct  415  LKEGTVIPMPDIKDKMPKRSFLPRTIITKLPFSVSKLGEIKRIFHAGENSTMGGLITDAV  474

Query  53   AECERAPSRDETKRCV  6
             ECER PS  ETKRCV
Sbjct  475  TECERPPSVGETKRCV  490


 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 71/138 (51%), Gaps = 7/138 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +NG G    F+ YG++SNV++  F +YG SG G A  FT+Y  N NNP + F  Y  G
Sbjct  156  YSRNGAGHDDKFSVYGDSSNVVEEGFNSYGTSGTGGAGEFTNYQNNVNNPTSRFTAYSDG  215

Query  584  GNGPVDTFNSYRQESNVG-ADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV  408
             NG   +F +Y Q +N G   SF SYGK  N     F +YG + N     FS Y +    
Sbjct  216  ANGRTQSFKTYTQNANAGPGQSFTSYGKNGNGIPNEFASYGASSNVVGSGFSNYGE----  271

Query  407  SFNGYGVNNTFKDYAKTG  354
              NG   N+TF  Y   G
Sbjct  272  --NGNAANDTFTSYGTDG  287


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 45/90 (50%), Gaps = 0/90 (0%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG    G  D+F +Y+ +GN   ++F+ Y   G G  D F+ Y   SNV  + FNSY
Sbjct  125  FTNYGSGRPGGGDSFKNYSKDGNVETDSFRRYSRNGAGHDDKFSVYGDSSNVVEEGFNSY  184

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSD  420
            G         F NY    N  T +F+ YSD
Sbjct  185  GTSGTGGAGEFTNYQNNVNNPTSRFTAYSD  214


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 64/144 (44%), Gaps = 10/144 (7%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            FT+YG+       +FKNY + GN + D+F  Y+ NG   D+ F  YG   N   + FNSY
Sbjct  125  FTNYGSGRPGGGDSFKNYSKDGNVETDSFRRYSRNGAGHDDKFSVYGDSSNVVEEGFNSY  184

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV----SF-----N  399
                  GA  F +Y    N     F  Y    NG T  F  Y+ +       SF     N
Sbjct  185  GTSGTGGAGEFTNYQNNVNNPTSRFTAYSDGANGRTQSFKTYTQNANAGPGQSFTSYGKN  244

Query  398  GYGVNNTFKDY-AKTGVTFAGYLN  330
            G G+ N F  Y A + V  +G+ N
Sbjct  245  GNGIPNEFASYGASSNVVGSGFSN  268



>ref|XP_010471032.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Camelina sativa]
Length=624

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 182/256 (71%), Gaps = 9/256 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYG +SNV+ + F NYGE+GN   DTFTSY  +GN P N FKNYGA 
Sbjct  241  YGKNGNGIPNEFASYGVSSNVVGSGFSNYGENGNAANDTFTSYGTDGNVPQNNFKNYGAA  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   DTF++YR ++NVG DSF+SY K S+   V FVNYG++FN G++KF+GY   ++  
Sbjct  301  GNSADDTFSNYRDKANVGDDSFSSYAKDSSNEKVKFVNYGQSFNPGSEKFTGYGKGAEDS  360

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            R+SF  Y  N+TFKDYAK GV F+ Y    +V+ A     GK VN  +W+EPGKFFRE  
Sbjct  361  RISFKTYTPNSTFKDYAKNGVAFSKY----NVSTANTVGDGKTVN--KWIEPGKFFRESS  414

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDI+DKMPKRSFLPR I  +LPFS +++GE+++IFHA E S M  +I   +
Sbjct  415  LKEGTVIPMPDIKDKMPKRSFLPRTIITKLPFSVSKLGEIKRIFHAGENSTMGGLITDAV  474

Query  53   AECERAPSRDETKRCV  6
             ECER PS  ETKRCV
Sbjct  475  TECERPPSVGETKRCV  490


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 71/138 (51%), Gaps = 7/138 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +NG G    F+ YG++SNV++  F +YG SG G A  FT+Y  N NNP + F  Y  G
Sbjct  156  YSRNGAGHDDKFSVYGDSSNVVEEGFNSYGTSGTGGAGEFTNYQNNVNNPTSRFTAYSDG  215

Query  584  GNGPVDTFNSYRQESNVG-ADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV  408
             NG   +F +Y Q +N G   SF SYGK  N     F +YG + N     FS Y +    
Sbjct  216  ANGRTQSFKTYTQNANAGPGQSFTSYGKNGNGIPNEFASYGVSSNVVGSGFSNYGE----  271

Query  407  SFNGYGVNNTFKDYAKTG  354
              NG   N+TF  Y   G
Sbjct  272  --NGNAANDTFTSYGTDG  287


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 45/90 (50%), Gaps = 0/90 (0%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG    G  D+F +Y+ +GN   ++F+ Y   G G  D F+ Y   SNV  + FNSY
Sbjct  125  FTNYGSGRPGGGDSFKNYSKDGNVETDSFRRYSRNGAGHDDKFSVYGDSSNVVEEGFNSY  184

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSD  420
            G         F NY    N  T +F+ YSD
Sbjct  185  GTSGTGGAGEFTNYQNNVNNPTSRFTAYSD  214


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 53/120 (44%), Gaps = 4/120 (3%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            FT+YG+       +FKNY + GN + D+F  Y+ NG   D+ F  YG   N   + FNSY
Sbjct  125  FTNYGSGRPGGGDSFKNYSKDGNVETDSFRRYSRNGAGHDDKFSVYGDSSNVVEEGFNSY  184

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV----SFNGYGVN  384
                  GA  F +Y    N     F  Y    NG T  F  Y+ +       SF  YG N
Sbjct  185  GTSGTGGAGEFTNYQNNVNNPTSRFTAYSDGANGRTQSFKTYTQNANAGPGQSFTSYGKN  244



>ref|XP_010415713.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Camelina sativa]
Length=624

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 183/256 (71%), Gaps = 9/256 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYG +SNV+ + F NYGE+GN   DTFTSY  +GN P N FKNYGA 
Sbjct  241  YGKNGNGIPNEFASYGVSSNVIGSGFSNYGENGNAANDTFTSYGTDGNVPQNNFKNYGAA  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   DTF++YR ++NVG DSF+SY K S+   V FVNYG++FN G++KF+GY   S+  
Sbjct  301  GNSADDTFSNYRDKANVGDDSFSSYAKDSSNEKVKFVNYGQSFNPGSEKFTGYGKGSEGS  360

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            R+SF  Y  N+TFK+YAK GV F+ Y    +V+ A     GK VN  +W+EPGKFFRE  
Sbjct  361  RISFKTYTPNSTFKEYAKNGVAFSKY----NVSTANTVGDGKTVN--KWIEPGKFFRESS  414

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDI+DKMPKRSFLPR+I  +LPFS +++GE+++IFHA E S M  +I   +
Sbjct  415  LKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSVSKLGEIKRIFHAGENSTMGGLITDAV  474

Query  53   AECERAPSRDETKRCV  6
             ECER PS  ETKRCV
Sbjct  475  TECERPPSVGETKRCV  490


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 71/138 (51%), Gaps = 7/138 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +NG G    F+ YG++SNV++  F +YG SG G A  FT+Y  N NNP + F  Y  G
Sbjct  156  YSRNGAGHDDKFSVYGDSSNVVEEGFNSYGTSGTGGAGEFTNYQNNVNNPTSRFTAYSDG  215

Query  584  GNGPVDTFNSYRQESNVG-ADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV  408
             NG   +F +Y Q +N G   SF SYGK  N     F +YG + N     FS Y +    
Sbjct  216  ANGRTQSFKTYTQNANAGPGQSFTSYGKNGNGIPNEFASYGVSSNVIGSGFSNYGE----  271

Query  407  SFNGYGVNNTFKDYAKTG  354
              NG   N+TF  Y   G
Sbjct  272  --NGNAANDTFTSYGTDG  287


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 45/90 (50%), Gaps = 0/90 (0%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG    G  D+F +Y+ +GN   ++F+ Y   G G  D F+ Y   SNV  + FNSY
Sbjct  125  FTNYGSGRPGGGDSFKNYSKDGNVETDSFRRYSRNGAGHDDKFSVYGDSSNVVEEGFNSY  184

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSD  420
            G         F NY    N  T +F+ YSD
Sbjct  185  GTSGTGGAGEFTNYQNNVNNPTSRFTAYSD  214


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 53/120 (44%), Gaps = 4/120 (3%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            FT+YG+       +FKNY + GN + D+F  Y+ NG   D+ F  YG   N   + FNSY
Sbjct  125  FTNYGSGRPGGGDSFKNYSKDGNVETDSFRRYSRNGAGHDDKFSVYGDSSNVVEEGFNSY  184

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV----SFNGYGVN  384
                  GA  F +Y    N     F  Y    NG T  F  Y+ +       SF  YG N
Sbjct  185  GTSGTGGAGEFTNYQNNVNNPTSRFTAYSDGANGRTQSFKTYTQNANAGPGQSFTSYGKN  244



>emb|CDY59986.1| BnaC06g43610D [Brassica napus]
Length=611

 Score =   285 bits (730),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 183/256 (71%), Gaps = 8/256 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYG ++NV+ + F NYGE GN   D+FTSY  +GN P N FKNYGA 
Sbjct  243  YGKNGNGVPNEFASYGVSANVIGSGFSNYGEKGNAANDSFTSYGSDGNVPQNNFKNYGAS  302

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   DTF +YR +SNVG DSF+SY K SN+    F NYG++FN G++ F+GY   ++  
Sbjct  303  GNAASDTFANYRDKSNVGDDSFSSYAKDSNSGTAKFTNYGQSFNPGSETFTGYGKGAEGH  362

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++SF  Y  N+TFKDYAK GV FA Y N +  +A +G   GK VN  +W+EPGKFFRE  
Sbjct  363  KISFKTYTPNSTFKDYAKNGVGFAKY-NVSSTSATLG--DGKTVN--KWIEPGKFFREAS  417

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDI+DKMPKRSFLPR+I ++LPFS +++ E+ KIFHA E S M K+I+  +
Sbjct  418  LKEGTVIPMPDIKDKMPKRSFLPRSIISKLPFSTSKLAEINKIFHAGENSTMEKIISDAV  477

Query  53   AECERAPSRDETKRCV  6
             ECER+PS  ETKRCV
Sbjct  478  TECERSPSVGETKRCV  493


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 56/123 (46%), Gaps = 11/123 (9%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G  D+F +Y+ +GN   ++F+ Y     G  D F  Y   SNV  ++FNSY
Sbjct  127  FTNYGNAAAGGVDSFKTYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGDSSNVVEENFNSY  186

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY-----AKTGVTF  345
            G         F NY    N  T +F+ YSD       G G   +FK Y     A  G +F
Sbjct  187  GTFGTGGTGEFTNYQNGVNNPTSRFTAYSDG------GNGKAQSFKTYTHEANAGNGQSF  240

Query  344  AGY  336
              Y
Sbjct  241  TSY  243



>ref|XP_009794727.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Nicotiana sylvestris]
Length=625

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 180/258 (70%), Gaps = 5/258 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG+N NGA   FTSY NNSNV+ + F NYGESGNG  +TF SY  N N P+NTF NYGA 
Sbjct  234  YGRNSNGAINDFTSYANNSNVIGSTFTNYGESGNGGGNTFKSYGSNANVPENTFTNYGAD  293

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKF----SGYSDS  417
            GN P +TF +YR +SNVG D F SY    NA    F NYG++F  G+D F    SG +D+
Sbjct  294  GNAPFETFINYRDKSNVGDDKFTSYVDDPNAGRANFENYGQSFGEGSDTFNKYGSGITDA  353

Query  416  DRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNK-RWVEPGKFFRE  240
              V F  YGVN TFK+Y KTGVTFA Y N T    +V ++     N K +W+EPGKFFRE
Sbjct  354  QTVGFKTYGVNTTFKEYGKTGVTFADYKNKTINQVSVSSSVVSDKNAKNKWIEPGKFFRE  413

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
            KMLK+ TIMPMPDI+DKMPKRSFLPR IA++LPFS ++I +L+ IFHA + + M KM+  
Sbjct  414  KMLKTETIMPMPDIQDKMPKRSFLPRVIASKLPFSTSKIRDLKTIFHAGDDTQMGKMMLD  473

Query  59   TLAECERAPSRDETKRCV  6
             L ECER+PS  ETKRCV
Sbjct  474  ALTECERSPSAGETKRCV  491


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 69/145 (48%), Gaps = 23/145 (16%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYG----AGGNG----  576
            F  Y  N N+   +F+ Y   G G  D F++YA NGN  D +F  YG    AGG G    
Sbjct  132  FKKYAENDNLPVNSFRQYSRGGAGHDDKFSTYAPNGNVVDQSFNTYGTGLSAGGVGEFKN  191

Query  575  -------PVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS  417
                   P   F +Y  E      SF+SY K +N+ D  F +YG+  NG  + F+ Y+++
Sbjct  192  YAPNVNVPNLRFTTYSTEVAGRKQSFSSYTKDTNSGDQSFTSYGRNSNGAINDFTSYANN  251

Query  416  DRV---SFNGYGVN-----NTFKDY  366
              V   +F  YG +     NTFK Y
Sbjct  252  SNVIGSTFTNYGESGNGGGNTFKSY  276


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 76/164 (46%), Gaps = 22/164 (13%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGN-GDADTFTSYAFNGNNPDNTFKNYGA  588
            Y + G G    F++Y  N NV+D +F  YG   + G    F +YA N N P+  F  Y  
Sbjct  149  YSRGGAGHDDKFSTYAPNGNVVDQSFNTYGTGLSAGGVGEFKNYAPNVNVPNLRFTTYST  208

Query  587  GGNGPVDTFNSYRQESNVGADSFNSYGKKSNAAD------------VG--FVNYGKTFNG  450
               G   +F+SY +++N G  SF SYG+ SN A             +G  F NYG++ NG
Sbjct  209  EVAGRKQSFSSYTKDTNSGDQSFTSYGRNSNGAINDFTSYANNSNVIGSTFTNYGESGNG  268

Query  449  GTDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG-VTFAGYLNATD  321
            G + F  Y  +  V        NTF +Y   G   F  ++N  D
Sbjct  269  GGNTFKSYGSNANVP------ENTFTNYGADGNAPFETFINYRD  306


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 53/110 (48%), Gaps = 7/110 (6%)
 Frame = -1

Query  749  NGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPV  570
            +G    F+SY      M   F NYG       D+F  YA N N P N+F+ Y  GG G  
Sbjct  104  HGQDVQFSSY------MSKNFTNYGSKLPRGFDSFKKYAENDNLPVNSFRQYSRGGAGHD  157

Query  569  DTFNSYRQESNVGADSFNSYGKKSNAADVG-FVNYGKTFNGGTDKFSGYS  423
            D F++Y    NV   SFN+YG   +A  VG F NY    N    +F+ YS
Sbjct  158  DKFSTYAPNGNVVDQSFNTYGTGLSAGGVGEFKNYAPNVNVPNLRFTTYS  207



>emb|CDY57845.1| BnaA07g38770D [Brassica napus]
Length=627

 Score =   285 bits (730),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 183/256 (71%), Gaps = 8/256 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYG ++NV+ + F NYGE GN   D+FTSY  +GN P N FKNYGA 
Sbjct  243  YGKNGNGVPNEFASYGVSANVIGSGFSNYGEKGNAANDSFTSYGSDGNVPQNNFKNYGAS  302

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   DTF +YR +SNVG DSF+SY K SN+    F NYG++FN G++ F+GY   ++  
Sbjct  303  GNAASDTFANYRDKSNVGDDSFSSYAKDSNSGTAKFTNYGQSFNPGSETFTGYGKGAEGH  362

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++SF  Y  N+TFKDYAK GV FA Y N +  +A +G   GK VN  +W+EPGKFFRE  
Sbjct  363  KISFKTYTPNSTFKDYAKNGVGFAKY-NVSSTSATLG--DGKTVN--KWIEPGKFFREAS  417

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDI+DKMPKRSFLPR+I ++LPFS +++ E+ KIFHA E S M K+I+  +
Sbjct  418  LKEGTVIPMPDIKDKMPKRSFLPRSIISKLPFSTSKLAEINKIFHAGENSTMEKIISDAV  477

Query  53   AECERAPSRDETKRCV  6
             ECER+PS  ETKRCV
Sbjct  478  TECERSPSVGETKRCV  493


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 56/123 (46%), Gaps = 11/123 (9%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G  D+F +Y+ +GN   ++F+ Y     G  D F  Y   SNV  ++FNSY
Sbjct  127  FTNYGNAAAGGTDSFKTYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGDSSNVVEENFNSY  186

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY-----AKTGVTF  345
            G         F NY    N  T +F+ YSD       G G   +FK Y     A  G +F
Sbjct  187  GTFGTGGTGEFTNYQNGVNNPTSRFTAYSDG------GNGKAQSFKTYTHEANAGDGQSF  240

Query  344  AGY  336
              Y
Sbjct  241  TSY  243



>ref|XP_008389645.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=632

 Score =   285 bits (728),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 143/257 (56%), Positives = 180/257 (70%), Gaps = 6/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   FT YG+N+NV+ + F +YG+SGNG  D F++Y  + NNP N F++YG G
Sbjct  244  YSKNGNGAPNEFTGYGSNANVVGSGFTSYGQSGNGANDKFSNYGNDQNNPKNNFQSYGDG  303

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  V+TF SYR+ +NVG DSF SY K SN   + F +YGK+FN G+DKF+GY   +   
Sbjct  304  GNAGVETFTSYRERANVGDDSFQSYAKNSNGEKMDFTSYGKSFNIGSDKFTGYGKGAKGQ  363

Query  413  RVSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             + F  YGVN TFKDYA K  V+F  Y  A   +    AA G +V  K+WVEPGKFFRE 
Sbjct  364  DIGFKIYGVNTTFKDYAKKETVSFKSYTKAGGGSVKAAAASGSLV--KKWVEPGKFFRES  421

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G +MPMPDI+DKMPKRSFLPR I ++LPF+ ++I  L++IFHA + S+M K+I   
Sbjct  422  MLKKGVVMPMPDIQDKMPKRSFLPRTILSKLPFATSKIATLKQIFHAADNSSMEKIIVDA  481

Query  56   LAECERAPSRDETKRCV  6
            L ECERAPS  ETKRCV
Sbjct  482  LQECERAPSAGETKRCV  498


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 66/155 (43%), Gaps = 22/155 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNT-------  606
            YG +       F +Y   +N+   +F+ Y        D FTSYA +GN  D +       
Sbjct  132  YGTDRLAGVDSFKNYSLGNNIPVDSFRRYSRDSVNHKDQFTSYANDGNVVDQSFNGYAAG  191

Query  605  -------FKNYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                   FK Y    N P   FNSY  +SN  +  F  Y + +NA D  F  Y K  NG 
Sbjct  192  ATGGAGDFKKYADSVNVPHLGFNSYSDDSNGRSHGFTGYSENANAGDQSFTGYSKNGNGA  251

Query  446  TDKFSGYSDSDRVSFNGY--------GVNNTFKDY  366
             ++F+GY  +  V  +G+        G N+ F +Y
Sbjct  252  PNEFTGYGSNANVVGSGFTSYGQSGNGANDKFSNY  286



>gb|KHG24447.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=628

 Score =   285 bits (728),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 177/257 (69%), Gaps = 6/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F+SYG  +NV+ + F  YGE+ NG  D+FTSY F+ N P NTFK+YG G
Sbjct  239  YGKNGNGVPNEFSSYGKGANVIGSGFSGYGEAANGANDSFTSYGFDSNAPQNTFKSYGDG  298

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS---D  414
            GN  V+TF+SYR +SNVG DSF SY K SN   V F NYG++FN GTDKF+GY       
Sbjct  299  GNAAVNTFSSYRDQSNVGDDSFQSYAKNSNGEKVDFSNYGQSFNEGTDKFTGYGQGAVVQ  358

Query  413  RVSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             + F  YG N+TFKDYA K G+ F  Y N +    A        VN  +WVEPGKFFREK
Sbjct  359  SIGFKIYGRNSTFKDYAKKEGIVFGRYNNGSSSETAQVKGGSSAVN--KWVEPGKFFREK  416

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            +LK GT+MPMPDI+DKMP RSFLPR I ++LPFS+++ GEL++IFHA + S +  ++   
Sbjct  417  LLKQGTVMPMPDIKDKMPVRSFLPRTIVSKLPFSSSKFGELKRIFHAGDNSTLETVMLDA  476

Query  56   LAECERAPSRDETKRCV  6
            L ECERAPS  ETKRCV
Sbjct  477  LKECERAPSPGETKRCV  493


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 64/148 (43%), Gaps = 11/148 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +       F +Y  +SN++  +F  Y     G  + F +YA  GN  D  F +Y A 
Sbjct  126  YGTDRLAGVDSFKNYSEDSNIVVDSFHRYSRDSTGHKEQFANYASEGNVVDQNFHSYAAS  185

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGT-DKFSGYSDSDRV  408
              G    FN+Y +E N     F+SYG  SN     F  Y +  N G    FSGY      
Sbjct  186  ATGGSGNFNNYNREVNNPNLRFSSYGDDSNGHGQTFTQYTENANAGNGQSFSGYGK----  241

Query  407  SFNGYGVNNTFKDYAK----TGVTFAGY  336
              NG GV N F  Y K     G  F+GY
Sbjct  242  --NGNGVPNEFSSYGKGANVIGSGFSGY  267



>ref|XP_009363553.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009363554.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X3 [Pyrus x bretschneideri]
Length=632

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 176/257 (68%), Gaps = 6/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   FT YG N+NV+ + F  YG+SGNG  D F +Y  + N+P N FK+YG G
Sbjct  244  YSKNGNGAPNEFTGYGTNANVVGSGFTAYGQSGNGANDKFNNYGNDQNDPANNFKSYGDG  303

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
            GN  V+TF SYR+ +NVG DSF SY K SN   + F +YGK+FN G+DKF+GY    R  
Sbjct  304  GNAGVETFTSYRERANVGDDSFQSYAKNSNGEKMDFTSYGKSFNIGSDKFTGYGKGARGQ  363

Query  410  -VSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             + F  YGVN TFKDYA K  V+F  Y  A   +    AA G MV  K+WVEPGKFFRE 
Sbjct  364  DIGFKIYGVNTTFKDYAKKETVSFKSYTKAGAGSVKAAAASGSMV--KKWVEPGKFFRES  421

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G +MPMPDI+DKMPKRSFLPR I ++LPF+ ++I  L++IFHA + S M K+I   
Sbjct  422  MLKKGVVMPMPDIQDKMPKRSFLPRTILSKLPFATSKIAALKQIFHAADNSTMEKIIVDA  481

Query  56   LAECERAPSRDETKRCV  6
            L ECERAPS  ETKRCV
Sbjct  482  LQECERAPSAGETKRCV  498


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 66/155 (43%), Gaps = 22/155 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNT-------  606
            YG +       F +Y    N+   +F+ Y        D FTSYA +GN  D +       
Sbjct  132  YGTDRLAGVDSFKNYSLGENLPVDSFRRYSRDSVNHKDQFTSYANDGNVVDQSFNGYAAG  191

Query  605  -------FKNYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                   FK Y    N P   FNSY  +SN  +  F  Y + +NA D  F +Y K  NG 
Sbjct  192  ATGGAGDFKKYADSVNVPHLGFNSYSDDSNGRSHGFTGYSENANAGDQSFTSYSKNGNGA  251

Query  446  TDKFSGYSDSDRVSFNGY--------GVNNTFKDY  366
             ++F+GY  +  V  +G+        G N+ F +Y
Sbjct  252  PNEFTGYGTNANVVGSGFTAYGQSGNGANDKFNNY  286



>ref|XP_009105700.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Brassica rapa]
Length=627

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 183/256 (71%), Gaps = 8/256 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYG ++NV+ + F NYGE GN   D+FTSY  +GN P N FKNYGA 
Sbjct  243  YGKNGNGVPNEFASYGVSANVIGSGFSNYGEKGNAANDSFTSYGSDGNVPQNNFKNYGAS  302

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   DTF +YR +SNVG DSF+SY K SN+    F NYG++FN G++ F+GY   ++  
Sbjct  303  GNAASDTFANYRDKSNVGDDSFSSYAKDSNSGTAKFNNYGQSFNPGSETFTGYGKGAEGH  362

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++SF  Y  N+TFKDYAK GV FA Y N +  +A +G   GK VN  +W+EPGKFFRE  
Sbjct  363  KISFKTYTPNSTFKDYAKNGVGFAKY-NVSSTSATLG--DGKTVN--KWIEPGKFFREAS  417

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDI+DKMPKRSFLPR+I ++LPFS +++ E+ KIFHA E S M K+I+  +
Sbjct  418  LKEGTVIPMPDIKDKMPKRSFLPRSIISKLPFSTSKLAEINKIFHAGENSTMEKIISDAV  477

Query  53   AECERAPSRDETKRCV  6
             ECER+PS  ETKRCV
Sbjct  478  TECERSPSVGETKRCV  493


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 56/123 (46%), Gaps = 11/123 (9%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G  D+F +Y+ +GN   ++F+ Y     G  D F  Y   SNV  ++FNSY
Sbjct  127  FTNYGNAAAGGTDSFKTYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGDSSNVVEENFNSY  186

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY-----AKTGVTF  345
            G         F NY    N  T +F+ YSD       G G   +FK Y     A  G +F
Sbjct  187  GTFGTGGTGEFTNYQNGVNNPTSRFTAYSDG------GNGKAQSFKTYTHEANAGDGQSF  240

Query  344  AGY  336
              Y
Sbjct  241  TSY  243



>ref|XP_010427809.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Camelina sativa]
 ref|XP_010427810.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X2 [Camelina sativa]
Length=625

 Score =   283 bits (723),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 184/257 (72%), Gaps = 10/257 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYG +SNV+ + F NYGE+GN   DTFTSY  +GN P N FKNYGA 
Sbjct  241  YGKNGNGLPNEFASYGASSNVVGSGFSNYGENGNAANDTFTSYGTDGNVPQNNFKNYGAA  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   DTF++YR ++NVG DSF+SY K S+   V FVNYG++FN G++KF+GY   ++  
Sbjct  301  GNSADDTFSNYRDKANVGDDSFSSYAKDSSNEKVKFVNYGQSFNPGSEKFTGYGKGAEGS  360

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++SF  Y  N+TFKDYAK GV F+ Y    +V++A     GK VN  +W+EPGKFFRE  
Sbjct  361  KISFKTYTPNSTFKDYAKNGVAFSKY----NVSSANTVGDGKTVN--KWIEPGKFFRESS  414

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAV-EGSAMAKMIAGT  57
            LK GT++PMPDI+DKMPKRSFLPR+I  +LPFS +++GE+++IFHA  E S M  +I   
Sbjct  415  LKEGTVIPMPDIKDKMPKRSFLPRSIITKLPFSVSKLGEIKRIFHAAGENSTMGGLITDA  474

Query  56   LAECERAPSRDETKRCV  6
            + ECER PS  ETKRCV
Sbjct  475  VTECERPPSVGETKRCV  491


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 70/138 (51%), Gaps = 7/138 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +NG G    F+ YG +SNV++  F +YG  G G A  FT+Y  N NNP +TF  Y  G
Sbjct  156  YSRNGAGHDDKFSVYGESSNVVEEGFNSYGTFGTGGAGEFTNYQNNVNNPTSTFTAYSDG  215

Query  584  GNGPVDTFNSYRQESNVG-ADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV  408
             NG   +F +Y Q +N G   SF SYGK  N     F +YG + N     FS Y +    
Sbjct  216  ANGRTQSFKTYTQNANAGPGQSFTSYGKNGNGLPNEFASYGASSNVVGSGFSNYGE----  271

Query  407  SFNGYGVNNTFKDYAKTG  354
              NG   N+TF  Y   G
Sbjct  272  --NGNAANDTFTSYGTDG  287


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 45/90 (50%), Gaps = 0/90 (0%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG    G  D+F +Y+ +GN   ++F+ Y   G G  D F+ Y + SNV  + FNSY
Sbjct  125  FTNYGSGRPGGGDSFKNYSKDGNVETDSFRRYSRNGAGHDDKFSVYGESSNVVEEGFNSY  184

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSD  420
            G         F NY    N  T  F+ YSD
Sbjct  185  GTFGTGGAGEFTNYQNNVNNPTSTFTAYSD  214



>ref|XP_006390895.1| hypothetical protein EUTSA_v10018277mg [Eutrema salsugineum]
 gb|ESQ28181.1| hypothetical protein EUTSA_v10018277mg [Eutrema salsugineum]
Length=627

 Score =   282 bits (722),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 185/256 (72%), Gaps = 7/256 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F+SYG ++NV+ + F NYGE GN   D+FT+Y  +GN P N FKNYGA 
Sbjct  242  YGKNGNGLPNSFSSYGVSANVIGSGFSNYGEKGNAANDSFTNYGNDGNVPQNNFKNYGAS  301

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF++YR ++NVG DSF+SY K SN+  V FVNYG++FN G++ F+GY   ++  
Sbjct  302  GNAAVDTFSNYRDKANVGDDSFSSYAKDSNSGKVNFVNYGQSFNPGSESFTGYGKGAEGH  361

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDYAK GV F+ Y N +  +AA     GK VN  +W+EPGKFFRE  
Sbjct  362  KIGFKTYTPNSTFKDYAKNGVGFSKY-NVSSFSAAT-VGDGKTVN--KWIEPGKFFREST  417

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++PMPDIRDKMPKRSFLPR+I ++LPFS ++IGE+++IFHA + S M  +I+  +
Sbjct  418  LKEGTVIPMPDIRDKMPKRSFLPRSIISKLPFSTSKIGEIKRIFHAGDNSTMENIISDAV  477

Query  53   AECERAPSRDETKRCV  6
             ECER  S  ETKRCV
Sbjct  478  KECERPASVGETKRCV  493


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 79/168 (47%), Gaps = 25/168 (15%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +   G    FT Y +NSNV++  F +YG  G G A  FT+Y    NNP + F  Y  G
Sbjct  157  YSRGAAGHDDKFTVYSDNSNVVEENFNSYGTFGTGGAGEFTNYQNGVNNPTSRFTAYSDG  216

Query  584  GNGPVDTFNSYRQESNVG---------------ADSFNSYGKKSNAADVGFVNYGKTFNG  450
            GNG   +FNSY  E+N G                +SF+SYG  +N    GF NYG+  N 
Sbjct  217  GNGRSQSFNSYTHEANAGNGQSFTSYGKNGNGLPNSFSSYGVSANVIGSGFSNYGEKGNA  276

Query  449  GTDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG----VTFAGYLNATDV  318
              D F+ Y +   V        N FK+Y  +G     TF+ Y +  +V
Sbjct  277  ANDSFTNYGNDGNVP------QNNFKNYGASGNAAVDTFSNYRDKANV  318


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 63/137 (46%), Gaps = 9/137 (7%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G AD+F +Y+ +GN   ++F+ Y  G  G  D F  Y   SNV  ++FNSY
Sbjct  126  FTNYGNARAGGADSFKTYSKDGNVVTDSFRRYSRGAAGHDDKFTVYSDNSNVVEENFNSY  185

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSD---SDRVSFNGY------GVNNTFKDYAKT  357
            G         F NY    N  T +F+ YSD       SFN Y      G   +F  Y K 
Sbjct  186  GTFGTGGAGEFTNYQNGVNNPTSRFTAYSDGGNGRSQSFNSYTHEANAGNGQSFTSYGKN  245

Query  356  GVTFAGYLNATDVTAAV  306
            G       ++  V+A V
Sbjct  246  GNGLPNSFSSYGVSANV  262



>gb|KCW86731.1| hypothetical protein EUGRSUZ_B03343 [Eucalyptus grandis]
Length=610

 Score =   279 bits (713),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 146/261 (56%), Positives = 188/261 (72%), Gaps = 9/261 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +NGN A + FT+Y  +SN + + F  Y + G+G  ++FTSY FNGNNP N F +YG G
Sbjct  219  YSRNGNRAPSEFTAYATDSNTVGSGFSAYSQGGDGANNSFTSYGFNGNNPHNRFNSYGNG  278

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
             NG V+ F +YR+ +NVG DSF SY K S +A+V F NYGKTFN GTDKF+GY   +   
Sbjct  279  VNGAVENFKTYRESANVGEDSFTSYVKDSKSAEVNFANYGKTFNEGTDKFTGYGGGATGQ  338

Query  413  RVSFNGYGVNNTFKDYAKTGV-TFAGYLNATDVTA---AVGAAKGKMVNNKRWVEPGKFF  246
             V F  YGVNN+FK Y K  + TF+ Y N T  ++   A+ AA  K +N  RWVEPGKFF
Sbjct  339  AVGFKIYGVNNSFKGYDKNVIATFSSYTNRTTSSSTTDAIAAASVKNIN--RWVEPGKFF  396

Query  245  REKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMI  66
            RE MLK GT+MPMPDIRDKMP+RSFLPR+IA++LPFS+ ++ EL++IFHA + S M K++
Sbjct  397  RESMLKMGTVMPMPDIRDKMPRRSFLPRSIASKLPFSSTKVDELKQIFHAGQNSTMEKIM  456

Query  65   AGTLAECERAPSRDETKRCVT  3
            A  LAECERAPSR E+K+CV+
Sbjct  457  ADALAECERAPSRGESKQCVS  477


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 59/122 (48%), Gaps = 6/122 (5%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F++YG   NV D +F +YG +  G    F  Y  + N P+  F NYG+ G G   +F+ Y
Sbjct  146  FSTYGAQGNVADQSFNSYGVASTGGHGEFIEYNKDVNIPNLNFNNYGSSGEGRSHSFSGY  205

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFK  372
             + +N GA++F +Y +  N A   F  Y    N     FS YS        G G NN+F 
Sbjct  206  TEGTNAGAETFTTYSRNGNRAPSEFTAYATDSNTVGSGFSAYSQG------GDGANNSFT  259

Query  371  DY  366
             Y
Sbjct  260  SY  261


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 48/104 (46%), Gaps = 0/104 (0%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            FT+YG N      +FK Y    N    +F  Y+       + F  YGA GN    +FNSY
Sbjct  104  FTAYGANGVGRRDSFKGYSVDENLPVSSFRRYSRGSTIHRDEFSTYGAQGNVADQSFNSY  163

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD  420
               S  G   F  Y K  N  ++ F NYG +  G +  FSGY++
Sbjct  164  GVASTGGHGEFIEYNKDVNIPNLNFNNYGSSGEGRSHSFSGYTE  207



>ref|XP_010044636.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=621

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/261 (56%), Positives = 188/261 (72%), Gaps = 9/261 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +NGN A + FT+Y  +SN + + F  Y + G+G  ++FTSY FNGNNP N F +YG G
Sbjct  230  YSRNGNRAPSEFTAYATDSNTVGSGFSAYSQGGDGANNSFTSYGFNGNNPHNRFNSYGNG  289

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
             NG V+ F +YR+ +NVG DSF SY K S +A+V F NYGKTFN GTDKF+GY   +   
Sbjct  290  VNGAVENFKTYRESANVGEDSFTSYVKDSKSAEVNFANYGKTFNEGTDKFTGYGGGATGQ  349

Query  413  RVSFNGYGVNNTFKDYAKTGV-TFAGYLNATDVTA---AVGAAKGKMVNNKRWVEPGKFF  246
             V F  YGVNN+FK Y K  + TF+ Y N T  ++   A+ AA  K +N  RWVEPGKFF
Sbjct  350  AVGFKIYGVNNSFKGYDKNVIATFSSYTNRTTSSSTTDAIAAASVKNIN--RWVEPGKFF  407

Query  245  REKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMI  66
            RE MLK GT+MPMPDIRDKMP+RSFLPR+IA++LPFS+ ++ EL++IFHA + S M K++
Sbjct  408  RESMLKMGTVMPMPDIRDKMPRRSFLPRSIASKLPFSSTKVDELKQIFHAGQNSTMEKIM  467

Query  65   AGTLAECERAPSRDETKRCVT  3
            A  LAECERAPSR E+K+CV+
Sbjct  468  ADALAECERAPSRGESKQCVS  488


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 59/122 (48%), Gaps = 6/122 (5%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F++YG   NV D +F +YG +  G    F  Y  + N P+  F NYG+ G G   +F+ Y
Sbjct  157  FSTYGAQGNVADQSFNSYGVASTGGHGEFIEYNKDVNIPNLNFNNYGSSGEGRSHSFSGY  216

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFK  372
             + +N GA++F +Y +  N A   F  Y    N     FS YS        G G NN+F 
Sbjct  217  TEGTNAGAETFTTYSRNGNRAPSEFTAYATDSNTVGSGFSAYSQG------GDGANNSFT  270

Query  371  DY  366
             Y
Sbjct  271  SY  272


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 48/104 (46%), Gaps = 0/104 (0%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            FT+YG N      +FK Y    N    +F  Y+       + F  YGA GN    +FNSY
Sbjct  115  FTAYGANGVGRRDSFKGYSVDENLPVSSFRRYSRGSTIHRDEFSTYGAQGNVADQSFNSY  174

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD  420
               S  G   F  Y K  N  ++ F NYG +  G +  FSGY++
Sbjct  175  GVASTGGHGEFIEYNKDVNIPNLNFNNYGSSGEGRSHSFSGYTE  218



>emb|CDP12374.1| unnamed protein product [Coffea canephora]
Length=654

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 178/259 (69%), Gaps = 10/259 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNG    FTSYG+ SNV+ +AF  YGE GN   D+F +Y  N NNP N FKNYG+G
Sbjct  266  YAKNGNGVPLDFTSYGDTSNVIGSAFSGYGELGNAANDSFKAYGRNANNPSNNFKNYGSG  325

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  +D+F SYR  +N G D+F SYG+ SN+    FVNYGK+FN G D F  Y   +   
Sbjct  326  GNSGIDSFMSYRDSANAGTDTFQSYGRSSNSETANFVNYGKSFNEGIDTFKEYGKGAKGQ  385

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNK---RWVEPGKFFR  243
             + F  YGVNNTFKDYAK GV FA Y   T  +++ G    K +N+K   +WVE GKFFR
Sbjct  386  SIGFKIYGVNNTFKDYAKNGVAFALY---TKPSSSKGDDTSK-INSKSVNKWVEEGKFFR  441

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            E MLK GTI+ MPDIRDKMPKRSFLPR I+++LPFS +E+  +++IFHA++ S + ++I 
Sbjct  442  EYMLKDGTIIKMPDIRDKMPKRSFLPRLISSKLPFSTSELSAIKRIFHALDNSTLERVIV  501

Query  62   GTLAECERAPSRDETKRCV  6
              L ECERA SR E+KRCV
Sbjct  502  NALEECERAASRGESKRCV  520


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 70/145 (48%), Gaps = 8/145 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++ N     FTSY ++ NV +  F +YG    G +  F +Y    N PD  F +Y + 
Sbjct  182  YSRSSNDLHEDFTSYADDGNVANANFTSYGSGARGGSGEFKNYLPRVNVPDLRFTSYDSD  241

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV-  408
            GN    +F+SY  ++N G+ +F +Y K  N   + F +YG T N     FSGY +     
Sbjct  242  GNNHKLSFSSYVDDTNSGSQAFTNYAKNGNGVPLDFTSYGDTSNVIGSAFSGYGELGNAA  301

Query  407  --SFNGYGVN-----NTFKDYAKTG  354
              SF  YG N     N FK+Y   G
Sbjct  302  NDSFKAYGRNANNPSNNFKNYGSGG  326


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 70/157 (45%), Gaps = 22/157 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G    F +Y N  N    +F  Y  S N   + FTSYA +GN  +  F +YG+G
Sbjct  154  YGSSRLGGIDMFKNYSNGVNFATGSFARYSRSSNDLHEDFTSYADDGNVANANFTSYGSG  213

Query  584  GNG--------------PVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
              G              P   F SY  + N    SF+SY   +N+    F NY K  NG 
Sbjct  214  ARGGSGEFKNYLPRVNVPDLRFTSYDSDGNNHKLSFSSYVDDTNSGSQAFTNYAKNGNGV  273

Query  446  TDKFSGYSDSDRV---SFNGYG-----VNNTFKDYAK  360
               F+ Y D+  V   +F+GYG      N++FK Y +
Sbjct  274  PLDFTSYGDTSNVIGSAFSGYGELGNAANDSFKAYGR  310



>ref|XP_008340027.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=636

 Score =   277 bits (709),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 174/261 (67%), Gaps = 10/261 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KN NGA   FT YG ++NV+ + F  YG+SGNG  D F +Y  + NNP N F++YG G
Sbjct  244  YSKNANGAPNEFTGYGTSANVVGSGFTGYGQSGNGANDKFNNYGNDQNNPTNNFRSYGDG  303

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  V+TF SYR  +NVG DSF SY K SN   + F NYGK+FN G+DKF+GY   +   
Sbjct  304  GNAGVETFTSYRDSANVGXDSFQSYAKNSNGQKMDFTNYGKSFNVGSDKFTGYGQGAKGQ  363

Query  413  RVSFNGYGVNNTFKDYA-KTGVTFAGYLNA----TDVTAAVGAAKGKMVNNKRWVEPGKF  249
             + F  YG N TFKDYA K  V+F  Y  A      V A + AA G +V  K+WVEPGKF
Sbjct  364  EIGFKIYGANTTFKDYAKKETVSFKSYTKAGAGSEKVAATMAAASGSLV--KKWVEPGKF  421

Query  248  FREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKM  69
            FRE MLK G +MPMPDI+DK PKRSFLPR I ++LPF+ ++I  L++IFHA + S M K+
Sbjct  422  FRESMLKKGVVMPMPDIQDKTPKRSFLPRTILSKLPFATSKIAALKQIFHAADNSTMEKI  481

Query  68   IAGTLAECERAPSRDETKRCV  6
            I   L ECERAPS  ETKRCV
Sbjct  482  IVDALQECERAPSAGETKRCV  502


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 59/122 (48%), Gaps = 6/122 (5%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            FTSY N+ NV+D +F +Y     G A  F  YA + N P   F +Y    NG    F  Y
Sbjct  171  FTSYANDGNVVDQSFNSYAGGSTGGAGDFKKYADSVNVPHLGFNSYSDDSNGRSHGFTGY  230

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFK  372
             + +N G  SF+SY K +N A   F  YG + N     F+GY  S      G G N+ F 
Sbjct  231  SENANAGDQSFSSYSKNANGAPNEFTGYGTSANVVGSGFTGYGQS------GNGANDKFN  284

Query  371  DY  366
            +Y
Sbjct  285  NY  286


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 64/144 (44%), Gaps = 12/144 (8%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            FT+YG +      +FKNY    N   D+F  Y+ +  N  + F +Y   GN    +FNSY
Sbjct  129  FTNYGTDRLAGVDSFKNYSIGENLPVDSFRRYSRDSVNHKDQFTSYANDGNVVDQSFNSY  188

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV---SFNGY----  393
               S  GA  F  Y    N   +GF +Y    NG +  F+GYS++      SF+ Y    
Sbjct  189  AGGSTGGAGDFKKYADSVNVPHLGFNSYSDDSNGRSHGFTGYSENANAGDQSFSSYSKNA  248

Query  392  -GVNNTFKDYAKT----GVTFAGY  336
             G  N F  Y  +    G  F GY
Sbjct  249  NGAPNEFTGYGTSANVVGSGFTGY  272



>ref|XP_006303930.1| hypothetical protein CARUB_v10008588mg [Capsella rubella]
 gb|EOA36828.1| hypothetical protein CARUB_v10008588mg [Capsella rubella]
Length=623

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 179/256 (70%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F SYG +SNV+ + F NYGE+ N   DTF  Y  +GN P N FKNYGA 
Sbjct  243  YGKNGNGAPNEFASYGVSSNVIGSDFSNYGENANSANDTFKGYGGDGNVPRNNFKNYGAS  302

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR ++N G D+F+SY KKSN+  V FVNYGK+FN G++ F+GY   ++ +
Sbjct  303  GNAAVDTFLNYRDKANAGDDTFSSYAKKSNSQKVDFVNYGKSFNPGSETFTGYGKGAEGN  362

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFK YAKTGV FA Y  +           GK VN  RWVEPGKFFRE M
Sbjct  363  KIGFKTYTKNSTFKSYAKTGVEFAKYNQSR-------LRDGKTVN--RWVEPGKFFRESM  413

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++ MPD++DKMPKRSFLPR+I ++LPFS ++I E++++FHA + S M  +I   L
Sbjct  414  LKEGTLIWMPDVKDKMPKRSFLPRSIVSKLPFSTSKIAEIKRVFHARDNSTMEGIITNAL  473

Query  53   AECERAPSRDETKRCV  6
             ECER+P+  ETKRCV
Sbjct  474  TECERSPTIGETKRCV  489


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 74/146 (51%), Gaps = 9/146 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    FT Y +NSNV+D +F  YG S  G +D F SY    NNP + F  Y   
Sbjct  158  YSRDAAGHDDTFTGYADNSNVVDESFNTYGTSATGGSDEFKSYQSEVNNPTSRFTAYSDN  217

Query  584  GNGPVDTFNSYRQESNVGA-DSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDS  417
            GNG   TF +Y  + N G+  SF SYGK  N A   F +YG + N     FS Y   ++S
Sbjct  218  GNGRTQTFKTYAHDGNAGSGQSFTSYGKNGNGAPNEFASYGVSSNVIGSDFSNYGENANS  277

Query  416  DRVSFNGYG-----VNNTFKDYAKTG  354
               +F GYG       N FK+Y  +G
Sbjct  278  ANDTFKGYGGDGNVPRNNFKNYGASG  303


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 66/154 (43%), Gaps = 23/154 (15%)
 Frame = -1

Query  746  GAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVD  567
            G A  F  Y  + NV+  +F+ Y     G  DTFT YA N N  D +F  YG    G  D
Sbjct  136  GGADSFEKYSQDGNVVTDSFRRYSRDAAGHDDTFTGYADNSNVVDESFNTYGTSATGGSD  195

Query  566  TFNSYRQESNVGADSFNSYGK---------KSNAAD------VGFVNYGKTFNGGTDKFS  432
             F SY+ E N     F +Y           K+ A D        F +YGK  NG  ++F+
Sbjct  196  EFKSYQSEVNNPTSRFTAYSDNGNGRTQTFKTYAHDGNAGSGQSFTSYGKNGNGAPNEFA  255

Query  431  GYSDSDRV---SFNGYG-----VNNTFKDYAKTG  354
             Y  S  V    F+ YG      N+TFK Y   G
Sbjct  256  SYGVSSNVIGSDFSNYGENANSANDTFKGYGGDG  289



>ref|XP_004238669.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum lycopersicum]
Length=622

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/258 (55%), Positives = 177/258 (69%), Gaps = 10/258 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +N NGA + FTSY NNSNV+ + F NYGES NG   TF SY  N N P NTFK+YG  
Sbjct  238  YARNANGADSDFTSYANNSNVIGSTFTNYGESENGGGYTFNSYGSNANVPKNTFKSYGLS  297

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SDS  417
            GN P +TF +YR +SNVG D+F SY    N+    F NYG++F  G+D FS Y    +D+
Sbjct  298  GNAPFETFINYRDKSNVGHDNFVSYVDDPNSGRAHFQNYGQSFGEGSDDFSKYGSKITDA  357

Query  416  DRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
              + F  YGVN+TF +Y ++  TFA Y N T  ++ +G       NNK  VEPGKFFREK
Sbjct  358  QTIGFETYGVNSTFNEYGRSIPTFADYKNTTISSSLMGK------NNKWMVEPGKFFREK  411

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK GTIMPMPDI+DKMPKRSFLPR I+++LPFS ++IG+L+KIFHA   S M KMI   
Sbjct  412  MLKIGTIMPMPDIQDKMPKRSFLPRVISSKLPFSTSKIGDLKKIFHAGNDSQMEKMIDDA  471

Query  56   LAECERAPSRDETKRCVT  3
            L ECER+PS  ETK+CV+
Sbjct  472  LLECERSPSTGETKKCVS  489


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 78/172 (45%), Gaps = 38/172 (22%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGES----GNGDADTFTSYAFNGNNPDNTFKN  597
            Y + G G    F++Y  N NV+D +F  YG      G G    F  Y  N N P+  F  
Sbjct  153  YSRGGAGHDDIFSTYAPNGNVIDQSFNTYGTGLAAFGVGQ---FKIYGANVNVPNLRFTT  209

Query  596  YGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAAD------------VG--FVNYGKT  459
            Y   G G   +F SY +++N G  SF SY + +N AD            +G  F NYG++
Sbjct  210  YSTEGVGRKQSFTSYSKDTNSGTQSFTSYARNANGADSDFTSYANNSNVIGSTFTNYGES  269

Query  458  FNGGTDKFSGYSDSDRVSFNGYGVN-----NTFKDYAKTG-VTFAGYLNATD  321
             NGG     GY      +FN YG N     NTFK Y  +G   F  ++N  D
Sbjct  270  ENGG-----GY------TFNSYGSNANVPKNTFKSYGLSGNAPFETFINYRD  310


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 60/131 (46%), Gaps = 13/131 (10%)
 Frame = -1

Query  749  NGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPV  570
            +G  T F+SY      M   F NYG       D+F  YA N N P N+F+ Y  GG G  
Sbjct  108  HGQDTQFSSY------MSKNFTNYGNKLPRGFDSFKKYAENDNLPVNSFRQYSRGGAGHD  161

Query  569  DTFNSYRQESNVGADSFNSYGKKSNAADVG-FVNYGKTFNGGTDKFSGYSDSDRVSFNGY  393
            D F++Y    NV   SFN+YG    A  VG F  YG   N    +F+ YS        G 
Sbjct  162  DIFSTYAPNGNVIDQSFNTYGTGLAAFGVGQFKIYGANVNVPNLRFTTYSTE------GV  215

Query  392  GVNNTFKDYAK  360
            G   +F  Y+K
Sbjct  216  GRKQSFTSYSK  226



>gb|KDO82432.1| hypothetical protein CISIN_1g044596mg [Citrus sinensis]
Length=644

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 175/256 (68%), Gaps = 6/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SY   SNV+ + F +YGE+GN   DTF SY  +GN P+  FK+YG G
Sbjct  255  YGKNGNGLPNEFMSYAKESNVIQSNFTSYGEAGNAANDTFKSYGSDGNVPEQNFKSYGDG  314

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  +++F SY  +SNVGA++F SY K SN   V F NY + FN  + +FSGY   +D  
Sbjct  315  GNSGIESFTSYNPQSNVGANNFKSYAKSSNTEKVNFANYQEDFNSVSHRFSGYGENADGQ  374

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  YG + +FKDYAKTGVTFA Y      + +  +      NN +WVEPGKFFRE M
Sbjct  375  KIGFKVYGPDRSFKDYAKTGVTFASYSKNGSGSTSGSSVNK---NNNKWVEPGKFFRESM  431

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK+GT+MPMPDIRDKMP+RSFLPR I ++LPFS++ +  L++IFHA E S+M  +I   L
Sbjct  432  LKTGTVMPMPDIRDKMPQRSFLPRAIVSKLPFSSSNVNVLKEIFHASENSSMESIIKDAL  491

Query  53   AECERAPSRDETKRCV  6
            +ECER PS+ ETKRC+
Sbjct  492  SECERQPSKGETKRCI  507


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 70/137 (51%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F++Y ++SNV+D +F  YG    G A  F SY    N P+  F +Y   
Sbjct  171  YSRDSAGHNDKFSAYASHSNVVDDSFNTYGTGATGGAGDFKSYNREVNVPNLRFTSYSDA  230

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
            GNG   TF+SY + +N G +SF+SYGK  N     F++Y K  N     F+ Y ++    
Sbjct  231  GNGRAQTFSSYTENTNSGGESFSSYGKNGNGLPNEFMSYAKESNVIQSNFTSYGEA----  286

Query  404  FNGYGVNNTFKDYAKTG  354
              G   N+TFK Y   G
Sbjct  287  --GNAANDTFKSYGSDG  301


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 70/152 (46%), Gaps = 28/152 (18%)
 Frame = -1

Query  749  NGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPV  570
            +GA   F  Y N +      F NYG +G G  ++F +Y+ +GN   ++F+ Y     G  
Sbjct  126  HGADANFAVYENKN------FTNYGTAGLGGVNSFKNYSEDGNVEVDSFRRYSRDSAGHN  179

Query  569  DTFNSYRQESNVGADSFN--------------SYGKKSNAADVGFVNYGKTFNGGTDKFS  432
            D F++Y   SNV  DSFN              SY ++ N  ++ F +Y    NG    FS
Sbjct  180  DKFSAYASHSNVVDDSFNTYGTGATGGAGDFKSYNREVNVPNLRFTSYSDAGNGRAQTFS  239

Query  431  GYSD---SDRVSFNGYGVN-----NTFKDYAK  360
             Y++   S   SF+ YG N     N F  YAK
Sbjct  240  SYTENTNSGGESFSSYGKNGNGLPNEFMSYAK  271



>ref|XP_006438392.1| hypothetical protein CICLE_v10030930mg [Citrus clementina]
 gb|ESR51632.1| hypothetical protein CICLE_v10030930mg [Citrus clementina]
Length=644

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 175/256 (68%), Gaps = 6/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SY   SNV+ + F +YGE+GN   DTF SY  +GN P+  FK+YG G
Sbjct  255  YGKNGNGLPNEFMSYAKESNVIQSNFTSYGEAGNAANDTFKSYGSDGNVPEQNFKSYGDG  314

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  +++F SY  +SNVGA++F SY K SN   V F NY + FN  + KFSGY   +D  
Sbjct  315  GNSGIESFTSYNPQSNVGANNFKSYAKSSNTEKVNFANYQEDFNSVSHKFSGYGENADGQ  374

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  YG + +FKDYAKTGVTFA Y  +   +A   +      NN +WVEPGKFFRE M
Sbjct  375  KIGFKVYGPDRSFKDYAKTGVTFASYSKSGSGSANGSSVNK---NNNKWVEPGKFFRESM  431

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK+GT+MPMPDIRDKMP+RSFLPR I ++ PFS++ +  L++IFHA E S+M  +I   L
Sbjct  432  LKTGTVMPMPDIRDKMPQRSFLPRAIVSKFPFSSSNVNVLKEIFHASENSSMESIIKDAL  491

Query  53   AECERAPSRDETKRCV  6
            +ECER PS+ ETKRC+
Sbjct  492  SECERPPSKGETKRCI  507


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 70/137 (51%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F++Y ++SNV+D +F  YG    G A  F SY    N P+  F +Y   
Sbjct  171  YSRDSAGHNDKFSAYASHSNVVDDSFNTYGTGATGGAGDFKSYNREVNVPNLRFTSYSDA  230

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
            GNG   TF+SY + +N G +SF+SYGK  N     F++Y K  N     F+ Y ++    
Sbjct  231  GNGRAQTFSSYTENTNSGGESFSSYGKNGNGLPNEFMSYAKESNVIQSNFTSYGEA----  286

Query  404  FNGYGVNNTFKDYAKTG  354
              G   N+TFK Y   G
Sbjct  287  --GNAANDTFKSYGSDG  301


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 70/152 (46%), Gaps = 28/152 (18%)
 Frame = -1

Query  749  NGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPV  570
            +GA   F  Y N +      F NYG +G G  ++F +Y+ +GN   ++F+ Y     G  
Sbjct  126  HGADANFAVYENKN------FTNYGTAGLGGVNSFKNYSEDGNVEVDSFRRYSRDSAGHN  179

Query  569  DTFNSYRQESNVGADSFN--------------SYGKKSNAADVGFVNYGKTFNGGTDKFS  432
            D F++Y   SNV  DSFN              SY ++ N  ++ F +Y    NG    FS
Sbjct  180  DKFSAYASHSNVVDDSFNTYGTGATGGAGDFKSYNREVNVPNLRFTSYSDAGNGRAQTFS  239

Query  431  GYSD---SDRVSFNGYGVN-----NTFKDYAK  360
             Y++   S   SF+ YG N     N F  YAK
Sbjct  240  SYTENTNSGGESFSSYGKNGNGLPNEFMSYAK  271



>ref|XP_004509821.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=624

 Score =   275 bits (702),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 182/259 (70%), Gaps = 10/259 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNY-GESGNGDADTFTSYAFNGNNPDNTFKNYGA  588
            YGK+  GA  GF +YG +SNV  + F +Y GE    + DTFT+Y  N NNP   FKNYG 
Sbjct  236  YGKDSVGAVNGFDAYGTDSNVASSGFSSYAGEQSTSENDTFTNYGVNMNNPTENFKNYGK  295

Query  587  GGNGPVDTFNSYRQESNVGADSFNSYGKKSNA-ADVGFVNYGKTFNGGTDKFSGYS---D  420
            G     + F++YR ++NVGADSF+SYGK S     V F NYGK+FN GTD F GY+   D
Sbjct  296  GSFVANEKFSNYRDQANVGADSFSSYGKDSRGGIHVDFNNYGKSFNEGTDTFKGYAKGAD  355

Query  419  SD-RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFR  243
             D +VSF GYGVNNTFKDY K G++FA Y NA+  T +V  +   +   K+WV+PGKFFR
Sbjct  356  LDHKVSFKGYGVNNTFKDYDKKGISFAAYTNASS-TNSVSVSDSLV---KKWVQPGKFFR  411

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            E MLK GT+MPMPDI+DK+PKRSFLPR I  +LPFS++++ EL+++F   + S+M KMI 
Sbjct  412  EMMLKQGTVMPMPDIKDKLPKRSFLPRTILTKLPFSSSKLNELKQVFKVSDNSSMEKMIV  471

Query  62   GTLAECERAPSRDETKRCV  6
             +L+ECERAPS+ E KRCV
Sbjct  472  DSLSECERAPSKGENKRCV  490



>ref|XP_004298578.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Fragaria vesca subsp. vesca]
Length=624

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 141/257 (55%), Positives = 176/257 (68%), Gaps = 8/257 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y K+GNGA   FT YG +SNV  + F  Y ESGNG  DTFT+Y  + NNP   FK+YG G
Sbjct  238  YAKHGNGAPNEFTGYGTSSNVAASDFTGYSESGNGINDTFTNYGNDENNPTERFKSYGDG  297

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   + F++YR ++NVG  SF SYGK SN+  V FVNYGK+FN G++ F+GY   S   
Sbjct  298  GNAGSEKFSNYRDKANVGESSFQSYGKNSNSDKVSFVNYGKSFNNGSESFTGYGKGSQGG  357

Query  413  RVSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             V F  YG NNTFKDY  K    F  Y+   D   ++ +A G +   KRWVEPGKFFRE 
Sbjct  358  SVGFKIYGFNNTFKDYKDKKSAKFTEYV--ADEKTSLASASGSLA--KRWVEPGKFFRES  413

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK GT+MP PDI+DKMP+RSFLPR I+++LPF+ A++ EL++IFHA + S M K+I   
Sbjct  414  MLKKGTVMPFPDIKDKMPERSFLPRTISSKLPFATAKLSELKRIFHAEDNSTMEKIITDA  473

Query  56   LAECERAPSRDETKRCV  6
            L ECERAPS+ ETKRCV
Sbjct  474  LQECERAPSKGETKRCV  490


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 64/125 (51%), Gaps = 12/125 (10%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYG---ESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTF  561
            F +Y  + NV+D +F +Y     SG GD   F  YA + N P+  F +Y    NG   +F
Sbjct  165  FNNYAADGNVIDQSFNSYAAGATSGTGD---FKRYADSTNVPNLRFTSYSDDSNGRAQSF  221

Query  560  NSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNN  381
             +Y + +N G  SF SY K  N A   F  YG + N     F+GYS+S      G G+N+
Sbjct  222  TAYSENANAGQQSFTSYAKHGNGAPNEFTGYGTSSNVAASDFTGYSES------GNGIND  275

Query  380  TFKDY  366
            TF +Y
Sbjct  276  TFTNY  280



>ref|XP_010682558.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Beta vulgaris subsp. vulgaris]
Length=651

 Score =   275 bits (703),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 178/262 (68%), Gaps = 11/262 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG   GF+ YG N+NV+ + F  Y ++GN   D+FTSY FNGN P+N F +Y  G
Sbjct  257  YGKNGNGLINGFSRYGENTNVVGSTFSGYSQTGNSGNDSFTSYGFNGNVPENKFNSYADG  316

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
            GN  V++F+SYR +SNVG D F SY K SN   V F NY ++FN G+D F+GY +  +  
Sbjct  317  GNAGVESFSSYRDQSNVGDDVFKSYAKSSNIQKVEFGNYAQSFNQGSDNFTGYGEGAKGQ  376

Query  410  -VSFNGYGVNNTFKDYAKTGVTFAGYLN------ATDVTAAVGAAKGKMVNNKRWVEPGK  252
             + F+ YG  + FK YAK GVTFA Y N      +      + A KGK VN  +WVEPGK
Sbjct  377  DIGFSTYGQGSNFKSYAKKGVTFADYRNTSSSTSSGGGVGVLMANKGKKVN--KWVEPGK  434

Query  251  FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAK  72
            FFRE+MLK GTIMPMPD++DKMP RSFLPR+I +++PF +++I +L +IFHA + S M  
Sbjct  435  FFRERMLKEGTIMPMPDVKDKMPPRSFLPRSILSKIPFESSKITQLREIFHAFDNSTMEG  494

Query  71   MIAGTLAECERAPSRDETKRCV  6
            M+   L ECERAPS  ETK+CV
Sbjct  495  MLNAALRECERAPSMGETKKCV  516


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 86/184 (47%), Gaps = 13/184 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F +Y  + NV+   F  Y     G A +F+SYA N N P   F +Y   
Sbjct  173  YSRDSAGHNDEFINYAKDGNVISQTFNTYAAGATGGAGSFSSYADNVNAPGLQFTSYLDE  232

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYS---DSD  414
             NG V++F SY  E+N G   F +YGK  N    GF  YG+  N     FSGYS   +S 
Sbjct  233  ANGRVNSFKSYSTEANAGDQGFGNYGKNGNGLINGFSRYGENTNVVGSTFSGYSQTGNSG  292

Query  413  RVSFNGYGVN-----NTFKDYAKTG----VTFAGYLNATDVTAAVGAAKGKMVNNKRWVE  261
              SF  YG N     N F  YA  G     +F+ Y + ++V   V  +  K  N ++ VE
Sbjct  293  NDSFTSYGFNGNVPENKFNSYADGGNAGVESFSSYRDQSNVGDDVFKSYAKSSNIQK-VE  351

Query  260  PGKF  249
             G +
Sbjct  352  FGNY  355


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 65/137 (47%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y    N     F  Y  +S   +  F NY + GN  + TF +YA        +F +Y   
Sbjct  159  YSAEENEPLDSFRRYSRDSAGHNDEFINYAKDGNVISQTFNTYAAGATGGAGSFSSYADN  218

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
             N P   F SY  E+N   +SF SY  ++NA D GF NYGK  NG  + FS Y ++  V 
Sbjct  219  VNAPGLQFTSYLDEANGRVNSFKSYSTEANAGDQGFGNYGKNGNGLINGFSRYGENTNV-  277

Query  404  FNGYGVNNTFKDYAKTG  354
                 V +TF  Y++TG
Sbjct  278  -----VGSTFSGYSQTG  289



>ref|XP_009363551.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
isoform X1 [Pyrus x bretschneideri]
Length=646

 Score =   275 bits (702),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 176/271 (65%), Gaps = 20/271 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   FT YG N+NV+ + F  YG+SGNG  D F +Y  + N+P N FK+YG G
Sbjct  244  YSKNGNGAPNEFTGYGTNANVVGSGFTAYGQSGNGANDKFNNYGNDQNDPANNFKSYGDG  303

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
            GN  V+TF SYR+ +NVG DSF SY K SN   + F +YGK+FN G+DKF+GY    R  
Sbjct  304  GNAGVETFTSYRERANVGDDSFQSYAKNSNGEKMDFTSYGKSFNIGSDKFTGYGKGARGQ  363

Query  410  -VSFNGYGVNNTFKDYA-KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             + F  YGVN TFKDYA K  V+F  Y  A   +    AA G MV  K+WVEPGKFFRE 
Sbjct  364  DIGFKIYGVNTTFKDYAKKETVSFKSYTKAGAGSVKAAAASGSMV--KKWVEPGKFFRES  421

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G +MPMPDI+DKMPKRSFLPR I ++LPF+ ++I  L++IFHA + S M K+I   
Sbjct  422  MLKKGVVMPMPDIQDKMPKRSFLPRTILSKLPFATSKIAALKQIFHAADNSTMEKIIVDA  481

Query  56   LAE--------------CERAPSRDETKRCV  6
            L E              CERAPS  ETKRCV
Sbjct  482  LQEXXXXXXXXXXXXXXCERAPSAGETKRCV  512


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/155 (30%), Positives = 66/155 (43%), Gaps = 22/155 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNT-------  606
            YG +       F +Y    N+   +F+ Y        D FTSYA +GN  D +       
Sbjct  132  YGTDRLAGVDSFKNYSLGENLPVDSFRRYSRDSVNHKDQFTSYANDGNVVDQSFNGYAAG  191

Query  605  -------FKNYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                   FK Y    N P   FNSY  +SN  +  F  Y + +NA D  F +Y K  NG 
Sbjct  192  ATGGAGDFKKYADSVNVPHLGFNSYSDDSNGRSHGFTGYSENANAGDQSFTSYSKNGNGA  251

Query  446  TDKFSGYSDSDRVSFNGY--------GVNNTFKDY  366
             ++F+GY  +  V  +G+        G N+ F +Y
Sbjct  252  PNEFTGYGTNANVVGSGFTAYGQSGNGANDKFNNY  286



>ref|XP_006365226.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=625

 Score =   274 bits (701),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 146/258 (57%), Positives = 174/258 (67%), Gaps = 7/258 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +N NGA   FTSY NNSNV+ + F NYGES NG  +TF SY  N N P NTFK+YG  
Sbjct  238  YARNANGAVNDFTSYANNSNVIGSTFTNYGESENGGGNTFNSYGSNANVPKNTFKSYGLS  297

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SDS  417
            GN P +TF +YR +SNVG D+F SY    N+    F NYG++F  G+D FS Y    +D+
Sbjct  298  GNAPFETFINYRDKSNVGDDNFVSYVDDPNSGRAHFQNYGQSFGEGSDGFSKYGSKITDA  357

Query  416  DRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
              + F  YGVN+TF +Y K+  TF  Y N T +        GK  NNK  VEPGKFFREK
Sbjct  358  QTIGFETYGVNSTFNEYGKSIPTFTDYKNKT-INQISSFLMGK--NNKWMVEPGKFFREK  414

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK GTIMPMPDI+DKMPKRSFLPR IA++LPFS ++IG L+KIFHA   S M KMI   
Sbjct  415  MLKIGTIMPMPDIQDKMPKRSFLPRVIASKLPFSTSKIGNLKKIFHAGNDSQMGKMIDDA  474

Query  56   LAECERAPSRDETKRCVT  3
            L ECER+PS  ETKRCV+
Sbjct  475  LVECERSPSAGETKRCVS  492


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/186 (30%), Positives = 75/186 (40%), Gaps = 38/186 (20%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG    G    F  Y  N N+   +F+ Y   G G  D F++YA NGN  D +F  YG G
Sbjct  125  YGNKLPGGFDSFKKYAENDNLPVNSFRQYSRGGAGHDDIFSTYAPNGNVIDQSFNTYGTG  184

Query  584  ---------------GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNG  450
                            N P   F +Y  E      SF SY K +N+    F +Y +  NG
Sbjct  185  LAAFGVGQFKIYGPNVNVPNLRFTTYSTEGVGRKQSFTSYSKDTNSGSQSFTSYARNANG  244

Query  449  GTDKFSGYSDSDRV-----------------SFNGYGVN-----NTFKDYAKTG-VTFAG  339
              + F+ Y+++  V                 +FN YG N     NTFK Y  +G   F  
Sbjct  245  AVNDFTSYANNSNVIGSTFTNYGESENGGGNTFNSYGSNANVPKNTFKSYGLSGNAPFET  304

Query  338  YLNATD  321
            ++N  D
Sbjct  305  FINYRD  310


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 62/131 (47%), Gaps = 13/131 (10%)
 Frame = -1

Query  749  NGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPV  570
            +G  T F+SY + +      F NYG    G  D+F  YA N N P N+F+ Y  GG G  
Sbjct  108  HGQDTQFSSYTSKN------FTNYGNKLPGGFDSFKKYAENDNLPVNSFRQYSRGGAGHD  161

Query  569  DTFNSYRQESNVGADSFNSYGKKSNAADVG-FVNYGKTFNGGTDKFSGYSDSDRVSFNGY  393
            D F++Y    NV   SFN+YG    A  VG F  YG   N    +F+ YS        G 
Sbjct  162  DIFSTYAPNGNVIDQSFNTYGTGLAAFGVGQFKIYGPNVNVPNLRFTTYSTE------GV  215

Query  392  GVNNTFKDYAK  360
            G   +F  Y+K
Sbjct  216  GRKQSFTSYSK  226



>gb|KEH20007.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=627

 Score =   274 bits (700),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 135/258 (52%), Positives = 177/258 (69%), Gaps = 7/258 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+  GA   FT+YG +SNV  + F +Y + G G+ DTF +Y  N NNP   FKNY +G
Sbjct  238  YGKDSAGAENKFTAYGTDSNVASSGFSSYADQGTGNKDTFVNYGVNMNNPTENFKNYASG  297

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNA-ADVGFVNYGKTFNGGTDKFSGYS---DS  417
              G  + F++YR ++NVGADSF SY K S     V F NYGK+FN GTD F GY+   D+
Sbjct  298  SLGAAEKFSNYRDQANVGADSFTSYAKDSTGGTHVDFDNYGKSFNEGTDSFKGYAKGADA  357

Query  416  D-RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
            D +++F GYGVNNTFKDY K G++FAGY   +  +    +    +   K+WV+PGKFFRE
Sbjct  358  DHKITFKGYGVNNTFKDYDKKGISFAGYTKKSSSSTNSVSESVSLA--KKWVQPGKFFRE  415

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
            KMLK G +MPMPDI+DK+P RSFLPR I  +LPF+++++ EL+++F   E S+M KMI  
Sbjct  416  KMLKQGVVMPMPDIKDKLPPRSFLPRTILTKLPFASSKLNELKQVFKVSENSSMDKMIVD  475

Query  59   TLAECERAPSRDETKRCV  6
            +L ECERAPS  ETKRCV
Sbjct  476  SLGECERAPSMGETKRCV  493


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 66/142 (46%), Gaps = 8/142 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    FT+Y   +NV D  F  YG    G +  F +YA   N P+  F  Y  G
Sbjct  154  YSRSSAGHNDSFTNYALETNVADQNFNTYGSGAAGGSGDFKAYAKGTNVPNLRFTTYSVG  213

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS---D  414
              G    F SY +  N G  SF +YGK S  A+  F  YG   N  +  FS Y+D    +
Sbjct  214  VAGRQQEFTSYSEAGNAGDQSFGNYGKDSAGAENKFTAYGTDSNVASSGFSSYADQGTGN  273

Query  413  RVSFNGYGVN-----NTFKDYA  363
            + +F  YGVN       FK+YA
Sbjct  274  KDTFVNYGVNMNNPTENFKNYA  295



>ref|XP_010498883.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=633

 Score =   274 bits (700),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 182/256 (71%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F+SYG +SNV+ + F NYGE+ N   DTF  Y  +GN P N FK+YGA 
Sbjct  253  YGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENANAANDTFKGYGGDGNVPRNNFKSYGAS  312

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR ++NVG D+F+SY K SN+  VGFVNYGK+FN G++ F+GY   ++ +
Sbjct  313  GNAAVDTFLNYRDKANVGDDTFSSYAKNSNSEKVGFVNYGKSFNPGSESFTGYGKGAEGN  372

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDYAKTGV FA Y N + +        GK VN  +WVEPGKFFRE M
Sbjct  373  KIDFKTYTKNSTFKDYAKTGVEFARY-NQSKLR------DGKTVN--KWVEPGKFFRESM  423

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK G ++ MPDI+DKMPKRSFLPR+I ++LPFS ++I E++++FHA + S M  +I   +
Sbjct  424  LKEGMLIWMPDIKDKMPKRSFLPRSIVSKLPFSTSKIAEIKRLFHARDNSTMEGIITDAV  483

Query  53   AECERAPSRDETKRCV  6
             ECER P+  ETKRCV
Sbjct  484  TECERLPTVGETKRCV  499


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 71/160 (44%), Gaps = 23/160 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYG--  591
            YG    G A  F  Y  N NV+  +F+ Y     G  D+FT YA N N  D  FK+YG  
Sbjct  140  YGTTRPGGADSFEKYSQNGNVVTDSFRRYSRDAAGHDDSFTGYADNSNVVDENFKSYGTS  199

Query  590  ------------AGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAAD-VGFVNYGKTFNG  450
                        +G N P   F +Y  + N  A +F +Y  + NA     F +YGK  NG
Sbjct  200  ATGGSGEFKAYQSGVNNPTSRFTAYSDDGNGRAQTFKTYTHEGNAGPGQSFTSYGKNGNG  259

Query  449  GTDKFSGYSDSDRV---SFNGYG-----VNNTFKDYAKTG  354
              ++FS Y  S  V    F+ YG      N+TFK Y   G
Sbjct  260  APNEFSSYGVSSNVIGSDFSNYGENANAANDTFKGYGGDG  299


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 53/112 (47%), Gaps = 6/112 (5%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G AD+F  Y+ NGN   ++F+ Y     G  D+F  Y   SNV  ++F SY
Sbjct  137  FTNYGTTRPGGADSFEKYSQNGNVVTDSFRRYSRDAAGHDDSFTGYADNSNVVDENFKSY  196

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG  354
            G  +      F  Y    N  T +F+ YSD      +G G   TFK Y   G
Sbjct  197  GTSATGGSGEFKAYQSGVNNPTSRFTAYSD------DGNGRAQTFKTYTHEG  242



>ref|XP_002511417.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
 gb|EEF52019.1| Polygalacturonase-1 non-catalytic subunit beta precursor, putative 
[Ricinus communis]
Length=637

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 170/257 (66%), Gaps = 12/257 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK GNG    F +Y  +SN++++ F  YGE GN   D+F  Y  +GNNP N FK+YG G
Sbjct  255  YGKKGNGVPAEFATYSGDSNIIESTFTGYGELGNVANDSFAGYGLSGNNPHNNFKSYGTG  314

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
            GN  +D+F+SYR  +NVG DSF SY + +NA  V F NYGKTFN G D F  Y    +  
Sbjct  315  GNSAIDSFSSYRNGANVGQDSFQSYARNTNAGKVSFTNYGKTFNPGNDTFKEYGKGSKGN  374

Query  410  --VSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
              V F  YG + +FK+Y + GVTFA Y N T  +       G  V N+RWVEPGKFFRE 
Sbjct  375  TAVGFKIYGPDRSFKEYIQKGVTFAAYANTTSTS-------GSFV-NRRWVEPGKFFRES  426

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G ++ MPDI DKMPKRSFLPR+I ++LPFS+  + EL+++FHA+E S M  ++   
Sbjct  427  MLKQGNVVVMPDITDKMPKRSFLPRSIVSKLPFSSPRLSELKEVFHALENSTMECVLVNA  486

Query  56   LAECERAPSRDETKRCV  6
            LAECER PS+ ETKRCV
Sbjct  487  LAECEREPSQGETKRCV  503


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 76/161 (47%), Gaps = 12/161 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G +  FT+Y  + NV +  F NYG    G +  F +Y    N P   F  Y + 
Sbjct  171  YSRDATGHSEAFTNYATDGNVANATFGNYGAGATGGSGVFKNYDDRVNVPGLRFTTYDSD  230

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV-  408
            GN    +F+SY  ++N G++SF SYGKK N     F  Y    N     F+GY +   V 
Sbjct  231  GNNHKLSFSSYSGDTNSGSESFTSYGKKGNGVPAEFATYSGDSNIIESTFTGYGELGNVA  290

Query  407  --SFNGYGV-----NNTFKDYAKTG----VTFAGYLNATDV  318
              SF GYG+     +N FK Y   G     +F+ Y N  +V
Sbjct  291  NDSFAGYGLSGNNPHNNFKSYGTGGNSAIDSFSSYRNGANV  331



>ref|XP_010460151.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=623

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 182/256 (71%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F+SYG +SNV+ + F NYGE+ N   DTF  Y  +GN P N FK+YGA 
Sbjct  243  YGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENANAANDTFKGYGGDGNVPRNNFKSYGAS  302

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR ++NVG D+F+SY K SN+  V FVNYGK+FN G++ F+GY   ++ +
Sbjct  303  GNAAVDTFLNYRDKANVGDDTFSSYAKNSNSQKVNFVNYGKSFNPGSESFTGYGKGAEGN  362

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDYAKTGV FA Y N + +        GK VN  +WVEPGKFFRE M
Sbjct  363  KIDFKTYTKNSTFKDYAKTGVGFARY-NQSKLR------DGKTVN--KWVEPGKFFRESM  413

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++ MPDI+DKMPKRSFLPR+I ++LPFS ++I E++++FHA + S M  +I   +
Sbjct  414  LKEGTLIWMPDIKDKMPKRSFLPRSIVSKLPFSTSKIAEIKRVFHARDNSTMEGIITDAV  473

Query  53   AECERAPSRDETKRCV  6
             ECER P+  ETKRCV
Sbjct  474  TECERLPTVGETKRCV  489


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 70/160 (44%), Gaps = 23/160 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYG--  591
            YG    G A  F  Y  N NV+  +F+ Y     G  D+FT YA N N  D  F +YG  
Sbjct  130  YGTTRPGGADSFQKYSQNGNVVTDSFRRYSRDAAGHDDSFTGYADNSNVVDENFNSYGTS  189

Query  590  ------------AGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAAD-VGFVNYGKTFNG  450
                        +G N P   F +Y  + N  A +F +Y  K NA     F +YGK  NG
Sbjct  190  ATGGSDEFKTYQSGVNNPTSRFTAYSDDGNGRAQTFKTYTHKGNAGPGQSFTSYGKNGNG  249

Query  449  GTDKFSGYSDSDRV---SFNGYG-----VNNTFKDYAKTG  354
              ++FS Y  S  V    F+ YG      N+TFK Y   G
Sbjct  250  APNEFSSYGVSSNVIGSDFSNYGENANAANDTFKGYGGDG  289


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G AD+F  Y+ NGN   ++F+ Y     G  D+F  Y   SNV  ++FNSY
Sbjct  127  FTNYGTTRPGGADSFQKYSQNGNVVTDSFRRYSRDAAGHDDSFTGYADNSNVVDENFNSY  186

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG  354
            G  +      F  Y    N  T +F+ YSD      +G G   TFK Y   G
Sbjct  187  GTSATGGSDEFKTYQSGVNNPTSRFTAYSD------DGNGRAQTFKTYTHKG  232



>ref|XP_006483847.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Citrus sinensis]
Length=644

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 177/256 (69%), Gaps = 6/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SY   SNV+ + F +YGE+GN   DTF SY  +GN P+  FK+YG G
Sbjct  255  YGKNGNGLPNEFMSYAKESNVIQSNFTSYGEAGNAANDTFKSYGSDGNVPEQNFKSYGDG  314

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  +++F SY  +SNVGA++F SY K SN   V F NY + FN  + KFSGY   +D  
Sbjct  315  GNSGIESFTSYNPQSNVGANNFKSYAKSSNTEKVNFANYQEDFNSVSHKFSGYGENADGQ  374

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  YG + +FKDYAKTGVTFA Y  +   +A+  +      NN +WVEPGKFFRE M
Sbjct  375  KIGFKVYGPDRSFKDYAKTGVTFASYSKSGSGSASGSSVNK---NNNKWVEPGKFFRESM  431

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK+GT+MPMPDIRDKMP+RSFLPR I ++LPFS++ +  L++IFHA E S+M  +I   L
Sbjct  432  LKTGTVMPMPDIRDKMPQRSFLPRAIVSKLPFSSSNVNVLKEIFHASENSSMESIIKDAL  491

Query  53   AECERAPSRDETKRCV  6
            +ECER PS+ ETKRC+
Sbjct  492  SECERPPSKGETKRCI  507


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 70/137 (51%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F++Y ++SNV+D +F  YG    G A  F SY    N P+  F +Y   
Sbjct  171  YSRDSAGHNDKFSAYASHSNVVDDSFNTYGTGATGGAGDFKSYNREVNVPNLRFTSYSDA  230

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
            GNG   TF+SY + +N G +SF+SYGK  N     F++Y K  N     F+ Y ++    
Sbjct  231  GNGRAQTFSSYTENTNSGGESFSSYGKNGNGLPNEFMSYAKESNVIQSNFTSYGEA----  286

Query  404  FNGYGVNNTFKDYAKTG  354
              G   N+TFK Y   G
Sbjct  287  --GNAANDTFKSYGSDG  301


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 70/152 (46%), Gaps = 28/152 (18%)
 Frame = -1

Query  749  NGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPV  570
            +GA   F  Y N +      F NYG +G G  ++F +Y+ +GN   ++F+ Y     G  
Sbjct  126  HGADANFAVYENKN------FTNYGTAGLGGVNSFKNYSEDGNVEVDSFRRYSRDSAGHN  179

Query  569  DTFNSYRQESNVGADSFN--------------SYGKKSNAADVGFVNYGKTFNGGTDKFS  432
            D F++Y   SNV  DSFN              SY ++ N  ++ F +Y    NG    FS
Sbjct  180  DKFSAYASHSNVVDDSFNTYGTGATGGAGDFKSYNREVNVPNLRFTSYSDAGNGRAQTFS  239

Query  431  GYSD---SDRVSFNGYGVN-----NTFKDYAK  360
             Y++   S   SF+ YG N     N F  YAK
Sbjct  240  SYTENTNSGGESFSSYGKNGNGLPNEFMSYAK  271



>ref|XP_010551569.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=625

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 176/256 (69%), Gaps = 11/256 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+G G    F+SY  NSNV+ + F NYG  G+   ++FT+Y  + N P N F++YG+ 
Sbjct  244  YGKHGTGDVDDFSSYAVNSNVVGSGFANYGTHGHVANESFTNYGIDSNVPQNNFRSYGSE  303

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN    TF++YR  SNVG D F+SY K SNA  V FVNYG+TFN G+D F+GY   +   
Sbjct  304  GNAATQTFSNYRDRSNVGDDRFSSYAKNSNAEKVNFVNYGQTFNPGSDTFTGYGKGAKGH  363

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  YGVN TFKDYAK GV FA Y         +  + GK VN  RW+EPGKFFRE M
Sbjct  364  KIGFKTYGVNTTFKDYAKKGVEFAKY------NQTMPLSDGKSVN--RWIEPGKFFREAM  415

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK G  +PMPDIRDKMPKRSFLPRNI ++LPFSA++I ++++IF A + S M ++I+  L
Sbjct  416  LKEGNTIPMPDIRDKMPKRSFLPRNIISKLPFSASKIADIKRIFGAGDNSTMERIISDAL  475

Query  53   AECERAPSRDETKRCV  6
            +ECER+PS  ETKRCV
Sbjct  476  SECERSPSAGETKRCV  491


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 59/123 (48%), Gaps = 12/123 (10%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G  D+F +Y+ + N   ++F+ Y     G  D F++Y   SNV  +SFNSY
Sbjct  129  FTNYGTTRAGGVDSFKNYSQDSNVVADSFRRYSRDSAGHDDKFSNYATSSNVVEESFNSY  188

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDYAK-----TGVTF  345
            G  +      F NY    N  T  F+ YSDS   +        TFK Y++     +G +F
Sbjct  189  GGSTAGGSGTFTNYHNDVNNPTSTFTSYSDSAIRT-------QTFKTYSRDANAGSGQSF  241

Query  344  AGY  336
              Y
Sbjct  242  TSY  244



>ref|NP_173788.1| putative polygalacturonase non-catalytic subunit JP630 [Arabidopsis 
thaliana]
 sp|P92982.2|JP630_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
JP630; AltName: Full=Aromatic-rich glycoprotein JP630; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAC98031.1| Identical to gb|ATU59467 aromatic rich glycoprotein which is 
strongly similar to gb|U63373 polygalacturonase isozyme 1 from 
Arabidopsis thaliana. EST gb|AA395212 comes from this gene 
[Arabidopsis thaliana]
 gb|AEE30429.1| putative polygalacturonase non-catalytic subunit JP630 [Arabidopsis 
thaliana]
Length=622

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 178/256 (70%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F+SYG +SNV+ + F NYGE+GN   DTF  Y  +GN P N FK+YGA 
Sbjct  242  YGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGAS  301

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR  +NVG DSF+SY K SN   V FVNYGK+ N G++ FSGY   ++ +
Sbjct  302  GNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGN  361

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDY KTGV FA Y  ++          GK VN  +WVEPGKFFRE M
Sbjct  362  KIDFKTYTQNSTFKDYTKTGVEFAKYNRSS-------LGGGKTVN--KWVEPGKFFRESM  412

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++ MPDI+DKMPKRSFLPR+I ++LPFS ++I E++++FHA + S M  +I   +
Sbjct  413  LKEGTLIWMPDIKDKMPKRSFLPRSIVSKLPFSTSKIAEIKRVFHANDNSTMEGIITDAV  472

Query  53   AECERAPSRDETKRCV  6
             ECER P+  ETKRCV
Sbjct  473  RECERPPTVSETKRCV  488


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 68/138 (49%), Gaps = 7/138 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    FT Y +NSNV++  F +YG S  G +  F +Y    NNP   FK Y   
Sbjct  157  YSRDAAGHEDKFTGYADNSNVVEEKFNSYGTSATGGSGDFKNYQSGVNNPTTRFKAYSDE  216

Query  584  GNGPVDTFNSYRQESNVG-ADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV  408
            GNG   TF +Y  E+N G   SF SYGK  N A   F +YG + N     FS Y +    
Sbjct  217  GNGRAQTFKTYTHEANSGPGQSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGE----  272

Query  407  SFNGYGVNNTFKDYAKTG  354
              NG   N+TFK Y   G
Sbjct  273  --NGNAANDTFKGYGGDG  288


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 49/108 (45%), Gaps = 6/108 (6%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG    G AD+F  Y+ NGN   ++F+ Y     G  D F  Y   SNV  + FNSY
Sbjct  126  FTNYGTIHPGGADSFKKYSQNGNAVTDSFRRYSRDAAGHEDKFTGYADNSNVVEEKFNSY  185

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY  366
            G  +      F NY    N  T +F  YSD       G G   TFK Y
Sbjct  186  GTSATGGSGDFKNYQSGVNNPTTRFKAYSDE------GNGRAQTFKTY  227



>gb|KFK44451.1| hypothetical protein AALP_AA1G258600 [Arabis alpina]
Length=621

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 181/256 (71%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   FTSYG +SNV+ + F NYGE+GN   DTF  Y  +GN P N FK+YGA 
Sbjct  241  YGKNGNGAPNEFTSYGVSSNVIGSDFSNYGENGNVANDTFKGYGGDGNVPKNNFKSYGAS  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR ++NVG DSF+SY K SN+  VGFVNYGK+FN G++ F GY   ++ +
Sbjct  301  GNAGVDTFLNYRDKANVGDDSFSSYAKNSNSESVGFVNYGKSFNPGSESFKGYGKGAEGN  360

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDYAKTG+ FA Y  +       G   GK VN  +WVEPGKFFRE M
Sbjct  361  KIDFKTYTQNSTFKDYAKTGLEFARYNQS-------GLRGGKAVN--KWVEPGKFFRESM  411

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++ MPDI+D+MPKRSFLPR+I +++PFS ++I E++ +FHA + S M  +I+  +
Sbjct  412  LKEGTLVSMPDIKDRMPKRSFLPRSIISKIPFSTSKIAEIKGVFHARDNSTMEGIISNAI  471

Query  53   AECERAPSRDETKRCV  6
             ECER  +  ETKRCV
Sbjct  472  TECERPSTVGETKRCV  487


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 62/137 (45%), Gaps = 25/137 (18%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            FT+YG      D +FK Y + GN   D+F  Y+  G   D  FK Y  GGN         
Sbjct  125  FTNYGTVRAGGDDSFKKYSQDGNVVTDSFRQYSREGAGHDEKFKGY--GGN---------  173

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFK  372
               SNV  ++FNSYGK +      F +Y    N  T +F+ YSD      NG G + TFK
Sbjct  174  ---SNVVEENFNSYGKAATGGSGDFRSYQTGVNNPTSRFTSYSD------NGNGESQTFK  224

Query  371  DY-----AKTGVTFAGY  336
             Y     A  G +F  Y
Sbjct  225  TYTHEANAGPGQSFTSY  241



>ref|XP_006300871.1| hypothetical protein CARUB_v10019963mg [Capsella rubella]
 gb|EOA33769.1| hypothetical protein CARUB_v10019963mg [Capsella rubella]
Length=628

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 174/256 (68%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV+ + F  YGE+GNG  D+FTSY  NGN P N FK YG G
Sbjct  248  YSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNGNVPVNDFKGYGDG  307

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG V  F +YR +SN+G DSF+SY K SN   V FVNYGK+FN G+D F+GY   +   
Sbjct  308  GNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSFNLGSDNFTGYGQGNVGG  367

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             VSF  YG   +FK+Y K GV FA Y N         ++ GK VN  +WVE GKFFRE M
Sbjct  368  NVSFKTYGQGPSFKEYTKDGVVFAHYTNNV-------SSSGKTVN--KWVEEGKFFRESM  418

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT M MPDI+DKMPKR+FLPR+I ++LPFS++EIGE+ K+F A E S+MA +I   +
Sbjct  419  LKEGTFMQMPDIKDKMPKRTFLPRSIVSKLPFSSSEIGEIRKVFGAGENSSMANIILSAV  478

Query  53   AECERAPSRDETKRCV  6
            +ECER  S  ETKRCV
Sbjct  479  SECERPASHGETKRCV  494


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 65/159 (41%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +    A  F +Y    N+   +F+ Y  +  G  D FT+YA + N  D +F  Y  G
Sbjct  136  YGSDRLSGADSFKNYSGGDNIAVDSFRRYSRNSAGHDDGFTNYAGDVNVADQSFSTYATG  195

Query  584  GNG--------------PVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
              G              P   F SY  ++N  + +F SY    N  +  F +Y K  NG 
Sbjct  196  TTGGSGEFASYNTNANEPNGIFTSYSDKANGRSQTFTSYSGNGNTGEQTFTSYSKNGNGA  255

Query  446  TDKFSGYSDSDRVSFNGY--------GVNNTFKDYAKTG  354
             + FSGY     V  +G+        G N++F  Y   G
Sbjct  256  PNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNG  294



>emb|CDY53059.1| BnaA09g14240D [Brassica napus]
Length=623

 Score =   272 bits (695),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 176/256 (69%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA  GF+ YG+ SNV+ + F  YGE+ NG  DTFTSY  +GN P N FK YG G
Sbjct  243  YSKNGNGAPNGFSGYGSGSNVVKSGFSGYGETSNGANDTFTSYGGDGNLPVNDFKKYGEG  302

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNG V  F SYR +SN+GADSF+SY K S+   V FVNYGK+FN G+D F+GY   +D  
Sbjct  303  GNGAVYGFKSYRDQSNIGADSFSSYAKDSHNEKVNFVNYGKSFNLGSDDFTGYGQGNDGG  362

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             VSF  YG   +FK Y K GV FA Y N         ++ GK VN  +W EPGKFFRE M
Sbjct  363  NVSFKTYGQGPSFKAYTKDGVVFARYFNN-------ASSSGKKVN--KWTEPGKFFRESM  413

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+M MPDI+DKMPKR+FLPR I ++L FS+++ GE+ +IF A E S+MA +I+  +
Sbjct  414  LKEGTLMQMPDIKDKMPKRTFLPRTIVSKLSFSSSKTGEVRRIFGAGENSSMAGIISSAI  473

Query  53   AECERAPSRDETKRCV  6
            +ECER PS  ETKRCV
Sbjct  474  SECERPPSYGETKRCV  489


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 64/137 (47%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G   GFT+Y    NV D +F  Y     G +  FT+Y  N N P+  F +Y   
Sbjct  159  YSRDSAGHDDGFTNYAGEVNVADQSFTTYATGSTGGSGDFTNYHTNANQPNGRFTSYSDE  218

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
             NG   +F +Y + +N GA +F SY K  N A  GF  YG   N     FSGY ++    
Sbjct  219  ANGRSQSFTAYSENANSGAQTFTSYSKNGNGAPNGFSGYGSGSNVVKSGFSGYGETSN--  276

Query  404  FNGYGVNNTFKDYAKTG  354
                G N+TF  Y   G
Sbjct  277  ----GANDTFTSYGGDG  289



>emb|CDX68345.1| BnaA07g23850D [Brassica napus]
Length=618

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 181/259 (70%), Gaps = 15/259 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYG--  591
            Y K GN +   F+SYG++SNV+ + FKNYGE  N   DTFTSYA  GN P N FKNYG  
Sbjct  242  YSKKGNTSPNEFSSYGDSSNVIGSDFKNYGEEENAAKDTFTSYASGGNVPLNNFKNYGDY  301

Query  590  -AGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---S  423
               GN  VDTF +YR ++NVG DSF+ Y K SNA  V F NYG+++N G++ F+GY   S
Sbjct  302  GVSGNDAVDTFANYRDKANVGDDSFSGYAKDSNAGTVKFTNYGQSYNPGSESFTGYGKGS  361

Query  422  DSDRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFR  243
            +  ++SF  Y  N+TFKDYAK GV FA Y N + +      A GK VN  +W+EPGKFFR
Sbjct  362  EGHKISFKTYTPNSTFKDYAKNGVAFAKY-NVSSI------ADGKTVN--KWIEPGKFFR  412

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            E  LK GT++PMPDI+DKMPKRSFLPR+I ++LPFS +++ E++ IFHA + S+M K+I+
Sbjct  413  ESTLKEGTVIPMPDIKDKMPKRSFLPRSIVSKLPFSTSKLAEVKTIFHAGDNSSMEKIIS  472

Query  62   GTLAECERAPSRDETKRCV  6
              + ECER PS  ETKRCV
Sbjct  473  DAVTECERPPSVGETKRCV  491


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 73/171 (43%), Gaps = 28/171 (16%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +N  G    FT YG   NV +  F +YG    G A  FT+Y  + N+P + F  Y  G
Sbjct  157  YSRNAAGHEDKFTVYGERGNVDEKDFNSYGTFAAGGAGDFTNYQNDVNDPMSRFTAYSDG  216

Query  584  GNGPVDTFNSYRQESNVG---------------ADSFNSYGKKSNAADVGFVNYGKTFNG  450
            G G   TF +Y  ++N G                + F+SYG  SN     F NYG+  N 
Sbjct  217  GTGRSQTFKTYTHDANAGNGQSFTSYSKKGNTSPNEFSSYGDSSNVIGSDFKNYGEEENA  276

Query  449  GTDKFSGYSDSDRVSFNGYGVNNTFKDYAKTGV-------TFAGYLNATDV  318
              D F+ Y+    V        N FK+Y   GV       TFA Y +  +V
Sbjct  277  AKDTFTSYASGGNVPL------NNFKNYGDYGVSGNDAVDTFANYRDKANV  321



>ref|XP_002279813.2| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Vitis vinifera]
Length=633

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 171/256 (67%), Gaps = 4/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNG      FTSYG+NSN++ + F  YG+  N   D+F +Y  + NNP N FK+Y  G
Sbjct  245  YGKNGKNVPAEFTSYGDNSNIIGSTFTAYGQLANSQNDSFKAYGHSSNNPHNNFKSYSLG  304

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   DTF++YR  +NVG DSF SY + SN+A+V F NYG+TFN G D F  Y   S   
Sbjct  305  GNAATDTFSNYRDGANVGDDSFQSYARSSNSAEVNFANYGRTFNVGNDTFKEYGKGSTDS  364

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             V F  YG+N TFKDY + GVTF+ Y  A+  T A       +  N RWVEPGKFFRE M
Sbjct  365  SVGFKIYGLNYTFKDYERKGVTFSQYSRASSNTTATATTASGISVN-RWVEPGKFFRESM  423

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK G +M MPDIRD+MP+RSFLPR IA++LPFS++ + EL+ IFHA + S M  +IA  L
Sbjct  424  LKEGNVMVMPDIRDRMPERSFLPRVIASKLPFSSSRLQELKDIFHARDNSTMEHVIANAL  483

Query  53   AECERAPSRDETKRCV  6
             ECERAPSR ETKRCV
Sbjct  484  EECERAPSRGETKRCV  499


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 60/146 (41%), Gaps = 8/146 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G    F +Y +  N+   +F+ Y        + FTSYA +GN    +F  YG+G
Sbjct  133  YGDSRIGGVDSFKNYSDGLNMPSGSFRRYSGDSTDHHEEFTSYARDGNVATGSFAGYGSG  192

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
              G    F +Y    NV    F +Y    N   + F  Y    N GT+ F+ Y  + +  
Sbjct  193  ATGGSGEFTNYDPLVNVPHLEFTTYDPNGNNHKLTFAAYTDDTNSGTESFTSYGKNGKNV  252

Query  410  -VSFNGYGVNNTFKDYAKTGVTFAGY  336
               F  YG N+        G TF  Y
Sbjct  253  PAEFTSYGDNSNI-----IGSTFTAY  273



>ref|XP_010477679.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Camelina sativa]
Length=623

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 183/256 (71%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA    +SYG +SNV+ + F NYG++ N   DTF  Y  +GN P N FK+YGA 
Sbjct  243  YGKNGNGAPNELSSYGVSSNVIGSEFSNYGQNANSANDTFKGYGGDGNVPRNNFKSYGAS  302

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR ++NVG D+F+SY K SN+  V FVNYGK+FN G++ F+GY   ++ +
Sbjct  303  GNAAVDTFLNYRDKANVGDDTFSSYAKNSNSEKVDFVNYGKSFNPGSESFTGYGKGAEGN  362

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDYAKTGV FA Y N + +        GK VN  +WVEPGKFFRE M
Sbjct  363  KIDFKTYTKNSTFKDYAKTGVGFARY-NQSKLR------DGKKVN--KWVEPGKFFRESM  413

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++ MPDI+DKMPKRSFLPR+I ++LPFS ++I E++++FHA + S M  +IA  +
Sbjct  414  LKEGTLIWMPDIKDKMPKRSFLPRSIVSKLPFSTSKITEIKRVFHARDNSTMEGIIANAV  473

Query  53   AECERAPSRDETKRCV  6
             ECER+P+  ETKRCV
Sbjct  474  TECERSPTVGETKRCV  489


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G AD+F  Y+ NGN   ++F+ Y     G  D+F  Y   SNV  ++FNSY
Sbjct  127  FTNYGTTRPGGADSFEKYSQNGNVVTDSFRRYSRDAAGHDDSFKGYADNSNVVDENFNSY  186

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG  354
            G+ +      F  Y    N  T +F+ YSD      +G G   TFK Y   G
Sbjct  187  GRSATGGSGEFKTYQSGDNNPTSRFTAYSD------DGNGRAQTFKTYTHEG  232



>gb|KDP31113.1| hypothetical protein JCGZ_11489 [Jatropha curcas]
Length=627

 Score =   272 bits (695),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 171/257 (67%), Gaps = 12/257 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK GN   + F +Y  +SN++D+ F  YGE GN   D+FT Y  +GNNP   FK+YGAG
Sbjct  245  YGKKGNAVPSEFINYSEDSNIIDSTFTGYGELGNVANDSFTGYGVSGNNPHTNFKSYGAG  304

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
             N   D+F++YR  +NVG DSF SY K +NA  V F NYGKTFN G D F  Y    +  
Sbjct  305  ENAASDSFSNYRNGANVGQDSFQSYAKNANAGKVSFTNYGKTFNPGNDTFKEYGKGSKGL  364

Query  410  --VSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
              V F  YG + +FK+Y   GV+F+GY N + V+       G  VN+ RWVEPGKFFRE 
Sbjct  365  TTVGFKIYGPDRSFKEYMDKGVSFSGYTNTSSVS-------GSFVNH-RWVEPGKFFRES  416

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G +M MPDI DKMPKRSFLPR+I ++LPFS++ + EL++IFHA E S M ++I   
Sbjct  417  MLKQGNVMVMPDITDKMPKRSFLPRSIVSKLPFSSSNLSELKQIFHAPENSTMERVINNA  476

Query  56   LAECERAPSRDETKRCV  6
            LAECER PSR ETKRC+
Sbjct  477  LAECERTPSRGETKRCL  493



>emb|CCD74525.1| polygalacturonase 1 [Arabidopsis halleri subsp. halleri]
Length=626

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 175/256 (68%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV++T F  YGE+ NG  D+FTSY  NGN P N FK YG G
Sbjct  246  YSKNGNGAPNEFSGYGTGSNVVNTGFTKYGETANGANDSFTSYGENGNVPVNDFKGYGDG  305

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG V  F +YR +SN+G DSF+SY K SN   V FVNYGK+FN G+D F+GY   +   
Sbjct  306  GNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSFNLGSDNFTGYGQGNVGG  365

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             VSF  YG   +FK Y K GV FA Y N         ++ GK VN  +WVE GKFFRE M
Sbjct  366  NVSFKTYGQGQSFKVYTKDGVVFAHYSNNV-------SSSGKTVN--KWVEEGKFFRESM  416

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+M MPDI+DKMPKR+FLPR+I + LPFS++EIGE+ ++F A E S+MA +I+  +
Sbjct  417  LKEGTLMQMPDIKDKMPKRTFLPRSIVSNLPFSSSEIGEIWRVFGAGENSSMAGIISSAV  476

Query  53   AECERAPSRDETKRCV  6
            +ECER  S+ ETKRCV
Sbjct  477  SECERPASKGETKRCV  492


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 65/159 (41%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFK-----  600
            YG +    A  F +Y    N+   +F+ Y  +  G  D FT+YA   N  D +F      
Sbjct  134  YGSDRLSGADSFKNYSGGDNIAVDSFRRYSRNSAGHDDGFTNYAGEVNVADQSFTTYATG  193

Query  599  ---------NYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                     NY    N P   F SY  ++N  + +F +Y    N  D  F +Y K  NG 
Sbjct  194  TTGGSGEFTNYNTNANEPNGRFTSYSDKANGRSQTFTTYSDNGNTGDQTFTSYSKNGNGA  253

Query  446  TDKFSGYSDSDRVSFNGY--------GVNNTFKDYAKTG  354
             ++FSGY     V   G+        G N++F  Y + G
Sbjct  254  PNEFSGYGTGSNVVNTGFTKYGETANGANDSFTSYGENG  292



>dbj|BAE99852.1| putative polygalacuronase isoenzyme 1 beta subunit [Arabidopsis 
thaliana]
Length=622

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 178/256 (70%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F+SYG +SNV+ + F NYGE+GN   DTF  Y  +GN P N FK++GA 
Sbjct  242  YGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFKSHGAS  301

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR  +NVG DSF+SY K SN   V FVNYGK+ N G++ FSGY   ++ +
Sbjct  302  GNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGN  361

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDY KTGV FA Y  ++          GK VN  +WVEPGKFFRE M
Sbjct  362  KIDFKTYTQNSTFKDYTKTGVEFAKYNRSS-------LGGGKTVN--KWVEPGKFFRESM  412

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++ MPDI+DKMPKRSFLPR+I ++LPFS ++I E++++FHA + S M  +I   +
Sbjct  413  LKEGTLIWMPDIKDKMPKRSFLPRSIVSKLPFSTSKIAEIKRVFHANDNSTMEGIITDAV  472

Query  53   AECERAPSRDETKRCV  6
             ECER P+  ETKRCV
Sbjct  473  RECERPPTVSETKRCV  488


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 68/138 (49%), Gaps = 7/138 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    FT Y +NSNV++  F +YG S  G +  F +Y    NNP   FK Y   
Sbjct  157  YSRDAAGHEDKFTGYADNSNVVEEKFNSYGTSATGGSGDFKNYQSGVNNPTTRFKAYSDE  216

Query  584  GNGPVDTFNSYRQESNVG-ADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV  408
            GNG   TF +Y  E+N G   SF SYGK  N A   F +YG + N     FS Y +    
Sbjct  217  GNGRAQTFKTYTHEANSGPGQSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGE----  272

Query  407  SFNGYGVNNTFKDYAKTG  354
              NG   N+TFK Y   G
Sbjct  273  --NGNAANDTFKGYGGDG  288


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 49/108 (45%), Gaps = 6/108 (6%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG    G AD+F  Y+ NGN   ++F+ Y     G  D F  Y   SNV  + FNSY
Sbjct  126  FTNYGTIHPGGADSFKKYSQNGNAVTDSFRRYSRDAAGHEDKFTGYADNSNVVEEKFNSY  185

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY  366
            G  +      F NY    N  T +F  YSD       G G   TFK Y
Sbjct  186  GTSATGGSGDFKNYQSGVNNPTTRFKAYSDE------GNGRAQTFKTY  227



>gb|AAB39538.1| aromatic rich glycoprotein JP630 [Arabidopsis thaliana]
Length=622

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 178/256 (70%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F+SYG +SNV+ + F NYGE+GN   DTF  Y  +GN P N FK+YGA 
Sbjct  242  YGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGAS  301

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR  +NVG DSF+SY K SN   V FVNYGK+ N G++ FSGY   ++ +
Sbjct  302  GNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGN  361

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDYAKTGV FA Y  ++          GK VN  +WVEPGKFFRE M
Sbjct  362  KIDFKTYTQNSTFKDYAKTGVEFAKYNRSS-------LGGGKTVN--KWVEPGKFFRESM  412

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT++ MPDI+DKMPKRSFLP +I ++LPFS ++I E++++FHA + S M  +I   +
Sbjct  413  LKEGTLIWMPDIKDKMPKRSFLPCSIVSKLPFSTSKIAEIKRVFHANDNSTMEGIITDAV  472

Query  53   AECERAPSRDETKRCV  6
             ECER P+  ETKRCV
Sbjct  473  RECERPPTVSETKRCV  488


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 68/138 (49%), Gaps = 7/138 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    FT Y +NSNV++  F +YG S  G +  F +Y    NNP   FK Y   
Sbjct  157  YSRDAAGHEDKFTGYADNSNVVEEKFNSYGTSATGGSGDFKNYQSGVNNPTTRFKAYSDE  216

Query  584  GNGPVDTFNSYRQESNVGA-DSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV  408
            GNG   TF +Y  E+N G   SF SYGK  N A   F +YG + N     FS Y +    
Sbjct  217  GNGRAQTFKTYTHEANSGPGQSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGE----  272

Query  407  SFNGYGVNNTFKDYAKTG  354
              NG   N+TFK Y   G
Sbjct  273  --NGNAANDTFKGYGGDG  288


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 49/108 (45%), Gaps = 6/108 (6%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG    G AD+F  Y+ NGN   ++F+ Y     G  D F  Y   SNV  + FNSY
Sbjct  126  FTNYGTIHPGGADSFKKYSQNGNAVTDSFRRYSRDAAGHEDKFTGYADNSNVVEEKFNSY  185

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY  366
            G  +      F NY    N  T +F  YSD       G G   TFK Y
Sbjct  186  GTSATGGSGDFKNYQSGVNNPTTRFKAYSDE------GNGRAQTFKTY  227



>ref|XP_006345047.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Solanum tuberosum]
Length=642

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/257 (56%), Positives = 175/257 (68%), Gaps = 6/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNG    FT+YG+ SNV+ ++F  YGESGN   D+F +Y+ N NNP+N FKNYG+G
Sbjct  254  YAKNGNGVPAEFTTYGDTSNVIGSSFNGYGESGNAANDSFKAYSSNSNNPNNNFKNYGSG  313

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS----  417
            GN  +D+F SYR  +N G+D+F SY + SN   V F+NYGK+FN GT+ F GY       
Sbjct  314  GNSGIDSFESYRDAANAGSDTFTSYARGSNTGKVNFLNYGKSFNEGTEIFKGYGSQGAKF  373

Query  416  DRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
              V F  YGVNN+FK+Y+  GV FAGY      T       GK VN  +WVE GKFFRE 
Sbjct  374  PSVGFKVYGVNNSFKEYSPKGVNFAGYTKKNGPTTGSLKTSGKTVN--KWVEEGKFFRES  431

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK GT+M MPDIRDKMP RSFLPR+I+++LPFS  E+ EL+ IFHA E S M  +I  T
Sbjct  432  MLKEGTVMKMPDIRDKMPGRSFLPRSISSKLPFSTKELTELKSIFHAQENSTMEHVIGNT  491

Query  56   LAECERAPSRDETKRCV  6
            LAECERAPS  E K+CV
Sbjct  492  LAECERAPSLGEKKQCV  508


 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 61/133 (46%), Gaps = 6/133 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    FTSY  + NV    F +Y     G   TF SY    N PD  F +Y + 
Sbjct  170  YSRSSTGHHEDFTSYAADGNVATGNFTSYAAGATGGGGTFQSYMPRVNVPDLRFASYDSD  229

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
            GN    +FNSY  ++N G + F SY K  N     F  YG T N     F+GY +S    
Sbjct  230  GNNHKLSFNSYVGDTNSGREFFISYAKNGNGVPAEFTTYGDTSNVIGSSFNGYGES----  285

Query  404  FNGYGVNNTFKDY  366
              G   N++FK Y
Sbjct  286  --GNAANDSFKAY  296



>ref|NP_176242.1| polygalacturonase 1 [Arabidopsis thaliana]
 sp|O80760.1|Y639_ARATH RecName: Full=Probable polygalacturonase non-catalytic subunit 
At1g60390; AltName: Full=Aromatic-rich glycoprotein At1g60390; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24065.1| Strong similarity to AR0GP2 gene gb|1762634 from Lycopersicon 
esculentum [Arabidopsis thaliana]
 dbj|BAE99558.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33681.1| polygalacturonase 1 [Arabidopsis thaliana]
Length=624

 Score =   270 bits (689),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 172/256 (67%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV++T F  YGES NG  D+FTSY  NGN P N FK YG G
Sbjct  244  YSKNGNGAPNEFSGYGTGSNVVNTGFTKYGESANGANDSFTSYGENGNVPVNEFKGYGDG  303

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG V  F +YR +SN+G DSF+SY K SN   V FVNYGK+FN G+D F+GY   +   
Sbjct  304  GNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSFNLGSDNFTGYGQDNVGG  363

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             VSF  YG   +FK Y K GV FA Y N         ++ GK VN  +WVE GKFFRE M
Sbjct  364  NVSFKTYGQGQSFKVYTKDGVVFARYSNNV-------SSNGKTVN--KWVEEGKFFREAM  414

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+M MPDI+DKMPKR+FLPRNI   LPFS++ IGE+ ++F A E S+MA +I+  +
Sbjct  415  LKEGTLMQMPDIKDKMPKRTFLPRNIVKNLPFSSSTIGEIWRVFGAGENSSMAGIISSAV  474

Query  53   AECERAPSRDETKRCV  6
            +ECER  S  ETKRCV
Sbjct  475  SECERPASHGETKRCV  490


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 64/170 (38%), Gaps = 45/170 (26%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYA----------------  633
            YG +    A  F +Y    N+   +F+ Y  +  G  D FT+YA                
Sbjct  132  YGSDRLSGADSFKNYSGGDNIAVDSFRRYSRNSAGHDDGFTNYAGEVNVADQSFTTYATG  191

Query  632  ------------FNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSYGKK----  501
                         + N P+  F +Y    NG   TF +Y +  N G  SF SY K     
Sbjct  192  TTGGSGEFTNYNTDANEPNGRFTSYSDKANGRSQTFTTYSENGNTGYQSFTSYSKNGNGA  251

Query  500  ----------SNAADVGFVNYGKTFNGGTDKFSGYSDSDRV---SFNGYG  390
                      SN  + GF  YG++ NG  D F+ Y ++  V    F GYG
Sbjct  252  PNEFSGYGTGSNVVNTGFTKYGESANGANDSFTSYGENGNVPVNEFKGYG  301



>ref|XP_009113216.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Brassica rapa]
Length=623

 Score =   269 bits (688),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 174/256 (68%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA  GF+ YG+ SNV+ + F  YGE+ NG  DTFTSY  +GN P N FK YG G
Sbjct  243  YSKNGNGAPNGFSGYGSGSNVVKSGFSGYGETSNGANDTFTSYGGDGNLPVNDFKKYGEG  302

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG V  F SYR +SN+GADSF+SY K S+   V FVNYGK+FN G+D F+GY   D   
Sbjct  303  GNGAVYGFKSYRDQSNIGADSFSSYAKDSHNEKVNFVNYGKSFNLGSDDFTGYGQGDDGG  362

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             VSF  YG   +FK Y K GV FA Y N         ++ GK VN  +W EPGKFFRE M
Sbjct  363  NVSFKTYGQGPSFKAYTKDGVVFARYFNN-------ASSSGKRVN--KWTEPGKFFRESM  413

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+  MPDI+DKMPKR+FLPR I ++L FS+++ GE+ +IF A E S+MA +I+  +
Sbjct  414  LKEGTLTQMPDIKDKMPKRTFLPRTIVSKLSFSSSKTGEVWRIFGAGENSSMAGIISSAI  473

Query  53   AECERAPSRDETKRCV  6
            +ECER PS  ETKRCV
Sbjct  474  SECERPPSYGETKRCV  489


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 64/137 (47%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G   GFT+Y    NV D +F  Y     G +  FT+Y  N N P+  F +Y   
Sbjct  159  YSRDSAGHDDGFTNYAGEVNVADQSFTTYATGSTGGSGDFTNYHTNANQPNGRFTSYSDE  218

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
             NG   +F +Y + +N GA +F SY K  N A  GF  YG   N     FSGY ++    
Sbjct  219  ANGRSQSFTAYSENANSGAQTFTSYSKNGNGAPNGFSGYGSGSNVVKSGFSGYGETSN--  276

Query  404  FNGYGVNNTFKDYAKTG  354
                G N+TF  Y   G
Sbjct  277  ----GANDTFTSYGGDG  289



>ref|XP_002890594.1| hypothetical protein ARALYDRAFT_472637 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66853.1| hypothetical protein ARALYDRAFT_472637 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   269 bits (688),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 178/256 (70%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F+SYG +SNV+ + F NYGE+ N   DTF  Y  +GN P N FK+YGA 
Sbjct  243  YGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENSNAANDTFKGYGGDGNVPRNNFKSYGAS  302

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR ++NVG DSF SY K SN   V FVNYGK+ N G++ F+GY   ++ +
Sbjct  303  GNAAVDTFLNYRDKANVGDDSFASYAKNSNFEKVDFVNYGKSINPGSESFTGYGKGAEGN  362

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDYAKTGV FA Y  +           GK VN  +WVEPGKFFRE +
Sbjct  363  KIGFKTYTQNSTFKDYAKTGVEFAKYNQSR-------LGGGKTVN--KWVEPGKFFRESL  413

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK  +++ MPDI+DKMPKRSFLPRNI ++LPFS ++I E++++FHA + S MA +I   +
Sbjct  414  LKESSLIWMPDIKDKMPKRSFLPRNIVSKLPFSTSKIAEIKRVFHAKDNSTMAGIITDAV  473

Query  53   AECERAPSRDETKRCV  6
             ECER+P+  ETKRCV
Sbjct  474  TECERSPTIGETKRCV  489


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 79/162 (49%), Gaps = 13/162 (8%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    FT Y +NSNV++  F +YG S  G +  F +Y    NNP + FK Y   
Sbjct  158  YSRDAAGHEDKFTGYADNSNVVEENFNSYGTSATGGSGDFKNYQSGVNNPTSRFKAYSDD  217

Query  584  GNGPVDTFNSYRQESNVG-ADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDS  417
            GNG   TF +Y  E+N G   SF SYGK  N A   F +YG + N     FS Y   S++
Sbjct  218  GNGRAQTFKTYTHEANAGPGQSFTSYGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENSNA  277

Query  416  DRVSFNGYG-----VNNTFKDYAKTG----VTFAGYLNATDV  318
               +F GYG       N FK Y  +G     TF  Y +  +V
Sbjct  278  ANDTFKGYGGDGNVPRNNFKSYGASGNAAVDTFLNYRDKANV  319


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 68/154 (44%), Gaps = 23/154 (15%)
 Frame = -1

Query  746  GAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNT-------------  606
            G A  F  Y  N NV+  +F+ Y     G  D FT YA N N  +               
Sbjct  136  GGADSFKKYSQNGNVVTDSFRRYSRDAAGHEDKFTGYADNSNVVEENFNSYGTSATGGSG  195

Query  605  -FKNYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAAD-VGFVNYGKTFNGGTDKFS  432
             FKNY +G N P   F +Y  + N  A +F +Y  ++NA     F +YGK  NG  ++FS
Sbjct  196  DFKNYQSGVNNPTSRFKAYSDDGNGRAQTFKTYTHEANAGPGQSFTSYGKNGNGAPNEFS  255

Query  431  GYSDSDRV---SFNGYG-----VNNTFKDYAKTG  354
             Y  S  V    F+ YG      N+TFK Y   G
Sbjct  256  SYGVSSNVIGSDFSNYGENSNAANDTFKGYGGDG  289


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 58/124 (47%), Gaps = 12/124 (10%)
 Frame = -1

Query  689  FKNYGESGN-GDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNS  513
            F NYG + + G AD+F  Y+ NGN   ++F+ Y     G  D F  Y   SNV  ++FNS
Sbjct  126  FTNYGGTIHPGGADSFKKYSQNGNVVTDSFRRYSRDAAGHEDKFTGYADNSNVVEENFNS  185

Query  512  YGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY-----AKTGVT  348
            YG  +      F NY    N  T +F  YSD      +G G   TFK Y     A  G +
Sbjct  186  YGTSATGGSGDFKNYQSGVNNPTSRFKAYSD------DGNGRAQTFKTYTHEANAGPGQS  239

Query  347  FAGY  336
            F  Y
Sbjct  240  FTSY  243



>ref|XP_011071835.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Sesamum indicum]
Length=635

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 163/256 (64%), Gaps = 5/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGN     FTSYG  SNV+ + F  YGE GN   D+F  Y  N NNP N FKNYG G
Sbjct  248  YGKNGNAVPVEFTSYGQTSNVVGSTFTGYGELGNSANDSFKGYDTNANNPSNNFKNYGVG  307

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD---SD  414
            GNG  DTF +YR  +N G D+F SYG+ SN+    FVNYG +FN G D F  Y+      
Sbjct  308  GNGGSDTFTNYRDSANAGTDTFQSYGRNSNSEKSTFVNYGNSFNVGFDSFKEYAKGGVDQ  367

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             V F  YGVNNTFK+YAK GVTFA Y              GKMVNN   VE GKFFRE M
Sbjct  368  TVGFKIYGVNNTFKEYAKKGVTFAQYTKPGSTQDGSTMVSGKMVNNG--VEEGKFFRESM  425

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+M MP+IRD MPKRSFLPR I ++LPFS +E+ EL++ FH  + S M  ++   L
Sbjct  426  LKEGTVMKMPNIRDWMPKRSFLPRPITSKLPFSTSELVELKRTFHIEDNSTMEHVVMNAL  485

Query  53   AECERAPSRDETKRCV  6
            AECERAPS  E KRCV
Sbjct  486  AECERAPSTGENKRCV  501



>ref|XP_008346742.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=630

 Score =   269 bits (687),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 136/259 (53%), Positives = 172/259 (66%), Gaps = 8/259 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GN     FT Y   SN++ + F  YGESGNG  D+FT Y  +GNNP N FK+YGAG
Sbjct  240  YGKSGNSNPNQFTRYAEGSNIIGSGFTGYGESGNGQNDSFTGYGQSGNNPHNNFKSYGAG  299

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
            GN  +D F++YR  +NVG D+F SY + SN+  V F NYGK+FN G D F  Y    +  
Sbjct  300  GNAGLDGFSNYRSWANVGDDTFQSYARNSNSGKVRFSNYGKSFNPGNDSFKEYGAGSKGR  359

Query  410  --VSFNGYGVNNTFKDYAKTGVTFAGY--LNATDVTAAVGAAKGKMVNNKRWVEPGKFFR  243
              V F  YG+  +FK+YAK GVTFA Y  L++    +    + G  VN  RWVEPGKFFR
Sbjct  360  TTVGFKTYGLGRSFKEYAKNGVTFAEYNDLSSVGTHSTEKESSGSAVN--RWVEPGKFFR  417

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            E ML+ G +M MPDIRD+MP+RSFLPR I ++LPFS   + E+++IFHA E SAM +++ 
Sbjct  418  ESMLRQGNVMVMPDIRDRMPERSFLPRGILSKLPFSTLRMSEIKEIFHAPENSAMERVLT  477

Query  62   GTLAECERAPSRDETKRCV  6
              LAECER PS  ETKRCV
Sbjct  478  NALAECERDPSPGETKRCV  496


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 8/123 (7%)
 Frame = -1

Query  698  DTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSF  519
            D  F NYG S  G  D+F +Y+   N+P ++FK Y  G +  ++ F SY  ++NV   +F
Sbjct  122  DKNFANYGSSQLGGVDSFKNYSEELNSPRDSFKKYSKGSHSHLEKFTSYAHDANVANSNF  181

Query  518  NSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSDRVSFNGYGVN-----NTFKDYA  363
             SYG  S      F +Y    N  +  F+ Y   ++  R+SF GYG +      +F  Y 
Sbjct  182  TSYGADSGGGSGEFTSYDDRVNVPSLGFTSYDSNANDHRLSFTGYGHDTNSGSESFTSYG  241

Query  362  KTG  354
            K+G
Sbjct  242  KSG  244


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 63/147 (43%), Gaps = 10/147 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G    F +Y    N    +FK Y +  +   + FTSYA + N  ++ F +YGA 
Sbjct  128  YGSSQLGGVDSFKNYSEELNSPRDSFKKYSKGSHSHLEKFTSYAHDANVANSNFTSYGAD  187

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
              G    F SY    NV +  F SY   +N   + F  YG   N G++ F+ Y  S    
Sbjct  188  SGGGSGEFTSYDDRVNVPSLGFTSYDSNANDHRLSFTGYGHDTNSGSESFTSYGKS----  243

Query  404  FNGYGVNNTFKDYAK----TGVTFAGY  336
              G    N F  YA+     G  F GY
Sbjct  244  --GNSNPNQFTRYAEGSNIIGSGFTGY  268



>ref|XP_002886622.1| hypothetical protein ARALYDRAFT_475291 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62881.1| hypothetical protein ARALYDRAFT_475291 [Arabidopsis lyrata subsp. 
lyrata]
Length=625

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 173/256 (68%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV+ T F  YGE+ NG  D+FTSY  NGN P N FK YG G
Sbjct  245  YSKNGNGAPNEFSGYGTGSNVVITGFTKYGETANGANDSFTSYGENGNVPVNDFKGYGDG  304

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG V  F +YR +SN+G DSF+SY K SN   V FVNYGK+FN G+D F+GY   +   
Sbjct  305  GNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSFNLGSDNFTGYGQGNVGG  364

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             VSF  YG   +FK Y K GV FA Y N         ++ GK VN  +WVE GKFFRE M
Sbjct  365  NVSFKTYGQGQSFKVYTKDGVVFAHYSNNV-------SSNGKTVN--KWVEEGKFFRESM  415

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+M +PDI+DKMPKR+FLPRNI + LPFS++EIGE+  +F A E S+MA +I+  +
Sbjct  416  LKEGTLMQLPDIKDKMPKRTFLPRNIVSNLPFSSSEIGEIWGVFGAGENSSMAGIISSAV  475

Query  53   AECERAPSRDETKRCV  6
            +ECER  S+ ETKRCV
Sbjct  476  SECERPASKGETKRCV  491


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 62/142 (44%), Gaps = 17/142 (12%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +N  G   GFT+Y    NV D +F  Y     G +  FTSY  N N P+  F +Y   
Sbjct  161  YSRNSAGHDDGFTNYAGEVNVADQSFTTYATGTTGGSGEFTSYNTNANEPNGRFTSYSDK  220

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKK--------------SNAADVGFVNYGKTFNGG  447
             NG   TF +Y    N G  +F SY K               SN    GF  YG+T NG 
Sbjct  221  ANGRSQTFTTYSDNGNTGDQTFTSYSKNGNGAPNEFSGYGTGSNVVITGFTKYGETANGA  280

Query  446  TDKFSGYSDSDRV---SFNGYG  390
             D F+ Y ++  V    F GYG
Sbjct  281  NDSFTSYGENGNVPVNDFKGYG  302


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 65/159 (41%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFK-----  600
            YG +    A  F +Y    N+   +F+ Y  +  G  D FT+YA   N  D +F      
Sbjct  133  YGSDRLSGADSFKNYSGGDNIAVDSFRRYSRNSAGHDDGFTNYAGEVNVADQSFTTYATG  192

Query  599  ---------NYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                     +Y    N P   F SY  ++N  + +F +Y    N  D  F +Y K  NG 
Sbjct  193  TTGGSGEFTSYNTNANEPNGRFTSYSDKANGRSQTFTTYSDNGNTGDQTFTSYSKNGNGA  252

Query  446  TDKFSGYSDSDRVSFNGY--------GVNNTFKDYAKTG  354
             ++FSGY     V   G+        G N++F  Y + G
Sbjct  253  PNEFSGYGTGSNVVITGFTKYGETANGANDSFTSYGENG  291



>ref|XP_010473218.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=629

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 174/256 (68%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV+ + F  YGE+GNG  D+FTSY  NGN P N FK YG G
Sbjct  249  YSKNGNGAPNEFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNGNVPVNDFKGYGDG  308

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG V  F +YR +SN+G DSF SY K SN   V FVNYGK+FN G+D F+GY   +   
Sbjct  309  GNGAVYGFKNYRDQSNIGVDSFASYAKNSNNEKVNFVNYGKSFNLGSDNFTGYGQGNVGG  368

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             VSF  YG   +FK+Y K GV FA Y N         ++ GK VN  +WVE GKFFRE M
Sbjct  369  NVSFKTYGQGPSFKEYTKDGVVFAHYTNNV-------SSSGKTVN--KWVEEGKFFRESM  419

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+M MPDI+DKMP+R+FLPR+I + +PFS++EIGE+ ++F A E S+MA +I+  +
Sbjct  420  LKEGTLMQMPDIKDKMPERTFLPRSIVSSIPFSSSEIGEIRRVFGAGENSSMAGIISSAV  479

Query  53   AECERAPSRDETKRCV  6
            +ECER  S  ETKRCV
Sbjct  480  SECERPASHGETKRCV  495



>emb|CDY47228.1| BnaC09g14770D [Brassica napus]
Length=623

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 175/256 (68%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA  GF+ YG+ SNV+ + F  YGE+ NG  DTFTSY  +GN P N FK YG  
Sbjct  243  YSKNGNGAPNGFSGYGSGSNVVKSGFSGYGETANGANDTFTSYGGDGNLPVNDFKKYGER  302

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNG V  F SYR +SN+GADSF+SY K S+   V FVNYGK+FN G+D F+GY   +D  
Sbjct  303  GNGAVYGFKSYRDQSNIGADSFSSYAKDSHNEKVNFVNYGKSFNLGSDDFTGYGQGNDGG  362

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             VSF  YG   +FK Y K GV FA Y N         ++ GK VN  +W EPGKFFRE M
Sbjct  363  NVSFKTYGQGPSFKAYTKDGVVFARYFNN-------ASSSGKKVN--KWTEPGKFFRESM  413

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            L+ GT+M MPDI+DKMPKR+FLPR I ++L FS+++ GE+ +IF A E S+MA +I+  +
Sbjct  414  LREGTLMQMPDIKDKMPKRTFLPRTIVSKLSFSSSKTGEVWRIFGAGENSSMAGIISSAI  473

Query  53   AECERAPSRDETKRCV  6
            +ECER PS  ETKRCV
Sbjct  474  SECERPPSYGETKRCV  489


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 64/137 (47%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G   GF++Y    NV D +F  Y     G A  FT+Y  N N P+  F +Y   
Sbjct  159  YSRDSAGHDDGFSNYAGEVNVADQSFTTYATGSTGGAGDFTNYHTNANQPNGRFTSYSDE  218

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
             NG   +F +Y + +N GA +F SY K  N A  GF  YG   N     FSGY ++    
Sbjct  219  ANGRSQSFTTYSENANSGAQTFTSYSKNGNGAPNGFSGYGSGSNVVKSGFSGYGETAN--  276

Query  404  FNGYGVNNTFKDYAKTG  354
                G N+TF  Y   G
Sbjct  277  ----GANDTFTSYGGDG  289



>ref|XP_007036187.1| Polygalacturonase 2, putative [Theobroma cacao]
 gb|EOY20688.1| Polygalacturonase 2, putative [Theobroma cacao]
Length=628

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 170/257 (66%), Gaps = 6/257 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGN     FTSY +N+N + ++F  YGE GN   ++F +Y  +GNNP N FK+Y   
Sbjct  240  YGKNGNAVPAEFTSYSDNANTIGSSFTGYGELGNAPNNSFKAYGDSGNNPHNNFKSYDLA  299

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SDS  417
             N   ++F SYR  +NVG DSF SY + SN+  V F NYGK+FN G D F  Y    + S
Sbjct  300  ANAGTNSFTSYRDSANVGDDSFQSYARNSNSGKVNFANYGKSFNVGNDTFKEYGKGSTGS  359

Query  416  DRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
              + F  YG++++FKDYAK GVTFAGY N++    A   + G  VN  RWVEPGKFFRE 
Sbjct  360  TSIGFKIYGLDSSFKDYAKKGVTFAGYTNSSSREIASSRSSGVSVN--RWVEPGKFFRES  417

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G +M MPDIRDKMPKRSFLPR + ++LPFS +E+  L +IF A + S M  ++   
Sbjct  418  MLKQGNVMVMPDIRDKMPKRSFLPRGVLSKLPFSTSELPSLREIFGAPDNSTMELVLINA  477

Query  56   LAECERAPSRDETKRCV  6
            LAECER PS+ ETKRCV
Sbjct  478  LAECERPPSQGETKRCV  494


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 56/104 (54%), Gaps = 5/104 (5%)
 Frame = -1

Query  692  AFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNS  513
            +F  YG S  G  D+F +Y+   N P+ +FK Y  G NG  + F SY +++NV  D+F +
Sbjct  124  SFTGYGTSRLGGVDSFKNYSDELNTPNESFKKYSRGSNGHREEFTSYAKDANVATDNFTN  183

Query  512  YGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD----RVSFNGY  393
            YG  +     GF NY +  N    +F+ Y DSD    ++SF  Y
Sbjct  184  YGTSATGGSGGFNNYQERVNVPNLRFTTY-DSDGNNHKLSFTSY  226



>ref|XP_006392169.1| hypothetical protein EUTSA_v10023352mg [Eutrema salsugineum]
 gb|ESQ29455.1| hypothetical protein EUTSA_v10023352mg [Eutrema salsugineum]
Length=622

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 171/256 (67%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA  GF+ YG+ SNV+ + F  YGE+ NG  DTFTSY  NGN P N FK YG  
Sbjct  242  YSKNGNGAPNGFSGYGSGSNVLKSGFTGYGETENGANDTFTSYGGNGNLPVNDFKKYGEE  301

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG V  F +YR +SN+G DSF+SY K SN   V FVNYGK+FN G+D F+GY   +   
Sbjct  302  GNGAVYGFKNYRDQSNIGVDSFSSYAKDSNNEKVNFVNYGKSFNLGSDNFTGYGQGNTGG  361

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             VSF  YG   +FK Y K GV FA Y N          + GK VN  +WVE GKFFRE M
Sbjct  362  NVSFKTYGQGPSFKAYTKDGVVFARYSNN-------ATSSGKTVN--KWVETGKFFRESM  412

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT M MPDI+DKMPKR+FLPR I + LPFS+ E G++ +IF A E S+MA++I+  +
Sbjct  413  LKEGTSMQMPDIKDKMPKRTFLPRAIVSNLPFSSPETGKIRRIFGAGENSSMAEIISSAI  472

Query  53   AECERAPSRDETKRCV  6
            +ECER PS  ETKRCV
Sbjct  473  SECERLPSHGETKRCV  488


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 66/137 (48%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G   GF++Y  + NV D +F  Y     G +  FTSY  N N P+  F +Y   
Sbjct  158  YSRDSAGHGDGFSNYAGDVNVADQSFTTYATESTGGSGDFTSYHTNANQPNGRFTSYSDK  217

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
             NG   +F +Y + +N GA SF SY K  N A  GF  YG   N     F+GY +++   
Sbjct  218  ANGRSQSFTAYSENANTGAQSFTSYSKNGNGAPNGFSGYGSGSNVLKSGFTGYGETEN--  275

Query  404  FNGYGVNNTFKDYAKTG  354
                G N+TF  Y   G
Sbjct  276  ----GANDTFTSYGGNG  288



>ref|XP_003552018.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=622

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 171/258 (66%), Gaps = 11/258 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKN  GAA  F +YG +SNV  + F NYG+ G G  DTFT+Y  N NNP  TF++Y  G
Sbjct  237  YGKNSAGAANDFAAYGTDSNVASSDFTNYGKGGAGPNDTFTNYGVNMNNPTETFQSYADG  296

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYS---DSD  414
              G   +F++YR ++NVGADSF SY K +  ++  F NYG +FN G+D F GY+   + +
Sbjct  297  TVGGTQSFSNYRDQANVGADSFQSYAKNTLGSEADFKNYGNSFNPGSDTFKGYAKGAEDN  356

Query  413  RVSFNGYGVNN--TFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
            +V F  Y  N   TFKDYAK GV+FA Y        +  +        KRWVEPGKFFRE
Sbjct  357  KVGFTTYSANTNATFKDYAKHGVSFASY------NVSSESKTVSSSVVKRWVEPGKFFRE  410

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
             MLK GT+MPMPDIRDKMPKRSFLPR I  +LPFS+A++ EL+++F   E S+M KMI  
Sbjct  411  TMLKEGTVMPMPDIRDKMPKRSFLPRAILTKLPFSSAKVDELKRVFKVSENSSMDKMIMD  470

Query  59   TLAECERAPSRDETKRCV  6
            +L ECERAPS  ETKRCV
Sbjct  471  SLGECERAPSVGETKRCV  488



>ref|XP_006844960.1| hypothetical protein AMTR_s00058p00173800 [Amborella trichopoda]
 gb|ERN06635.1| hypothetical protein AMTR_s00058p00173800 [Amborella trichopoda]
Length=583

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/261 (52%), Positives = 174/261 (67%), Gaps = 12/261 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK GNG  + FTSYG +SNVM + F  YGESGNG  D+F SYA +GN P N F++YG  
Sbjct  242  YGKRGNGVPSSFTSYGKDSNVMGSTFVAYGESGNGANDSFVSYAESGNVPQNNFRSYGDS  301

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNG +++F  YR  +NVG D+F SYGK SN+    F NYGK+FN G+D F GY   +++ 
Sbjct  302  GNGAIESFIKYRDSANVGDDTFQSYGKGSNSGSASFSNYGKSFNEGSDLFKGYGEGANAQ  361

Query  413  RVSFNGY-GVNNTFKDYAKTG--VTFAGYLNATDVTAAVGAAKGKMVNNKRW-VEPGKFF  246
             V+F GY G N TFKDY K    +TF+ Y N+T   ++ G+ +       +W VEPGKFF
Sbjct  362  TVNFKGYAGDNTTFKDYVKKSATITFSQYTNSTPSESSAGSPQ-----TSKWAVEPGKFF  416

Query  245  REKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMI  66
            R+K+L  G I+PMPDIRD MP RSFLPR+IA +LPFS   +  L  +F  VE S M K++
Sbjct  417  RQKLLTRGAILPMPDIRDSMPSRSFLPRSIAEKLPFSTESLPRLAAVFSTVEDSGMGKVL  476

Query  65   AGTLAECERAPSRDETKRCVT  3
              TL ECER PS+ E ++CVT
Sbjct  477  RKTLKECEREPSKGERRKCVT  497


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 63/137 (46%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F  Y  ++NV D +F  YG    G +  F +YA + N P+  F  Y + 
Sbjct  158  YSRDATGHGDSFAHYSPDTNVFDGSFSGYGSGSVGKSSEFVNYAGDANVPELRFNVYSSD  217

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
              G    F SY   +N G   F SYGK+ N     F +YGK  N     F  Y +S    
Sbjct  218  STGREQRFASYSDNANAGDQGFKSYGKRGNGVPSSFTSYGKDSNVMGSTFVAYGES----  273

Query  404  FNGYGVNNTFKDYAKTG  354
              G G N++F  YA++G
Sbjct  274  --GNGANDSFVSYAESG  288



>ref|XP_009775426.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nicotiana sylvestris]
Length=638

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 175/256 (68%), Gaps = 5/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNG    FT+YG+ SNV+ ++F  YGESGN   D+F +Y+ N NNP+N FKNYGAG
Sbjct  251  YAKNGNGVPAEFTTYGDTSNVIGSSFNGYGESGNAANDSFKAYSTNSNNPNNNFKNYGAG  310

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF SYR  +N G D+F SY K S++    FVNYGK+FN G D F  Y   +   
Sbjct  311  GNTGVDTFTSYRDSANAGTDTFTSYAKGSSSGKANFVNYGKSFNEGKDTFKEYGKGAKDP  370

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             V F  YG NN+FK+Y+  GV FAGY   +  T     A GK VN  +WVE GKFFRE M
Sbjct  371  SVGFKIYGFNNSFKEYSPKGVNFAGYTKKSAPTVGSLKASGKSVN--KWVEEGKFFRESM  428

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+M MPDIRDKMP RSFLPR I+++LPFS  E+ +L+ IFHA E S M ++I   L
Sbjct  429  LKEGTVMKMPDIRDKMPGRSFLPRTISSKLPFSTKELSDLKTIFHAQENSTMERVILNAL  488

Query  53   AECERAPSRDETKRCV  6
            AECERAPS+ ETKRCV
Sbjct  489  AECERAPSQGETKRCV  504



>ref|XP_010925453.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=636

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 181/262 (69%), Gaps = 11/262 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GNG    FTSYGNNSNV+++ F NYGE GNG  DTFT+Y  NGN P+N F++YG+G
Sbjct  245  YGKHGNGIPLSFTSYGNNSNVINSDFNNYGEDGNGANDTFTNYGENGNVPENNFRSYGSG  304

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   + F++YR ++NVG D+F SY K  NA    F NYG +FN G+D F GY   S + 
Sbjct  305  GNAGSEEFSNYRDQANVGDDTFTSYAKGENAGSADFKNYGNSFNQGSDSFKGYGEGSTNH  364

Query  413  RVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNK---RW-VEPGKF  249
            +++F  Y G N TFK YAKTG+ F  Y N++ + ++  A+       +   RW VEPGKF
Sbjct  365  KITFASYSGDNTTFKGYAKTGIGFKSYRNSSSLPSSAAASATLPARRRPTSRWVVEPGKF  424

Query  248  FREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKM  69
            FRE  LK GT+MPMPDIRDKMP RSFLPR+I+  +PFSAAE+   +++F+    +A+ K 
Sbjct  425  FRESQLKKGTVMPMPDIRDKMPARSFLPRSISGRIPFSAAEV---QRVFNIPADTALGKA  481

Query  68   IAGTLAECERAPSRDETKRCVT  3
            +A T+AECER PSR ETKRC T
Sbjct  482  VADTVAECERPPSRGETKRCAT  503


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 66/137 (48%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F  Y  + NV+   F +Y  +  G A  F+SYA  GN P+  F NY A 
Sbjct  161  YSRDSAGHDDSFAVYQPDGNVVTANFTSYASAATGGAGDFSSYAHEGNVPNLKFTNYDAD  220

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
             +G V  F+ Y  ++N G  SF  YGK  N   + F +YG   N     F+ Y +     
Sbjct  221  ADGRVQKFSRYSDDTNSGDQSFAGYGKHGNGIPLSFTSYGNNSNVINSDFNNYGE-----  275

Query  404  FNGYGVNNTFKDYAKTG  354
             +G G N+TF +Y + G
Sbjct  276  -DGNGANDTFTNYGENG  291


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 59/121 (49%), Gaps = 3/121 (2%)
 Frame = -1

Query  743  AATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDT  564
            A + F++YG +      +FKNY  S N   DTF  Y+ +    D++F  Y   GN     
Sbjct  126  ADSNFSNYGTDRAGGADSFKNYSASENLPVDTFRRYSRDSAGHDDSFAVYQPDGNVVTAN  185

Query  563  FNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD---SDRVSFNGY  393
            F SY   +  GA  F+SY  + N  ++ F NY    +G   KFS YSD   S   SF GY
Sbjct  186  FTSYASAATGGAGDFSSYAHEGNVPNLKFTNYDADADGRVQKFSRYSDDTNSGDQSFAGY  245

Query  392  G  390
            G
Sbjct  246  G  246



>ref|XP_003532010.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=627

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 135/258 (52%), Positives = 174/258 (67%), Gaps = 7/258 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKN  GAA  F++YG  SNV  + F NYG+ G G  +TFT+Y  N NNP  TF++Y  G
Sbjct  238  YGKNSAGAANDFSAYGTGSNVASSDFTNYGKGGAGPNNTFTNYGVNMNNPTETFQSYADG  297

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYS---DSD  414
              G   +F++YR ++NVGADSF SY K ++ ++  F +YG +FN G+D F GY+   +  
Sbjct  298  TVGGTQSFSNYRDQANVGADSFKSYAKSTSGSEADFKSYGNSFNPGSDTFKGYAKGAEDS  357

Query  413  RVSFNGYG--VNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
            +V F  Y    N TFKDYAK GV+FA Y  +     A     G +V  KRWVEPGKFFRE
Sbjct  358  KVGFTTYSAYTNATFKDYAKQGVSFASYNVSFSPGRASKTVSGSLV--KRWVEPGKFFRE  415

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
             MLK GT+MPMPDIRDKMPKRSFLPR+I  +LPFS++++ EL+++F   + S+M KMI  
Sbjct  416  SMLKDGTLMPMPDIRDKMPKRSFLPRSILTKLPFSSSKVHELKRLFKVSDNSSMEKMIMD  475

Query  59   TLAECERAPSRDETKRCV  6
            +L ECER PS  ETKRCV
Sbjct  476  SLGECERVPSMGETKRCV  493


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 60/140 (43%), Gaps = 26/140 (19%)
 Frame = -1

Query  734  GFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFN-GNNPDNTFKNYGAGGNGPVDTFN  558
            GF +Y +  N     F NYG    G  DTF +Y+      P N F+ Y  G  G  + F+
Sbjct  112  GFQTYNDGQN-----FTNYGTDFAGGIDTFKNYSNEISTTPVNDFRRYSRGAAGHEERFS  166

Query  557  SYRQESNVGADSFNSYG--------------KKSNAADVGFVNYGKTFNGGTDKFSGYSD  420
            +Y  +SNV   SF++YG                SN  D+ F  Y  +  G T  FS YS+
Sbjct  167  AYASDSNVADQSFSTYGTNAAGGSGEFKNYSSNSNVPDLRFTTYSDSTGGRTQSFSSYSE  226

Query  419  SDRVSFNGYGVNNTFKDYAK  360
                  NG     TF+ Y K
Sbjct  227  ------NGNAGGQTFQSYGK  240



>ref|XP_004236111.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Solanum lycopersicum]
Length=636

 Score =   263 bits (673),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 144/259 (56%), Positives = 174/259 (67%), Gaps = 14/259 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNG    FT+YG+ SNV+ ++F  YGESGN   D+F +Y+ N NNP+N FKNYG+G
Sbjct  252  YAKNGNGVPAEFTNYGDTSNVIGSSFSGYGESGNAANDSFKAYSSNSNNPNNNFKNYGSG  311

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS----  417
            GN  +D+F SYR  +N G D+F SY + SN   V F+NYGK+FN G D F GY       
Sbjct  312  GNSGIDSFESYRDAANAGTDTFTSYARGSNTGKVNFLNYGKSFNEGHDIFKGYGSQGAKF  371

Query  416  DRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAK--GKMVNNKRWVEPGKFFR  243
              V F  YGVNN+FK+Y+  GV FAGY      T   G+ K  GK VN  +WVE GKFFR
Sbjct  372  PSVGFKVYGVNNSFKEYSPKGVNFAGY------TKKTGSLKTSGKTVN--KWVEEGKFFR  423

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            E MLK GT+M MPDIRDKMP RSFLPR I+++LPFS  E+ EL+ IF A E S M  +I 
Sbjct  424  ESMLKEGTVMKMPDIRDKMPGRSFLPRTISSKLPFSTKELNELQSIFRARENSTMEHVIG  483

Query  62   GTLAECERAPSRDETKRCV  6
             TLAECERAPS  E K+CV
Sbjct  484  NTLAECERAPSPGENKQCV  502


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 63/133 (47%), Gaps = 6/133 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    FTSY  + NV    F +Y     G   TF SY    N PD  F +Y + 
Sbjct  168  YSRSSTGHHEDFTSYAADGNVATGNFTSYAAGATGGGGTFQSYMPRVNVPDLRFASYDSD  227

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
            GN    +FNSY +++N G + F SY K  N     F NYG T N     FSGY +S    
Sbjct  228  GNNHKLSFNSYVRDTNSGREFFISYAKNGNGVPAEFTNYGDTSNVIGSSFSGYGES----  283

Query  404  FNGYGVNNTFKDY  366
              G   N++FK Y
Sbjct  284  --GNAANDSFKAY  294



>ref|XP_010417970.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=628

 Score =   263 bits (673),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 176/256 (69%), Gaps = 11/256 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV+ + F  YGE+GN   D+FTSY  NGN P N FK YG G
Sbjct  247  YSKNGNGAPNEFSGYGTGSNVVKSGFTKYGENGNEANDSFTSYGGNGNVPVNDFKGYGDG  306

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG V  F +YR +SN+G DSF SY K SN   V FVNYGK+FN G+D F+GY   +   
Sbjct  307  GNGAVYGFKNYRDQSNIGVDSFASYAKNSNNEKVNFVNYGKSFNLGSDNFTGYGKGNVGG  366

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             VSF  YG   +FK+Y K GV FA Y N  +V+++     GK VN  +WVE GKFFRE M
Sbjct  367  NVSFKTYGQGPSFKEYTKDGVVFAHYTN-NNVSSS-----GKTVN--KWVEEGKFFRESM  418

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+M MPDI+DKMP+R+FLPR+I + +PFS++EIGE+ ++F A E S+M+ +I+  +
Sbjct  419  LKEGTLMQMPDIKDKMPERTFLPRSIVSSIPFSSSEIGEIRRVFGAGENSSMSGIISSAV  478

Query  53   AECERAPSRDETKRCV  6
            +ECER  S  ETKRCV
Sbjct  479  SECERPASHGETKRCV  494



>ref|XP_010510953.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Camelina sativa]
Length=626

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 172/256 (67%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV+ + F  YGE+GNG  D+FTSY  NGN P N FK YG G
Sbjct  246  YSKNGNGAPNEFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNGNVPVNDFKGYGDG  305

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG V  F +YR +SN+G DSF SY K SN   V FVNYGK+FN G+D F+ Y   +   
Sbjct  306  GNGAVYGFKNYRDQSNIGVDSFASYAKNSNNEKVNFVNYGKSFNLGSDNFTAYGQGNVGG  365

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             VSF  YG   +FK+Y K GV FA Y N         ++ G+ VN  +W+E GKFFRE M
Sbjct  366  NVSFKTYGQGPSFKEYTKDGVVFAHYSNNV-------SSSGRRVN--KWIEEGKFFRESM  416

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+M MPDI+DKMPKR+FLPR+I + +PFS++EIGE+ ++F A   S+M ++I+  +
Sbjct  417  LKEGTLMQMPDIKDKMPKRTFLPRSIVSSIPFSSSEIGEIRRVFGAGVNSSMERIISSAV  476

Query  53   AECERAPSRDETKRCV  6
            +ECER  S  ETKRCV
Sbjct  477  SECERPASHGETKRCV  492



>ref|XP_009415276.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/270 (52%), Positives = 179/270 (66%), Gaps = 19/270 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GNG  T FTSY +NSNV+ ++F  YGE  NG  D+F SY FNGN P+N F++YG G
Sbjct  248  YGKDGNGVPTSFTSYADNSNVIGSSFAGYGEGANGANDSFASYGFNGNVPENNFRSYGDG  307

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   + F SYR +SNVG D F SY K  NAA   FVNYG +FN G+D F GY   S   
Sbjct  308  GNSGSERFTSYRDQSNVGDDRFTSYAKGGNAAAADFVNYGNSFNEGSDSFKGYGEGSSKH  367

Query  413  RVSFNGYGVNNT-FKDYAKTGVTFAGYLNATDVTAAV---GAAKGKMVNNK--------R  270
             V+F  Y  +NT FK YAK+GV F  Y N++ + ++     AA G +++ +        R
Sbjct  368  SVTFKSYAADNTSFKAYAKSGVDFKAYRNSSVIPSSSSSDAAATGSLLSLRKAGGRPANR  427

Query  269  W-VEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAV  93
            W VEPGKFFRE+ L+ G++MPMPDIRDKMP RSFLPR+IA  +P SA E+    +IF   
Sbjct  428  WLVEPGKFFRERDLRRGSVMPMPDIRDKMPPRSFLPRSIAGRIPLSATEV---RRIFGIP  484

Query  92   EGSAMAKMIAGTLAECERAPSRDETKRCVT  3
              +A+ + +A T+AECERAP+RDETKRC T
Sbjct  485  ADTALGRAVADTVAECERAPNRDETKRCAT  514


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 63/145 (43%), Gaps = 8/145 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F SY    NV+   F +YG S  G A  F SY    N PD  F NY A 
Sbjct  164  YSRDSTGHNDSFASYSPEGNVVTANFTSYGSSATGGAGDFASYDHESNVPDLKFTNYDAD  223

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
              G   +F+SY  ++N G  SF  YGK  N     F +Y    N     F+GY   ++  
Sbjct  224  ATGRRRSFSSYSDDTNAGDQSFAGYGKDGNGVPTSFTSYADNSNVIGSSFAGYGEGANGA  283

Query  413  RVSFNGYGVN-----NTFKDYAKTG  354
              SF  YG N     N F+ Y   G
Sbjct  284  NDSFASYGFNGNVPENNFRSYGDGG  308


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 70/155 (45%), Gaps = 22/155 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG    G  + F +Y ++ NV    F+ Y     G  D+F SY+  GN     F +YG+ 
Sbjct  136  YGTGAAGGRSSFKNYSDDLNVPVDTFRRYSRDSTGHNDSFASYSPEGNVVTANFTSYGSS  195

Query  584  GNGPVDTFNSYRQESNV--------GAD------SFNSYGKKSNAADVGFVNYGKTFNGG  447
              G    F SY  ESNV         AD      SF+SY   +NA D  F  YGK  NG 
Sbjct  196  ATGGAGDFASYDHESNVPDLKFTNYDADATGRRRSFSSYSDDTNAGDQSFAGYGKDGNGV  255

Query  446  TDKFSGYSDSDRV---SFNGY-----GVNNTFKDY  366
               F+ Y+D+  V   SF GY     G N++F  Y
Sbjct  256  PTSFTSYADNSNVIGSSFAGYGEGANGANDSFASY  290


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 66/144 (46%), Gaps = 12/144 (8%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F+ YG  +    ++FKNY +  N   DTF  Y+ +    +++F +Y   GN     F SY
Sbjct  133  FSDYGTGAAGGRSSFKNYSDDLNVPVDTFRRYSRDSTGHNDSFASYSPEGNVVTANFTSY  192

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV---SFNGY----  393
               +  GA  F SY  +SN  D+ F NY     G    FS YSD       SF GY    
Sbjct  193  GSSATGGAGDFASYDHESNVPDLKFTNYDADATGRRRSFSSYSDDTNAGDQSFAGYGKDG  252

Query  392  -GVNNTFKDYAK----TGVTFAGY  336
             GV  +F  YA      G +FAGY
Sbjct  253  NGVPTSFTSYADNSNVIGSSFAGY  276



>emb|CDY23501.1| BnaC06g24700D [Brassica napus]
Length=625

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/259 (53%), Positives = 177/259 (68%), Gaps = 15/259 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYG--  591
            Y K GN +   F SYG++SNV+ + FKNYGE  N   DTFTSYA  GN   N FKNYG  
Sbjct  242  YSKKGNASPNEFASYGDSSNVIGSDFKNYGEEENAAKDTFTSYASGGNVLLNNFKNYGDY  301

Query  590  -AGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---S  423
               GNG VDTF +YR ++NVG DSF+ Y K SN+  V F NYG+++N G++ F+ Y   S
Sbjct  302  GVSGNGAVDTFANYRDKANVGDDSFSGYAKDSNSGTVKFTNYGQSYNPGSESFTSYGKGS  361

Query  422  DSDRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFR  243
            +  ++SF  Y  N+TFKDYAK GV FA Y N + +        GK VN  +W+EPGKFFR
Sbjct  362  EGQKISFKTYTPNSTFKDYAKNGVAFAKY-NVSSI------GDGKTVN--KWIEPGKFFR  412

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            E  LK GT++ MPDI+DKMPKRSFLPR+I ++LPFS +++ E++ IFHA + S+M K+I+
Sbjct  413  ESTLKEGTVIAMPDIKDKMPKRSFLPRSIVSKLPFSTSKLAEVKMIFHAGDNSSMEKIIS  472

Query  62   GTLAECERAPSRDETKRCV  6
              + ECER PS  ETKRCV
Sbjct  473  DAVTECERPPSVGETKRCV  491


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 78/165 (47%), Gaps = 16/165 (10%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +N  G    FT YG   NV +  F +YG  G G A  FT+Y  + N+P + F  Y  G
Sbjct  157  YSRNAAGHEDKFTVYGERGNVDEKDFNSYGTFGAGGAGDFTNYQNDVNDPMSRFTAYSDG  216

Query  584  GNGPVDTFNSYRQESNVG-ADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD--  414
            G G   TF +Y  ++N G   SF SY KK NA+   F +YG + N     F  Y + +  
Sbjct  217  GTGRSQTFKTYTHDANAGNGQSFTSYSKKGNASPNEFASYGDSSNVIGSDFKNYGEEENA  276

Query  413  -RVSFNGYG-----VNNTFKDYAKTGV-------TFAGYLNATDV  318
             + +F  Y      + N FK+Y   GV       TFA Y +  +V
Sbjct  277  AKDTFTSYASGGNVLLNNFKNYGDYGVSGNGAVDTFANYRDKANV  321



>ref|XP_008453099.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Cucumis melo]
Length=648

 Score =   262 bits (669),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 164/257 (64%), Gaps = 11/257 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F+SY + SN++ + F  YGESG    D+F  Y  +GNNP   FKNYG G
Sbjct  265  YGKNGNGVPQDFSSYSDGSNILTSTFTGYGESGKTANDSFKEYGVSGNNPHTNFKNYGKG  324

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GN  +DTF++YR  +NVG DSF SY K SN+  V F NYGK+FN G D F+ Y       
Sbjct  325  GNSEIDTFSNYRNGANVGDDSFQSYAKNSNSGRVNFANYGKSFNHGNDSFTEYGKGSIGK  384

Query  413  -RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
              V F  Y ++  F  YAK GV+F+ Y N T  T +     G  VN+   VEPGKFFRE 
Sbjct  385  TTVGFKSYSIDRNFTTYAKNGVSFSEYSNFTTATGS-----GIHVNSH--VEPGKFFRES  437

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
             LK G +M MPDIRDKMP RSFLPR I   LPFS++ I E +++FHA +GS M  +I   
Sbjct  438  ELKQGNVMVMPDIRDKMPPRSFLPRAILVNLPFSSSRISEAKEMFHARDGSTMESVITNA  497

Query  56   LAECERAPSRDETKRCV  6
            LAECERAPSR ETKRCV
Sbjct  498  LAECERAPSRGETKRCV  514


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 77/159 (48%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGA-  588
            YG N  G    F +Y +  N  + +FK YG + +   + FTSYA +GN  ++ F +YGA 
Sbjct  153  YGGNRLGGTDSFKNYSDGLNTAEHSFKRYGGNSSNHKEGFTSYAEDGNVANSNFVSYGAE  212

Query  587  -----GG--------NGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                 GG        N P   F +Y   S     +F SYG ++N+    F +YGK  NG 
Sbjct  213  SKSGSGGFTNYDKLVNVPNLRFTAYDLNSRSHKLTFTSYGNETNSGSQSFTSYGKNGNGV  272

Query  446  TDKFSGYSDSDRV---SFNGYG-----VNNTFKDYAKTG  354
               FS YSD   +   +F GYG      N++FK+Y  +G
Sbjct  273  PQDFSSYSDGSNILTSTFTGYGESGKTANDSFKEYGVSG  311


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 66/134 (49%), Gaps = 14/134 (10%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F  YGN +      F NYG +  G  D+F +Y+   N  +++FK YG   +   + F SY
Sbjct  142  FKLYGNKN------FANYGGNRLGGTDSFKNYSDGLNTAEHSFKRYGGNSSNHKEGFTSY  195

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSDRVSFNGYGV--  387
             ++ NV   +F SYG +S +   GF NY K  N    +F+ Y   S S +++F  YG   
Sbjct  196  AEDGNVANSNFVSYGAESKSGSGGFTNYDKLVNVPNLRFTAYDLNSRSHKLTFTSYGNET  255

Query  386  ---NNTFKDYAKTG  354
               + +F  Y K G
Sbjct  256  NSGSQSFTSYGKNG  269



>ref|XP_002318036.2| hypothetical protein POPTR_0012s08060g [Populus trichocarpa]
 gb|EEE96256.2| hypothetical protein POPTR_0012s08060g [Populus trichocarpa]
Length=637

 Score =   261 bits (668),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/257 (51%), Positives = 168/257 (65%), Gaps = 9/257 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK GNG  + F SY  +SN +++ F  YGE GN   D+FTSY  +GNNP N FK+YG+G
Sbjct  250  YGKKGNGVPSEFVSYSRDSNGIESKFTGYGELGNAANDSFTSYGNSGNNPHNNFKSYGSG  309

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
             N   D F+SYR  +NVG DSF SY K SN+  V F NYGK+FN G D F  Y    +  
Sbjct  310  ANSASDRFSSYRNGANVGQDSFQSYAKDSNSGKVSFANYGKSFNPGNDSFIDYGKGSKGM  369

Query  410  --VSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
              + F  Y ++ +F  Y   GVTFAGY N + + +  G +      NKR VEPGKFFRE 
Sbjct  370  TTIGFKSYSLDRSFMVYKDKGVTFAGYSNTSSMPSDNGVSV-----NKRRVEPGKFFRES  424

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G +M MPDIRDKMP+RSFLPR+I ++LPFS  ++ +L+ +FHA + S M +++   
Sbjct  425  MLKPGNVMVMPDIRDKMPERSFLPRSIVSKLPFSTTKMAKLKDLFHASDNSTMTRVLINA  484

Query  56   LAECERAPSRDETKRCV  6
            LAECERAPS  ETKRCV
Sbjct  485  LAECERAPSHGETKRCV  501


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 72/137 (53%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +   G +  FT+YGN+ NV +  F NYG +  G + TF +Y    N P   F  Y + 
Sbjct  166  YSRESTGHSETFTNYGNDGNVANATFGNYGSAATGGSGTFKNYDNRVNVPGLRFTTYASD  225

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
            GN    +F+SY  E+NVGA  FNSYGKK N     FV+Y +  NG   KF+GY +     
Sbjct  226  GNDHKLSFSSYSDETNVGAQGFNSYGKKGNGVPSEFVSYSRDSNGIESKFTGYGEL----  281

Query  404  FNGYGVNNTFKDYAKTG  354
              G   N++F  Y  +G
Sbjct  282  --GNAANDSFTSYGNSG  296



>ref|XP_010924225.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=636

 Score =   261 bits (668),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 139/261 (53%), Positives = 179/261 (69%), Gaps = 10/261 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GNG    FTSYGNNSNV+ + F NYGE GNG  DTFT+Y  NGN P+N F++YGAG
Sbjct  246  YGKHGNGIPLSFTSYGNNSNVILSDFNNYGEDGNGANDTFTNYGRNGNVPENNFRSYGAG  305

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   + F++YR ++NVG DSF SY K+ NA    F NYG +FN G+D F+GY   S + 
Sbjct  306  GNAASEKFSNYRDQANVGDDSFASYAKQGNAGAADFENYGNSFNEGSDSFNGYGEGSINH  365

Query  413  RVSFNGY-GVNNTFKDYAKTG-VTFAGYLNATDV-TAAVGAAKGKMVNNKRW-VEPGKFF  246
             ++F  Y G N TFK YAKTG + F  Y N++ + ++A  A   +     RW VEPGKFF
Sbjct  366  TITFASYSGDNTTFKGYAKTGSIGFKSYRNSSTLPSSATAALTARRRPTSRWVVEPGKFF  425

Query  245  REKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMI  66
            RE  L+ GT+MPMPDI D+MP RSFLPR+IA  +PFSA E+   +++F+    +A+ K +
Sbjct  426  RESELQKGTVMPMPDIGDRMPARSFLPRSIAGRIPFSATEV---QRVFNIPADTALGKAV  482

Query  65   AGTLAECERAPSRDETKRCVT  3
            A T+AECER PSR ETKRC T
Sbjct  483  ADTVAECERPPSRGETKRCAT  503


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 63/126 (50%), Gaps = 6/126 (5%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F  Y  + NV+ T F +Y  +  G A  F+SYA  GN PD  F NY A  NG V  F+ Y
Sbjct  173  FALYQPDGNVVTTNFTSYATAATGGAGDFSSYAHEGNVPDLKFTNYEADANGRVQKFSRY  232

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFK  372
              ++N G  SF  YGK  N   + F +YG   N     F+ Y +      +G G N+TF 
Sbjct  233  SDDTNSGGQSFAGYGKHGNGIPLSFTSYGNNSNVILSDFNNYGE------DGNGANDTFT  286

Query  371  DYAKTG  354
            +Y + G
Sbjct  287  NYGRNG  292


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 58/117 (50%), Gaps = 3/117 (3%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F++YG +      +FKNY  S N   DTF  Y+ +  + D++F  Y   GN     F SY
Sbjct  131  FSNYGTDRGGGADSFKNYSASENTPIDTFRRYSRDSVDHDDSFALYQPDGNVVTTNFTSY  190

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD---SDRVSFNGYG  390
               +  GA  F+SY  + N  D+ F NY    NG   KFS YSD   S   SF GYG
Sbjct  191  ATAATGGAGDFSSYAHEGNVPDLKFTNYEADANGRVQKFSRYSDDTNSGGQSFAGYG  247



>gb|EPS60630.1| polygalacturonase-1 non-catalytic subunit beta, partial [Genlisea 
aurea]
Length=595

 Score =   260 bits (665),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 182/261 (70%), Gaps = 11/261 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK GNG    F  Y N +N + + F +Y  +GNG  DTF+SY  NGNNP N F+NY + 
Sbjct  209  YGKAGNGPENLFIGYANGANSVTSNFNSYDRNGNGGNDTFSSYGENGNNPTNNFRNYDSQ  268

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNG  D+F +YR +SN+G D+FNSYG KSN   +GF +YG+++N GTD F+ Y    ++ 
Sbjct  269  GNGGTDSFTTYRNQSNIGNDNFNSYGTKSNGLTIGFAHYGESYNQGTDNFTTYGKGGNAP  328

Query  413  RVSFNGYG--VNNTFKDYAKTG-VTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFR  243
             VSF  YG   N+TFK Y +   VTF+ Y N    +++   + GK V NK WVEPGKFFR
Sbjct  329  DVSFKIYGHAENDTFKGYVRQELVTFSTYNND---SSSENPSSGKKVVNK-WVEPGKFFR  384

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEG-SAMAKMI  66
            E MLKSGTIMPMPDIRDKMPKRSFLPR+IA++LPFS ++I E+  IF A +G S +++ I
Sbjct  385  ESMLKSGTIMPMPDIRDKMPKRSFLPRSIASKLPFSTSKIAEIAAIFRAGDGESKLSETI  444

Query  65   AGTLAECERAPSRDETKRCVT  3
            A +L ECERAPS  ETKRCV+
Sbjct  445  ANSLRECERAPSPGETKRCVS  465


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 71/160 (44%), Gaps = 34/160 (21%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F+SYG+  +    +F++Y E G    + F SY+    +  + F +YG   N    +F++Y
Sbjct  96   FSSYGDKRSYGTDSFQHYAEHGTTAVNAFRSYSRESFSHFDKFDSYGTDNNVADQSFDTY  155

Query  551  RQESNVGA--------------------------DSFNSYGKKSNAADVGFVNYGKTFNG  450
             +E+N GA                           SF +Y   SN  + GF NYGK  NG
Sbjct  156  GKEANTGAGTFENYNNRVNDQNLRFATYSGGQLYQSFATYSTASNTGEEGFANYGKAGNG  215

Query  449  GTDKFSGY---SDSDRVSFNGY-----GVNNTFKDYAKTG  354
              + F GY   ++S   +FN Y     G N+TF  Y + G
Sbjct  216  PENLFIGYANGANSVTSNFNSYDRNGNGGNDTFSSYGENG  255


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 48/93 (52%), Gaps = 0/93 (0%)
 Frame = -1

Query  701  MDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADS  522
            +D  F +YG+  +   D+F  YA +G    N F++Y        D F+SY  ++NV   S
Sbjct  92   LDRNFSSYGDKRSYGTDSFQHYAEHGTTAVNAFRSYSRESFSHFDKFDSYGTDNNVADQS  151

Query  521  FNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYS  423
            F++YGK++N     F NY    N    +F+ YS
Sbjct  152  FDTYGKEANTGAGTFENYNNRVNDQNLRFATYS  184



>ref|XP_011044316.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Populus euphratica]
Length=637

 Score =   261 bits (667),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 166/257 (65%), Gaps = 9/257 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK GNG  + F SY  +SN++++ F  YGE GN   D+FT Y  +GNNP + FK+YG+G
Sbjct  250  YGKKGNGVPSEFISYSRDSNIIESKFTGYGELGNAANDSFTGYGNSGNNPHDNFKSYGSG  309

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
             N  +D F+SYR+ +NVG DSF SY K SN+  V F NYGK+FN G D F  Y    +  
Sbjct  310  ANSAIDRFSSYRKGANVGQDSFQSYAKNSNSGKVSFANYGKSFNPGNDSFIDYGKGSKGM  369

Query  410  --VSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
              + F  Y ++ +F  Y   GVTFAGY N + + +  G +       KRWVEPGKFFRE 
Sbjct  370  TTIGFKSYSLDRSFVVYKDKGVTFAGYSNKSSMPSENGVSV-----KKRWVEPGKFFRES  424

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G ++ MPDIRDKMP+RSFLPR+I ++LPFS   + +L+ +FHA   S M +++   
Sbjct  425  MLKQGNVIVMPDIRDKMPERSFLPRSIVSKLPFSTTNMAKLKDLFHASAKSTMTRVLVNA  484

Query  56   LAECERAPSRDETKRCV  6
            L ECER PS  ETKRCV
Sbjct  485  LTECERVPSPGETKRCV  501


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 70/145 (48%), Gaps = 22/145 (15%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +   G +  FT+YGN+ NV +  F NYG +  G + TF +Y    N P   F  Y + 
Sbjct  166  YSRESTGQSETFTNYGNDGNVANATFGNYGSAATGGSGTFKNYDSQVNVPGLRFTTYASE  225

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYS-DSDRV  408
            GN    +F+SY  E+NVGA  FNSYG              K  NG   +F  YS DS+ +
Sbjct  226  GNDHKLSFSSYSDETNVGAQGFNSYG--------------KKGNGVPSEFISYSRDSNII  271

Query  407  S--FNGYG-----VNNTFKDYAKTG  354
               F GYG      N++F  Y  +G
Sbjct  272  ESKFTGYGELGNAANDSFTGYGNSG  296


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 62/159 (39%), Gaps = 45/159 (28%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYG-------------  591
            F +YG +      +FKNY    N  AD+F  Y+        TF NYG             
Sbjct  135  FANYGASRLSGVDSFKNYSNGLNSVADSFIRYSRESTGQSETFTNYGNDGNVANATFGNY  194

Query  590  ----AGGNGPVD-------------------------TFNSYRQESNVGADSFNSYGKKS  498
                 GG+G                            +F+SY  E+NVGA  FNSYGKK 
Sbjct  195  GSAATGGSGTFKNYDSQVNVPGLRFTTYASEGNDHKLSFSSYSDETNVGAQGFNSYGKKG  254

Query  497  NAADVGFVNYGKTFNGGTDKFSGYSDSDRV---SFNGYG  390
            N     F++Y +  N    KF+GY +       SF GYG
Sbjct  255  NGVPSEFISYSRDSNIIESKFTGYGELGNAANDSFTGYG  293



>ref|XP_004138283.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
 gb|KGN63588.1| Polygalacturonase-1 non-catalytic subunit beta [Cucumis sativus]
Length=645

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 163/257 (63%), Gaps = 11/257 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F+SY + SN++ + F  YGESG    D+F  Y  +GNNP   FKNYG G
Sbjct  262  YGKNGNGVPQDFSSYSDGSNILTSTFTGYGESGKTANDSFKEYGISGNNPHTNFKNYGKG  321

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
            GN  +DTF++YR  +NVG DSF SY K SN+  V F NYGK+FN G D F+ Y       
Sbjct  322  GNSEIDTFSNYRNGANVGDDSFQSYAKNSNSGRVNFANYGKSFNHGNDSFTEYGKGSMGK  381

Query  410  --VSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
              V F  Y V+  F  YAK GV+F+ Y N T        A G  ++    VEPGKFFRE 
Sbjct  382  TTVGFKSYSVDRNFTTYAKNGVSFSVYNNFT-------TATGSGIHANSHVEPGKFFRES  434

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
             LK G +M MPDI+DKMP RSFLPR+I   LPFS++ I E +++FHA +GS M  +I   
Sbjct  435  ELKQGNVMVMPDIKDKMPPRSFLPRSILVNLPFSSSRISEAKEMFHARDGSTMESVITNA  494

Query  56   LAECERAPSRDETKRCV  6
            LAECERAPSR ETKRCV
Sbjct  495  LAECERAPSRGETKRCV  511


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 76/159 (48%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G    F +Y +  N  + +FK YG + +   + FTSYA +GN  ++ F +YGAG
Sbjct  150  YGGSRLGGTDSFKNYSDGLNTAEHSFKRYGGNSSNHKEGFTSYAEDGNVANSNFVSYGAG  209

Query  584  G--------------NGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                           N P   F +Y   S     SF SYG ++N+    F +YGK  NG 
Sbjct  210  SKSGSGEFTNYDKLVNVPNLRFTAYDLNSRSHKLSFTSYGNETNSGSQSFTSYGKNGNGV  269

Query  446  TDKFSGYSDSDRV---SFNGYG-----VNNTFKDYAKTG  354
               FS YSD   +   +F GYG      N++FK+Y  +G
Sbjct  270  PQDFSSYSDGSNILTSTFTGYGESGKTANDSFKEYGISG  308


 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 64/134 (48%), Gaps = 14/134 (10%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F  YGN +      F NYG S  G  D+F +Y+   N  +++FK YG   +   + F SY
Sbjct  139  FKLYGNKN------FVNYGGSRLGGTDSFKNYSDGLNTAEHSFKRYGGNSSNHKEGFTSY  192

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSDRVSFNGYGV--  387
             ++ NV   +F SYG  S +    F NY K  N    +F+ Y   S S ++SF  YG   
Sbjct  193  AEDGNVANSNFVSYGAGSKSGSGEFTNYDKLVNVPNLRFTAYDLNSRSHKLSFTSYGNET  252

Query  386  ---NNTFKDYAKTG  354
               + +F  Y K G
Sbjct  253  NSGSQSFTSYGKNG  266



>ref|XP_004973305.1| PREDICTED: BURP domain-containing protein 12-like [Setaria italica]
Length=647

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 142/264 (54%), Positives = 174/264 (66%), Gaps = 13/264 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    FTSYGN SNVM +AF NYGESGNG  DTF+SY   GN P+NTF++YGAG
Sbjct  250  YGKNGNGVRETFTSYGNESNVMASAFANYGESGNGATDTFSSYGVEGNVPENTFRSYGAG  309

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
            GN  VDTF  YR ++NVG D F+SY K +N     F +YG + N G+  F GY +    +
Sbjct  310  GNAGVDTFKKYRDDANVGDDRFSSYAKGANGGGAEFQSYGNSANPGSTTFKGYGEGTNPN  369

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVG----AAKGKMVNNKRWV-EPG  255
              + F  Y G NNTFK YAKTGV F GY N +  TAA+     AA      + +W  EPG
Sbjct  370  HHIGFKEYAGENNTFKGYAKTGVDFKGYHNTSGSTAALTVSAEAAASMHHQHLKWSPEPG  429

Query  254  KFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMA  75
            KFFRE+ L +G  MPMPDIRDKMP R+FLPR+IAA++PF    + E   +F     +AM 
Sbjct  430  KFFRERELVAGNRMPMPDIRDKMPPRAFLPRDIAAKIPFDPNAVSE---VFGVPLDTAMG  486

Query  74   KMIAGTLAECERAPSRDETKRCVT  3
            K +A T+AEC+RAPS+ ETKRC T
Sbjct  487  KAVASTVAECQRAPSKGETKRCAT  510


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 73/155 (47%), Gaps = 22/155 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++ +  A  F SY  + NV+   F +Y     G + TF SYA   N PD+TF NY A 
Sbjct  166  YARDSSDRADRFESYEADGNVVTANFTSYAGGSTGGSGTFASYAAETNVPDSTFTNYDAA  225

Query  584  GNGPVDTFNSYRQESNVGA--------------DSFNSYGKKSNAADVGFVNYGKTFNGG  447
             NG    F SY QE+N G               ++F SYG +SN     F NYG++ NG 
Sbjct  226  ANGRGRGFASYAQEANHGENGFSGYGKNGNGVRETFTSYGNESNVMASAFANYGESGNGA  285

Query  446  TDKFSGYSDSDRV---SFNGYGVN-----NTFKDY  366
            TD FS Y     V   +F  YG       +TFK Y
Sbjct  286  TDTFSSYGVEGNVPENTFRSYGAGGNAGVDTFKKY  320


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 57/122 (47%), Gaps = 6/122 (5%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F SY  + N+   +F+ Y    +  AD F SY  +GN     F +Y  G  G   TF SY
Sbjct  149  FRSYSPDLNIAADSFRRYARDSSDRADRFESYEADGNVVTANFTSYAGGSTGGSGTFASY  208

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFK  372
              E+NV   +F +Y   +N    GF +Y +  N G + FSGY        NG GV  TF 
Sbjct  209  AAETNVPDSTFTNYDAAANGRGRGFASYAQEANHGENGFSGYGK------NGNGVRETFT  262

Query  371  DY  366
             Y
Sbjct  263  SY  264



>ref|XP_004166494.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cucumis sativus]
Length=688

 Score =   260 bits (664),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 163/257 (63%), Gaps = 11/257 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F+SY + SN++ + F  YGESG    D+F  Y  +GNNP   FKNYG G
Sbjct  305  YGKNGNGVPQDFSSYSDGSNILTSTFTGYGESGKTANDSFKEYGISGNNPHTNFKNYGKG  364

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
            GN  +DTF++YR  +NVG DSF SY K SN+  V F NYGK+FN G D F+ Y       
Sbjct  365  GNSEIDTFSNYRNGANVGDDSFQSYAKNSNSGRVNFANYGKSFNHGNDSFTEYGKGSMGK  424

Query  410  --VSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
              V F  Y V+  F  YAK GV+F+ Y N T  T       G  ++    VEPGKFFRE 
Sbjct  425  TTVGFKSYSVDRNFTTYAKNGVSFSVYNNFTTAT-------GSGIHANSHVEPGKFFRES  477

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
             LK G +M MPDI+DKMP RSFLPR+I   LPFS++ I E +++FHA +GS M  +I   
Sbjct  478  ELKQGNVMVMPDIKDKMPPRSFLPRSILVNLPFSSSRISEAKEMFHARDGSTMESVITNA  537

Query  56   LAECERAPSRDETKRCV  6
            LAECERAPSR ETKRCV
Sbjct  538  LAECERAPSRGETKRCV  554


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 76/159 (48%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG N  G    F +Y +  N  + +FK YG + +   + FTSYA +GN  ++ F +YGAG
Sbjct  193  YGGNRLGGTDSFKNYSDGLNTAEHSFKRYGGNSSNHKEGFTSYAEDGNVANSNFVSYGAG  252

Query  584  G--------------NGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                           N P   F +Y   S     SF SYG ++N+    F +YGK  NG 
Sbjct  253  SKSGSGEFTNYGKLVNVPNLRFTAYDLNSRSHKLSFTSYGNETNSGSQSFTSYGKNGNGV  312

Query  446  TDKFSGYSDSDRV---SFNGYG-----VNNTFKDYAKTG  354
               FS YSD   +   +F GYG      N++FK+Y  +G
Sbjct  313  PQDFSSYSDGSNILTSTFTGYGESGKTANDSFKEYGISG  351


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 65/134 (49%), Gaps = 14/134 (10%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F  YGN +      F NYG +  G  D+F +Y+   N  +++FK YG   +   + F SY
Sbjct  182  FKLYGNKN------FVNYGGNRLGGTDSFKNYSDGLNTAEHSFKRYGGNSSNHKEGFTSY  235

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSDRVSFNGYGV--  387
             ++ NV   +F SYG  S +    F NYGK  N    +F+ Y   S S ++SF  YG   
Sbjct  236  AEDGNVANSNFVSYGAGSKSGSGEFTNYGKLVNVPNLRFTAYDLNSRSHKLSFTSYGNET  295

Query  386  ---NNTFKDYAKTG  354
               + +F  Y K G
Sbjct  296  NSGSQSFTSYGKNG  309



>ref|XP_008800877.1| PREDICTED: BURP domain-containing protein 12-like [Phoenix dactylifera]
Length=637

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 175/261 (67%), Gaps = 10/261 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GNG    FTSYG+NSNVM++ F NYGE GNG  DTFT+Y  NGN P+N F++YGA 
Sbjct  247  YGKHGNGIPLSFTSYGSNSNVMNSDFNNYGEDGNGANDTFTNYGQNGNVPENNFRSYGAA  306

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GN   + F++YR ++NVG DSF SY K+ NA    F NYG +FN GTD F GY       
Sbjct  307  GNAASEKFSNYRDQANVGDDSFTSYAKEDNAGAADFKNYGNSFNQGTDSFKGYGQGSINF  366

Query  413  RVSFNG-YGVNNTFKDYAKTGVT-FAGYLNATDVTAAVGAAKGKMVN-NKRW-VEPGKFF  246
             ++F   YG N TFK YAKTG+  F GY N++   ++  AA         RW VEPGKFF
Sbjct  367  TITFGSYYGDNTTFKAYAKTGIIGFNGYRNSSTFPSSAAAALKARRRPTSRWVVEPGKFF  426

Query  245  REKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMI  66
            RE  LK GT+MPMPDI D+MP RSFLPR+IA  +PFSAAE+   +++F+    +A+ K  
Sbjct  427  RESELKKGTVMPMPDISDRMPARSFLPRSIAGRIPFSAAEV---QRVFNMPADTALGKAA  483

Query  65   AGTLAECERAPSRDETKRCVT  3
            A T+AECER PSR ETKRC T
Sbjct  484  ADTVAECERPPSRGETKRCAT  504


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 66/137 (48%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F  Y  + N+    F +Y  +  G A  F+SYA  GN PD  F NY A 
Sbjct  163  YSRDSVGHDDSFALYQPDGNIDTANFTSYATAATGGAGDFSSYAHEGNVPDLKFTNYEAD  222

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
             NG V  F+SY  ++N G  SF  YGK  N   + F +YG   N     F+ Y +     
Sbjct  223  ANGRVQKFSSYSDDTNSGGQSFAGYGKHGNGIPLSFTSYGSNSNVMNSDFNNYGE-----  277

Query  404  FNGYGVNNTFKDYAKTG  354
             +G G N+TF +Y + G
Sbjct  278  -DGNGANDTFTNYGQNG  293


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 57/117 (49%), Gaps = 3/117 (3%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F++YG +      +FKNY  S N   DTF  Y+ +    D++F  Y   GN     F SY
Sbjct  132  FSNYGADRAGGADSFKNYSASENSPIDTFRRYSRDSVGHDDSFALYQPDGNIDTANFTSY  191

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD---SDRVSFNGYG  390
               +  GA  F+SY  + N  D+ F NY    NG   KFS YSD   S   SF GYG
Sbjct  192  ATAATGGAGDFSSYAHEGNVPDLKFTNYEADANGRVQKFSSYSDDTNSGGQSFAGYG  248



>ref|XP_004300895.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Fragaria vesca subsp. vesca]
Length=634

 Score =   259 bits (661),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 136/260 (52%), Positives = 168/260 (65%), Gaps = 9/260 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGN     F SY  N+N++ + F  YGESG    D+F  Y  NGNNP + FK+YGAG
Sbjct  242  YGKNGNANPNEFNSYAGNANIVGSGFTGYGESGKAANDSFKGYGLNGNNPHSNFKSYGAG  301

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SDS  417
            G   +D+F+SYR  +NVG DSF SY K +N+  V F NYGK+FN G D F  Y    +  
Sbjct  302  GKSGIDSFSSYRNGANVGDDSFLSYAKNANSGKVTFSNYGKSFNLGNDSFKEYGAGSTGR  361

Query  416  DRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTA---AVGAAKGKMVNNKRWVEPGKFF  246
              V F  Y +  +FK+YAK GVTFA Y N T V A       + G  VN  RWVEPGKFF
Sbjct  362  TSVGFKSYSLGRSFKEYAKNGVTFAQYNNFTTVAADSEEKSGSSGSSVN--RWVEPGKFF  419

Query  245  REKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMI  66
            RE MLK G +M MPDI+DKMP+RSFLPR I ++LPFS + + EL+++FH  + SA  ++I
Sbjct  420  RESMLKQGNVMVMPDIKDKMPERSFLPRTILSKLPFSTSRMSELKELFHVGDNSATERVI  479

Query  65   AGTLAECERAPSRDETKRCV  6
              TL ECERAPS  ETK CV
Sbjct  480  TNTLTECERAPSPGETKYCV  499


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 81/161 (50%), Gaps = 12/161 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y K     +  FTSY +++NV +  F NY       +  F SY  + N P+  F +Y +G
Sbjct  158  YSKTSRSHSEHFTSYAHDANVANDTFTNYAAGAVAGSGDFNSYHDHVNVPNLRFASYDSG  217

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV-  408
             +    +F +Y  ++N GA++F SYGK  NA    F +Y    N     F+GY +S +  
Sbjct  218  SSNHKLSFTAYSDDTNAGAETFISYGKNGNANPNEFNSYAGNANIVGSGFTGYGESGKAA  277

Query  407  --SFNGYGVN-----NTFKDY---AKTGV-TFAGYLNATDV  318
              SF GYG+N     + FK Y    K+G+ +F+ Y N  +V
Sbjct  278  NDSFKGYGLNGNNPHSNFKSYGAGGKSGIDSFSSYRNGANV  318



>ref|XP_009593470.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Nicotiana tomentosiformis]
Length=636

 Score =   258 bits (660),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 173/256 (68%), Gaps = 5/256 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNG    FT+YG+ SNV+ ++F  YGESGN   D+F +Y+ N NNP+N FKNYGAG
Sbjct  249  YAKNGNGVPVEFTTYGDTSNVIGSSFNGYGESGNSANDSFKAYSTNSNNPNNNFKNYGAG  308

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF SYR  +N G D+F SY K S++    FVNYGK+FN G D F  Y   +   
Sbjct  309  GNSGVDTFTSYRNSANAGTDTFTSYAKGSSSGKANFVNYGKSFNEGKDTFKEYGKGAKDP  368

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             V F  YG NN+FK+Y+  GV FAGY   +  T       GK VN  +WVE GKFFRE +
Sbjct  369  SVGFKIYGFNNSFKEYSPKGVNFAGYTKKSTPTVGSLNTSGKSVN--KWVEEGKFFREAI  426

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK GT+M MPDIRDKMP+RSFLPR I+++LPFS  E+  ++ IFHA E S M ++I   L
Sbjct  427  LKEGTVMKMPDIRDKMPRRSFLPRTISSKLPFSTQELSNMKTIFHAQENSTMERVIINAL  486

Query  53   AECERAPSRDETKRCV  6
            AECERA S+ ETKRCV
Sbjct  487  AECERASSQGETKRCV  502


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 62/134 (46%), Gaps = 6/134 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F SY  + NV    F +Y     G   TF +Y    N PD  F +Y + 
Sbjct  165  YSRSSTGHREDFNSYAADGNVASGNFTSYAAGATGGGGTFQNYMPRVNVPDLRFASYDSD  224

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
            GN    +F SY  ++N G ++F SY K  N   V F  YG T N     F+GY +S    
Sbjct  225  GNNHKLSFTSYVGDTNSGNEAFISYAKNGNGVPVEFTTYGDTSNVIGSSFNGYGES----  280

Query  404  FNGYGVNNTFKDYA  363
              G   N++FK Y+
Sbjct  281  --GNSANDSFKAYS  292



>ref|XP_006659367.1| PREDICTED: BURP domain-containing protein 12-like, partial [Oryza 
brachyantha]
Length=495

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 140/265 (53%), Positives = 170/265 (64%), Gaps = 14/265 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    FT+YGN SNV+ + F NYGES NG  DTFT Y   GN PDNTF++YGAG
Sbjct  101  YGKNGNGLRETFTTYGNESNVIASGFANYGESANGATDTFTGYGAEGNVPDNTFRSYGAG  160

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
            GN  VDTF  YR ESNVG D+F SY K +N     F NYG +FN G+  F GY +    +
Sbjct  161  GNAGVDTFKGYRSESNVGDDTFASYAKGANGNAAEFQNYGGSFNPGSVTFKGYGEGTNPN  220

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYL-----NATDVTAAVGAAKGKMVNNKRWV-EP  258
              + F GY G NNTFK YAK+GV F  Y      NA   T ++ AA     ++ +W  EP
Sbjct  221  HHIGFKGYAGSNNTFKGYAKSGVDFKEYHNTSSDNAAAATMSLEAAVSSGHHHLKWSPEP  280

Query  257  GKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAM  78
            GKFFRE+ L +G  MPMPDI+DKMP R+FLPR+IA ++PF    + E   +F     +AM
Sbjct  281  GKFFREQELVTGNRMPMPDIKDKMPPRAFLPRDIAKKIPFKPDAVSE---VFGVPLDTAM  337

Query  77   AKMIAGTLAECERAPSRDETKRCVT  3
             K +A T+ ECERAPSR ETKRC T
Sbjct  338  GKAVASTVTECERAPSRGETKRCAT  362


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 75/167 (45%), Gaps = 24/167 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG++    A  F SY    NV+   F +Y     G    F SYA + N PD  F  Y   
Sbjct  17   YGRDSTRRADTFASYEAEGNVVTANFTSYAGGATGGTGAFASYAADRNGPDPPFTTYDGE  76

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGK--------------KSNAADVGFVNYGKTFNGG  447
             NG    F SY QE+N G ++F  YGK              +SN    GF NYG++ NG 
Sbjct  77   ANGRRREFTSYSQEANHGENTFAGYGKNGNGLRETFTTYGNESNVIASGFANYGESANGA  136

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG----VTFAGYLNATDV  318
            TD F+GY     V       +NTF+ Y   G     TF GY + ++V
Sbjct  137  TDTFTGYGAEGNVP------DNTFRSYGAGGNAGVDTFKGYRSESNV  177



>ref|XP_008221868.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=619

 Score =   255 bits (652),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 169/257 (66%), Gaps = 16/257 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y K+GNGA   FT YG ++N + + F  Y E+ NG  D F +Y  + NNP N FK+YG  
Sbjct  241  YSKHGNGAPNEFTGYGTDANSVGSGFTGYSEAVNGADDKFNNYGNDQNNPQNKFKSYGDS  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  V+TF SYR  +NVG DSF SY K S    V F+NYGK+F  G+DKF+GY   +  +
Sbjct  301  GNAAVETFTSYRDSANVGDDSFQSYAKNSEGEKVNFINYGKSFEVGSDKFTGYGKGAHGE  360

Query  413  RVSFNGYGVNNTFKDYAK-TGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             V F  YGVNN+F DY+K   +TF GY   +          G +V  KR VEPGKFFRE 
Sbjct  361  SVGFKIYGVNNSFSDYSKNESITFKGYTKLS----------GSLV--KRRVEPGKFFRES  408

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G +MPMP+I+DKMPKRSFLPR I+++LPF+ ++I EL++IF A + S M K++   
Sbjct  409  MLKKGIVMPMPNIQDKMPKRSFLPRFISSKLPFATSKIYELKRIFQAPDNSTMEKIMVDA  468

Query  56   LAECERAPSRDETKRCV  6
            L ECERAPS  ETKRCV
Sbjct  469  LEECERAPSAGETKRCV  485


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 69/145 (48%), Gaps = 15/145 (10%)
 Frame = -1

Query  749  NGAATGFTSYGNNSNVMDTAFKNYGES-GNGDADT---------FTSYAFNGNNPDNTFK  600
            N  +T    + +++N++   F + G S  N D DT         FT+Y        ++FK
Sbjct  84   NALSTRLQEFCSSANLL--CFPDVGHSLENHDGDTNFTAYSTKNFTNYGTARWAGVDSFK  141

Query  599  NYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD  420
            NY  G    VD+F  Y ++S    D FNSYG ++N  D  F NY      GT +F  Y+D
Sbjct  142  NYSVGDTSQVDSFRRYSRDSVNHTDDFNSYGPEANLVDQSFNNYATGAIAGTGEFKNYAD  201

Query  419  SDRV---SFNGYGVNNTFKDYAKTG  354
            S  V    FN Y  ++T + +A T 
Sbjct  202  SVNVPNLRFNSYSDDSTGRAHAFTA  226



>ref|XP_006365229.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Solanum tuberosum]
Length=611

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/258 (53%), Positives = 167/258 (65%), Gaps = 8/258 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y  +G G    F SY +++N    +FKNYG+ GNG    F  Y    N+P N F NYG  
Sbjct  221  YSDHGTGGEEEFKSYSDDANGGVQSFKNYGKDGNGPNGKFIEYGNKANDPQNNFNNYGVE  280

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKT---FNGGTDKFSGYSD--  420
            GNG  +TF +YR +S +G D F  Y K +N  +  F NYG++   F+ GTD+F+ Y +  
Sbjct  281  GNGISETFTNYRDQSTLGDDKFTVYVKDANGGEANFTNYGQSTDEFDNGTDEFTTYGEGG  340

Query  419  -SDRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFR  243
                ++F  YGVNN FK Y K   TF+ Y   T   +A     GK VNN RWVEPGKFFR
Sbjct  341  NDPHINFKTYGVNNNFKGYVKDTATFSNYRKKTPQVSA-SLTGGKKVNN-RWVEPGKFFR  398

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            EKMLKSGTIMPMPDI+DKMPKRSFLPR IAA+LPFS ++I EL+KIFHA   S +AK+I 
Sbjct  399  EKMLKSGTIMPMPDIKDKMPKRSFLPRVIAAKLPFSTSKIDELKKIFHAANDSQVAKIIG  458

Query  62   GTLAECERAPSRDETKRC  9
              L+ECERAPS  ETKRC
Sbjct  459  DALSECERAPSAGETKRC  476


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 59/106 (56%), Gaps = 2/106 (2%)
 Frame = -1

Query  731  FTSYGN-NSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNS  555
            FT+YG   S V   +FKNY + GN   ++F  Y+ +  + DN F NY   GN P  +FNS
Sbjct  105  FTNYGTKESGVGFNSFKNYSDEGNFPVNSFRRYSRDSPH-DNQFDNYAPDGNVPDQSFNS  163

Query  554  YRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS  417
            Y + +  G+  FN+Y   SN A++GF +Y     G   KF+ Y+ S
Sbjct  164  YSKNTPGGSGQFNNYDPNSNVANMGFNSYADNGAGSVQKFTNYAPS  209



>ref|XP_008776735.1| PREDICTED: BURP domain-containing protein 12-like [Phoenix dactylifera]
Length=641

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 139/266 (52%), Positives = 174/266 (65%), Gaps = 15/266 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GNG    F SYGNNSNV+++ F NYGE GNG  DTFT+Y  NGN P+ TF++YG+ 
Sbjct  246  YGKHGNGIPLTFISYGNNSNVINSDFNNYGEDGNGANDTFTNYGENGNVPETTFRSYGSS  305

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   + F++YR ++NVG DSF SY K  NA    F NYG +FN G+D F GY   S + 
Sbjct  306  GNAGSEKFSNYRDQANVGDDSFTSYTKGGNAGSADFKNYGNSFNQGSDSFKGYGEGSTNH  365

Query  413  RVSFNGY-GVNNTFKDYAKTGVTFAGYLN-------ATDVTAAVGAAKGKMVNNKRW-VE  261
            ++ F  Y G N TFK YAKTG++F  Y N       +    AA      +     RW VE
Sbjct  366  KIRFASYSGDNATFKGYAKTGISFKRYRNSSSLPSSSAATAAADATLAARRRPTSRWVVE  425

Query  260  PGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSA  81
            PGKFFRE  LK GT+MPMPDIRDKMP RSFLPR+IA  +PFSAAE+   +++F+    +A
Sbjct  426  PGKFFRESELKKGTVMPMPDIRDKMPARSFLPRSIAGRIPFSAAEV---QQVFNIPADTA  482

Query  80   MAKMIAGTLAECERAPSRDETKRCVT  3
            + K +  T+AECER PSR ETKRC T
Sbjct  483  LGKAVEDTVAECERPPSRGETKRCAT  508


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 56/117 (48%), Gaps = 3/117 (3%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            FT+YG +      +FKNY  S N   DTF  Y+ +    D++F  Y   GN     F SY
Sbjct  131  FTNYGTDRAGGADSFKNYSASENLPIDTFRRYSRDSAGHDDSFAVYQPDGNVVTANFTSY  190

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV---SFNGYG  390
               +  GA  F+SY  + N  ++ F NY    NG   +FS YSD       SF GYG
Sbjct  191  ASAATGGAGDFSSYASEVNVPNLKFTNYDADANGRVQRFSSYSDDTNAGDQSFAGYG  247



>ref|XP_007224206.1| hypothetical protein PRUPE_ppa017408mg [Prunus persica]
 gb|EMJ25405.1| hypothetical protein PRUPE_ppa017408mg [Prunus persica]
Length=620

 Score =   253 bits (647),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 168/257 (65%), Gaps = 16/257 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y K+GNGA   FT YG ++N + + F  Y E+ NG  D F +Y  + NNP N FK+YG  
Sbjct  241  YSKHGNGAPNEFTGYGTDANSVGSGFTGYSEAVNGADDKFNNYGNDQNNPQNKFKSYGDS  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
             N  V+TF SYR  +NVG DSF SY K S+   V FVNYGK+F  G+DKF+GY    R  
Sbjct  301  SNAAVETFTSYRDSANVGDDSFQSYAKNSDGEKVNFVNYGKSFEVGSDKFTGYGKGARGE  360

Query  410  -VSFNGYGVNNTFKDYAK-TGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             V F  YGVNN+F DYAK   +TF GY   +          G +V  KR VEPGKFFRE 
Sbjct  361  SVGFKIYGVNNSFSDYAKNESITFKGYTKLS----------GSLV--KRRVEPGKFFRES  408

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK G +MPMP+I+DKMPKRSFLP+ I+++LPF+ ++I EL++IF A + S M K++   
Sbjct  409  MLKKGIVMPMPNIQDKMPKRSFLPQFISSKLPFATSKIYELKRIFQAPDNSTMEKIMLDA  468

Query  56   LAECERAPSRDETKRCV  6
            L ECERAPS  ETKRCV
Sbjct  469  LEECERAPSAGETKRCV  485


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 62/130 (48%), Gaps = 8/130 (6%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F  Y  +S      F +YG   N    +F SYA         FKNY    N P   FNSY
Sbjct  154  FRRYSRDSVNHTDDFNSYGPEANLVDQSFNSYATGAIAGTGEFKNYADSVNVPNLRFNSY  213

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY-SDSDRV--SFNGY----  393
              +S   A +F +Y + +NA D  F +Y K  NG  ++F+GY +D++ V   F GY    
Sbjct  214  SDDSTGRAHAFTAYSENANAGDQSFTSYSKHGNGAPNEFTGYGTDANSVGSGFTGYSEAV  273

Query  392  -GVNNTFKDY  366
             G ++ F +Y
Sbjct  274  NGADDKFNNY  283



>ref|NP_001061692.1| Os08g0380100 [Oryza sativa Japonica Group]
 sp|Q6ZA27.1|BURPC_ORYSJ RecName: Full=BURP domain-containing protein 12; Short=OsBURP12; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD05416.1| putative polygalacturonase isoenzyme 1 beta subunit homolog [Oryza 
sativa Japonica Group]
 dbj|BAF23606.1| Os08g0380100 [Oryza sativa Japonica Group]
 dbj|BAG95253.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96203.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   253 bits (647),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 168/263 (64%), Gaps = 12/263 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    FT+YGN+SNV+ + F NYGESGNG  DTFT+Y   GN PDNTF++YGAG
Sbjct  235  YGKNGNGLRETFTTYGNDSNVIASGFTNYGESGNGATDTFTAYGKEGNVPDNTFRSYGAG  294

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
            GN  VDTF  YR ESNVG DSF SY K +N     F NYG +FN GT  F GY +    +
Sbjct  295  GNAGVDTFKGYRSESNVGDDSFASYAKGANGNAAEFQNYGGSFNPGTVTFKGYGEGSNPN  354

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAA----VGAAKGKMVNNKRWVEPGK  252
              + F  Y G NN+FK YAK+GV F  Y N +   AA    + A      + K   EPGK
Sbjct  355  HHIGFKEYAGSNNSFKGYAKSGVDFKEYHNTSSADAATTMSLEAVSSGHQHLKWSPEPGK  414

Query  251  FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAK  72
            FFRE  L SG  MPMPDI+DKMP R+FLPR+IA ++PF    + E   +F     +AM K
Sbjct  415  FFRETELVSGNTMPMPDIKDKMPPRAFLPRDIAKKIPFKPNAVSE---VFGVPLDTAMGK  471

Query  71   MIAGTLAECERAPSRDETKRCVT  3
             +  T+AECERAPSR ETKRC T
Sbjct  472  AVTSTVAECERAPSRGETKRCAT  494


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 81/167 (49%), Gaps = 24/167 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG++       F SY    NV+   F +Y  +  G + +F++YA + N PD+TF NY A 
Sbjct  151  YGRDSTRRVDTFASYEAEGNVVTANFTSYAGAATGGSGSFSAYAADTNVPDSTFTNYDAE  210

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGK--------------KSNAADVGFVNYGKTFNGG  447
             NG    F SY QE+N G+++F  YGK               SN    GF NYG++ NG 
Sbjct  211  ANGRRREFTSYSQEANHGSNTFAGYGKNGNGLRETFTTYGNDSNVIASGFTNYGESGNGA  270

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG----VTFAGYLNATDV  318
            TD F+ Y     V       +NTF+ Y   G     TF GY + ++V
Sbjct  271  TDTFTAYGKEGNVP------DNTFRSYGAGGNAGVDTFKGYRSESNV  311



>ref|XP_009393062.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=651

 Score =   254 bits (648),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 143/276 (52%), Positives = 175/276 (63%), Gaps = 27/276 (10%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+G+   T FTSY NNSNV+ ++F  YGE   G  D+F SY FNGN P+N F++YGAG
Sbjct  248  YGKDGDRVPTSFTSYANNSNVIGSSFAGYGEGAKGANDSFASYGFNGNVPENNFRSYGAG  307

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   + F+SYR +SNVG DSF SY K   AA   FVNYG +FN G+D F GY   S   
Sbjct  308  GNSGSERFSSYRDQSNVGDDSFASYAKGGGAATADFVNYGDSFNPGSDSFKGYGEGSAKH  367

Query  413  RVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGA-----------------AKGK  288
            RV+F  Y G N +FK YAK+GV F  Y N++   ++  A                 A GK
Sbjct  368  RVTFKSYAGDNTSFKGYAKSGVDFKSYRNSSVDPSSSSARAAATATATASLLSLRRAAGK  427

Query  287  MVNNKRW-VEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELE  111
              N  RW VEPGKFFRE  L+ G++MPMPDIRDKMP RSFLPR+IA  +PFS AE+    
Sbjct  428  PSN--RWLVEPGKFFREHDLRRGSVMPMPDIRDKMPPRSFLPRSIAGRIPFSPAEV---R  482

Query  110  KIFHAVEGSAMAKMIAGTLAECERAPSRDETKRCVT  3
            +IF     +A+ K +  T+AECERAPSR ETKRC T
Sbjct  483  RIFGIPADTALGKAVGDTVAECERAPSRGETKRCAT  518


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 64/145 (44%), Gaps = 8/145 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F SY  + NV+   F +YG S  G A  F SY    N PD  F NY A 
Sbjct  164  YSRDSTGHNDSFASYAPDGNVVTANFTSYGSSATGGAGDFASYDHESNVPDLKFTNYDAD  223

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
              G   +F+SY  ++N G  SF  YGK  +     F +Y    N     F+GY +  +  
Sbjct  224  ATGRRRSFSSYSDDTNAGDQSFAGYGKDGDRVPTSFTSYANNSNVIGSSFAGYGEGAKGA  283

Query  410  -VSFNGYGVN-----NTFKDYAKTG  354
              SF  YG N     N F+ Y   G
Sbjct  284  NDSFASYGFNGNVPENNFRSYGAGG  308


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 65/146 (45%), Gaps = 8/146 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG   +G  + F  Y ++ NV    F+ Y     G  D+F SYA +GN     F +YG+ 
Sbjct  136  YGTGASGGRSAFKHYSDDLNVPVDTFRRYSRDSTGHNDSFASYAPDGNVVTANFTSYGSS  195

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY-SDSDRV  408
              G    F SY  ESNV    F +Y   +      F +Y    N G   F+GY  D DRV
Sbjct  196  ATGGAGDFASYDHESNVPDLKFTNYDADATGRRRSFSSYSDDTNAGDQSFAGYGKDGDRV  255

Query  407  --SFNGYGVNNTFKDYAKTGVTFAGY  336
              SF  Y  N+        G +FAGY
Sbjct  256  PTSFTSYANNSNV-----IGSSFAGY  276



>ref|XP_007153633.1| hypothetical protein PHAVU_003G052000g [Phaseolus vulgaris]
 gb|ESW25627.1| hypothetical protein PHAVU_003G052000g [Phaseolus vulgaris]
Length=624

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 171/260 (66%), Gaps = 15/260 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKN  GA   FT YG NSNV  + F NYG  G G  DTF +Y  + N P+ TFK+Y  G
Sbjct  239  YGKNSAGAENEFTGYGTNSNVASSGFTNYGSKGTGPNDTFANYGVDMNVPEITFKSYADG  298

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKS-NAADVGFVNYGKTFNGGTDKFSGYSD----  420
             +G  +TF +YR +SNVG D+F SY K +     V F NYG + N GTD F GY+     
Sbjct  299  THGGTETFANYRDQSNVGDDTFQSYAKNTKEGTQVDFKNYGNSANPGTDTFKGYAKGAEG  358

Query  419  SDRVSFNGYGVNN--TFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFF  246
              +V F GYGVN   TFKDYAK GV+FA Y  ++   + +G   G +V  KRWVEPGKFF
Sbjct  359  DHKVGFTGYGVNTNATFKDYAKEGVSFASYNTSS---SNLG---GSLV--KRWVEPGKFF  410

Query  245  REKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMI  66
            RE MLK G++M MPDIRDKMP+RSFLPR+I  +LPFS+++I EL+ +F   + S+M KM+
Sbjct  411  RESMLKEGSVMGMPDIRDKMPQRSFLPRSILMKLPFSSSKIEELKSVFKVSDNSSMEKMM  470

Query  65   AGTLAECERAPSRDETKRCV  6
              +L ECERAPS  E KRCV
Sbjct  471  TDSLGECERAPSVGEIKRCV  490


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 55/119 (46%), Gaps = 9/119 (8%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNN-PDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNS  513
            F NYG +  G  DTF +Y+ +  + P N F+ Y  G  G  +TF  Y   +NV   SF++
Sbjct  123  FTNYGTARGGGIDTFKNYSNDLLSIPVNDFRRYSRGAAGHEETFTGYASGTNVADQSFHT  182

Query  512  YGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS--------DRVSFNGYGVNNTFKDYAK  360
            YG  S      F NY    N    +FS YSDS         R S +G     TF+ Y K
Sbjct  183  YGTNSAGGSGEFKNYSSDSNVPDLRFSTYSDSTAGRTQSFSRYSEDGNSGGQTFQSYGK  241



>gb|EEC83505.1| hypothetical protein OsI_29064 [Oryza sativa Indica Group]
Length=623

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 168/263 (64%), Gaps = 12/263 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    FT+YGN+SNV+ + F NYGESGNG  DTFT+Y   GN PDNTF++YGAG
Sbjct  204  YGKNGNGLRETFTTYGNDSNVIASGFTNYGESGNGATDTFTAYGKEGNVPDNTFRSYGAG  263

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
            GN  VDTF  YR ESNVG DSF SY K +N     F NYG +FN GT  F GY +    +
Sbjct  264  GNAGVDTFKGYRSESNVGDDSFASYAKGANGNAAEFQNYGGSFNPGTVTFKGYGEGSNPN  323

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMV---NNKRWV-EPGK  252
              + F  Y G NN+FK YAK+GV F  Y N +   AA   +   +     + +W  EPGK
Sbjct  324  HHIGFKEYAGSNNSFKGYAKSGVDFKEYHNTSSADAATAMSLEAVSSGHQHLKWSPEPGK  383

Query  251  FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAK  72
            FFRE  L SG  MPMPDI+DKMP R+FLPR+IA ++PF    + E   +F     +AM K
Sbjct  384  FFRETELVSGNTMPMPDIKDKMPPRAFLPRDIAKKIPFKPNAVSE---VFGVPLDTAMGK  440

Query  71   MIAGTLAECERAPSRDETKRCVT  3
             +  T+AECER PSR ETKRC T
Sbjct  441  AVTSTVAECEREPSRGETKRCAT  463


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 80/167 (48%), Gaps = 24/167 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++       F SY    NV+   F +Y  +  G + +F++YA + N PD+TF NY A 
Sbjct  120  YARDSTRRVDTFASYEPEGNVVTANFTSYAGAATGGSGSFSAYAADTNVPDSTFTNYDAE  179

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGK--------------KSNAADVGFVNYGKTFNGG  447
             NG    F SY QE+N G+++F  YGK               SN    GF NYG++ NG 
Sbjct  180  ANGRRREFTSYSQEANHGSNTFAGYGKNGNGLRETFTTYGNDSNVIASGFTNYGESGNGA  239

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG----VTFAGYLNATDV  318
            TD F+ Y     V       +NTF+ Y   G     TF GY + ++V
Sbjct  240  TDTFTAYGKEGNVP------DNTFRSYGAGGNAGVDTFKGYRSESNV  280



>ref|XP_010553600.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390 
[Tarenaya hassleriana]
Length=626

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/256 (52%), Positives = 174/256 (68%), Gaps = 12/256 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV+ + F  YG++ NG+ DTFTSY  +GN P N F++YG G
Sbjct  245  YSKNGNGAPNEFSGYGTGSNVVQSDFSGYGQTANGENDTFTSYGTDGNIPVNNFRSYGDG  304

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNG V  F SYR +SN+GADSF+SY K S+ A + F NY K+ N G+D F+ Y   + + 
Sbjct  305  GNGGVYGFKSYRDDSNIGADSFSSYAKNSDNAKIDFENYAKSVNLGSDNFTSYGHGAQNQ  364

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
               F  YG N  FK+Y K  V F+ Y N+T       +A GK VN  +WVEPGKFFRE M
Sbjct  365  ETGFKSYGPNPNFKEYTKNDVVFSRYTNST-------SASGKTVN--KWVEPGKFFREAM  415

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            L+ GT+M MPDIRDKMP+R+FLPR I A+LPFS++   E+ +IF A E S+++++I+  +
Sbjct  416  LREGTLMQMPDIRDKMPRRTFLPRAITAKLPFSSSTTREILRIFSAAENSSISRIISYAV  475

Query  53   AECERAPSRDETKRCV  6
            AECER PSR E KRCV
Sbjct  476  AECERPPSRGEVKRCV  491


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G + GF++Y +++NV D +F  YG    G +  FT+Y    N P+  F +Y   
Sbjct  161  YSRDSAGHSDGFSTYADDANVADQSFNTYGAGSTGGSGDFTAYLAGVNGPNGRFTSYSDD  220

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
             NG   +F SY  ++N G  +F SY K  N A   F  YG   N     FSGY  +    
Sbjct  221  ANGRSQSFTSYSSDANAGVQAFTSYSKNGNGAPNEFSGYGTGSNVVQSDFSGYGQT----  276

Query  404  FNGYGVNNTFKDYAKTG  354
                G N+TF  Y   G
Sbjct  277  --ANGENDTFTSYGTDG  291



>gb|EEE68602.1| hypothetical protein OsJ_27135 [Oryza sativa Japonica Group]
Length=703

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 169/263 (64%), Gaps = 12/263 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    FT+YGN+SNV+ + F NYGESGNG  DTFT+Y   GN PDNTF++YGAG
Sbjct  211  YGKNGNGLRETFTTYGNDSNVIASGFTNYGESGNGATDTFTAYGKEGNVPDNTFRSYGAG  270

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
            GN  VDTF  YR ESNVG DSF SY K +N     F NYG +FN GT  F GY +    +
Sbjct  271  GNAGVDTFKGYRSESNVGDDSFASYAKGANGNAAEFQNYGGSFNPGTVTFKGYGEGSNPN  330

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMV---NNKRWV-EPGK  252
              + F  Y G NN+FK YAK+GV F  Y N +   AA   +   +     + +W  EPGK
Sbjct  331  HHIGFKEYAGSNNSFKGYAKSGVDFKEYHNTSSADAATTMSLEAVSSGHQHLKWSPEPGK  390

Query  251  FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAK  72
            FFRE  L SG  MPMPDI+DKMP R+FLPR+IA ++PF    + E   +F     +AM K
Sbjct  391  FFRETELVSGNTMPMPDIKDKMPPRAFLPRDIAKKIPFKPNAVSE---VFGVPLDTAMGK  447

Query  71   MIAGTLAECERAPSRDETKRCVT  3
             +  T+AECERAPSR ETKRC T
Sbjct  448  AVTSTVAECERAPSRGETKRCAT  470


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 81/167 (49%), Gaps = 24/167 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG++       F SY    NV+   F +Y  +  G + +F++YA + N PD+TF NY A 
Sbjct  127  YGRDSTRRVDTFASYEAEGNVVTANFTSYAGAATGGSGSFSAYAADTNVPDSTFTNYDAE  186

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGK--------------KSNAADVGFVNYGKTFNGG  447
             NG    F SY QE+N G+++F  YGK               SN    GF NYG++ NG 
Sbjct  187  ANGRRREFTSYSQEANHGSNTFAGYGKNGNGLRETFTTYGNDSNVIASGFTNYGESGNGA  246

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG----VTFAGYLNATDV  318
            TD F+ Y     V       +NTF+ Y   G     TF GY + ++V
Sbjct  247  TDTFTAYGKEGNVP------DNTFRSYGAGGNAGVDTFKGYRSESNV  287



>ref|XP_006476763.1| PREDICTED: probable polygalacturonase non-catalytic subunit At1g60390-like 
[Citrus sinensis]
Length=624

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/258 (50%), Positives = 164/258 (64%), Gaps = 15/258 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGN   T FTSY +++N + ++F  Y ESGN   D+F +Y  +GNNP N FK+YG G
Sbjct  243  YGKNGNAGPTDFTSYADSANTVGSSFTGYAESGNAANDSFKAYGVSGNNPHNNFKSYGIG  302

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
             N  V  F SYR  +NVG DSF SY K +N+  V F NYGKTFN G D F  Y  +    
Sbjct  303  ANSAVAGFTSYRNGANVGDDSFQSYAKNANSGKVNFANYGKTFNLGNDTFKEYGKASVGR  362

Query  413  -RVSFNGYGVNNTFKDYAK-TGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
              + F  Y +  +FK+Y K   VTFAGY N +    +V           RWVEPGKFFRE
Sbjct  363  TSIGFKNYDMGRSFKEYTKGVPVTFAGYTNLSSDANSV----------NRWVEPGKFFRE  412

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
             MLK G +M MPDIRDKMP+RSFLPR I+++LPF+ +++ +L++IF   + S+M ++I  
Sbjct  413  SMLKQGNVMVMPDIRDKMPRRSFLPRPISSKLPFATSQLTQLKEIFRVRDNSSMERVIVN  472

Query  59   TLAECERAPSRDETKRCV  6
             LAECER PS  E KRCV
Sbjct  473  ALAECERPPSPGEAKRCV  490


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 77/161 (48%), Gaps = 12/161 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +   G    FTSY  + NV +  F +Y  + N  +  F +YA   N P+  F +Y + 
Sbjct  159  YSRESTGHTEDFTSYAKDGNVANENFTSYAANANAGSGGFNNYAERVNVPNLRFASYVSD  218

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV-  408
            GN    +F SY  ++N GA+ F SYGK  NA    F +Y  + N     F+GY++S    
Sbjct  219  GNNHKLSFTSYGSDTNSGAEGFMSYGKNGNAGPTDFTSYADSANTVGSSFTGYAESGNAA  278

Query  407  --SFNGYGV-----NNTFKDY---AKTGVT-FAGYLNATDV  318
              SF  YGV     +N FK Y   A + V  F  Y N  +V
Sbjct  279  NDSFKAYGVSGNNPHNNFKSYGIGANSAVAGFTSYRNGANV  319


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 71/159 (45%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G    F +Y    N  + +FK Y     G  + FTSYA +GN  +  F +Y A 
Sbjct  131  YGDSKLGGIDSFKNYSQALNTPNDSFKKYSRESTGHTEDFTSYAKDGNVANENFTSYAAN  190

Query  584  GNGPVDTFNSYRQESNV--------------GADSFNSYGKKSNAADVGFVNYGKTFNGG  447
             N     FN+Y +  NV                 SF SYG  +N+   GF++YGK  N G
Sbjct  191  ANAGSGGFNNYAERVNVPNLRFASYVSDGNNHKLSFTSYGSDTNSGAEGFMSYGKNGNAG  250

Query  446  TDKFSGYSDSDRV---SFNGY-----GVNNTFKDYAKTG  354
               F+ Y+DS      SF GY       N++FK Y  +G
Sbjct  251  PTDFTSYADSANTVGSSFTGYAESGNAANDSFKAYGVSG  289


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 8/120 (7%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG+S  G  D+F +Y+   N P+++FK Y     G  + F SY ++ NV  ++F SY
Sbjct  128  FANYGDSKLGGIDSFKNYSQALNTPNDSFKKYSRESTGHTEDFTSYAKDGNVANENFTSY  187

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYS---DSDRVSFNGYGVNNT-----FKDYAKTG  354
               +NA   GF NY +  N    +F+ Y    ++ ++SF  YG +       F  Y K G
Sbjct  188  AANANAGSGGFNNYAERVNVPNLRFASYVSDGNNHKLSFTSYGSDTNSGAEGFMSYGKNG  247



>ref|XP_008374449.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=629

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 169/259 (65%), Gaps = 8/259 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GN     FT Y   SN++ + F  YGESGNG  D+FT Y  + NNP N FK+YGAG
Sbjct  239  YGKSGNSNPNQFTRYAEGSNIIGSGFTGYGESGNGQNDSFTGYGQSSNNPHNNFKSYGAG  298

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
            GN  ++ F++YR  + VG D F SY + SN+  V F NYGK+FN G D F  Y    +  
Sbjct  299  GNAGLNGFSNYRSWATVGDDMFQSYARNSNSGKVRFSNYGKSFNPGNDSFKEYGAGSKGR  358

Query  410  --VSFNGYGVNNTFKDYAKTGVTFAGY--LNATDVTAAVGAAKGKMVNNKRWVEPGKFFR  243
              V F  YG+  +FK+YAK GVTFA Y  L++    +    + G  VN  RWVEPGKFFR
Sbjct  359  TTVGFKTYGLGRSFKEYAKNGVTFAEYNDLSSVGTHSTEKESSGSAVN--RWVEPGKFFR  416

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            E ML+ G +M MPDIRD+MP+RSFLPR I ++LPFS   + E+++IFHA E SAM +++ 
Sbjct  417  ESMLRQGNVMVMPDIRDRMPERSFLPRGILSKLPFSTLRMSEIKEIFHAPENSAMERVLT  476

Query  62   GTLAECERAPSRDETKRCV  6
              LAECER PS  ETKRCV
Sbjct  477  NALAECERDPSPGETKRCV  495


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 8/123 (7%)
 Frame = -1

Query  698  DTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSF  519
            D  F NYG S  G  D+F +Y+   N+P ++FK Y  G +  ++ F SY Q++NV   +F
Sbjct  121  DKNFANYGSSQLGGVDSFKNYSEELNSPRDSFKKYSKGSHSHLEKFTSYAQDANVANANF  180

Query  518  NSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSDRVSFNGYGVN-----NTFKDYA  363
             SYG  S      F +Y    N  +  F+ Y   ++  R+SF  YG +      +F  Y 
Sbjct  181  TSYGADSGGGSGEFTSYDDRVNVHSLGFTSYVSNANDHRLSFTAYGHDTNSGSESFARYG  240

Query  362  KTG  354
            K+G
Sbjct  241  KSG  243


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 62/147 (42%), Gaps = 10/147 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G    F +Y    N    +FK Y +  +   + FTSYA + N  +  F +YGA 
Sbjct  127  YGSSQLGGVDSFKNYSEELNSPRDSFKKYSKGSHSHLEKFTSYAQDANVANANFTSYGAD  186

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
              G    F SY    NV +  F SY   +N   + F  YG   N G++ F+ Y  S    
Sbjct  187  SGGGSGEFTSYDDRVNVHSLGFTSYVSNANDHRLSFTAYGHDTNSGSESFARYGKS----  242

Query  404  FNGYGVNNTFKDYAK----TGVTFAGY  336
              G    N F  YA+     G  F GY
Sbjct  243  --GNSNPNQFTRYAEGSNIIGSGFTGY  267



>ref|XP_009394250.1| PREDICTED: BURP domain-containing protein 12-like [Musa acuminata 
subsp. malaccensis]
Length=646

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 172/263 (65%), Gaps = 12/263 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GNG  + F SY N+SNV+ + F  YGE  N   D+FT+Y FNGN P+N F++YG  
Sbjct  254  YGKDGNGVVSAFASYANDSNVIGSGFAGYGEGANAARDSFTNYGFNGNVPENNFRSYGDR  313

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD---SD  414
            GNG  + F+SYR ESNVG DSF SY K SNA    F NYG +FN G+D F GY     + 
Sbjct  314  GNGGSERFSSYRDESNVGDDSFTSYAKGSNAGTAEFDNYGNSFNPGSDSFKGYGQGFGNH  373

Query  413  RVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKR----W-VEPGK  252
             ++F  Y G NN+FK YAK+G+ F  Y + +   ++   A   +   K+    W VEPGK
Sbjct  374  EITFKSYIGENNSFKGYAKSGIDFKAYRHPSSSPSSAHPADAAVKPVKKIAGHWLVEPGK  433

Query  251  FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAK  72
            FFRE  L+SG +MPMPDIRDKMP RSFLPR+IA  + FSAAE+   ++ F     +A+ K
Sbjct  434  FFREHELRSGNLMPMPDIRDKMPARSFLPRSIAGRIAFSAAEV---QRFFGIPADTALGK  490

Query  71   MIAGTLAECERAPSRDETKRCVT  3
             +A T+AECERAPSR ETKRC T
Sbjct  491  AVADTVAECERAPSRGETKRCTT  513


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 71/157 (45%), Gaps = 8/157 (5%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F++Y   +     +F+NY ES N   DTF  Y+ +    +++F +Y  GGN     F SY
Sbjct  139  FSNYATGAVGGTQSFENYSESLNVPVDTFRRYSRDSAGHNDSFASYAPGGNVVTAKFTSY  198

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD---SDRVSFNGYGVNN  381
               +  G   F SYG  +N  ++ F NY    NG    F  YSD   S   SF GYG   
Sbjct  199  ASSATGGTGDFTSYGDDTNNPELKFTNYDAQANGRHQSFGSYSDDANSGDQSFAGYG---  255

Query  380  TFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKR  270
              KD       FA Y N ++V  +  A  G+  N  R
Sbjct  256  --KDGNGVVSAFASYANDSNVIGSGFAGYGEGANAAR  290


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 55/128 (43%), Gaps = 17/128 (13%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F SY    NV+   F +Y  S  G    FTSY  + NNP+  F NY A 
Sbjct  170  YSRDSAGHNDSFASYAPGGNVVTAKFTSYASSATGGTGDFTSYGDDTNNPELKFTNYDAQ  229

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV-  408
             NG   +F SY  ++N G              D  F  YGK  NG    F+ Y++   V 
Sbjct  230  ANGRHQSFGSYSDDANSG--------------DQSFAGYGKDGNGVVSAFASYANDSNVI  275

Query  407  --SFNGYG  390
               F GYG
Sbjct  276  GSGFAGYG  283



>ref|XP_010028282.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Eucalyptus grandis]
 gb|KCW83445.1| hypothetical protein EUGRSUZ_B00367 [Eucalyptus grandis]
Length=643

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 163/260 (63%), Gaps = 8/260 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y K+GN + T F +Y  +SN + + F  YG  GN   +TFTSY  N N+P NTFK Y  G
Sbjct  251  YAKHGNSSPTHFATYSGDSNTISSTFSGYGLLGNAGNETFTSYGGNANDPHNTFKGYSTG  310

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
            GN   ++F SYR ++NVG  SF SY + +N+A   F +YGK+FN G D F  Y    +  
Sbjct  311  GNSATESFTSYRNKANVGDSSFQSYARSANSAKTTFASYGKSFNEGNDTFKEYGKGSKGQ  370

Query  410  --VSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNN---KRWVEPGKFF  246
              + F  Y V+  FKDYA+ GVTFAGY N +   A + +   + ++     RWVEPG+FF
Sbjct  371  TTIDFKEYSVDRNFKDYAQKGVTFAGYSNVSS-EAQLSSPSSRTISGGSVNRWVEPGRFF  429

Query  245  REKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMI  66
            RE  L+ GT+M MPDI DKMP+RSFLPR IA++LPFS   + E++++F   EGSA   +I
Sbjct  430  RESELRPGTVMQMPDIVDKMPRRSFLPRAIASKLPFSTQRLQEVKELFAVQEGSATEHVI  489

Query  65   AGTLAECERAPSRDETKRCV  6
               L ECER PSR E KRCV
Sbjct  490  LNALRECERPPSRGEMKRCV  509


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 78/161 (48%), Gaps = 12/161 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y K G+G + GF +Y  + NV +++F NY    NG +  F +Y    N P+  F  Y + 
Sbjct  167  YTKEGSGHSEGFANYATDGNVANSSFANYAFGANGGSGDFKNYHLRVNVPNLLFTTYDSD  226

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN    +F SY Q++N G  SF SY K  N++   F  Y    N  +  FSGY    ++ 
Sbjct  227  GNDHKRSFTSYNQDANTGGQSFTSYAKHGNSSPTHFATYSGDSNTISSTFSGYGLLGNAG  286

Query  413  RVSFNGYGVN-----NTFKDYAKTG----VTFAGYLNATDV  318
              +F  YG N     NTFK Y+  G     +F  Y N  +V
Sbjct  287  NETFTSYGGNANDPHNTFKGYSTGGNSATESFTSYRNKANV  327



>ref|XP_010101197.1| hypothetical protein L484_015001 [Morus notabilis]
 gb|EXB87871.1| hypothetical protein L484_015001 [Morus notabilis]
Length=637

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 160/257 (62%), Gaps = 12/257 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNG  + F SYG  SN + + F  YGESGNG  DTF  Y  +GNNP + FK+YG+G
Sbjct  254  YSKNGNGVPSEFGSYGEGSNTVGSGFTGYGESGNGGNDTFKGYGLSGNNPKSDFKSYGSG  313

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SDS  417
            G   +D F +YR  +NVG DSF SY + SN+    FVNYGK+FN G D F  Y    +  
Sbjct  314  GTAGIDQFWNYRNGANVGGDSFLSYARNSNSGKAIFVNYGKSFNLGNDSFKEYGKGATGR  373

Query  416  DRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
              + F  Y +  TFKDY K GV F  Y N +       A  G +VN  R VE GKFFRE 
Sbjct  374  TTIGFKSYSLGRTFKDYTKNGVVFMEYNNFST------AESGNVVN--RRVEEGKFFRES  425

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
             LK G +M MPDIRDKM KRSFLPR +  +LPFS   + EL+ IFHA +GSAM ++I   
Sbjct  426  ALKKGNVMAMPDIRDKMRKRSFLPRYLLTKLPFSKMRLDELKVIFHAQDGSAMERVIIDA  485

Query  56   LAECERAPSRDETKRCV  6
            L ECERAPS  ETKRCV
Sbjct  486  LDECERAPSPGETKRCV  502


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 61/120 (51%), Gaps = 8/120 (7%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G  D+F +Y+   N+P+++F+ Y  G N   + F++Y  ++NV   +F +Y
Sbjct  139  FANYGAARLGGGDSFKNYSAELNSPNDSFRKYSRGSNSHGEGFDNYAADANVATSTFTNY  198

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSDRVSFNGYGVN-----NTFKDYAKTG  354
            G  + A    F  Y +  N    +FS Y   ++  R+SF+ Y         +F  Y+K G
Sbjct  199  GADATAGSGEFKTYHRQVNVPNLRFSSYDSAANGHRLSFSSYAAETNSGAESFVSYSKNG  258



>ref|XP_008239752.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Prunus mume]
Length=627

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/259 (51%), Positives = 165/259 (64%), Gaps = 8/259 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK GN   T F+SY  ++N++ + F  YGESG G  D+F  Y  + NNP N FK+YG G
Sbjct  237  YGKTGNANPTEFSSYAEDANIIGSGFTGYGESGTGQNDSFKGYGQSANNPHNNFKSYGGG  296

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
            G   +D F++YR  +NVG DSF SY + SN+  V F NYGK+FN G D F  Y    +  
Sbjct  297  GTSGIDGFSNYRSGANVGDDSFQSYARNSNSGKVSFSNYGKSFNPGNDSFKEYGTGSKGR  356

Query  410  --VSFNGYGVNNTFKDYAKTGVTFAGY--LNATDVTAAVGAAKGKMVNNKRWVEPGKFFR  243
              V F  YG+   FK+YAK GVTFA Y  L+     A    + G +VN  +WVEPGKFFR
Sbjct  357  TSVGFKSYGLGRNFKEYAKNGVTFAEYSSLSKEGTEATKTESSGSLVN--KWVEPGKFFR  414

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            E MLK G ++ MPDIRDKMP+RSFLPR I ++LPFS   + EL +IFHA + SAM  ++ 
Sbjct  415  ESMLKQGNVVVMPDIRDKMPERSFLPRGILSKLPFSTPGLSELREIFHARDNSAMEHVLT  474

Query  62   GTLAECERAPSRDETKRCV  6
              L ECERAPS  ETK CV
Sbjct  475  NALGECERAPSPGETKLCV  493


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 51/108 (47%), Gaps = 22/108 (20%)
 Frame = -1

Query  611  NTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFS  432
            ++FKNY  G N P D+F  Y +++N  ++ F  Y  ++N A+  F +YG    GG+ +F+
Sbjct  134  DSFKNYSDGLNSPYDSFKKYSKDANSHSEKFTFYAHEANVANASFTSYGADSAGGSGEFT  193

Query  431  GYSDS-----------------DRVSFNGYGVN-----NTFKDYAKTG  354
             Y D                   R+SF GY  +      TF  Y KTG
Sbjct  194  SYDDQVNVPNLRFAAYDSDANNHRLSFIGYSHDTNSGSETFVSYGKTG  241


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/159 (30%), Positives = 71/159 (45%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYG--  591
            YG         F +Y +  N    +FK Y +  N  ++ FT YA   N  + +F +YG  
Sbjct  125  YGSPQPAGGDSFKNYSDGLNSPYDSFKKYSKDANSHSEKFTFYAHEANVANASFTSYGAD  184

Query  590  -AGGNG-----------PVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
             AGG+G           P   F +Y  ++N    SF  Y   +N+    FV+YGKT N  
Sbjct  185  SAGGSGEFTSYDDQVNVPNLRFAAYDSDANNHRLSFIGYSHDTNSGSETFVSYGKTGNAN  244

Query  446  TDKFSGYSDSDRV---SFNGY-----GVNNTFKDYAKTG  354
              +FS Y++   +    F GY     G N++FK Y ++ 
Sbjct  245  PTEFSSYAEDANIIGSGFTGYGESGTGQNDSFKGYGQSA  283



>ref|XP_004501939.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=627

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/258 (51%), Positives = 165/258 (64%), Gaps = 14/258 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDA-DTFTSYAFNGNNPDNTFKNYGA  588
            YGK      + FT+Y  ++N++ + F +Y E G G A D+F SY+FNGNNP N FK Y A
Sbjct  245  YGKRVRSGNSDFTNYAVDANILQSTFTSYSELGTGAANDSFRSYSFNGNNPRNNFKTYSA  304

Query  587  GGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SD  420
            G +   DTF SYR  +NVG DSF SYG KS +    F NYG++FN G D F+ Y    S 
Sbjct  305  GSDFGSDTFISYRDRANVGDDSFQSYGSKSKSGTASFANYGQSFNEGNDTFTEYGKGSSG  364

Query  419  SDRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
                 F  YG+   FK Y K GV+F+ Y N         A  GK+VN  R+VEPGKFFRE
Sbjct  365  KTAFGFKTYGLGRAFKGYNKNGVSFSAYNN-------FSAFSGKIVN--RFVEPGKFFRE  415

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
             MLK G +M MPDI+DKMP R FLP  I+++LPFS++ +GE+++ FHA EGSA  ++I  
Sbjct  416  SMLKEGNVMMMPDIKDKMPARMFLPLTISSKLPFSSSRLGEVKEAFHAREGSATERVIIN  475

Query  59   TLAECERAPSRDETKRCV  6
             L ECERAPS DETKRCV
Sbjct  476  ALGECERAPSMDETKRCV  493


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 71/171 (42%), Gaps = 37/171 (22%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G    F +Y N  N  + +FK Y  +       F SYA NGN  +  F +YG+G
Sbjct  133  YGSSQLGGVDSFKNYSNGLNTNNDSFKRYSTTSTRHGGNFNSYAENGNVANTNFTSYGSG  192

Query  584  ---GNGPVD-------------------------TFNSYRQESNVGADSFNSYGKKSNAA  489
               G G                            +F+SY  E+N G+ SFNSYGK+  + 
Sbjct  193  STSGTGEFKNYDKLVNVPNLGFTTYDSAAKNHELSFSSYGNETNSGSQSFNSYGKRVRSG  252

Query  488  DVGFVNYGKTFNGGTDKFSGYS--------DSDR-VSFNGYGVNNTFKDYA  363
            +  F NY    N     F+ YS        DS R  SFNG    N FK Y+
Sbjct  253  NSDFTNYAVDANILQSTFTSYSELGTGAANDSFRSYSFNGNNPRNNFKTYS  303



>ref|XP_007210277.1| hypothetical protein PRUPE_ppa003003mg [Prunus persica]
 gb|EMJ11476.1| hypothetical protein PRUPE_ppa003003mg [Prunus persica]
Length=613

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 165/259 (64%), Gaps = 8/259 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK GN   T F+SY  ++N++ + F  YGESG G  D+F  Y  + NNP N FK+YG G
Sbjct  223  YGKTGNANPTEFSSYAEDANIIGSGFTGYGESGTGQNDSFKGYGQSANNPHNNFKSYGGG  282

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
            G   +D F++YR  +NVG DSF SY + SN+  V F NYGK+FN G D F  Y    +  
Sbjct  283  GTSGIDGFSNYRSGANVGDDSFQSYARNSNSGKVSFSNYGKSFNPGNDSFKEYGTGSKGR  342

Query  410  --VSFNGYGVNNTFKDYAKTGVTFAGY--LNATDVTAAVGAAKGKMVNNKRWVEPGKFFR  243
              V F  Y +  +FK+YAK GV FA Y  L+     A    + G +VN  +WVEPGKFFR
Sbjct  343  TSVGFKSYALGRSFKEYAKNGVAFAEYSSLSKEGTEATKTESSGSLVN--KWVEPGKFFR  400

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            E MLK G ++ MPDIRDKMP+RSFLPR I ++LPFS   + EL +IFHA + SAM  ++ 
Sbjct  401  ESMLKQGNVVVMPDIRDKMPERSFLPRGILSKLPFSTPGMSELREIFHARDNSAMEHVLT  460

Query  62   GTLAECERAPSRDETKRCV  6
              L ECERAPS  ETKRCV
Sbjct  461  NALGECERAPSPGETKRCV  479


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 59/121 (49%), Gaps = 10/121 (8%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG S  GD D+F +Y+   N+P ++FK Y    N   + F  Y  E+NV   SF SY
Sbjct  108  FANYGSSQLGDGDSFKNYSDGLNSPYDSFKKYSKDANSHSEKFTFYAHEANVANASFTSY  167

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD----RVSFNGYGVN-----NTFKDYAKT  357
            G  S      F +Y    N    +F+ Y DSD    R+SF GY  +      TF  Y KT
Sbjct  168  GADSAGGSGQFTSYDDQVNVPNLRFAAY-DSDANNHRLSFIGYSHDTNSGSETFVSYGKT  226

Query  356  G  354
            G
Sbjct  227  G  227


 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 73/159 (46%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYG--  591
            YG +  G    F +Y +  N    +FK Y +  N  ++ FT YA   N  + +F +YG  
Sbjct  111  YGSSQLGDGDSFKNYSDGLNSPYDSFKKYSKDANSHSEKFTFYAHEANVANASFTSYGAD  170

Query  590  -AGGNG-----------PVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
             AGG+G           P   F +Y  ++N    SF  Y   +N+    FV+YGKT N  
Sbjct  171  SAGGSGQFTSYDDQVNVPNLRFAAYDSDANNHRLSFIGYSHDTNSGSETFVSYGKTGNAN  230

Query  446  TDKFSGYSDSDRV---SFNGY-----GVNNTFKDYAKTG  354
              +FS Y++   +    F GY     G N++FK Y ++ 
Sbjct  231  PTEFSSYAEDANIIGSGFTGYGESGTGQNDSFKGYGQSA  269



>ref|XP_002444270.1| hypothetical protein SORBIDRAFT_07g019310 [Sorghum bicolor]
 gb|EES13765.1| hypothetical protein SORBIDRAFT_07g019310 [Sorghum bicolor]
Length=658

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 135/265 (51%), Positives = 168/265 (63%), Gaps = 14/265 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GNG    F+SYGN SNV+ + F NYG+S NG  DTFT Y   GN P+NTF+NYGAG
Sbjct  252  YGKSGNGVRETFSSYGNESNVLGSGFANYGQSANGATDTFTGYGVEGNVPENTFRNYGAG  311

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
            GN  VDTF  YR ++NVG D F SY K +N     F +YG + N G+  F GY +    +
Sbjct  312  GNAGVDTFKKYRDDANVGDDRFTSYAKGANGGAAEFQSYGNSANPGSTTFKGYGEGSNPN  371

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAV-----GAAKGKMVNNKRW-VEP  258
              + F  Y G NNTFK YAKTGV+F  Y N +  TAA+      AA  +  ++ +W  EP
Sbjct  372  HHIGFKEYAGENNTFKGYAKTGVSFKEYHNTSSSTAALTVSAEAAASMQHHDHLKWSPEP  431

Query  257  GKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAM  78
            GKFFRE+ L SG  MPMPDIRDKMP R+FLPR IAA +PF    + E    F     +A+
Sbjct  432  GKFFREQELVSGNRMPMPDIRDKMPPRAFLPRAIAARIPFDPQAVSE---AFGLPLDTAL  488

Query  77   AKMIAGTLAECERAPSRDETKRCVT  3
             K ++ T+AEC RAPS+ ETKRC T
Sbjct  489  GKAVSSTVAECLRAPSKGETKRCAT  513


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 79/151 (52%), Gaps = 20/151 (13%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG++ +G A  F SY ++ NV+   F +Y     G + +F +YA   N PD+TF NY AG
Sbjct  168  YGRDSSGRADSFASYESDGNVVTANFTSYAGGATGGSGSFAAYAAETNVPDSTFTNYDAG  227

Query  584  GNGPVDTFNSYRQESNVGA--------------DSFNSYGKKSNAADVGFVNYGKTFNGG  447
             NG   +F SY QE+N G               ++F+SYG +SN    GF NYG++ NG 
Sbjct  228  ANGRGRSFASYSQEANHGENGFSGYGKSGNGVRETFSSYGNESNVLGSGFANYGQSANGA  287

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG  354
            TD F+GY     V        NTF++Y   G
Sbjct  288  TDTFTGYGVEGNVP------ENTFRNYGAGG  312


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 67/155 (43%), Gaps = 24/155 (15%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG  G   AD+F +Y+ + N   ++F+ YG   +G  D+F SY  + NV   +F SY
Sbjct  137  FSNYGTGGVAGADSFRNYSPDLNIAADSFRRYGRDSSGRADSFASYESDGNVVTANFTSY  196

Query  509  --------------GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFK  372
                            ++N  D  F NY    NG    F+ YS       NG      F 
Sbjct  197  AGGATGGSGSFAAYAAETNVPDSTFTNYDAGANGRGRSFASYSQEANHGENG------FS  250

Query  371  DYAKTG----VTFAGYLNATDVTAAVGAAKGKMVN  279
             Y K+G     TF+ Y N ++V  +  A  G+  N
Sbjct  251  GYGKSGNGVRETFSSYGNESNVLGSGFANYGQSAN  285



>ref|XP_006365230.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Solanum tuberosum]
Length=627

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 134/258 (52%), Positives = 170/258 (66%), Gaps = 13/258 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y  +G G    F SY +++N  + +F NYG+ GNG    F SY   G++  N FKNYG  
Sbjct  242  YSDHGTGGEQEFKSYSDDANEANQSFINYGKDGNGANSKFNSYGNKGSSI-NKFKNYGVE  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKT---FNGGTDKFSGYS---  423
            GNG  +TF +YR++S+ G D F +Y K +N  +  F NYG++    + GTD+F+ Y    
Sbjct  301  GNGISETFTNYREQSSFGNDRFTNYVKDANGGEANFTNYGQSTDELDPGTDEFTTYGKGG  360

Query  422  DSDRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFR  243
            +   ++F  YG +  FK Y K   TF+ Y N T   + +G   GK VNN RWVEPGKFFR
Sbjct  361  NDPHINFKSYGGDKLFKGYVKDTATFSNYRNKT--PSLIG---GKKVNN-RWVEPGKFFR  414

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            EKMLKSGTIMPMPDI+DKMPKRSFLPR IAA+LPFS ++IGEL+KIFHA     +AKMI 
Sbjct  415  EKMLKSGTIMPMPDIKDKMPKRSFLPRVIAAKLPFSTSKIGELKKIFHAANDFQVAKMIG  474

Query  62   GTLAECERAPSRDETKRC  9
              L+ECERAPS  ETKRC
Sbjct  475  DALSECERAPSAGETKRC  492


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 57/129 (44%), Gaps = 3/129 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGA-  588
            YG +GN A   F SY  N+      F NYG + N     F SYA NG      F NY   
Sbjct  171  YGPDGNTAVQSFNSYSTNTPGGSGKFNNYGPNSNDANMGFNSYADNGAGSVQKFTNYAPI  230

Query  587  GGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD--SD  414
              N P   F SY      G   F SY   +N A+  F+NYGK  NG   KF+ Y +  S 
Sbjct  231  RSNIPNIHFTSYSDHGTGGEQEFKSYSDDANEANQSFINYGKDGNGANSKFNSYGNKGSS  290

Query  413  RVSFNGYGV  387
               F  YGV
Sbjct  291  INKFKNYGV  299


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 66/133 (50%), Gaps = 11/133 (8%)
 Frame = -1

Query  731  FTSYGN-NSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNS  555
            FT+YG   + +   +FKNY E  N   ++F  Y  +    DN F NYG  GN  V +FNS
Sbjct  126  FTNYGTKEAGIGVNSFKNYTEEENFPMNSFRRYGRDSPR-DNQFDNYGPDGNTAVQSFNS  184

Query  554  YRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SDSDRVSFNGYGV  387
            Y   +  G+  FN+YG  SN A++GF +Y     G   KF+ Y    S+   + F  Y  
Sbjct  185  YSTNTPGGSGKFNNYGPNSNDANMGFNSYADNGAGSVQKFTNYAPIRSNIPNIHFTSYSD  244

Query  386  NNT-----FKDYA  363
            + T     FK Y+
Sbjct  245  HGTGGEQEFKSYS  257



>ref|XP_010678748.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Beta vulgaris subsp. vulgaris]
Length=628

 Score =   243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 125/258 (48%), Positives = 167/258 (65%), Gaps = 14/258 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG  T F SY  +SN++ + F +YG+  N   D+F  Y  + NNP NTFKNYG+ 
Sbjct  246  YGKNGNGVPTEFNSYSKSSNIVGSTFASYGQLANAANDSFKGYGGSANNPHNTFKNYGSK  305

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
             +  V+ F +YR+ +NVG D+F +Y + S +    FVNYGK+FN G DKF GY   + + 
Sbjct  306  VSSGVEGFENYREGANVGDDTFQNYLRDSTSTKASFVNYGKSFNQGIDKFKGYGKGAVNR  365

Query  413  RVSFNGYGVNNTFKDYA--KTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
             + F GYGVNN+F  Y   K G+ F+GY  +  +        G +VN  +WVE GKFFRE
Sbjct  366  HIDFKGYGVNNSFSGYDNNKKGINFSGYTQSAPM-------DGSVVN--KWVEEGKFFRE  416

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
             MLK GT+M MP+I DKMPKRSFLPR ++++LPFS +E+ EL   F A E S + ++I  
Sbjct  417  SMLKPGTVMKMPNIEDKMPKRSFLPRVLSSKLPFSTSELVELRGTFKAKENSTLERVIVN  476

Query  59   TLAECERAPSRDETKRCV  6
             L ECER PS+ ETK+CV
Sbjct  477  ALGECERPPSQGETKKCV  494


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 71/147 (48%), Gaps = 10/147 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG++  G    F +Y +N N+   +F  Y  +  G  + F +YA NGN  +++F +YGAG
Sbjct  134  YGRSRGGGVDSFKNYSDNINMPVNSFTRYSSNSAGHGEKFANYADNGNVANDSFMSYGAG  193

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
            G G +  F +Y    NV    F+SY    N     F +Y +  N GT  F+ Y       
Sbjct  194  GTGGLGEFKNYESNVNVPNLHFSSYSASGNNHKQSFGSYAEDTNSGTQVFTSYGK-----  248

Query  404  FNGYGVNNTFKDYAKT----GVTFAGY  336
             NG GV   F  Y+K+    G TFA Y
Sbjct  249  -NGNGVPTEFNSYSKSSNIVGSTFASY  274


 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 67/163 (41%), Gaps = 18/163 (11%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F SY N        F  YG S  G  D+F +Y+ N N P N+F  Y +   G  + F +Y
Sbjct  123  FISYTNKQ------FTTYGRSRGGGVDSFKNYSDNINMPVNSFTRYSSNSAGHGEKFANY  176

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDS---DRVSFNGYGVN-  384
                NV  DSF SYG         F NY    N     FS YS S    + SF  Y  + 
Sbjct  177  ADNGNVANDSFMSYGAGGTGGLGEFKNYESNVNVPNLHFSSYSASGNNHKQSFGSYAEDT  236

Query  383  ----NTFKDYAKTG----VTFAGYLNATDVTAAVGAAKGKMVN  279
                  F  Y K G      F  Y  ++++  +  A+ G++ N
Sbjct  237  NSGTQVFTSYGKNGNGVPTEFNSYSKSSNIVGSTFASYGQLAN  279



>gb|KHN00353.1| Polygalacturonase-1 non-catalytic subunit beta [Glycine soja]
Length=437

 Score =   238 bits (606),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 129/259 (50%), Positives = 164/259 (63%), Gaps = 19/259 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y    N    GFTSY +N+N    +F +Y E+GN    TFTSY  NGN P N F +YG  
Sbjct  58   YADETNVPNLGFTSYSDNANGRTQSFSSYSENGNAGEQTFTSYGKNGNGPTNVFASYGTE  117

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
             N     F++Y + +N   D+F  YG  +NAAD+GF NYGK+FN GTD F+ Y+ S    
Sbjct  118  SNVVGSGFSNYAETANAANDTFKGYGIAANAADIGFSNYGKSFNEGTDTFTTYAKSSDGE  177

Query  413  -RVSFNGYGVNNTFKDYAKTG--VTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFR  243
             +V F  YGVNNTFKDY K G  V+FA Y N +   +   ++    + NK WVEPGKFFR
Sbjct  178  TKVGFTSYGVNNTFKDYEKKGTTVSFARYTNISTTLSVSASSVSGSLVNK-WVEPGKFFR  236

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            EKM+K GT+MPMPDI+DKMP+RSFLPR+I ++LPFSA++ G +E            KM+ 
Sbjct  237  EKMMKEGTVMPMPDIKDKMPERSFLPRSILSKLPFSASDNGSME------------KMMK  284

Query  62   GTLAECERAPSRDETKRCV  6
             +L ECERAPS  ETKRCV
Sbjct  285  DSLEECERAPSSGETKRCV  303



>gb|ACG28762.1| polygalacturonase-1 non-catalytic beta subunit precursor [Zea 
mays]
Length=642

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 165/267 (62%), Gaps = 16/267 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYGN SNV+ + F NYG+S NG  DTFT Y   GN P+N F++YGAG
Sbjct  245  YGKNGNGVRETFKSYGNESNVLASGFANYGQSANGATDTFTGYGVEGNVPENRFRSYGAG  304

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
            GN  VDTF +YR + NVG D F SY K +N     F +YG + N G+  F GY +    +
Sbjct  305  GNAGVDTFKNYRDDGNVGDDRFTSYAKGANGGAAEFQSYGNSANPGSTIFKGYGEGTNPN  364

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNAT-------DVTAAVGAAKGKMVNNKRW-V  264
              + F  Y G NNTFK YAK+GV F GY N T        +T +  AA      + +W  
Sbjct  365  HHIGFKEYAGENNTFKGYAKSGVDFKGYHNTTVSSSTAAALTVSAEAAASMHHEHLKWSP  424

Query  263  EPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGS  84
            EPGKFFRE+ L +G  MPMPDIRDKMP R+FLPR IAA +PF   E   + + F     +
Sbjct  425  EPGKFFRERELVAGNRMPMPDIRDKMPPRAFLPRAIAARIPF---EPNAVSEAFGLPLDT  481

Query  83   AMAKMIAGTLAECERAPSRDETKRCVT  3
            A+ K +A T+AECERAPS+ ETKRC T
Sbjct  482  ALGKAVASTVAECERAPSKGETKRCAT  508


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 81/159 (51%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG++ +G A  FTSY ++ NV+   F +Y     G + +F +YA   N PD+TF NY A 
Sbjct  161  YGRDSSGRADSFTSYEDDGNVVTANFTSYAGGATGGSGSFAAYAAETNVPDSTFTNYDAA  220

Query  584  GNGPVDTFNSYRQESNVGA--------------DSFNSYGKKSNAADVGFVNYGKTFNGG  447
             NG   +F SY QE+N G               ++F SYG +SN    GF NYG++ NG 
Sbjct  221  ANGRGRSFASYSQEANHGEYGFSGYGKNGNGVRETFKSYGNESNVLASGFANYGQSANGA  280

Query  446  TDKFSGYSDSDRVS---FNGYGVN-----NTFKDYAKTG  354
            TD F+GY     V    F  YG       +TFK+Y   G
Sbjct  281  TDTFTGYGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDG  319



>ref|NP_001146063.1| uncharacterized protein LOC100279594 precursor [Zea mays]
 gb|ACL53138.1| unknown [Zea mays]
 gb|ACN33667.1| unknown [Zea mays]
 gb|AFW62083.1| polygalacturonase-1 non-catalytic beta subunit [Zea mays]
Length=643

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 165/267 (62%), Gaps = 16/267 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYGN SNV+ + F NYG+S NG  DTFT Y   GN P+N F++YGAG
Sbjct  244  YGKNGNGVRETFKSYGNESNVLASGFANYGQSANGATDTFTGYGVEGNVPENRFRSYGAG  303

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
            GN  VDTF +YR + NVG D F SY K +N     F +YG + N G+  F GY +    +
Sbjct  304  GNAGVDTFKNYRDDGNVGDDRFTSYAKGANGGAAEFQSYGNSANPGSTIFKGYGEGTNPN  363

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNAT-------DVTAAVGAAKGKMVNNKRWV-  264
              + F  Y G NNTFK YAK+GV F GY N T        +T +  AA      + +W  
Sbjct  364  HHIGFKEYAGENNTFKGYAKSGVDFKGYHNTTVSSSTAAVLTVSAEAAASMHHEHLKWSP  423

Query  263  EPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGS  84
            EPGKFFRE+ L +G  MPMPDIRDKMP R+FLPR IAA +PF   E   + + F     +
Sbjct  424  EPGKFFRERELVAGNRMPMPDIRDKMPPRAFLPRAIAARIPF---EPNAVSEAFGLPLDT  480

Query  83   AMAKMIAGTLAECERAPSRDETKRCVT  3
            A+ K +A T+AECERAPS+ ETKRC T
Sbjct  481  ALGKAVASTVAECERAPSKGETKRCAT  507


 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 80/159 (50%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG++ +G A  FTSY  + NV+   F +Y     G + +F +YA   N PD+TF NY A 
Sbjct  160  YGRDSSGRADSFTSYEADGNVVTANFTSYAGGATGGSGSFAAYAAETNVPDSTFTNYDAA  219

Query  584  GNGPVDTFNSYRQESNVGA--------------DSFNSYGKKSNAADVGFVNYGKTFNGG  447
             NG   +F SY QE+N G               ++F SYG +SN    GF NYG++ NG 
Sbjct  220  ANGRGRSFASYSQEANHGENGFSGYGKNGNGVRETFKSYGNESNVLASGFANYGQSANGA  279

Query  446  TDKFSGYSDSDRVS---FNGYGVN-----NTFKDYAKTG  354
            TD F+GY     V    F  YG       +TFK+Y   G
Sbjct  280  TDTFTGYGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDG  318



>gb|ACN34141.1| unknown [Zea mays]
Length=643

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/267 (50%), Positives = 165/267 (62%), Gaps = 16/267 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    F SYGN SNV+ + F NYG+S NG  DTFT Y   GN P+N F++YGAG
Sbjct  244  YGKNGNGVRETFKSYGNESNVLASGFANYGQSANGATDTFTGYGVEGNVPENRFRSYGAG  303

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
            GN  VDTF +YR + NVG D F SY K +N     F +YG + N G+  F GY +    +
Sbjct  304  GNAGVDTFKNYRDDGNVGDDRFTSYAKGANGGAAEFQSYGNSANPGSTIFKGYGEGTNPN  363

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNAT-------DVTAAVGAAKGKMVNNKRW-V  264
              + F  Y G NNTFK YAK+GV F GY N T        +T +  AA      + +W  
Sbjct  364  HHIGFKEYAGENNTFKGYAKSGVDFKGYHNTTVSSSTAAVLTVSAEAAASMHHEHLKWSP  423

Query  263  EPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGS  84
            EPGKFFRE+ L +G  MPMPDIRDKMP R+FLPR IAA +PF   E   + + F     +
Sbjct  424  EPGKFFRERELVAGNRMPMPDIRDKMPPRAFLPRAIAARIPF---EPNAVSEAFGLPLDT  480

Query  83   AMAKMIAGTLAECERAPSRDETKRCVT  3
            A+ K +A T+AECERAPS+ ETKRC T
Sbjct  481  ALGKAVASTVAECERAPSKGETKRCAT  507


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 79/159 (50%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG++ +G A  FTSY  + NV+   F  Y     G + +F +YA   N PD+TF NY A 
Sbjct  160  YGRDSSGRADSFTSYEADGNVVTANFTPYAGGATGGSGSFAAYAAETNVPDSTFTNYDAA  219

Query  584  GNGPVDTFNSYRQESNVGA--------------DSFNSYGKKSNAADVGFVNYGKTFNGG  447
             NG   +F SY QE+N G               ++F SYG +SN    GF NYG++ NG 
Sbjct  220  ANGRGRSFASYSQEANHGENGFSGYGKNGNGVRETFKSYGNESNVLASGFANYGQSANGA  279

Query  446  TDKFSGYSDSDRVS---FNGYGVN-----NTFKDYAKTG  354
            TD F+GY     V    F  YG       +TFK+Y   G
Sbjct  280  TDTFTGYGVEGNVPENRFRSYGAGGNAGVDTFKNYRDDG  318



>emb|CBI15046.3| unnamed protein product [Vitis vinifera]
Length=602

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 128/253 (51%), Positives = 160/253 (63%), Gaps = 29/253 (11%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNG      FTSYG+NSN++ + F  YG+  N   D+F +Y  + NNP N FK+Y  G
Sbjct  245  YGKNGKNVPAEFTSYGDNSNIIGSTFTAYGQLANSQNDSFKAYGHSSNNPHNNFKSYSLG  304

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
            GN   DTF++YR  +NVG DSF SY + SN+A+V F NYG+TFN G              
Sbjct  305  GNAATDTFSNYRDGANVGDDSFQSYARSSNSAEVNFANYGRTFNVG--------------  350

Query  404  FNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKMLKS  225
                  N+TFK+Y K          +++ TA    A G  VN  RWVEPGKFFRE MLK 
Sbjct  351  ------NDTFKEYGKG-------RASSNTTATATTASGISVN--RWVEPGKFFRESMLKE  395

Query  224  GTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTLAEC  45
            G +M MPDIRD+MP+RSFLPR IA++LPFS++ + EL+ IFHA + S M  +IA  L EC
Sbjct  396  GNVMVMPDIRDRMPERSFLPRVIASKLPFSSSRLQELKDIFHARDNSTMEHVIANALEEC  455

Query  44   ERAPSRDETKRCV  6
            ERAPSR ETKRCV
Sbjct  456  ERAPSRGETKRCV  468



>emb|CAN81758.1| hypothetical protein VITISV_043391 [Vitis vinifera]
Length=574

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 156/237 (66%), Gaps = 4/237 (2%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNG      FTSYG+NSN++ + F  YG+  N   D+F +Y  + NNP N FK+Y  G
Sbjct  167  YGKNGKNVPAEFTSYGDNSNIIGSTFTAYGQLANXQNDSFKAYGHSSNNPHNNFKSYSLG  226

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN   DTF++YR  +NVG DSF SY + SN+A+V F NYG+TFN G D F  Y   S   
Sbjct  227  GNAATDTFSNYRDGANVGDDSFQSYARSSNSAEVNFANYGRTFNVGNDTFKEYGKGSTDS  286

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             V F  YG+N TFKDY + GVTF+ Y  A+  T A       +  N RWVEPGKFFRE M
Sbjct  287  SVGFKIYGLNYTFKDYERKGVTFSQYSRASSNTTATATTASGISVN-RWVEPGKFFRESM  345

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            LK G +M MPDIRD+MP+RSFLPR IA++LPFS++   EL+ IFHA + SAM  +IA
Sbjct  346  LKEGNVMVMPDIRDRMPERSFLPRVIASKLPFSSSRJQELKDIFHAXDNSAMEHVIA  402


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 60/146 (41%), Gaps = 8/146 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G    F +Y +  N+   +F+ Y        + FTSYA +GN    +F  YG+G
Sbjct  55   YGDSRIGGVDSFKNYSDGLNMPSGSFRRYSGDSTDHHEEFTSYARDGNVATGSFAGYGSG  114

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR--  411
              G    F +Y    NV    F +Y    N   + F  Y    N GT+ F+ Y  + +  
Sbjct  115  ATGGSGEFTNYDPLVNVPHLEFTTYDPNGNNHKLTFAAYTDDTNSGTESFTSYGKNGKNV  174

Query  410  -VSFNGYGVNNTFKDYAKTGVTFAGY  336
               F  YG N+        G TF  Y
Sbjct  175  PAEFTSYGDNSNI-----IGSTFTAY  195



>ref|XP_006578624.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Glycine max]
Length=631

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 121/259 (47%), Positives = 165/259 (64%), Gaps = 14/259 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDA-DTFTSYAFNGNNPDNTFKNYGA  588
            YGK   G  + F +Y +++N++ + F +YG+   G + D+F  Y+FNGNNP + FK+YG 
Sbjct  249  YGKRVRGGTSEFANYADDANILQSEFSSYGDLTTGASNDSFKFYSFNGNNPRHVFKSYGD  308

Query  587  GGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----  420
            G    VD+F SYR  +NVG DSF SY  +S +    F NYG +FN G D F+ Y      
Sbjct  309  GSAAGVDSFISYRNRANVGDDSFQSYAVRSKSGAATFANYGMSFNVGNDSFTEYGKGAMG  368

Query  419  SDRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
                 F  YG+   FK Y K G +F+ Y N         AA+GK+VN  +WVEPGKFFRE
Sbjct  369  KTSFGFKSYGLGRAFKVYNKDGASFSEYRN-------FSAARGKVVN--KWVEPGKFFRE  419

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
             M+K G ++PMPDI+DKMP RSFLP  IA++LPFS++ I E+ ++FH  EGS+  +++  
Sbjct  420  SMVKEGNVIPMPDIKDKMPARSFLPLAIASKLPFSSSRINEMREVFHTREGSSTERVMVK  479

Query  59   TLAECERAPSRDETKRCVT  3
             L ECERAPS+ ETKRCV+
Sbjct  480  ALKECERAPSKGETKRCVS  498


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 13/151 (9%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F +Y +N NV +T F +YG + N  +  F++Y    N P+  F  Y +G +    +F+SY
Sbjct  176  FKNYADNGNVANTNFSSYGSTANQASAEFSNYDKTVNVPNLGFTTYDSGASNHKLSFSSY  235

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR---------VSFN  399
              E+N G+ +F SYGK+       F NY    N    +FS Y D             SFN
Sbjct  236  GNETNSGSQTFTSYGKRVRGGTSEFANYADDANILQSEFSSYGDLTTGASNDSFKFYSFN  295

Query  398  GYGVNNTFKDY---AKTGV-TFAGYLNATDV  318
            G    + FK Y   +  GV +F  Y N  +V
Sbjct  296  GNNPRHVFKSYGDGSAAGVDSFISYRNRANV  326


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 76/160 (48%), Gaps = 23/160 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G    F +Y N  N  + AF+ Y  +     + F +YA NGN  +  F +YG+ 
Sbjct  137  YGSSRVGGVDSFKNYSNGLNANNDAFRRYSAASTRRGEQFKNYADNGNVANTNFSSYGST  196

Query  584  GNGPVDTFNSYRQESNV----------GAD----SFNSYGKKSNAADVGFVNYGKTFNGG  447
             N     F++Y +  NV          GA     SF+SYG ++N+    F +YGK   GG
Sbjct  197  ANQASAEFSNYDKTVNVPNLGFTTYDSGASNHKLSFSSYGNETNSGSQTFTSYGKRVRGG  256

Query  446  TDKFSGYSDSDRV---SFNGYG------VNNTFKDYAKTG  354
            T +F+ Y+D   +    F+ YG       N++FK Y+  G
Sbjct  257  TSEFANYADDANILQSEFSSYGDLTTGASNDSFKFYSFNG  296


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 59/119 (50%), Gaps = 10/119 (8%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDN-TFKNYGAGGNGPVDTFNSYRQESNVGADSFNS  513
            F NYG S  G  D+F +Y+ NG N +N  F+ Y A      + F +Y    NV   +F+S
Sbjct  134  FANYGSSRVGGVDSFKNYS-NGLNANNDAFRRYSAASTRRGEQFKNYADNGNVANTNFSS  192

Query  512  YGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSDRVSFNGYGV-----NNTFKDYAK  360
            YG  +N A   F NY KT N     F+ Y   + + ++SF+ YG      + TF  Y K
Sbjct  193  YGSTANQASAEFSNYDKTVNVPNLGFTTYDSGASNHKLSFSSYGNETNSGSQTFTSYGK  251



>dbj|BAK05386.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=625

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 163/263 (62%), Gaps = 12/263 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK GN     FTSYGN++N + + F NYGES NG  DTFT Y   GN P+NTF++YGAG
Sbjct  234  YGKTGNSLRETFTSYGNDTNTLSSGFANYGESANGATDTFTGYGVEGNVPENTFRSYGAG  293

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
            GN  VDTF  YR  SNVG DSF SY K +N     F +YG + N G+  F GY      +
Sbjct  294  GNAGVDTFKGYRDGSNVGDDSFASYAKGANGGAAEFESYGGSANAGSVGFKGYGQGTNRN  353

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNK---RW-VEPGK  252
              + F  Y G N TFK YAKTGV F  Y N +        ++ +  + +   +W  EPGK
Sbjct  354  HEIGFKAYAGDNTTFKAYAKTGVDFKEYHNTSAAATTASTSEQQQQHQRHATKWSPEPGK  413

Query  251  FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAK  72
            FFRE+ L +G  MPMPDIRDKMP R+FLPR+IA ++PF A+ + E    F A   +AM K
Sbjct  414  FFRERELVTGNRMPMPDIRDKMPPRAFLPRDIARKIPFEASAVSE---AFGAPPDTAMGK  470

Query  71   MIAGTLAECERAPSRDETKRCVT  3
             +  T+AECERAPSR ETKRC T
Sbjct  471  AVVSTVAECERAPSRGETKRCAT  493


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 82/167 (49%), Gaps = 24/167 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG++ +  A  F++Y  N NV+   F +Y     G + +FTSYA N N P++ F NY AG
Sbjct  150  YGRDSSARADLFSTYEANGNVVTANFTSYAGGATGGSGSFTSYAANTNVPESRFTNYDAG  209

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKK--------------SNAADVGFVNYGKTFNGG  447
             NG    F SY  E+N G  SF+ YGK               +N    GF NYG++ NG 
Sbjct  210  ANGRSRGFTSYSPEANSGESSFSGYGKTGNSLRETFTSYGNDTNTLSSGFANYGESANGA  269

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG----VTFAGYLNATDV  318
            TD F+GY     V        NTF+ Y   G     TF GY + ++V
Sbjct  270  TDTFTGYGVEGNVP------ENTFRSYGAGGNAGVDTFKGYRDGSNV  310


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 71/155 (46%), Gaps = 10/155 (6%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            FT+YG+ +      FKNY    N   D+F  Y  + +   + F  Y A GN     F SY
Sbjct  119  FTNYGSGAGAGTDGFKNYSPDVNIAGDSFRRYGRDSSARADLFSTYEANGNVVTANFTSY  178

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYS---DSDRVSFNGYG-VN  384
               +  G+ SF SY   +N  +  F NY    NG +  F+ YS   +S   SF+GYG   
Sbjct  179  AGGATGGSGSFTSYAANTNVPESRFTNYDAGANGRSRGFTSYSPEANSGESSFSGYGKTG  238

Query  383  NTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVN  279
            N+ ++      TF  Y N T+  ++  A  G+  N
Sbjct  239  NSLRE------TFTSYGNDTNTLSSGFANYGESAN  267



>gb|KHG12475.1| Polygalacturonase non-catalytic subunit protein [Gossypium arboreum]
Length=649

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 155/257 (60%), Gaps = 18/257 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK G      FTSY +N+N + ++F  YG  GN   D+F +Y  +GNNP N FK YG  
Sbjct  273  YGKKGKAVPAEFTSYSSNANTIGSSFAGYGVLGNSANDSFKAYGDSGNNPRNNFKIYGLA  332

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SDS  417
                +D F SYR  +NVG DSF SY + +N+    FVNYGKTFN G   F  Y    + S
Sbjct  333  SKLGIDNFTSYRDSANVGVDSFQSYARDANSGKANFVNYGKTFNVGNSTFKEYGKGSTGS  392

Query  416  DRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
              + F  Y +  +F DYAK GVTFAGY N++    +V           RWVEPGKFFRE 
Sbjct  393  TTIGFKMYDLARSFLDYAKKGVTFAGYTNSSSKETSVN----------RWVEPGKFFRES  442

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            +LK G +M MPDIRDKMP+RSFLPR I ++LPFS + + EL  IF    G++M  M+   
Sbjct  443  VLKQGNVMVMPDIRDKMPRRSFLPRGILSKLPFSTSHLSELRNIF----GASMEGMLENA  498

Query  56   LAECERAPSRDETKRCV  6
            L ECER  SR ETKRCV
Sbjct  499  LTECERPASRGETKRCV  515


 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 72/159 (45%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG    G    F +Y +  N  + +FK Y    +  ++ FTSYA + N   + F NYG+ 
Sbjct  161  YGSLSRGGIDSFKNYSDGLNTPNESFKKYSRGSSAHSEDFTSYAKDANVAIDNFTNYGSS  220

Query  584  GNGPVDTFNSYRQESNV--------------GADSFNSYGKKSNAADVGFVNYGKTFNGG  447
              G    FN+Y+   NV                 SF++Y  ++N+    F+NYGK     
Sbjct  221  ATGGSGGFNNYQDRVNVPNLRFTSYDSDGNKHKLSFSTYSSETNSGSEAFINYGKKGKAV  280

Query  446  TDKFSGYSDSDRV---SFNGYGV-----NNTFKDYAKTG  354
              +F+ YS +      SF GYGV     N++FK Y  +G
Sbjct  281  PAEFTSYSSNANTIGSSFAGYGVLGNSANDSFKAYGDSG  319


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 60/121 (50%), Gaps = 10/121 (8%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            FK YG    G  D+F +Y+   N P+ +FK Y  G +   + F SY +++NV  D+F +Y
Sbjct  158  FKGYGSLSRGGIDSFKNYSDGLNTPNESFKKYSRGSSAHSEDFTSYAKDANVAIDNFTNY  217

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD----RVSFNGYGV-----NNTFKDYAKT  357
            G  +     GF NY    N    +F+ Y DSD    ++SF+ Y       +  F +Y K 
Sbjct  218  GSSATGGSGGFNNYQDRVNVPNLRFTSY-DSDGNKHKLSFSTYSSETNSGSEAFINYGKK  276

Query  356  G  354
            G
Sbjct  277  G  277



>ref|XP_010520580.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Tarenaya hassleriana]
Length=614

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/256 (50%), Positives = 168/256 (66%), Gaps = 10/256 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+ +GAA  F+SY  +SNV+ + F NYG  G+   ++FTSY  + N P N F+NYG  
Sbjct  232  YGKHADGAADEFSSYSVSSNVVGSDFSNYGADGHAANESFTSYGTDSNEPQNNFRNYGTD  291

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN    TF++YR  + +G D+F SY K S    V FVNYG++   G+D F+GY   ++  
Sbjct  292  GNASTLTFSNYRDSTTIGDDTFTSYAKDSEDEKVNFVNYGQSVTLGSDTFTGYGEDAEGQ  351

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N +FK YAK GV FA Y   T     +  + GK VN  RW+EPGKFFRE M
Sbjct  352  KIGFKTYDGNTSFKHYAKDGVEFAEYNQTT-----MPLSDGKSVN--RWIEPGKFFREAM  404

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            LK G ++PMPDIRDKMPKRSFLPRNI  +LPFS ++I ++++ F A + S M K+I+  L
Sbjct  405  LKEGNMIPMPDIRDKMPKRSFLPRNILLKLPFSTSKIADIKRNFRANDNSTMEKIISDAL  464

Query  53   AECERAPSRDETKRCV  6
            +ECER PS  ETKRCV
Sbjct  465  SECERPPSAGETKRCV  480



>ref|XP_006439797.1| hypothetical protein CICLE_v10019363mg [Citrus clementina]
 gb|ESR53037.1| hypothetical protein CICLE_v10019363mg [Citrus clementina]
Length=608

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 160/254 (63%), Gaps = 21/254 (8%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGN   T FTSY +++N + ++F  Y ESGN   D+F +Y  +GNNP N FK+YG G
Sbjct  241  YGKNGNAGPTDFTSYADSANTVGSSFTGYAESGNAANDSFKAYGVSGNNPHNNFKSYGIG  300

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
             N  V  F SYR  +NVG DSF SY K +N+ +  F  YGK   G T           + 
Sbjct  301  ANSAVAGFTSYRNGANVGDDSFQSYAKNANSGNDTFKEYGKGSVGRTS----------IG  350

Query  404  FNGYGVNNTFKDYAK-TGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKMLK  228
            F  Y +  +FK+Y K   VTFAGY N +    +V           RWVEPGKFFRE MLK
Sbjct  351  FKSYDMGRSFKEYTKGVPVTFAGYTNLSSDANSV----------NRWVEPGKFFRESMLK  400

Query  227  SGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTLAE  48
             G +M MPDIRDKMP+RSFLPR+I+++LPF+ +++ +L++IF   + S+M ++I   LAE
Sbjct  401  QGNVMVMPDIRDKMPRRSFLPRSISSKLPFATSQLTQLKEIFRVRDNSSMERVILNALAE  460

Query  47   CERAPSRDETKRCV  6
            CERAPS  ETKRCV
Sbjct  461  CERAPSPGETKRCV  474


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 70/159 (44%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G    F +Y    N  + +FK Y     G  + FTSYA +GN  +  F +Y A 
Sbjct  129  YGDSKLGGIDSFKNYSQALNTPNDSFKKYSRESTGHTEDFTSYAKDGNVANENFTSYAAN  188

Query  584  GNG--------------PVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
             N               P   F SY  + N    SF SYG  +N+   GF++YGK  N G
Sbjct  189  ANAGSGGFTNYAERVNVPNLRFASYVSDGNNHKLSFTSYGSDTNSGAEGFMSYGKNGNAG  248

Query  446  TDKFSGYSDSDRV---SFNGY-----GVNNTFKDYAKTG  354
               F+ Y+DS      SF GY       N++FK Y  +G
Sbjct  249  PTDFTSYADSANTVGSSFTGYAESGNAANDSFKAYGVSG  287


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 8/120 (7%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG+S  G  D+F +Y+   N P+++FK Y     G  + F SY ++ NV  ++F SY
Sbjct  126  FANYGDSKLGGIDSFKNYSQALNTPNDSFKKYSRESTGHTEDFTSYAKDGNVANENFTSY  185

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYS---DSDRVSFNGYGVNNT-----FKDYAKTG  354
               +NA   GF NY +  N    +F+ Y    ++ ++SF  YG +       F  Y K G
Sbjct  186  AANANAGSGGFTNYAERVNVPNLRFASYVSDGNNHKLSFTSYGSDTNSGAEGFMSYGKNG  245



>ref|XP_004509826.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Cicer arietinum]
Length=636

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/261 (49%), Positives = 172/261 (66%), Gaps = 12/261 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+   AA  FT+YG ++NV ++ F +Y E G    DTFT+Y FN NNP N FK+YG G
Sbjct  246  YGKDSTRAANRFTAYGTSANVFNSDFSSYTEKGTSANDTFTNYGFNLNNPVNNFKDYGKG  305

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNA-ADVGFVNYGKTF---NGGTDKFSGY---  426
             +   + F  YR E+N G+DSFNSYG+ S A   V F NYG+       G+D F GY   
Sbjct  306  SSSANEKFTEYRDEANAGSDSFNSYGESSRAGIHVDFNNYGRKPGFPKLGSDTFKGYGKE  365

Query  425  SDSD-RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKF  249
            +D D ++SF  YGV N  KDY+K G++F+ Y  ++   +      G +V N  WV+PG F
Sbjct  366  ADLDHKMSFKSYGVGNPLKDYSKNGISFSSYTKSSSTNSV--TVNGSLVKN--WVQPGNF  421

Query  248  FREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKM  69
            FRE MLK GT+MPMPDI DK+PKRSFLPR+I  +LPF+++++ E++ +F   E S++ KM
Sbjct  422  FREGMLKEGTVMPMPDIVDKLPKRSFLPRSILTKLPFASSKLNEMKHVFRVAEKSSIEKM  481

Query  68   IAGTLAECERAPSRDETKRCV  6
            I   L+ECER+PS+ ETKRCV
Sbjct  482  IVDALSECERSPSQGETKRCV  502


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 62/143 (43%), Gaps = 8/143 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++       FT+Y  N+N  +  F  YG      +  F  YA + N P+  F  Y   
Sbjct  162  YSRDSASHNESFTTYAENTNAAEEKFNTYGTFAAAGSGDFKVYAKDSNVPNLDFNTYSVS  221

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD---SD  414
              G   TF SY +  N G  SF +YGK S  A   F  YG + N     FS Y++   S 
Sbjct  222  TAGREQTFTSYSEAGNAGNQSFTNYGKDSTRAANRFTAYGTSANVFNSDFSSYTEKGTSA  281

Query  413  RVSFNGYGVN-----NTFKDYAK  360
              +F  YG N     N FKDY K
Sbjct  282  NDTFTNYGFNLNNPVNNFKDYGK  304



>ref|XP_003528153.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Glycine max]
Length=629

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/259 (47%), Positives = 163/259 (63%), Gaps = 14/259 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDA-DTFTSYAFNGNNPDNTFKNYGA  588
            YGK   G  + F SY +++N++ + F +YG+   G + D+F  Y+FNGNNP + FK+Y A
Sbjct  247  YGKRVRGGTSEFASYADDANILQSEFNSYGDLSTGASNDSFKFYSFNGNNPRHVFKSYAA  306

Query  587  GGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SD  420
            G    VD F SYR  +NVG DSF SY  +S +    F NYG +FN G D F+ Y    + 
Sbjct  307  GSASGVDNFISYRNRANVGDDSFQSYAARSKSGAATFANYGMSFNVGNDSFTEYGKGATG  366

Query  419  SDRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
                 F  YG+   FK Y K G +F+ Y N         AA GK+VN +  VEPGKFFRE
Sbjct  367  KTSFGFKSYGLGRGFKVYNKDGASFSEYRN-------FSAASGKVVNKR--VEPGKFFRE  417

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
              ++ G ++PMPDI+DKMP RSFLP  IA++LPFS++ I E+ +IFHA EGS+  +++  
Sbjct  418  STVREGNVIPMPDIKDKMPARSFLPLAIASKLPFSSSRIDEMREIFHAREGSSTERVMVN  477

Query  59   TLAECERAPSRDETKRCVT  3
             L ECER PS+DETKRCV+
Sbjct  478  ALKECEREPSKDETKRCVS  496


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 76/160 (48%), Gaps = 23/160 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G    F +Y N  N  + AF+ Y  +     + F +YA NGN  +  F +YG+ 
Sbjct  135  YGSSRVGGVDSFKNYSNGLNANNDAFRRYSAASTRRGEQFNNYADNGNVANTNFSSYGSA  194

Query  584  GNGPVDTFNSYRQESNV----------GAD----SFNSYGKKSNAADVGFVNYGKTFNGG  447
             N     F++Y +  NV          GA     SF+SYG ++N+    F +YGK   GG
Sbjct  195  ANQTSGEFSNYDKTVNVPNLGFTTYDSGASNHKLSFSSYGNETNSGSQSFTSYGKRVRGG  254

Query  446  TDKFSGYSDSDRV---SFNGYG------VNNTFKDYAKTG  354
            T +F+ Y+D   +    FN YG       N++FK Y+  G
Sbjct  255  TSEFASYADDANILQSEFNSYGDLSTGASNDSFKFYSFNG  294


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 13/151 (9%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F +Y +N NV +T F +YG + N  +  F++Y    N P+  F  Y +G +    +F+SY
Sbjct  174  FNNYADNGNVANTNFSSYGSAANQTSGEFSNYDKTVNVPNLGFTTYDSGASNHKLSFSSY  233

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR---------VSFN  399
              E+N G+ SF SYGK+       F +Y    N    +F+ Y D             SFN
Sbjct  234  GNETNSGSQSFTSYGKRVRGGTSEFASYADDANILQSEFNSYGDLSTGASNDSFKFYSFN  293

Query  398  GYGVNNTFKDYA---KTGV-TFAGYLNATDV  318
            G    + FK YA    +GV  F  Y N  +V
Sbjct  294  GNNPRHVFKSYAAGSASGVDNFISYRNRANV  324



>ref|XP_003601289.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES71540.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=628

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/258 (48%), Positives = 163/258 (63%), Gaps = 14/258 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDA-DTFTSYAFNGNNPDNTFKNYGA  588
            YGK      + F +Y  +SN++ + F  YGE G G A D+F +Y+FNGNNP ++FK YG 
Sbjct  246  YGKRVRSGNSDFINYAVSSNILQSTFTGYGELGTGGANDSFKAYSFNGNNPKSSFKAYGT  305

Query  587  GGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SD  420
            G     DTF SYR  +NVG DSF SYG KS A    F NYG++FN G D F+ Y    + 
Sbjct  306  GSVSGSDTFVSYRNRANVGDDSFQSYGAKSKAGAASFTNYGQSFNEGNDTFTEYGKGATG  365

Query  419  SDRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
                 F  YG+   FK Y K G +F+ Y N + ++       GK+VN  R+VEPGKFFRE
Sbjct  366  KTAFGFKSYGLGRAFKLYNKNGASFSAYNNFSTIS-------GKIVN--RFVEPGKFFRE  416

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
             MLK G +M MPDI DKMP RSFLP +I+++LPFS++ + E+++ FHA +GSA  ++I  
Sbjct  417  SMLKEGNVMVMPDIGDKMPARSFLPLSISSKLPFSSSRLSEIKEAFHARDGSATERVIFN  476

Query  59   TLAECERAPSRDETKRCV  6
             L ECER PS  ETKRCV
Sbjct  477  ALKECEREPSVGETKRCV  494


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 74/151 (49%), Gaps = 13/151 (9%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F SY  N NV +T F NYG   +     F SY    N P+  F  Y +G N    +F+SY
Sbjct  173  FNSYAENGNVANTNFTNYGSGSSSGTGNFKSYDKLVNVPNLGFTTYDSGANNHKLSFSSY  232

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY--------SDSDRV-SFN  399
              ++N G+ SFNSYGK+  + +  F+NY  + N     F+GY        +DS +  SFN
Sbjct  233  GNDTNSGSQSFNSYGKRVRSGNSDFINYAVSSNILQSTFTGYGELGTGGANDSFKAYSFN  292

Query  398  GYGVNNTFKDYAKTGV----TFAGYLNATDV  318
            G    ++FK Y    V    TF  Y N  +V
Sbjct  293  GNNPKSSFKAYGTGSVSGSDTFVSYRNRANV  323



>ref|XP_010936822.1| PREDICTED: BURP domain-containing protein 12-like [Elaeis guineensis]
Length=615

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/257 (51%), Positives = 165/257 (64%), Gaps = 9/257 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG+    +   FT+Y  ++NV+ T F  Y E+     DTF+SY    N P NTF+ YG G
Sbjct  229  YGQRATASPATFTTYATDANVLGTGFAAYSEAATAANDTFSSYGSLTNRPSNTFRTYGDG  288

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
             +G V++F +YR+ +N G D+F SY K   AA   F+NYG +FN G+D F+GY   S + 
Sbjct  289  ASGGVESFATYRERANTGDDTFRSYAKHGTAARADFLNYGASFNPGSDSFNGYGEGSINP  348

Query  413  RVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
             + F  Y G N TFK Y+K+G+TFA Y N +        A GK VN KR +EPGKFFRE 
Sbjct  349  VIGFRVYAGDNTTFKAYSKSGITFAAYRNKSS-NPGPPHANGKSVNKKR-IEPGKFFRES  406

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
             LK+GT MPMPDIRDKMPKRSFLPR+IA +LPFSA  +  L   F     SAM + +A T
Sbjct  407  SLKNGTAMPMPDIRDKMPKRSFLPRSIAEKLPFSATALAPL---FGVSMDSAMGRAMAET  463

Query  56   LAECERAPSRDETKRCV  6
            +AECERAPSR ETKRCV
Sbjct  464  VAECERAPSRGETKRCV  480



>ref|XP_007141610.1| hypothetical protein PHAVU_008G210500g [Phaseolus vulgaris]
 gb|ESW13604.1| hypothetical protein PHAVU_008G210500g [Phaseolus vulgaris]
Length=611

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 167/257 (65%), Gaps = 17/257 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK GN     F +YG +SN   T F +YG  G    DTF +YA  GNNP NTF++YG G
Sbjct  234  YGKRGNETENSFQNYGTSSNPTLTGFSSYGNDGVRVNDTFKNYANQGNNPTNTFESYGNG  293

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            G+G VD F++YR ESN G+DSF +YGK+SN  DV F  Y K+ N  +DKF GY    +  
Sbjct  294  GDGAVDRFDTYRVESNGGSDSFQNYGKESNGGDVDFKGYDKSDNSNSDKFIGYGKGGEKQ  353

Query  413  RVSFNGYGVNNTFKDYAKTGV-TFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREK  237
            R  F+GY +N++F +YAK G  TFA Y N +          G +V N  WVE GKFFRE 
Sbjct  354  RFGFSGYRINSSFTEYAKQGAQTFASYKNES--------FSGTIVKN--WVEEGKFFREF  403

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLK GT+M MPDIRDKMP+RSFLPR I ++LPF+ + +    ++F    GS++ K++  +
Sbjct  404  MLKEGTVMAMPDIRDKMPERSFLPRVILSKLPFTVSGV---NRVFEVGAGSSLDKIVKDS  460

Query  56   LAECERAPSRDETKRCV  6
            ++ECER PS+ E+KRCV
Sbjct  461  VSECERVPSQGESKRCV  477



>gb|EMS58973.1| hypothetical protein TRIUR3_16136 [Triticum urartu]
Length=514

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 160/260 (62%), Gaps = 9/260 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+ N     FTSYG ++N + + F NYGES NG  DTFT Y   GN P+NTF++YGAG
Sbjct  125  YGKSANSLRETFTSYGGDTNTLSSGFANYGESANGATDTFTGYGVEGNVPENTFRSYGAG  184

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
            GN  VDTF  YR ++NVG DSF SY K +N     F +YG + N G+  F GY +    +
Sbjct  185  GNAGVDTFKGYRGDANVGDDSFASYAKGANGGAAEFQSYGGSANQGSVAFKGYGEGTNRN  244

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWV-EPGKFFR  243
              + F  Y G N TFK YAKTGV F  Y N +   +    A      + +W  EPGKFFR
Sbjct  245  HHIGFKQYAGDNTTFKGYAKTGVDFKEYHNTSSSVSVSAEATTSEHQHMKWSPEPGKFFR  304

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            E+ L +G  MPMPDIRDK P  + LPR+IA ++PF   E+  + ++F     +AM K +A
Sbjct  305  ERELVAGNRMPMPDIRDKRPPGASLPRDIARKIPF---ELNAVSEVFRVPLDTAMGKAVA  361

Query  62   GTLAECERAPSRDETKRCVT  3
             T+AECERAPS+ ETKRC T
Sbjct  362  STVAECERAPSQGETKRCAT  381


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 54/124 (44%), Gaps = 26/124 (21%)
 Frame = -1

Query  653  DTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAA-----  489
            D  ++   NG      F NY AG NG    F SY QE+N G  SF  YGK +N+      
Sbjct  80   DPLSAVVMNGET--RQFTNYDAGANGRTRGFTSYSQEANHGESSFAGYGKSANSLRETFT  137

Query  488  ---------DVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG----VT  348
                       GF NYG++ NG TD F+GY     V        NTF+ Y   G     T
Sbjct  138  SYGGDTNTLSSGFANYGESANGATDTFTGYGVEGNVP------ENTFRSYGAGGNAGVDT  191

Query  347  FAGY  336
            F GY
Sbjct  192  FKGY  195



>dbj|BAJ92348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 160/259 (62%), Gaps = 9/259 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GN     FTSYG ++N + + F NYGES NG  DTFT Y    N P NTF++YGAG
Sbjct  237  YGKSGNSLRETFTSYGGDTNTLTSGFANYGESANGATDTFTGYGVEANVPKNTFRSYGAG  296

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
            GN  VDTF  YR ++NVG DSF SY K +N     F +YG + N G+  F GY +    +
Sbjct  297  GNAGVDTFKGYRGDANVGDDSFASYAKGANGGAAEFQSYGGSANQGSVAFKGYGEGTNRN  356

Query  416  DRVSFNGYGVNN-TFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
              + F  Y  +N TFK YAKTGV F  Y N T  T +      +  + K   EPGKFFRE
Sbjct  357  HHIGFKQYARDNTTFKGYAKTGVDFKEYHN-TSATVSPEETTSEHRHMKWSPEPGKFFRE  415

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
            + L +G  MPMPDIRDKMP R+FLPR+IA ++PF   E   + ++F     +AM K +A 
Sbjct  416  RELVAGNRMPMPDIRDKMPPRAFLPRDIARKIPF---EPNAVSEVFRVPLDTAMGKAVAS  472

Query  59   TLAECERAPSRDETKRCVT  3
            T+AECER PSR ETKRC T
Sbjct  473  TVAECERVPSRGETKRCAT  491



>ref|XP_004956601.1| PREDICTED: BURP domain-containing protein 14-like [Setaria italica]
Length=683

 Score =   234 bits (596),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 165/262 (63%), Gaps = 11/262 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK  N AA  F +YGNNSN + + F NYGE  NG  DTF SY  +GN P+NTF++Y +G
Sbjct  291  YGKAANAAAESFKTYGNNSNTVASGFINYGEKANGLNDTFASYGLDGNAPENTFRSYASG  350

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
             N  VD F  YR  +N+G DSF SY   +N A+ GF +YGK+ N G+  F GY      +
Sbjct  351  SNAAVDDFKGYRDAANIGDDSFTSYASNANGAEAGFDSYGKSTNPGSVSFKGYGQGSNPN  410

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNK--RWVE-PGKF  249
             R+ F  Y G N TFK Y+  GV F  Y N + +  +  AA  +   ++  +W   PGKF
Sbjct  411  HRIGFTHYSGDNTTFKAYSNEGVEFKEYQNMSKMEVSKTAAGVEATGHRLPKWSPGPGKF  470

Query  248  FREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKM  69
            FRE+ L +G  MPMPDI DK+P R+FLPR+IAA++PF   E G +  +F A  G+AM ++
Sbjct  471  FRERDLMTGNRMPMPDIADKLPHRAFLPRDIAAKIPF---EEGAVSALFGAPPGTAMRQV  527

Query  68   IAGTLAECERAPSRDETKRCVT  3
            +A T+AEC RAPSR ETKRC T
Sbjct  528  VASTVAECARAPSRGETKRCAT  549



>emb|CDP00166.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   231 bits (589),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 162/260 (62%), Gaps = 7/260 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y K G  +   FT+       + ++F NYG+SGNG  DTFTSY F GN P+NTF +YG G
Sbjct  182  YTKKGTESENKFTTTRMAQTGILSSFSNYGKSGNGIKDTFTSYRFGGNVPENTFTSYGDG  241

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD---SD  414
            GN   + F  Y  E+NVGAD F SY K SNAA   F +YG++ N G  +F+ Y +   + 
Sbjct  242  GNAATEIFKCYSDETNVGADFFKSYAKDSNAAKANFASYGRSVNKGPVQFTSYGEGAKNH  301

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAA---KGKMVNNKRWVEPGKFFR  243
             + F  YG N +FK YAK  V F       D+T ++      +  + N+ + VEP KFFR
Sbjct  302  HIEFKIYGDNYSFKKYAKNDVAFKKCEVVPDITLSLSPKPKNRALIENHTQNVEPEKFFR  361

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            EK+LKSGT+MPMPDIRDKMPK SFLPR IAA+LPFS ++IGEL KIFH  E S + +MI+
Sbjct  362  EKILKSGTVMPMPDIRDKMPKMSFLPRVIAAKLPFSTSKIGELNKIFHVRENSGIGRMIS  421

Query  62   GTLAECERAPSRDE-TKRCV  6
              L E  R  ++   TKRCV
Sbjct  422  DALNEFTRKNTKASITKRCV  441


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 72/169 (43%), Gaps = 25/169 (15%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F++Y +  N++D  F  YG +  G A TFT+Y    N P+  F +Y   
Sbjct  99   YSRSSLGHDDKFSTYID-GNLVDQTFDTYGNTVTGGAGTFTNYQNLVNVPNLNFTSYSDD  157

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKK----------SNAADVG----FVNYGKTFNGG  447
             +G    F +Y    N G + F SY KK          +  A  G    F NYGK+ NG 
Sbjct  158  ASGRNQGFTNYINNGNSGEEDFKSYTKKGTESENKFTTTRMAQTGILSSFSNYGKSGNGI  217

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG----VTFAGYLNATDVTA  312
             D F+ Y       F G    NTF  Y   G      F  Y + T+V A
Sbjct  218  KDTFTSY------RFGGNVPENTFTSYGDGGNAATEIFKCYSDETNVGA  260



>ref|XP_003574428.1| PREDICTED: BURP domain-containing protein 12 [Brachypodium distachyon]
Length=623

 Score =   232 bits (592),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 132/265 (50%), Positives = 167/265 (63%), Gaps = 14/265 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+GN     FTSYGN++N + + F NYGES NG  DTF  Y   GN P+NTF++YGAG
Sbjct  229  YGKSGNRLRETFTSYGNDTNTLSSGFANYGESANGATDTFAGYGVEGNVPENTFRSYGAG  288

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GN  VD+F  YR +SNVG DSF SY K +N     F +YG + N G+  F GY + +   
Sbjct  289  GNAGVDSFKGYRDDSNVGDDSFASYAKGANGGAAEFRSYGGSANPGSVSFKGYGEGNNPN  348

Query  413  -RVSFNGY-GVNNTFKDYAKTGVTFAGYLNAT------DVTAAVGAAKGKMVNNKRWVEP  258
              + F  Y G N TFK YAKTG+ F GY N +       ++A   AA G   + K   EP
Sbjct  349  HHIGFKEYAGDNTTFKAYAKTGMDFKGYHNTSGNAAAEAMSAEAAAASGHHQHMKWSPEP  408

Query  257  GKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAM  78
            GKFFREK L +G  MPMPDIRDKMP R+FLPR+I+ ++PF   E   + ++F     SAM
Sbjct  409  GKFFREKELVAGNRMPMPDIRDKMPPRAFLPRDISRKIPF---EPNAVSEVFGVPLDSAM  465

Query  77   AKMIAGTLAECERAPSRDETKRCVT  3
             K +A T+AEC+RAPS+ ETKRC T
Sbjct  466  GKAVASTVAECDRAPSQGETKRCAT  490


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 78/167 (47%), Gaps = 24/167 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +   G A  F SY  N NV+   F +Y     G + +F +YA   N PD+ F NY AG
Sbjct  145  YSRGSTGRADTFASYEANGNVVTANFTSYAGGATGGSGSFAAYAEGTNVPDSKFTNYDAG  204

Query  584  GNGPVDTFNSYRQESNVGADS--------------FNSYGKKSNAADVGFVNYGKTFNGG  447
             NG    F +Y QE+N G +S              F SYG  +N    GF NYG++ NG 
Sbjct  205  ANGRARGFTAYSQEANHGENSFAGYGKSGNRLRETFTSYGNDTNTLSSGFANYGESANGA  264

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAKTG----VTFAGYLNATDV  318
            TD F+GY     V        NTF+ Y   G     +F GY + ++V
Sbjct  265  TDTFAGYGVEGNVP------ENTFRSYGAGGNAGVDSFKGYRDDSNV  305



>ref|XP_006438393.1| hypothetical protein CICLE_v10033917mg [Citrus clementina]
 gb|ESR51633.1| hypothetical protein CICLE_v10033917mg [Citrus clementina]
Length=618

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 168/261 (64%), Gaps = 13/261 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDA-DTFTSYAFNGNNPDNTFKNYGA  588
            YG NG GA   F +Y +++N M+T FK+Y E+ +G A DTF SY  +G  P   FK+YG 
Sbjct  226  YGNNGEGARNEFKAYLHDTNAMETHFKSYSEAAHGGANDTFKSYGADGAFPIEFFKSYGN  285

Query  587  GGNGPVDTFNSYRQESNVGADSFNSYGKKSNAAD-VGFVNYGKTFNGGTDKFSGYSD---  420
            GGN  V++F  Y   + + +D F +Y + S A+  V F  YG + +     F+ Y     
Sbjct  286  GGNAGVESFKEYNLNTFIASDYFKTYAENSKASQKVNFAAYGTSISARPHDFTRYGQNVK  345

Query  419  --SDRVSFNGYGVNNT-FKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKF  249
               +++ F  YG   T FKDYAK+GVTFA Y   T V      + G  VN  RWVEPGKF
Sbjct  346  GHQNQIDFKTYGSAYTKFKDYAKSGVTFANYTEGTPVPKP---SSGSSVN--RWVEPGKF  400

Query  248  FREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKM  69
            FRE MLK+GT+MPMPDIRD+MP+RSFLPR+I + LPF+++++ +L++IFHA + S M  +
Sbjct  401  FRESMLKNGTLMPMPDIRDRMPRRSFLPRSIVSNLPFTSSKLNQLKEIFHASDNSTMESI  460

Query  68   IAGTLAECERAPSRDETKRCV  6
            I   L++CERAPS+ ETKRCV
Sbjct  461  IKDALSDCERAPSKGETKRCV  481



>gb|KDP26582.1| hypothetical protein JCGZ_17740 [Jatropha curcas]
Length=625

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 126/258 (49%), Positives = 166/258 (64%), Gaps = 18/258 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGN A   F  Y    N+ D+ F NYGESG    ++F SY FNGN   N F +YG  
Sbjct  247  YGKNGNKANNEFVKYDEGVNLHDSNFTNYGESGIRSNESFKSYGFNGNEARNYFTSYGDR  306

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            G   ++ F SY +++++G ++F SYGKKSN   + F +YG+ FN   D F+GY   ++ +
Sbjct  307  GESGIERFTSYGEKASIGQEAFKSYGKKSNGEKIDFASYGE-FN--RDNFTGYGEGAEGN  363

Query  413  RVSFNGYGVNNT-FKDYAKTGVTFAGY-LNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
             + F  YG   T FK YAK  VTFA Y ++ T+    V          K+WVEPGKFFRE
Sbjct  364  SIGFKIYGEGETNFKSYAKKDVTFAKYNVSTTNEHNLV----------KKWVEPGKFFRE  413

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
             MLK G++MPMPDIRDKMPKR+FLPR I ++LPFS  +I +L++IF+A +GS+M  +I  
Sbjct  414  SMLKKGSVMPMPDIRDKMPKRAFLPRWIVSKLPFSTDQISQLKQIFNAGDGSSMETIILD  473

Query  59   TLAECERAPSRDETKRCV  6
             + ECERAPS  ETKRCV
Sbjct  474  AIKECERAPSPGETKRCV  491



>gb|ABR16440.1| unknown [Picea sitchensis]
Length=666

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/261 (48%), Positives = 168/261 (64%), Gaps = 15/261 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+ NG  +GF+SY  NSNV+   FK Y E GNG  D FTSYA NGN P N F++YG+ 
Sbjct  271  YGKDANGILSGFSSYAENSNVITNNFKGYSEGGNGPLDQFTSYADNGNVPRNEFESYGSN  330

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GNG + +F SY   +NV  D F SYGK +N   V F NYG + N   D+F  Y   S+S 
Sbjct  331  GNGALQSFTSYADGANVPQDVFKSYGKDANTPLVTFTNYGNSSNSQQDEFKQYGKGSNSP  390

Query  413  RVSFNGYGVNNTFKDYAK--TGVTFAGYLNATDV-TAAVGAAKGKMVNNKRWVEPGKFFR  243
             ++F  YG N  FK+YAK  TG+TF+ Y N+T+  ++A+G A G        VE GKFFR
Sbjct  391  DMTFTSYGRNTQFKEYAKNGTGITFSSYTNSTNSNSSAMGTAAG--------VEAGKFFR  442

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELP-FSAAEIGELEKIFHAVEGSAMAKMI  66
            E +L  G+ +P+P++RD MP+RSFLPR++A +LP FS+  + EL ++F   E S+M  M+
Sbjct  443  ENLLVQGSSLPLPNLRDFMPRRSFLPRSLADKLPSFSSQSLAELVRMFRIPENSSMEGMM  502

Query  65   AGTLAECERAPSRDETKRCVT  3
            A TL ECER   + E K+CVT
Sbjct  503  AKTLKECERPAVKGEIKKCVT  523


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 68/137 (50%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG++GNG +  F +Y   +N+ D  F  Y    +     FT+Y  N N PD+ FKNYG  
Sbjct  187  YGRDGNGRSQVFANYAPQTNIEDEGFATYSSGASAANSDFTNYGSNSNVPDHHFKNYGTD  246

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
             N  +  F SY   SNV  + F SYGK +N    GF +Y +  N  T+ F GYS+     
Sbjct  247  SNAGIQNFKSYADNSNVVKNDFASYGKDANGILSGFSSYAENSNVITNNFKGYSEG----  302

Query  404  FNGYGVNNTFKDYAKTG  354
              G G  + F  YA  G
Sbjct  303  --GNGPLDQFTSYADNG  317


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 63/137 (46%), Gaps = 6/137 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y    N A   F  YG + N     F NY    N + + F +Y+   +  ++ F NYG+ 
Sbjct  173  YSDGDNEAKDDFKRYGRDGNGRSQVFANYAPQTNIEDEGFATYSSGASAANSDFTNYGSN  232

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
             N P   F +Y  +SN G  +F SY   SN     F +YGK  NG    FS Y+++  V 
Sbjct  233  SNVPDHHFKNYGTDSNAGIQNFKSYADNSNVVKNDFASYGKDANGILSGFSSYAENSNV-  291

Query  404  FNGYGVNNTFKDYAKTG  354
                 + N FK Y++ G
Sbjct  292  -----ITNNFKGYSEGG  303


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 47/111 (42%), Gaps = 6/111 (5%)
 Frame = -1

Query  692  AFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNS  513
            +FKNY +  N   D F  Y  +GN     F NY    N   + F +Y   ++     F +
Sbjct  169  SFKNYSDGDNEAKDDFKRYGRDGNGRSQVFANYAPQTNIEDEGFATYSSGASAANSDFTN  228

Query  512  YGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDYAK  360
            YG  SN  D  F NYG   N G   F  Y+D+  V      V N F  Y K
Sbjct  229  YGSNSNVPDHHFKNYGTDSNAGIQNFKSYADNSNV------VKNDFASYGK  273



>gb|KEH20006.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=644

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 167/263 (63%), Gaps = 13/263 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+   A  GFT Y  N+NV  + F  Y E G+   D F SY+ N N P+NTFKNYG G
Sbjct  251  YGKDSIHAVNGFTQYAKNANVFKSDFSGYSEKGSSAVDAFVSYSKNLNKPENTFKNYGKG  310

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSN-AADVGFVNYGKTFN----GGTDKFSGYS-  423
                 + F +YR  +  G DSF SYG+ S     V F NYG+  +     G++ F GY+ 
Sbjct  311  SFAAQEKFTNYRDGAGSGDDSFTSYGENSQRGVKVDFNNYGQNPDYPKSPGSETFKGYAK  370

Query  422  --DSD-RVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPG  255
              D D +VSF  Y G NNTFKDY K G++FA Y   T  T ++  + G +  N   V+PG
Sbjct  371  GADLDHKVSFKVYNGNNNTFKDYDKKGISFASYNKTTTSTNSLSDS-GSLAKN--MVQPG  427

Query  254  KFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMA  75
            KFFREKMLK GT+MPMPDIRDK+P RSFLPR+I  +LPF+++++ E++++F   E S+M 
Sbjct  428  KFFREKMLKEGTVMPMPDIRDKLPPRSFLPRSILTKLPFASSKLNEMKQVFKVSENSSMN  487

Query  74   KMIAGTLAECERAPSRDETKRCV  6
            KM+   L+ECERAPS  ETKRCV
Sbjct  488  KMMVDALSECERAPSVGETKRCV  510


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 61/143 (43%), Gaps = 8/143 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y K   G    F +Y  N+N     F +YG         F +Y+   N P+  F  Y A 
Sbjct  167  YSKISTGHNDSFKNYALNNNEGVQTFNSYGTKSMAGFGEFKAYSEESNIPNLKFTTYTAS  226

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD---SD  414
              G   +F SY    N G  SF SYGK S  A  GF  Y K  N     FSGYS+   S 
Sbjct  227  VTGREQSFVSYSDGGNSGNQSFASYGKDSIHAVNGFTQYAKNANVFKSDFSGYSEKGSSA  286

Query  413  RVSFNGYGVN-----NTFKDYAK  360
              +F  Y  N     NTFK+Y K
Sbjct  287  VDAFVSYSKNLNKPENTFKNYGK  309



>gb|KHN27021.1| Putative polygalacturonase non-catalytic subunit [Glycine soja]
Length=340

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 140/211 (66%), Gaps = 11/211 (5%)
 Frame = -1

Query  623  NNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGT  444
            NNP  TF++Y  G  G   +F++YR ++NVGADSF SY K +  ++  F NYG +FN G+
Sbjct  2    NNPTETFQSYADGTVGGTQSFSNYRDQANVGADSFQSYAKNTLGSEADFKNYGNSFNPGS  61

Query  443  DKFSGYS---DSDRVSFNGYGVNN--TFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVN  279
            D F GY+   + ++V F  Y  N   TFKDYAK GV+FA Y        +  +       
Sbjct  62   DTFKGYAKGAEDNKVGFTTYSANTNATFKDYAKHGVSFASY------NVSSESKTVSSSV  115

Query  278  NKRWVEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFH  99
             KRWVEPGKFFRE MLK GT+MPMPDIRDKMPKRSFLPR I  +LPFS+A++ EL+++F 
Sbjct  116  VKRWVEPGKFFRETMLKEGTVMPMPDIRDKMPKRSFLPRAILTKLPFSSAKVDELKRVFK  175

Query  98   AVEGSAMAKMIAGTLAECERAPSRDETKRCV  6
              E S+M KMI  +L ECER PS  ETKRCV
Sbjct  176  VSENSSMDKMIMDSLGECEREPSVGETKRCV  206



>gb|EPS68955.1| hypothetical protein M569_05812, partial [Genlisea aurea]
Length=592

 Score =   227 bits (578),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 155/256 (61%), Gaps = 9/256 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG+NGN AA  F+SYG  SNV+ + F  YG  GN   D+F SYA N NNP N FK+YGAG
Sbjct  208  YGRNGNSAAEEFSSYGRTSNVVVSTFSGYGGGGNSANDSFKSYATNSNNPTNGFKSYGAG  267

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD---SD  414
            GN   D F +YR  +N GAD+F SYGK SNA    F NYGKT +GG D F  Y+    + 
Sbjct  268  GNDGADDFANYRDSANAGADTFQSYGKDSNAQKSNFANYGKTLSGGVDSFKEYAKGAAAQ  327

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
             + F  YG N TFK+Y+ TG+TF  Y   T                   V  GKFFRE  
Sbjct  328  SIGFKIYGENATFKEYSNTGITFDQYTKPTP------GHNAAAAAAAAAVPEGKFFRETT  381

Query  233  LKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTL  54
            L+ G  + M +IRD MP+RSFLPR I ++LPFS  ++ +L+++F A + S +  ++A  L
Sbjct  382  LREGNTIRMANIRDWMPERSFLPRTITSKLPFSKGKLVQLKRLFRAKDNSTLDHILAAAL  441

Query  53   AECERAPSRDETKRCV  6
            AEC RAPS  ETKRCV
Sbjct  442  AECGRAPSPGETKRCV  457


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 63/142 (44%), Gaps = 8/142 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y    N A  GF+ YG  +      F +YG+  N     FTSY          F+NY   
Sbjct  110  YSNGVNYAGGGFSRYGREATGNREGFASYGDDSNVAGANFTSYGGGATGGGGDFRNYMPR  169

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV-  408
             N P   F SY  E++    +F  Y   +N+   GF  YG+  N   ++FS Y  +  V 
Sbjct  170  VNVPNLRFGSYDSEADEHRLTFAGYSDDTNSGSQGFAGYGRNGNSAAEEFSSYGRTSNVV  229

Query  407  --SFNGYG-----VNNTFKDYA  363
              +F+GYG      N++FK YA
Sbjct  230  VSTFSGYGGGGNSANDSFKSYA  251



>ref|XP_007138090.1| hypothetical protein PHAVU_009G179500g [Phaseolus vulgaris]
 gb|ESW10084.1| hypothetical protein PHAVU_009G179500g [Phaseolus vulgaris]
Length=627

 Score =   227 bits (578),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 121/259 (47%), Positives = 157/259 (61%), Gaps = 15/259 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDA-DTFTSYAFNGNNPDNTFKNYGA  588
            YGK   G  + FT+Y +++N++ + F NYG+   G   D+F SY+FNGNNP N FK Y A
Sbjct  246  YGKRVRGGTSEFTNYASDANILQSEFNNYGDFSTGATNDSFKSYSFNGNNPRNVFKTYSA  305

Query  587  GGNGPV-DTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----S  423
            G  G   D F SYR  +NVG D+F SY  +S +    F NYG +FN G D F  Y    +
Sbjct  306  GSRGSAADNFISYRNRANVGDDTFQSYAARSKSGTAKFTNYGMSFNVGNDSFVEYGKGAT  365

Query  422  DSDRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFR  243
                  F  YG+   FK Y K   +F+ Y N         A  G++VN +  VEPGKFFR
Sbjct  366  GKSSFGFKSYGLGRAFKVYNKNDASFSEYRN-------FSATSGRVVNKR--VEPGKFFR  416

Query  242  EKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIA  63
            E ++K G ++ MPDIRDKMP RSFLP  IA++LPFS++ I E+ ++F A EGS   ++I 
Sbjct  417  ESIMKEGNVIVMPDIRDKMPARSFLPLAIASKLPFSSSRIDEMRELFEAREGSGTERVIV  476

Query  62   GTLAECERAPSRDETKRCV  6
              L ECERAPSR ETKRCV
Sbjct  477  NALRECERAPSRGETKRCV  495


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 75/160 (47%), Gaps = 23/160 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +       F +Y N  N  + AF+ Y +S     + F +YA NGN  +  F +YG+ 
Sbjct  134  YGTSRVDGVDSFKNYSNGLNANNDAFRRYSDSSTRRGEQFKNYADNGNVANTNFTSYGSA  193

Query  584  GNGPVDTFNSYRQESNV--------------GADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                   FN+Y +  NV                 SF SYG ++N+    F++YGK   GG
Sbjct  194  AAQSSSDFNNYDKTVNVPNLGFTTYDSGSSNHKLSFASYGNETNSGAQSFMSYGKRVRGG  253

Query  446  TDKFSGY-SDSDRVS--FNGYG------VNNTFKDYAKTG  354
            T +F+ Y SD++ +   FN YG       N++FK Y+  G
Sbjct  254  TSEFTNYASDANILQSEFNNYGDFSTGATNDSFKSYSFNG  293



>ref|XP_006484316.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630-like 
[Citrus sinensis]
Length=632

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 165/261 (63%), Gaps = 13/261 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDA-DTFTSYAFNGNNPDNTFKNYGA  588
            YG NG GA   F +Y +++N M+T FK+Y E+ +G A D F SY  +G  P   FK+YG 
Sbjct  240  YGNNGEGARNEFKAYLHDTNAMETHFKSYSEAAHGGANDKFKSYGADGAFPIEFFKSYGN  299

Query  587  GGNGPVDTFNSYRQESNVGADSFNSYGKKSNAAD-VGFVNYGKTFNGGTDKFSGYSD---  420
            GGN  V++F  Y   + + +D F +Y + S A+  V F  YG + +     F+ Y     
Sbjct  300  GGNAGVESFKEYNLNTFIASDYFKTYAENSKASQKVNFAAYGTSISARPHDFTRYGQNAK  359

Query  419  --SDRVSFNGYGVNNT-FKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKF  249
               +++ F  YG   T FKDYAK+GVTFA Y   T V      + G  VN  RWVEPGKF
Sbjct  360  GHQNQIDFKTYGSAYTKFKDYAKSGVTFANYTEGTPVP---NPSSGSSVN--RWVEPGKF  414

Query  248  FREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKM  69
            FRE MLK+GT+MPMPDIRD+MP+RSFLP +I + LPF+ +++ +L++IFHA + S M  +
Sbjct  415  FRESMLKNGTLMPMPDIRDRMPRRSFLPLSIVSNLPFTGSKLNQLKEIFHASDNSTMESI  474

Query  68   IAGTLAECERAPSRDETKRCV  6
            I   L++CERAPS+ ETKRCV
Sbjct  475  IKDALSDCERAPSKGETKRCV  495



>gb|AAB38497.1| female sex protein [Mercurialis annua]
Length=221

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 137/210 (65%), Gaps = 12/210 (6%)
 Frame = -1

Query  623  NNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGT  444
            +NP NTFKNYG G N  VD+F+SYR  +NVG DSF SY + +NA  V FVNYGK    G 
Sbjct  4    DNPHNTFKNYGTGANTAVDSFSSYRNGANVGHDSFQSYARNTNAGKVNFVNYGKHSTLGN  63

Query  443  DKFSGYSDSDR----VSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNN  276
            D F  Y    +    V F  YG +  FKDY + G TFAGY N T  +       G  V  
Sbjct  64   DTFKEYGKGSKGITTVGFKTYGPDRAFKDYIQKGGTFAGYTNTTTTS-------GSFVY-  115

Query  275  KRWVEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHA  96
            KR+VEPGKFFRE MLK G +M MPDI DKMPKRSFLP +I ++LPFS++ + E++KIFHA
Sbjct  116  KRFVEPGKFFRESMLKEGNVMVMPDIVDKMPKRSFLPLSIVSKLPFSSSNLTEMKKIFHA  175

Query  95   VEGSAMAKMIAGTLAECERAPSRDETKRCV  6
            ++ S   ++I   LAECER  S+ ETK+CV
Sbjct  176  LDDSETERVIVNALAECERKASQGETKQCV  205



>gb|EEC84370.1| hypothetical protein OsI_30914 [Oryza sativa Indica Group]
Length=658

 Score =   225 bits (574),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 167/262 (64%), Gaps = 14/262 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK  NGAA  F +YGN+SN + T F NYG+  NG AD F+SY  +GN P+NTFK+Y +G
Sbjct  269  YGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGAADAFSSYGASGNTPENTFKSYASG  328

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SDS  417
             N  VD F  YR ++NVG DSF SY   +N A  GF +YGK+ N G+  F GY    + +
Sbjct  329  SNAGVDDFKGYRDDANVGNDSFTSYASNANGAAAGFESYGKSVNPGSVTFKGYGLGSNPN  388

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNAT--DVTAAVGAAKGKMVNNKRW-VEPGKF  249
             R+ F  Y G N TFK Y+  GV F  Y N +  +V+    AA+   +   RW  EPGKF
Sbjct  389  HRIGFARYSGDNTTFKAYSNDGVEFKEYQNMSKMEVSKIEAAARRPPL---RWSPEPGKF  445

Query  248  FREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKM  69
            FRE+ L +G  MPMPDI D+ P R+FLPR+IAA++PF AA +  L   F A  G+AM ++
Sbjct  446  FRERDLVAGNRMPMPDIADRTPPRAFLPRDIAAKIPFDAAAVSAL---FGAAPGTAMRQV  502

Query  68   IAGTLAECERAPSRDETKRCVT  3
            ++ T+AEC R PSR ETKRC T
Sbjct  503  VSSTVAECARPPSRGETKRCAT  524


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 76/167 (46%), Gaps = 24/167 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK   G    FTSY    NV  ++F +Y     G A  F+SYA + N    +F NY   
Sbjct  185  YGKGSQGRNDSFTSYEAGGNVGTSSFTSYNGDATGGAGGFSSYAGDANTVAVSFGNYDHT  244

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGK--------------KSNAADVGFVNYGKTFNGG  447
            GNG    F+ Y Q++N G +SF +YGK               SN+   GF NYG   NG 
Sbjct  245  GNGRSREFSEYTQDANTGEESFVAYGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGA  304

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAK---TGV-TFAGYLNATDV  318
             D FS Y  S      G    NTFK YA     GV  F GY +  +V
Sbjct  305  ADAFSSYGAS------GNTPENTFKSYASGSNAGVDDFKGYRDDANV  345



>ref|NP_001062896.2| Os09g0329000 [Oryza sativa Japonica Group]
 sp|Q6K2M1.2|BURPE_ORYSJ RecName: Full=BURP domain-containing protein 14; Short=OsBURP14; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAF24810.2| Os09g0329000 [Oryza sativa Japonica Group]
Length=690

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 167/262 (64%), Gaps = 14/262 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK  NGAA  F +YGN+SN + T F NYG+  NG AD F+SY  +GN P+NTFK+Y +G
Sbjct  301  YGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGAADAFSSYGASGNTPENTFKSYASG  360

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SDS  417
             N  VD F  YR ++NVG DSF SY   +N A  GF +YGK+ N G+  F GY    + +
Sbjct  361  SNAGVDDFKGYRDDANVGNDSFTSYASNANGAAAGFESYGKSVNPGSVTFKGYGLGSNPN  420

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNAT--DVTAAVGAAKGKMVNNKRW-VEPGKF  249
             R+ F  Y G N TFK Y+  GV F  Y N +  +V+    AA+   +   RW  EPGKF
Sbjct  421  HRIGFARYSGDNTTFKAYSNDGVEFKEYQNMSKMEVSKIEAAARRPPL---RWSPEPGKF  477

Query  248  FREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKM  69
            FRE+ L +G  MPMPDI D+ P R+FLPR+IAA++PF AA +  L   F A  G+AM ++
Sbjct  478  FRERDLVAGNRMPMPDIADRTPPRAFLPRDIAAKIPFDAAAVSAL---FGAAPGTAMRQV  534

Query  68   IAGTLAECERAPSRDETKRCVT  3
            ++ T+AEC R PSR ETKRC T
Sbjct  535  VSSTVAECARPPSRGETKRCAT  556


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 76/167 (46%), Gaps = 24/167 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK   G    FTSY    NV  ++F +Y     G A  F+SYA + N    +F NY   
Sbjct  217  YGKGSQGRNDSFTSYEAGGNVGTSSFTSYNGDATGGAGGFSSYAGDANTVAVSFGNYDHT  276

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGK--------------KSNAADVGFVNYGKTFNGG  447
            GNG    F+ Y Q++N G +SF +YGK               SN+   GF NYG   NG 
Sbjct  277  GNGRSREFSEYTQDANTGEESFAAYGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGA  336

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAK---TGV-TFAGYLNATDV  318
             D FS Y  S      G    NTFK YA     GV  F GY +  +V
Sbjct  337  ADAFSSYGAS------GNTPENTFKSYASGSNAGVDDFKGYRDDANV  377



>dbj|BAD23622.1| polygalacturonase isoenzyme 1 beta subunit-like [Oryza sativa 
Japonica Group]
 dbj|BAD29397.1| polygalacturonase isoenzyme 1 beta subunit-like [Oryza sativa 
Japonica Group]
Length=690

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 167/262 (64%), Gaps = 14/262 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK  NGAA  F +YGN+SN + T F NYG+  NG AD F+SY  +GN P+NTFK+Y +G
Sbjct  301  YGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGAADAFSSYGASGNTPENTFKSYASG  360

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SDS  417
             N  VD F  YR ++NVG DSF SY   +N A  GF +YGK+ N G+  F GY    + +
Sbjct  361  SNAGVDDFKGYRDDANVGNDSFTSYASNANGAAAGFESYGKSVNPGSVTFKGYGLGSNPN  420

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNAT--DVTAAVGAAKGKMVNNKRW-VEPGKF  249
             R+ F  Y G N TFK Y+  GV F  Y N +  +V+    AA+   +   RW  EPGKF
Sbjct  421  HRIGFARYSGDNTTFKAYSNDGVEFKEYQNMSKMEVSKIEAAARRPPL---RWSPEPGKF  477

Query  248  FREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKM  69
            FRE+ L +G  MPMPDI D+ P R+FLPR+IAA++PF AA +  L   F A  G+AM ++
Sbjct  478  FRERDLVAGNRMPMPDIADRTPPRAFLPRDIAAKIPFDAAAVSAL---FGAAPGTAMRQV  534

Query  68   IAGTLAECERAPSRDETKRCVT  3
            ++ T+AEC R PSR ETKRC T
Sbjct  535  VSSTVAECARPPSRGETKRCAT  556


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 76/167 (46%), Gaps = 24/167 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK   G    FTSY    NV  ++F +Y     G A  F+SYA + N    +F NY   
Sbjct  217  YGKGSQGRNDSFTSYEAGGNVGTSSFTSYNGDATGGAGGFSSYAGDANTVAVSFGNYDHT  276

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGK--------------KSNAADVGFVNYGKTFNGG  447
            GNG    F+ Y Q++N G +SF +YGK               SN+   GF NYG   NG 
Sbjct  277  GNGRSREFSEYTQDANTGEESFAAYGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGA  336

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYAK---TGV-TFAGYLNATDV  318
             D FS Y  S      G    NTFK YA     GV  F GY +  +V
Sbjct  337  ADAFSSYGAS------GNTPENTFKSYASGSNAGVDDFKGYRDDANV  377



>ref|XP_008652571.1| PREDICTED: BURP domain-containing protein 14-like [Zea mays]
 tpg|DAA61067.1| TPA: hypothetical protein ZEAMMB73_635092 [Zea mays]
Length=679

 Score =   225 bits (573),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 163/262 (62%), Gaps = 13/262 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK  NGA   F +YGNNSN + + F NYGE  NG  DTFTSY   GN P+NTF++Y +G
Sbjct  290  YGKTANGAGESFETYGNNSNTVASGFINYGEKSNGFNDTFTSYGLVGNAPENTFRSYASG  349

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
             N  VD F +YR E+NVG DSF SY   +N A   F +YGK+ N G+  F GY      +
Sbjct  350  SNAGVDQFKAYRDEANVGDDSFMSYANNANGAAADFDSYGKSTNPGSVAFKGYGQGSNPN  409

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNAT--DVTAAVGAAKGKMVNNKRWV-EPGKF  249
             R+ F  Y G N TFK Y+  GV F  Y N +  +V+ A  AA G+ +    W  EPGKF
Sbjct  410  HRIGFKHYAGENTTFKAYSNEGVEFKEYQNMSKMEVSKAAAAAPGRRL--PAWSPEPGKF  467

Query  248  FREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKM  69
            FRE+ L  G  MPMPDI DKMP+R+FLPR+IA ++PF   E   +  +F A  G+AM ++
Sbjct  468  FRERDLMMGNRMPMPDIADKMPRRAFLPRDIATKIPF---EENAVSALFGAPPGTAMRQV  524

Query  68   IAGTLAECERAPSRDETKRCVT  3
            +A T+AEC R PS  ETKRC T
Sbjct  525  VASTVAECARPPSPGETKRCTT  546


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 57/145 (39%), Gaps = 22/145 (15%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK   G    F +Y   +NV  + F +Y     G A  F  YA   N     F  Y + 
Sbjct  206  YGKGSLGRNDSFANYEEGANVGTSTFNSYTTGATGGAGEFAGYAGQTNTVAVAFATYDSV  265

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVS  405
            GNG    F +Y Q++N G  SF                YGKT NG  + F  Y ++    
Sbjct  266  GNGRTHEFTAYSQDANSGVQSF--------------TGYGKTANGAGESFETYGNNSNTV  311

Query  404  FNGY--------GVNNTFKDYAKTG  354
             +G+        G N+TF  Y   G
Sbjct  312  ASGFINYGEKSNGFNDTFTSYGLVG  336


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 57/129 (44%), Gaps = 9/129 (7%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F  Y    +G  D+F  Y       +++F NY  G N    TFNSY   +  GA  F  Y
Sbjct  189  FAIYSSGKSGPVDSFKRYGKGSLGRNDSFANYEEGANVGTSTFNSYTTGATGGAGEFAGY  248

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYS---DSDRVSFNGY-----GVNNTFKDYAKTG  354
              ++N   V F  Y    NG T +F+ YS   +S   SF GY     G   +F+ Y    
Sbjct  249  AGQTNTVAVAFATYDSVGNGRTHEFTAYSQDANSGVQSFTGYGKTANGAGESFETYGNNS  308

Query  353  VTFA-GYLN  330
             T A G++N
Sbjct  309  NTVASGFIN  317



>ref|XP_002460065.1| hypothetical protein SORBIDRAFT_02g022220 [Sorghum bicolor]
 gb|EER96586.1| hypothetical protein SORBIDRAFT_02g022220 [Sorghum bicolor]
Length=691

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 159/262 (61%), Gaps = 11/262 (4%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK  NGA   F +YGNNSN + + F NYG+  NG  DTF SY  +GN P NTF++Y +G
Sbjct  300  YGKTANGAGESFKTYGNNSNTVASGFINYGDRANGFNDTFASYGLDGNAPQNTFRSYASG  359

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
             N  VD F +YR ++NVG DSF SY   +N A   F +YGK+ N G+  F GY      +
Sbjct  360  SNAAVDEFKAYRDQANVGDDSFASYASNANGAAADFDSYGKSTNPGSVAFKGYGQGSNPN  419

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNK--RWV-EPGKF  249
             R+ F  Y G N TFK Y+  GV F  Y N + +  +  AA      ++   W  EPGKF
Sbjct  420  HRIGFTHYSGENTTFKAYSNEGVEFKEYQNMSKMEVSKTAAPATTAGHRLPMWSPEPGKF  479

Query  248  FREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKM  69
            FRE+ L  G  MPMPDI DKMP R+FLPR+IAA++PF   E   +  +F A  G+AM ++
Sbjct  480  FRERDLMMGNRMPMPDIADKMPHRAFLPRDIAAKIPF---EENAVSALFGAPPGTAMRQV  536

Query  68   IAGTLAECERAPSRDETKRCVT  3
            +A T+AEC R PS  ETKRC T
Sbjct  537  VASTVAECARPPSLGETKRCTT  558


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 71/155 (46%), Gaps = 33/155 (21%)
 Frame = -1

Query  689  FKNYGESGN---------GDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESN  537
            FKNY E+GN         G +D F  Y+   + P ++FK YG G  G  D+F +Y +  N
Sbjct  177  FKNY-ENGNFSSYGNSGGGGSDQFAVYSSGKSGPVDSFKRYGKGSLGRNDSFTNYEEGGN  235

Query  536  VGADSFNS--------------YGKKSNAADVGFVNYGKTFNGGTDKFSGYS---DSDRV  408
            VG  SFNS              Y  ++N   V F  Y  T NG T +F+ YS   +S   
Sbjct  236  VGTSSFNSYTTGATGGAGEFAGYAGQTNTVAVTFATYDNTGNGRTHEFTAYSQDANSGVQ  295

Query  407  SFNGY-----GVNNTFKDYAKTGVTFA-GYLNATD  321
            SF GY     G   +FK Y     T A G++N  D
Sbjct  296  SFTGYGKTANGAGESFKTYGNNSNTVASGFINYGD  330



>gb|EEE69479.1| hypothetical protein OsJ_28904 [Oryza sativa Japonica Group]
Length=837

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 167/262 (64%), Gaps = 14/262 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK  NGAA  F +YGN+SN + T F NYG+  NG AD F+SY  +GN P+NTFK+Y +G
Sbjct  257  YGKTANGAAESFRTYGNHSNSIATGFDNYGDRANGAADAFSSYGASGNTPENTFKSYASG  316

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY----SDS  417
             N  VD F  YR ++NVG DSF SY   +N A  GF +YGK+ N G+  F GY    + +
Sbjct  317  SNAGVDDFKGYRDDANVGNDSFTSYASNANGAAAGFESYGKSVNPGSVTFKGYGLGSNPN  376

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNAT--DVTAAVGAAKGKMVNNKRW-VEPGKF  249
             R+ F  Y G N TFK Y+  GV F  Y N +  +V+    AA+   +   RW  EPGKF
Sbjct  377  HRIGFARYSGDNTTFKAYSNDGVEFKEYQNMSKMEVSKIEAAARRPPL---RWSPEPGKF  433

Query  248  FREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKM  69
            FRE+ L +G  MPMPDI D+ P R+FLPR+IAA++PF AA +  L   F A  G+AM ++
Sbjct  434  FRERDLVAGNRMPMPDIADRTPPRAFLPRDIAAKIPFDAAAVSAL---FGAAPGTAMRQV  490

Query  68   IAGTLAECERAPSRDETKRCVT  3
            ++ T+AEC R PSR ETKRC T
Sbjct  491  VSSTVAECARPPSRGETKRCAT  512


 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 63/86 (73%), Gaps = 3/86 (3%)
 Frame = -1

Query  260  PGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSA  81
            PGKFFRE+ L +G  MPMPDI D+ P R+FLPR+IAA++PF AA +  L   F A  G+A
Sbjct  623  PGKFFRERDLVAGNRMPMPDIADRTPPRAFLPRDIAAKIPFDAAAVSAL---FGAAPGTA  679

Query  80   MAKMIAGTLAECERAPSRDETKRCVT  3
            M ++++ T+AEC R PSR ETKRC T
Sbjct  680  MRQVVSSTVAECARPPSRGETKRCAT  705


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 66/142 (46%), Gaps = 24/142 (17%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F+SY  ++N +  +F NY  +GNG +  F+ Y  + N  + +F  YG   NG        
Sbjct  212  FSSYAGDANTVAVSFGNYDHTGNGRSREFSEYTQDANTGEESFAAYGKTANG--------  263

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFK  372
                   A+SF +YG  SN+   GF NYG   NG  D FS Y  S      G    NTFK
Sbjct  264  ------AAESFRTYGNHSNSIATGFDNYGDRANGAADAFSSYGAS------GNTPENTFK  311

Query  371  DYAK---TGV-TFAGYLNATDV  318
             YA     GV  F GY +  +V
Sbjct  312  SYASGSNAGVDDFKGYRDDANV  333



>ref|XP_003576424.1| PREDICTED: BURP domain-containing protein 14-like [Brachypodium 
distachyon]
Length=775

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 159/266 (60%), Gaps = 15/266 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK  N A   F  YGN+SN + + F NYGE  N   DTF SY  NGN P+NTF++Y +G
Sbjct  378  YGKTANSAGESFKDYGNHSNSIMSGFINYGEKANSANDTFASYGLNGNAPENTFRSYASG  437

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
             N   D F  YR  +NVG DSF SY   +N A   F +YGK+ N G+  F GY      +
Sbjct  438  SNAGADDFKGYRDNANVGDDSFMSYATDANGATADFESYGKSVNPGSVAFKGYGQGSNPN  497

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLN-----ATDVTAAVGAAKGKMVNNK-RW-VE  261
              + F  Y G N TFK Y+  GV F  Y N      + V A +  + G+    + +W  E
Sbjct  498  HHIGFTHYTGDNTTFKGYSNDGVAFKEYQNMSKMEVSKVVADLSLSSGQHHRPQPKWSPE  557

Query  260  PGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSA  81
            PGKFFRE  L +G  MPMPDI DKMP R+FLPR+IAA++PF   E G +  +F A  G+A
Sbjct  558  PGKFFREWDLMTGNRMPMPDISDKMPPRAFLPRDIAAKIPF---EAGAVSALFGAPPGTA  614

Query  80   MAKMIAGTLAECERAPSRDETKRCVT  3
            M +++A T+AECERAPSR ETKRC T
Sbjct  615  MRQVVASTVAECERAPSRGETKRCAT  640


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 63/148 (43%), Gaps = 20/148 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK   G    F +Y    NV   +F +Y     G A  F +Y    N    TF NY   
Sbjct  294  YGKGSLGRNDSFATYEALGNVGTASFNSYTTGATGGAGDFAAYDGETNTAAVTFANYDVT  353

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAAD--------------VGFVNYGKTFNGG  447
            GNG    F  Y +++N G +SF  YGK +N+A                GF+NYG+  N  
Sbjct  354  GNGRSREFTDYTRDANSGVESFTGYGKTANSAGESFKDYGNHSNSIMSGFINYGEKANSA  413

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYA  363
             D F+ Y        NG    NTF+ YA
Sbjct  414  NDTFASY------GLNGNAPENTFRSYA  435


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 68/143 (48%), Gaps = 9/143 (6%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F+SYGNN      AF  Y        D+F  Y       +++F  Y A GN    +FNSY
Sbjct  263  FSSYGNNGGGGADAFAVYSRGQINPVDSFRRYGKGSLGRNDSFATYEALGNVGTASFNSY  322

Query  551  RQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYS---DSDRVSFNGYG---  390
               +  GA  F +Y  ++N A V F NY  T NG + +F+ Y+   +S   SF GYG   
Sbjct  323  TTGATGGAGDFAAYDGETNTAAVTFANYDVTGNGRSREFTDYTRDANSGVESFTGYGKTA  382

Query  389  --VNNTFKDYA-KTGVTFAGYLN  330
                 +FKDY   +    +G++N
Sbjct  383  NSAGESFKDYGNHSNSIMSGFIN  405



>dbj|BAJ97940.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   221 bits (563),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 121/264 (46%), Positives = 157/264 (59%), Gaps = 13/264 (5%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG+  N A   F +YGN+SN + + F NYG+  N   DTF SY  NGN P+N+F++Y +G
Sbjct  359  YGRAANSAGESFKAYGNHSNSIMSGFINYGDKANSATDTFDSYGLNGNTPENSFRSYSSG  418

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
             NG  D F  YR  +NVG DSF SY   +N A   F +YGK+ N G+  F GY      +
Sbjct  419  SNGGADDFKGYRDNANVGDDSFTSYANDANGATADFQSYGKSVNPGSVAFKGYGQGSNPN  478

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAA----KGKMVNNKRW-VEPG  255
             R+ F  Y G N TFK Y+  GV F  Y N + +  +  AA       +    RW  EPG
Sbjct  479  HRIGFTHYTGDNTTFKAYSNEGVEFKEYQNMSRMEVSKLAANLSLPLSLTGTPRWSPEPG  538

Query  254  KFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMA  75
            KFFRE+ L +G  MPMPDI DKMP R+FLPR+IA ++PF   E G +  +F A  G+AM 
Sbjct  539  KFFRERDLITGNRMPMPDITDKMPPRAFLPRDIATKIPF---EAGAVSALFGAPPGNAMR  595

Query  74   KMIAGTLAECERAPSRDETKRCVT  3
            +++A T+ EC R PSR ETKRC T
Sbjct  596  QVVASTVDECARPPSRGETKRCAT  619


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 62/148 (42%), Gaps = 20/148 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK   G    F +Y    NV   +F +Y     G    F  Y    N    TF NY   
Sbjct  275  YGKGSLGRNDSFATYEALGNVGTASFNSYTAGATGGTGEFAEYDGETNTVAVTFANYDVA  334

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAAD--------------VGFVNYGKTFNGG  447
            GNG    F++Y Q++N G +SF  YG+ +N+A                GF+NYG   N  
Sbjct  335  GNGRSRDFSTYTQDANSGVESFTGYGRAANSAGESFKAYGNHSNSIMSGFINYGDKANSA  394

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYA  363
            TD F  Y        NG    N+F+ Y+
Sbjct  395  TDTFDSY------GLNGNTPENSFRSYS  416



>gb|KDO69698.1| hypothetical protein CISIN_1g0378482mg, partial [Citrus sinensis]
Length=495

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 144/227 (63%), Gaps = 15/227 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGN   T FTSY +++N + ++F  Y ESGN   D+F +Y  +GNNP N FK+YG G
Sbjct  279  YGKNGNAGPTDFTSYADSANTVGSSFTGYAESGNAANDSFKAYGVSGNNPHNNFKSYGIG  338

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
             N  V  F SYR  +NVG DSF SY K +N+  V F NYGKTFN G D F  Y       
Sbjct  339  ANSAVAGFTSYRNGANVGDDSFQSYAKNANSGKVNFANYGKTFNLGNDTFKEYGKGSVGR  398

Query  413  -RVSFNGYGVNNTFKDYAK-TGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
              + F  Y +  +FK+Y K   VTFAGY N +    +V           RWVEPGKFFRE
Sbjct  399  TSIGFKSYDMGRSFKEYTKGVPVTFAGYTNLSSDANSV----------NRWVEPGKFFRE  448

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFH  99
             MLK G +M MPDIRDKMP+RSFLPR+I+++LPF+ +++ +L++IF 
Sbjct  449  SMLKQGNVMVMPDIRDKMPRRSFLPRSISSKLPFATSQLTQLKEIFR  495


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 78/161 (48%), Gaps = 12/161 (7%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +   G    FTSY  + NV +  F +Y  + N  +  FT+YA   N P+  F +Y + 
Sbjct  195  YSRESTGHTEDFTSYAKDGNVANENFTSYAANANAGSGGFTNYAERVNVPNLRFASYVSD  254

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRV-  408
            GN    +F SY  ++N GA+ F SYGK  NA    F +Y  + N     F+GY++S    
Sbjct  255  GNNHKLSFTSYGSDTNSGAEGFMSYGKNGNAGPTDFTSYADSANTVGSSFTGYAESGNAA  314

Query  407  --SFNGYGV-----NNTFKDY---AKTGVT-FAGYLNATDV  318
              SF  YGV     +N FK Y   A + V  F  Y N  +V
Sbjct  315  NDSFKAYGVSGNNPHNNFKSYGIGANSAVAGFTSYRNGANV  355


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 70/159 (44%), Gaps = 22/159 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG +  G    F +Y    N  + +FK Y     G  + FTSYA +GN  +  F +Y A 
Sbjct  167  YGDSKLGGIDSFKNYSQALNTPNDSFKKYSRESTGHTEDFTSYAKDGNVANENFTSYAAN  226

Query  584  GNG--------------PVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGG  447
             N               P   F SY  + N    SF SYG  +N+   GF++YGK  N G
Sbjct  227  ANAGSGGFTNYAERVNVPNLRFASYVSDGNNHKLSFTSYGSDTNSGAEGFMSYGKNGNAG  286

Query  446  TDKFSGYSDSDRV---SFNGY-----GVNNTFKDYAKTG  354
               F+ Y+DS      SF GY       N++FK Y  +G
Sbjct  287  PTDFTSYADSANTVGSSFTGYAESGNAANDSFKAYGVSG  325


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 8/120 (7%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG+S  G  D+F +Y+   N P+++FK Y     G  + F SY ++ NV  ++F SY
Sbjct  164  FANYGDSKLGGIDSFKNYSQALNTPNDSFKKYSRESTGHTEDFTSYAKDGNVANENFTSY  223

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSDRVSFNGYGVNNT-----FKDYAKTG  354
               +NA   GF NY +  N    +F+ Y    ++ ++SF  YG +       F  Y K G
Sbjct  224  AANANAGSGGFTNYAERVNVPNLRFASYVSDGNNHKLSFTSYGSDTNSGAEGFMSYGKNG  283



>gb|KHN30893.1| Polygalacturonase-1 non-catalytic subunit beta [Glycine soja]
Length=541

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 155/265 (58%), Gaps = 31/265 (12%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSY  552
            F +Y +N NV +T F +YG + N  +  F++Y    N P+  F  Y +G +    +F+SY
Sbjct  153  FKNYADNGNVANTNFSSYGSAANQASAEFSNYDKTVNVPNLGFTTYDSGASNHKLSFSSY  212

Query  551  RQESNVGADSFNSYGKK--------SNAAD----------VGFVNYGKTFNGGTDKFSGY  426
              E+N G+ +F SYGK+        +N AD            F NYG +FN G D F+ Y
Sbjct  213  GNETNSGSQTFTSYGKRVRGGTSEFANYADDANILQSDGAATFANYGMSFNVGNDSFTEY  272

Query  425  SD----SDRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEP  258
                       F  YG+   FK Y K G +F+ Y N         AA+GK+VN  +WVEP
Sbjct  273  GKGAMGKTSFGFKSYGLGRAFKVYNKDGASFSEYRN-------FSAARGKVVN--KWVEP  323

Query  257  GKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAM  78
            GKFFRE M+K G ++PMPDI+DKMP RSFLP  IA++LPFS++ I E+ ++FH  EGS+ 
Sbjct  324  GKFFRESMVKEGNVIPMPDIKDKMPARSFLPLAIASKLPFSSSRINEMREVFHTREGSST  383

Query  77   AKMIAGTLAECERAPSRDETKRCVT  3
             +++   L ECERAPS+ ETKRCV+
Sbjct  384  ERVMVKALKECERAPSKGETKRCVS  408



>dbj|BAH57586.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57587.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57588.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57590.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57591.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57592.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57593.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57594.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57595.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57599.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57601.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57602.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57603.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57604.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57605.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57606.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57607.1| BURP domain-containing protein [Arabidopsis thaliana]
Length=196

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 130/192 (68%), Gaps = 12/192 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F+SYG +SNV+ + F NYGE+GN   DTF  Y  +GN P N FK+YGA 
Sbjct  14   YGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGAS  73

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR  +NVG DSF+SY K SN   V FVNYGK+ N G++ FSGY   ++ +
Sbjct  74   GNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGN  133

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDYAKTGV FA Y  ++          GK VN  +WVEPGKFFRE M
Sbjct  134  KIDFKTYTQNSTFKDYAKTGVEFAKYNRSS-------LGGGKTVN--KWVEPGKFFRESM  184

Query  233  LKSGTIMPMPDI  198
            LK GT++ MPDI
Sbjct  185  LKEGTLIWMPDI  196



>dbj|BAH57597.1| BURP domain-containing protein [Arabidopsis thaliana]
Length=196

 Score =   184 bits (467),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 130/192 (68%), Gaps = 12/192 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F+SYG +SNV+ + F NYGE+GN   DTF  Y  +GN P N FK+YGA 
Sbjct  14   YGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGAS  73

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR  +NVG DSF+SY K SN   V FVNYGK+ N G++ FSGY   ++ +
Sbjct  74   GNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGN  133

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDY+KTGV FA Y  ++          GK VN  +WVEPGKFFRE M
Sbjct  134  KIDFKTYTQNSTFKDYSKTGVEFAKYNRSS-------LGGGKTVN--KWVEPGKFFRESM  184

Query  233  LKSGTIMPMPDI  198
            LK GT++ MPDI
Sbjct  185  LKEGTLIWMPDI  196



>dbj|BAH57598.1| BURP domain-containing protein [Arabidopsis thaliana]
 dbj|BAH57600.1| BURP domain-containing protein [Arabidopsis thaliana]
Length=196

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 129/192 (67%), Gaps = 12/192 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F+SYG +SNV+ + F NYGE+GN   DTF  Y  +GN P N FK+YGA 
Sbjct  14   YGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGAS  73

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR  +NVG DSF+SY K SN   V FVNYGK+ N G++ FSGY   ++ +
Sbjct  74   GNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGN  133

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDY KTGV FA Y  ++          GK VN  +WVEPGKFFRE M
Sbjct  134  KIDFKTYTQNSTFKDYTKTGVEFAKYNRSS-------LGGGKTVN--KWVEPGKFFRESM  184

Query  233  LKSGTIMPMPDI  198
            LK GT++ MPDI
Sbjct  185  LKEGTLIWMPDI  196



>dbj|BAH57589.1| BURP domain-containing protein [Arabidopsis thaliana]
Length=196

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 130/192 (68%), Gaps = 12/192 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F+SYG +SNV+ + F NYGE+GN   DTF  Y  +GN P N FK+YGA 
Sbjct  14   YGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGAS  73

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR  +NVG DSF+SY K SN   V FVNYGK+ N G++ FSGY   ++ +
Sbjct  74   GNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGN  133

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDYAKTGV FA Y  ++          GK VN  +WVEPGKFFRE M
Sbjct  134  KIDFKTYTQNSTFKDYAKTGVEFAKYNRSS-------LGGGKTVN--KWVEPGKFFRESM  184

Query  233  LKSGTIMPMPDI  198
            LK GT++ +PDI
Sbjct  185  LKEGTLIWVPDI  196



>ref|XP_003610588.1| BURP domain-containing protein [Medicago truncatula]
 gb|AES92785.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=394

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 138/215 (64%), Gaps = 13/215 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNG    FT+YG +SN + + F NY E+ N   D+F  Y+ + NNP NTF NY  G
Sbjct  185  YGKNGNGHTEEFTNYGTSSNTVGSDFSNYAETSNSGNDSFKGYSVDMNNPTNTFSNYANG  244

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSD---  414
            GNG + TF++YR+++NVGADSF SY K +NAA +GF NYGK+FNGGTD F+ Y+ +    
Sbjct  245  GNGAIQTFSTYREDANVGADSFTSYAKTANAAKIGFDNYGKSFNGGTDTFTSYAKTSSGE  304

Query  413  -RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNN---KRWVEPGKFF  246
             +V F GYGV+NTFK+Y+K GV+FA Y NA+    A    K   V+    K  VEPGKFF
Sbjct  305  TKVDFKGYGVDNTFKEYSKEGVSFAKYTNASLSLNASMEMKKSTVSGSLVKTSVEPGKFF  364

Query  245  REKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELP  141
            RE MLK   +MP   IR  + K       + ++LP
Sbjct  365  RENMLKEVVVMP---IRMALNKEK---EGVNSQLP  393


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 78/192 (41%), Gaps = 41/192 (21%)
 Frame = -1

Query  731  FTSYGNNSNVMDTAFKNYGE----------------SGNGDADTFTSY------------  636
            FT+YG +      +FKNY +                +  G  +TFT+Y            
Sbjct  83   FTNYGTSLPGGHDSFKNYSDGDYSDGEVNDFCRYSRNSAGHKETFTNYTPQTPTSDEFKQ  142

Query  635  -AFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKT  459
                 N P+  F +Y    NG   +FNSY +  N G  SF SYGK  N     F NYG +
Sbjct  143  CTTEANVPNEVFTSYSDNANGRTQSFNSYTENGNGGDQSFTSYGKNGNGHTEEFTNYGTS  202

Query  458  FNGGTDKFSGY---SDSDRVSFNGYGVN-----NTFKDYAKTG----VTFAGYLNATDVT  315
             N     FS Y   S+S   SF GY V+     NTF +YA  G     TF+ Y    +V 
Sbjct  203  SNTVGSDFSNYAETSNSGNDSFKGYSVDMNNPTNTFSNYANGGNGAIQTFSTYREDANVG  262

Query  314  AAVGAAKGKMVN  279
            A    +  K  N
Sbjct  263  ADSFTSYAKTAN  274



>dbj|BAH57596.1| BURP domain-containing protein [Arabidopsis thaliana]
Length=196

 Score =   182 bits (461),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 129/192 (67%), Gaps = 12/192 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F+SYG +SNV+ + F NYGE+GN   DTF  Y  +GN P N FK+YGA 
Sbjct  14   YGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENGNAANDTFKGYGGDGNVPQNNFKSYGAS  73

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR  +NVG DSF+SY K SN   V FVNYGK+ N G++ FSGY   ++ +
Sbjct  74   GNAAVDTFLNYRDNANVGDDSFSSYAKNSNFEKVDFVNYGKSINPGSESFSGYGKGAEGN  133

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDYAKTGV FA Y  ++          GK VN  +WVE GKFFRE M
Sbjct  134  KIDFKTYTQNSTFKDYAKTGVEFAKYNRSS-------LGGGKTVN--KWVESGKFFRESM  184

Query  233  LKSGTIMPMPDI  198
            LK GT++ MPDI
Sbjct  185  LKEGTLIWMPDI  196



>dbj|BAH57581.1| BURP domain-containing protein [Arabidopsis lyrata]
Length=196

 Score =   176 bits (446),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 127/192 (66%), Gaps = 12/192 (6%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKNGNGA   F+SYG +SNV+ + F NYGE+ N   DTF  Y  +GN P N FK+YGA 
Sbjct  14   YGKNGNGAPNEFSSYGVSSNVIGSDFSNYGENSNAANDTFKGYGGDGNVPRNNFKSYGAS  73

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY---SDSD  414
            GN  VDTF +YR ++NVG DSF SY K SN   V FVNYGK+ N G++ F+GY   ++ +
Sbjct  74   GNAAVDTFLNYRDKANVGDDSFASYAKNSNFEKVDFVNYGKSINPGSESFTGYGKGAEGN  133

Query  413  RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKM  234
            ++ F  Y  N+TFKDYAKTGV FA Y  +           GK VN  +WVEPGKFFRE +
Sbjct  134  KIGFKTYTQNSTFKDYAKTGVEFAKYNQSR-------LGGGKTVN--KWVEPGKFFRESL  184

Query  233  LKSGTIMPMPDI  198
            LK  +++ MPDI
Sbjct  185  LKESSLIWMPDI  196



>gb|EMT30231.1| hypothetical protein F775_20363 [Aegilops tauschii]
Length=444

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 108/259 (42%), Positives = 147/259 (57%), Gaps = 28/259 (11%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK+ N     FTSYG ++N + + F NYGES NG  DTFT Y   GN P+NTF++YGAG
Sbjct  76   YGKSANSLRETFTSYGGDTNTLSSGFANYGESANGATDTFTGYGVEGNVPENTFRSYGAG  135

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
            GN  VDTF  YR ++NVG DSF SY K +N     F +YG + N G+  F GY +    +
Sbjct  136  GNAGVDTFKGYRDDANVGDDSFASYAKGANGGAAEFQSYGGSGNQGSVAFKGYGEGTNRN  195

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
              + F  Y G N TFK     GV+  G  +       + A+  ++V+  R V  G+    
Sbjct  196  HHIGFKQYAGDNTTFK-----GVSVGGGNH-------IRASAYEVVSRARQVLQGEGAGG  243

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
            +        P+ DI DK+P  + LPR+IA ++PF   E   + ++F     +AM K +A 
Sbjct  244  R--------PVRDIGDKIPPGASLPRDIAGKIPF---EPNAVSEVFRVPLDTAMGKAVAS  292

Query  59   TLAECERAPSRDETKRCVT  3
            T+AECERAPS+ ETKRC T
Sbjct  293  TVAECERAPSQGETKRCAT  311



>gb|KDO38689.1| hypothetical protein CISIN_1g045773mg [Citrus sinensis]
Length=303

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 111/171 (65%), Gaps = 15/171 (9%)
 Frame = -1

Query  515  SYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNT-FKDYAKTGVTFAG  339
            SYG   +A    F  YG+   G           +++ F  YG   T FKDYAK+GVTFA 
Sbjct  10   SYGTSMSARPHDFTRYGQNAKG---------HQNQIDFKTYGSAYTKFKDYAKSGVTFAN  60

Query  338  YLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRN  159
            Y   T V      + G  VN  RWVEPGKFFRE MLK+GT+MPMPDIRD+MP+RS LPR+
Sbjct  61   YTEGTPVPKP---SSGSSVN--RWVEPGKFFRESMLKNGTLMPMPDIRDRMPRRSLLPRS  115

Query  158  IAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTLAECERAPSRDETKRCV  6
            I + LPF+++++ +L++IFHA + S M  +I   L++CERAPS+ ETKRCV
Sbjct  116  IVSNLPFTSSKLNQLKEIFHASDNSTMESIIKDALSDCERAPSKGETKRCV  166



>gb|EMT26618.1| hypothetical protein F775_18544 [Aegilops tauschii]
Length=560

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 120/216 (56%), Gaps = 29/216 (13%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK  N     F SYGN++N + +AF NYG+  N   DTF SY  NGN P NTF++Y +G
Sbjct  43   YGKTANSVGESFKSYGNHTNSIMSAFINYGDKANSATDTFDSYGLNGNTPQNTFRSYSSG  102

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
             NG  D F  YR  +NVG DSF SY   +N A   F +YGK+ N G+  F GY      +
Sbjct  103  SNGGADDFKGYRDNANVGDDSFTSYANDANGATADFQSYGKSVNPGSVGFKGYGQGANPN  162

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
             R+ F  Y G NNT K Y+                             K W EPGKFFRE
Sbjct  163  HRIGFTRYNGDNNTLKAYSNRPPP------------------------KWWREPGKFFRE  198

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSA  132
            + L +G  MPMPDI DKMP R+FLPR+IAA++PF+A
Sbjct  199  RDLITGNRMPMPDISDKMPPRAFLPRDIAAKMPFAA  234


 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 82/155 (53%), Gaps = 12/155 (8%)
 Frame = -1

Query  650  TFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVN  471
            TF SY  NGN P N F++Y +G NG  D F  YR  +NVG DSF SY   +N     F +
Sbjct  256  TFDSYGLNGNTPQNNFRSYSSGSNGGADDFKGYRDNANVGDDSFTSYANDANGTAADFQS  315

Query  470  YGKTFNGGTDKFSGYSD----SDRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAV  306
            YGK+ N G+  F GY      + R+ F  Y G N  FK Y+  GV F  Y N   +  + 
Sbjct  316  YGKSVNPGSVAFKGYGQGANPNHRIGFTRYTGDNTIFKAYSNEGVEFKEYQNMLRMEVSK  375

Query  305  GAAKGKMVNNK------RWV-EPGKFFREKMLKSG  222
             AA   + +++      +W  +PGKFFRE+ L +G
Sbjct  376  VAANLSLSSSRNHRPPPKWSPKPGKFFRERDLITG  410



>gb|KEH20005.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=374

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 99/152 (65%), Gaps = 14/152 (9%)
 Frame = -1

Query  449  GTDKFSGY---SDSD-RVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMV  282
            GT+ F GY    D D + SF+ YG  N FKDYAK G++F  Y  ++   +          
Sbjct  99   GTNIFKGYGKGVDLDNKFSFDNYGFTNPFKDYAKRGISFGIYTKSSSTNSVTSLV-----  153

Query  281  NNKRWVEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIF  102
                 VEPGKFFRE+MLK GT+MPMPD RDK+P RSFLPR+I  +LPF+++++  ++++F
Sbjct  154  -----VEPGKFFRERMLKEGTVMPMPDTRDKLPPRSFLPRSILIKLPFASSKLNNMKQVF  208

Query  101  HAVEGSAMAKMIAGTLAECERAPSRDETKRCV  6
               E S M KMI  +L+ECERAPS+ E KRCV
Sbjct  209  KVSENSFMEKMIVDSLSECERAPSKGEIKRCV  240



>emb|CAN67205.1| hypothetical protein VITISV_037214 [Vitis vinifera]
Length=235

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 78/99 (79%), Gaps = 2/99 (2%)
 Frame = -1

Query  302  AAKGKMVNNKRWVEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEI  123
            A  G  VN  RWVEPGKFFRE MLK GT+MPMPDIRDKMPKRSFLPR I+++LPFS +++
Sbjct  5    AVSGSSVN--RWVEPGKFFRESMLKKGTVMPMPDIRDKMPKRSFLPRTISSKLPFSTSKL  62

Query  122  GELEKIFHAVEGSAMAKMIAGTLAECERAPSRDETKRCV  6
             E++KIFHA + S+M  M    L +CERAPS+ ETKRCV
Sbjct  63   EEMKKIFHAADNSSMEHMFTEALDDCERAPSKGETKRCV  101



>emb|CAN66340.1| hypothetical protein VITISV_018557 [Vitis vinifera]
Length=226

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -1

Query  272  RWVEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAV  93
            RW+EPGKFFRE MLK GT+MPMPDIRDKMPKRSFLPR+I+++LPFS +++ E++KIFHA 
Sbjct  4    RWIEPGKFFRESMLKKGTVMPMPDIRDKMPKRSFLPRSISSKLPFSTSKLEEMKKIFHAA  63

Query  92   EGSAMAKMIAGTLAECERAPSRDETKRCV  6
            + S+M  M    L +CERAPS+ ETKRCV
Sbjct  64   BNSSMEHMFTEALDDCERAPSKGETKRCV  92



>gb|KCW86723.1| hypothetical protein EUGRSUZ_B03334 [Eucalyptus grandis]
Length=260

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -1

Query  266  VEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEG  87
            VE G FFRE MLKSG +MPMPDIRD +PKRSFLPR I+AELPFS +++ EL++IFHA+E 
Sbjct  39   VEKGLFFRESMLKSGNVMPMPDIRDNLPKRSFLPRCISAELPFSTSKLAELKQIFHAIEN  98

Query  86   SAMAKMIAGTLAECERAPSRDETKRCV  6
            SAM K++A TL ECE A  +DETKRCV
Sbjct  99   SAMGKIMAQTLGECEGAALQDETKRCV  125



>ref|XP_010100467.1| hypothetical protein L484_027779 [Morus notabilis]
 gb|EXB82601.1| hypothetical protein L484_027779 [Morus notabilis]
Length=217

 Score =   132 bits (332),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 94/235 (40%), Positives = 118/235 (50%), Gaps = 37/235 (16%)
 Frame = -1

Query  734  GFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGG--NGPVDTF  561
            GF++YG  S      FK Y +S N     FTSY+         FK+Y        P    
Sbjct  11   GFSTYGTGSTKGTGDFKKYTDSANVPELHFTSYSARSGGRKQNFKSYSGRSILLTPKPRI  70

Query  560  NSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNN  381
                +  + G D+F S+GK +    +GF  Y                            N
Sbjct  71   QRTSESFSFGEDNFTSFGKGATGQSIGFKVYIDL-------------------------N  105

Query  380  TFKDYA--KTGVTFAGYLNATD-----VTAAVGAAKGKMVNNKRWVEPGKFFREKMLKSG  222
             FK+Y   K GVTFA Y N T       T    AA G  V  KR VEPGKFFRE ML +G
Sbjct  106  QFKEYTKDKKGVTFATY-NITHKKSAAATTTSMAASGSFV--KRIVEPGKFFRESMLNTG  162

Query  221  TIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            ++MPMPDIRDKM KRSFLPR I+++LPFS++++ EL+KIFHA +GSA   MI  T
Sbjct  163  SVMPMPDIRDKMAKRSFLPRAISSKLPFSSSKMAELKKIFHAGDGSATENMIVDT  217



>ref|XP_010046646.1| PREDICTED: BURP domain-containing protein 16-like [Eucalyptus 
grandis]
Length=538

 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -1

Query  266  VEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEG  87
            VE G FFRE MLKSG +MPMPDIRD +PKRSFLPR I+AELPFS +++ EL++IFHA+E 
Sbjct  143  VEKGLFFRESMLKSGNVMPMPDIRDNLPKRSFLPRCISAELPFSTSKLAELKQIFHAIEN  202

Query  86   SAMAKMIAGTLAECERAPSRDETKRCV  6
            SAM K++A TL ECE A  +DETKRCV
Sbjct  203  SAMGKIMAQTLGECEGAALQDETKRCV  229


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = -1

Query  284  VNNKRWVEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELE  111
            +N  R +EPGK+FRE ML+SG ++ MPD+R K P+RSFLPR+I++ LPFS +++ EL+
Sbjct  481  MNVNRGLEPGKYFRESMLRSGNMIRMPDLRVKAPQRSFLPRSISSGLPFSTSKLAELK  538



>gb|KCW86729.1| hypothetical protein EUGRSUZ_B03340 [Eucalyptus grandis]
Length=256

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (71%), Gaps = 2/112 (2%)
 Frame = -1

Query  341  GYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPR  162
             Y+     T  + A   K VN    VE G FFRE MLKSG +MPMPD+RD +PKRSFLPR
Sbjct  12   AYVYGLSPTDTIVATDDKKVNGG--VEQGLFFRESMLKSGNVMPMPDMRDNLPKRSFLPR  69

Query  161  NIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTLAECERAPSRDETKRCV  6
             I++ELPFS +++ EL++IF A+E SAM K++A TL ECE A  +DE+KRCV
Sbjct  70   CISSELPFSTSKLAELKQIFRAIENSAMGKIMAQTLGECEGAGVQDESKRCV  121



>gb|KCW86722.1| hypothetical protein EUGRSUZ_B03333 [Eucalyptus grandis]
Length=249

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  266  VEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEG  87
            VE G+FFRE MLKSG +MPMPD+RD +PKRSFLPR I++ELPFS +++ EL++IFHA+E 
Sbjct  31   VEQGEFFRESMLKSGNVMPMPDLRDNLPKRSFLPRRISSELPFSTSKLAELKQIFHAIEN  90

Query  86   SAMAKMIAGTLAECERAPSRDETKRCV  6
            S M K++A TL++ E A  +DE KRCV
Sbjct  91   STMEKIMAQTLSQWEGAALQDEIKRCV  117



>ref|XP_010046642.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=367

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -1

Query  266  VEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEG  87
            VE G FFRE MLKSG +MPMPDIRD +P+RSFLPR I++E+PFS +++ EL++IFHA E 
Sbjct  146  VEEGAFFRESMLKSGNVMPMPDIRDNLPRRSFLPRGISSEMPFSTSKLAELKQIFHATEN  205

Query  86   SAMAKMIAGTLAECERAPSRDETKRCV  6
            SAM K++A  L +CE A  +DETKRCV
Sbjct  206  SAMEKIMAQILGQCEVAALQDETKRCV  232



>gb|KCW86730.1| hypothetical protein EUGRSUZ_B03341 [Eucalyptus grandis]
Length=272

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  266  VEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEG  87
            VE G FFRE MLKSG +MPMPD+RD +PKRSFLPR I++ELPFS +++ EL++IF A+E 
Sbjct  51   VERGLFFRESMLKSGNVMPMPDMRDNLPKRSFLPRCISSELPFSTSKLAELKQIFRAIEN  110

Query  86   SAMAKMIAGTLAECERAPSRDETKRCV  6
            SA+ K++A TL ECE A  +DETKRCV
Sbjct  111  SAVGKIMAQTLGECEGAGVQDETKRCV  137



>ref|XP_010046648.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=383

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  266  VEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEG  87
            VE G FFRE MLKSG +MPMPD+RD +PKRSFLPR I++ELPFS +++ EL++IF A+E 
Sbjct  162  VERGLFFRESMLKSGNVMPMPDMRDNLPKRSFLPRCISSELPFSTSKLAELKQIFRAIEN  221

Query  86   SAMAKMIAGTLAECERAPSRDETKRCV  6
            SA+ K++A TL ECE A  +DETKRCV
Sbjct  222  SAVGKIMAQTLGECEGAGVQDETKRCV  248



>ref|XP_006661124.1| PREDICTED: LOW QUALITY PROTEIN: BURP domain-containing protein 
14-like [Oryza brachyantha]
Length=505

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 99/171 (58%), Gaps = 13/171 (8%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK  NGAA  F +YGN+SN + + F NYG+  NG ADTF+SY  NGN P+NTFK+YG  
Sbjct  244  YGKTANGAAESFKTYGNHSNSIASGFLNYGDRANGAADTFSSYGVNGNTPENTFKSYGTD  303

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY-------  426
             N  VD F  YR ++NVG DSF SY   +N A  GF +YGK+ N G+  F GY       
Sbjct  304  SNAGVDDFKGYRDDANVGNDSFTSYASNANGAAAGFESYGKSVNPGSVTFKGYGLAPTPG  363

Query  425  -SDSDRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTA----AVGAAKG  291
             + + R+ F  Y G N TFK Y+  GV F  Y N + +      AVG   G
Sbjct  364  SNPTHRIGFTRYSGDNTTFKAYSNDGVEFKEYQNMSKLEVSKLEAVGGGAG  414


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 65/147 (44%), Gaps = 20/147 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK   G    FTSY    NV    F +Y     G A  F++YA   N    +F NY   
Sbjct  160  YGKGSQGRNDSFTSYEAGGNVGTANFTSYNSGATGGAGGFSTYAGETNTASVSFANYDHD  219

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGK--------------KSNAADVGFVNYGKTFNGG  447
            GNG    F +Y Q++N G +SF +YGK               SN+   GF+NYG   NG 
Sbjct  220  GNGRSREFAAYTQDANTGEESFAAYGKTANGAAESFKTYGNHSNSIASGFLNYGDRANGA  279

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDY  366
             D FS Y        NG    NTFK Y
Sbjct  280  ADTFSSY------GVNGNTPENTFKSY  300


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 73/169 (43%), Gaps = 26/169 (15%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y     G A GF++Y   +N    +F NY   GNG +  F +Y  + N  + +F  YG  
Sbjct  188  YNSGATGGAGGFSTYAGETNTASVSFANYDHDGNGRSREFAAYTQDANTGEESFAAYGKT  247

Query  584  GNGPVDTFNSYRQESNV--------------GADSFNSYGKKSNAADVGFVNYGKTFNGG  447
             NG  ++F +Y   SN                AD+F+SYG   N  +  F +YG   N G
Sbjct  248  ANGAAESFKTYGNHSNSIASGFLNYGDRANGAADTFSSYGVNGNTPENTFKSYGTDSNAG  307

Query  446  TDKFSGYSDSDRV---SFNGY-----GVNNTFKDYAKT----GVTFAGY  336
             D F GY D   V   SF  Y     G    F+ Y K+     VTF GY
Sbjct  308  VDDFKGYRDDANVGNDSFTSYASNANGAAAGFESYGKSVNPGSVTFKGY  356



>ref|XP_010044627.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010044628.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
isoform X2 [Eucalyptus grandis]
Length=372

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -1

Query  266  VEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEG  87
            +E G FFRE MLKSG +MPMPD+RD  PK SFLPR I+++LPFS +++ EL++IFHA+E 
Sbjct  152  MEQGLFFRESMLKSGNVMPMPDLRDNFPKTSFLPRRISSKLPFSTSKLAELKQIFHAIEN  211

Query  86   SAMAKMIAGTLAECERAPSRDETKRCV  6
            S M K++A TL  CE A  +DETKRCV
Sbjct  212  STMEKIMAQTLGLCEGAALQDETKRCV  238



>gb|AEN81139.1| AT1G60390-like protein, partial [Capsella grandiflora]
Length=171

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV+ + F  YGE+GNG  D+FTSY  NGN P N FK YG G
Sbjct  51   YSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNGNVPVNDFKGYGDG  110

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY  426
            GNG V  F +YR +SN+G DSF+SY K SN   V FVNYGK+FN G+D F+GY
Sbjct  111  GNGAVYGFKNYRDQSNIGVDSFSSYAKNSNXEKVNFVNYGKSFNLGSDNFTGY  163



>gb|AEN81134.1| AT1G60390-like protein, partial [Capsella grandiflora]
 gb|AEN81135.1| AT1G60390-like protein, partial [Capsella grandiflora]
 gb|AEN81142.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81143.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81144.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81145.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81146.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81147.1| AT1G60390-like protein, partial [Capsella rubella]
Length=171

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV+ + F  YGE+GNG  D+FTSY  NGN P N FK YG G
Sbjct  51   YSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNGNVPVNDFKGYGDG  110

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY  426
            GNG V  F +YR +SN+G DSF+SY K SN   V FVNYGK+FN G+D F+GY
Sbjct  111  GNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSFNLGSDNFTGY  163



>gb|AEN81136.1| AT1G60390-like protein, partial [Capsella grandiflora]
Length=171

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV+ + F  YGE+GNG  D+FTSY  NGN P N FK YG G
Sbjct  51   YSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNGNVPVNDFKGYGDG  110

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY  426
            GNG V  F +YR +SN+G DSF+SY K SN   V FVNYGK+FN G+D F+GY
Sbjct  111  GNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSFNLGSDNFTGY  163



>gb|AEN81138.1| AT1G60390-like protein, partial [Capsella grandiflora]
Length=171

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV+ + F  YGE+GNG  D+FTSY  N N P N FK YG G
Sbjct  51   YSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNXNVPVNDFKGYGXG  110

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY  426
            GNG V  F +YR +SN+G DSF+SY K SN   V FVNYGK+FN G+D F+GY
Sbjct  111  GNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSFNLGSDNFTGY  163



>gb|AEN81137.1| AT1G60390-like protein, partial [Capsella grandiflora]
Length=171

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV+ + F  YGE+GNG  D+FTSY  N N P N FK YG G
Sbjct  51   YSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNXNVPVNDFKGYGXG  110

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY  426
            GNG V  F +YR +SN+G DSF+SY K SN   V FVNYGK+FN G+D F+GY
Sbjct  111  GNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFVNYGKSFNLGSDNFTGY  163



>ref|XP_010044626.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
 gb|KCW86719.1| hypothetical protein EUGRSUZ_B03326 [Eucalyptus grandis]
Length=364

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 83/121 (69%), Gaps = 9/121 (7%)
 Frame = -1

Query  362  KTGVTFAGYLN-ATDVTAAVGAAKGKMVNNKRWVEPGKFFREKMLKSGTIMPMPDIRDKM  186
            K G  F  ++N AT +   +   KG        VEPGK+F+E ML+SG ++ MPD+R K 
Sbjct  119  KDGRVFYDFINGATTLAGGMNVNKG--------VEPGKYFQESMLRSGNVIRMPDLRSKT  170

Query  185  PKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTLAECERAPSRDETKRCV  6
            P+RSFLPR+I++ LPFS +++ EL++IFHA + S M K++  TL+ CE+AP R ETKRCV
Sbjct  171  PERSFLPRSISSGLPFSTSKLAELKQIFHAGDDSTMEKIMVRTLSLCEKAPIRGETKRCV  230

Query  5    T  3
            +
Sbjct  231  S  231



>gb|EMS64687.1| hypothetical protein TRIUR3_01269 [Triticum urartu]
Length=487

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 97/180 (54%), Gaps = 5/180 (3%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG+  N     F SYGN++N + +AF NYG+  N   DTF SY  NGN P NTF++Y +G
Sbjct  208  YGRTANSVGESFNSYGNHTNSIMSAFINYGDKANSATDTFDSYGLNGNTPQNTFRSYSSG  267

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGYSD----S  417
             NG  D F  YR  +NVG DSF +Y   +N A   F +YGK+ N G+  F GY      +
Sbjct  268  SNGGADDFKGYRDNANVGDDSFTAYANDANGATADFQSYGKSVNPGSVGFKGYGQGANPN  327

Query  416  DRVSFNGY-GVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
             R+ F  Y G N TFK Y+  GV F  Y N + +  +  AA   + ++     P K+  E
Sbjct  328  HRIGFTRYTGDNTTFKAYSNEGVEFKEYQNMSRMEVSKVAANLSLSSSGNHRPPPKWSPE  387


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 62/148 (42%), Gaps = 20/148 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGK   G    F +Y    NV   +F +Y     G A  F  Y    N    TF NY   
Sbjct  124  YGKGSLGRNDSFATYQALGNVGTASFNSYTAGATGGAGKFAEYDGETNTVAVTFANYDVA  183

Query  584  GNGPVDTFNSYRQESNVGA--------------DSFNSYGKKSNAADVGFVNYGKTFNGG  447
            GNG    F++Y Q++N G               +SFNSYG  +N+    F+NYG   N  
Sbjct  184  GNGRSRDFSAYTQDANSGVESFTGYGRTANSVGESFNSYGNHTNSIMSAFINYGDKANSA  243

Query  446  TDKFSGYSDSDRVSFNGYGVNNTFKDYA  363
            TD F  Y        NG    NTF+ Y+
Sbjct  244  TDTFDSY------GLNGNTPQNTFRSYS  265


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 75/169 (44%), Gaps = 26/169 (15%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y     G A  F  Y   +N +   F NY  +GNG +  F++Y  + N+   +F  YG  
Sbjct  152  YTAGATGGAGKFAEYDGETNTVAVTFANYDVAGNGRSRDFSAYTQDANSGVESFTGYGRT  211

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYG-------KTF-------NGG  447
             N   ++FNSY   +N    +F +YG K+N+A   F +YG        TF       NGG
Sbjct  212  ANSVGESFNSYGNHTNSIMSAFINYGDKANSATDTFDSYGLNGNTPQNTFRSYSSGSNGG  271

Query  446  TDKFSGYSDSDRV---SFNGY-----GVNNTFKDYAKT----GVTFAGY  336
             D F GY D+  V   SF  Y     G    F+ Y K+     V F GY
Sbjct  272  ADDFKGYRDNANVGDDSFTAYANDANGATADFQSYGKSVNPGSVGFKGY  320



>gb|AEN81140.1| AT1G60390-like protein, partial [Capsella rubella]
 gb|AEN81141.1| AT1G60390-like protein, partial [Capsella rubella]
Length=171

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KNGNGA   F+ YG  SNV+ + F  YGE+GNG  D+FTSY  NGN P N FK YG G
Sbjct  51   YSKNGNGAPNDFSGYGTGSNVVKSGFTKYGENGNGANDSFTSYGGNGNVPVNDFKGYGDG  110

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY  426
            GNG V  F +YR +SN+G DSF+SY K SN   V F+NY K+FN G+D F+GY
Sbjct  111  GNGAVYGFKNYRDQSNIGVDSFSSYAKNSNNEKVNFINYSKSFNLGSDNFTGY  163



>gb|KCW86720.1| hypothetical protein EUGRSUZ_B03328 [Eucalyptus grandis]
Length=212

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = -1

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            MLKSG +MPMPDIRD +P+RSFLPR I++E+PFS +++ EL++IFHA E SAM K++A  
Sbjct  1    MLKSGNVMPMPDIRDNLPRRSFLPRGISSEMPFSTSKLAELKQIFHATENSAMEKIMAQI  60

Query  56   LAECERAPSRDETKRCV  6
            L +CE A  +DETKRCV
Sbjct  61   LGQCEVAALQDETKRCV  77



>ref|XP_010046641.1| PREDICTED: polygalacturonase non-catalytic subunit AroGP2-like 
[Eucalyptus grandis]
Length=364

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 82/121 (68%), Gaps = 9/121 (7%)
 Frame = -1

Query  362  KTGVTFAGYLN-ATDVTAAVGAAKGKMVNNKRWVEPGKFFREKMLKSGTIMPMPDIRDKM  186
            K G  F  ++N AT +   +   KG        VEPGK+F+E  L+SG ++ MPD+R K 
Sbjct  119  KDGRVFYDFINGATTLVGGMNVNKG--------VEPGKYFQESTLRSGNVIHMPDLRSKT  170

Query  185  PKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTLAECERAPSRDETKRCV  6
            P+RSFLPR+I++ LPFS +++ EL++IFHA + S M K++  TL+ CE+AP R ETKRCV
Sbjct  171  PERSFLPRSISSGLPFSTSKLAELKQIFHAGDDSTMEKIMVRTLSLCEKAPIRGETKRCV  230

Query  5    T  3
            +
Sbjct  231  S  231



>ref|XP_010044635.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP630 
[Eucalyptus grandis]
Length=358

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -1

Query  284  VNNKRWVEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKI  105
            +N  R VEPGK+FRE ML+SG ++ MPD+R K PKRSFLPR+I++ L FS +++ EL++I
Sbjct  132  MNLNRGVEPGKYFRESMLRSGNMIRMPDLRVKAPKRSFLPRSISSGLLFSTSKLAELKQI  191

Query  104  FHAVEGSAMAKMIAGTLAECERAPSRDETKRCVT  3
            FHA + S M K++  TL +CE+AP + ETKRCV+
Sbjct  192  FHAGDDSNMEKIMVRTLNQCEQAPIQGETKRCVS  225



>gb|KCW86721.1| hypothetical protein EUGRSUZ_B03330 [Eucalyptus grandis]
Length=227

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = -1

Query  284  VNNKRWVEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKI  105
            +N  + VEPG++FRE  L+SG ++ MPD+R K P+RSFLPR+I++ LP   ++I EL++I
Sbjct  1    MNVNKGVEPGRYFRESTLRSGNVIQMPDLRSKTPERSFLPRSISSGLPSLTSKIAELKQI  60

Query  104  FHAVEGSAMAKMIAGTLAECERAPSRDETKRCVT  3
            FHA + S M K++  TL  CE+AP++ ETKRCV+
Sbjct  61   FHARDDSTMEKIMVRTLGLCEKAPTQGETKRCVS  94



>ref|XP_010046644.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=283

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 80/121 (66%), Gaps = 9/121 (7%)
 Frame = -1

Query  362  KTGVTFAGYLN-ATDVTAAVGAAKGKMVNNKRWVEPGKFFREKMLKSGTIMPMPDIRDKM  186
            K G  F  ++N AT +   +   KG        VEPG++FRE  L+SG ++ MPD+R K 
Sbjct  38   KDGRVFYNFINGATTLAGGMNVNKG--------VEPGRYFRESTLRSGNVIQMPDLRSKT  89

Query  185  PKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTLAECERAPSRDETKRCV  6
            P+RSFLPR+I++ LP   ++I EL++IFHA + S M K++  TL  CE+AP++ ETKRCV
Sbjct  90   PERSFLPRSISSGLPSLTSKIAELKQIFHARDDSTMEKIMVRTLGLCEKAPTQGETKRCV  149

Query  5    T  3
            +
Sbjct  150  S  150



>gb|KCW86727.1| hypothetical protein EUGRSUZ_B03337 [Eucalyptus grandis]
Length=212

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = -1

Query  284  VNNKRWVEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKI  105
            +N  + VEPGK+FR   L+SG ++ MPD+R K P+RSFLPR+I++ LPFS ++I EL++I
Sbjct  1    MNVNKGVEPGKYFRHSTLRSGNVIRMPDLRSKTPERSFLPRSISSGLPFSTSKIAELKQI  60

Query  104  FHAVEGSAMAKMIAGTLAECERAPSRDETKR  12
            FHA++ S M +++  TL  CE+AP++ ETKR
Sbjct  61   FHAMDDSTMEEIMVRTLGLCEKAPTQGETKR  91



>ref|XP_008348846.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650 
[Malus domestica]
Length=154

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 75/115 (65%), Gaps = 3/115 (3%)
 Frame = -1

Query  695  TAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFN  516
            + F  YG+SGN   D F++Y  + NN  N F++YG GGN  V+TF SYR+ +NVG DSF 
Sbjct  5    SGFTGYGQSGNEANDKFSNYGNDQNNSANNFQSYGDGGNAGVETFTSYRESANVGDDSFQ  64

Query  515  SYGKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDR---VSFNGYGVNNTFKDYAK  360
            SY K SN   + F +YGK+FN G+D F+GY    +   + F  YG+N TFKDYAK
Sbjct  65   SYAKNSNGEKMDFTSYGKSFNIGSDTFTGYRKGAKGQDIEFKIYGMNTTFKDYAK  119



>ref|XP_010030785.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=132

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 75/135 (56%), Gaps = 26/135 (19%)
 Frame = -1

Query  419  SDRVSFNGYGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFRE  240
            S + SFN +  N+TFK+Y+K                    +KG+       +EP  FFRE
Sbjct  24   SKQKSFNEH--NDTFKEYSK-------------------GSKGQTT-----IEPDIFFRE  57

Query  239  KMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAG  60
              L+ GT+M M +I DKMP+ SFLPR   ++L FS   + E++++F   EGSA   +I  
Sbjct  58   FELRPGTVMQMLNIVDKMPRMSFLPRVNPSKLLFSTQRLQEVKELFVVQEGSATEHVILN  117

Query  59   TLAECERAPSRDETK  15
            TL EC+R PSR ETK
Sbjct  118  TLCECKRPPSRGETK  132



>ref|XP_006586545.1| PREDICTED: probable polygalacturonase non-catalytic subunit JP650-like 
[Glycine max]
Length=411

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 78/150 (52%), Gaps = 21/150 (14%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YGKN   AA  F  YG NSNV   AF NYG                 N P+ TFK+Y   
Sbjct  218  YGKNSADAANSFAGYGTNSNVATLAFINYG--------------VEMNVPEVTFKSYAVR  263

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNA-ADVGFVNYGKTFNGGTDKFSGYSD----  420
             +   ++F +YR ++N+  DSF SY K +     + F NYG +FN G+D F GY+     
Sbjct  264  THASTESFANYRDQANIADDSFQSYAKNTKERTKLDFKNYGNSFNPGSDTFKGYAKGAEG  323

Query  419  SDRVSFNGYGVNN--TFKDYAKTGVTFAGY  336
              +V F  Y VN   TFKDYAK GV+FA Y
Sbjct  324  DHKVGFTTYNVNTNATFKDYAKQGVSFASY  353



>ref|XP_010046643.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=211

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -1

Query  236  MLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGT  57
            ML+SG ++ + ++R K PKR FLPR+I++ LPFS ++  EL++IFHA + S M K++  T
Sbjct  1    MLRSGNMIRILNLRVKAPKRLFLPRSISSGLPFSISKFAELKQIFHAGDDSNMEKIMVRT  60

Query  56   LAECERAPSRDETKRCVT  3
            L++CE+AP + ETKRCV+
Sbjct  61   LSQCEQAPIQGETKRCVS  78



>gb|KCW86724.1| hypothetical protein EUGRSUZ_B03335 [Eucalyptus grandis]
Length=207

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 60/94 (64%), Gaps = 20/94 (21%)
 Frame = -1

Query  284  VNNKRWVEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKI  105
            +N  R +EPGK+FRE ML+SG ++ MPD+R K P+RSFLPR+I++ LPFS +++ EL   
Sbjct  1    MNVNRGLEPGKYFRESMLRSGNMIRMPDLRVKAPQRSFLPRSISSGLPFSTSKLAELN--  58

Query  104  FHAVEGSAMAKMIAGTLAECERAPSRDETKRCVT  3
                              +CE+AP + ETKRCV+
Sbjct  59   ------------------QCEQAPIQGETKRCVS  74



>gb|KHN27019.1| Putative polygalacturonase non-catalytic subunit [Glycine soja]
Length=253

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 66/115 (57%), Gaps = 1/115 (1%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y KN  G+   FT YG NSNV    F NYG+      +TFT+Y    N P+  FK+Y  G
Sbjct  47   YRKNFVGSGNEFTGYGTNSNVATLGFTNYGKGDASPNNTFTNYDMEMNVPEVMFKSYTDG  106

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKS-NAADVGFVNYGKTFNGGTDKFSGYS  423
             +G   +F +YR ++NVG DSF SY K +     V F NYG +FN G++ F GY+
Sbjct  107  THGGTKSFVNYRDQANVGDDSFQSYAKNTKEGTQVDFKNYGNSFNPGSNTFKGYA  161


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 56/119 (47%), Gaps = 9/119 (8%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F++Y ++  G  + FT Y  N N     F NYG G   P +TF +Y  E NV    F SY
Sbjct  44   FQSYRKNFVGSGNEFTGYGTNSNVATLGFTNYGKGDASPNNTFTNYDMEMNVPEVMFKSY  103

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYS----DSDRVSFNGYGV-----NNTFKDYAK  360
               ++     FVNY    N G D F  Y+    +  +V F  YG      +NTFK YAK
Sbjct  104  TDGTHGGTKSFVNYRDQANVGDDSFQSYAKNTKEGTQVDFKNYGNSFNPGSNTFKGYAK  162



>ref|XP_010030786.1| PREDICTED: polygalacturonase-1 non-catalytic subunit beta-like 
[Eucalyptus grandis]
Length=98

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -1

Query  266  VEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEG  87
            +EPG FFRE  L+ GT+M M +  DKMP RSFLPR   ++LPFS   + E++++F   EG
Sbjct  15   IEPGIFFREFELRLGTVMQMLNNVDKMPWRSFLPRVNPSKLPFSTQRLREVKELFAVQEG  74

Query  86   SAMAKMIAGTLAECERAPSRDETK  15
            S    +I   L EC+R PSR E K
Sbjct  75   SDTEHVILNALCECKRPPSRGEMK  98



>ref|XP_003610589.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES92786.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=190

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 15/70 (21%)
 Frame = -1

Query  215  MPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTLAECERA  36
            MPMPDIRDK+PKRSFLP++I A+LPFS ++I E++                 +L ECER 
Sbjct  1    MPMPDIRDKLPKRSFLPQSILAKLPFSTSKIDEMK---------------GDSLGECERV  45

Query  35   PSRDETKRCV  6
            P+R ETK+CV
Sbjct  46   PARGETKKCV  55



>ref|NP_001064572.1| Os10g0409400 [Oryza sativa Japonica Group]
 sp|Q7XES5.1|BURPG_ORYSJ RecName: Full=BURP domain-containing protein 16; Short=OsBURP16; 
AltName: Full=Protein WGP1; Short=OsWGP1; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAP53713.1| BURP domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26486.1| Os10g0409400 [Oryza sativa Japonica Group]
 gb|EAZ16044.1| hypothetical protein OsJ_31485 [Oryza sativa Japonica Group]
 gb|ABR23532.1| cell wall protein WGP1 [Oryza sativa Japonica Group]
 dbj|BAG99870.1| unnamed protein product [Oryza sativa Japonica Group]
Length=344

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 59/90 (66%), Gaps = 5/90 (6%)
 Frame = -1

Query  266  VEPGKFFREKMLKSGTIMPMPDIRDKM--PKRSFLPRNIAAELPFSAAEIGELEKIFHAV  93
            ++PG FFRE+ LK G ++ MPDI +++   + SFLPR+IA  +PF A  +  L   F   
Sbjct  123  IKPGIFFREQELKEGNVVRMPDIANELTTARSSFLPRSIADRIPFKAEAVKSL---FGLE  179

Query  92   EGSAMAKMIAGTLAECERAPSRDETKRCVT  3
              + +AK +  T+A+C+ +PS+ ETKRCVT
Sbjct  180  PNTTLAKAVDETVAQCQSSPSKGETKRCVT  209



>ref|XP_002525381.1| Polygalacturonase non-catalytic subunit AroGP2 precursor, putative 
[Ricinus communis]
 gb|EEF37019.1| Polygalacturonase non-catalytic subunit AroGP2 precursor, putative 
[Ricinus communis]
Length=531

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 104/239 (44%), Gaps = 53/239 (22%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y  + N A T F +YG  +   +  FK Y E  N     FTSYA +    + TF +Y   
Sbjct  177  YAPDANLAMTTFNTYGTGATGGEGEFKKYNERVNFQNIRFTSYADDSKGREYTFSSYVES  236

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGTDKFSGY-------  426
             N  V+ F+SY +  +  A+ F+ Y   S  AD  F +YG+  +  TD +  Y       
Sbjct  237  VNLGVEWFSSYGKNRDGDANEFDRYDVGSGLADSNFTSYGENGHEDTDTYKNYGLDGNQN  296

Query  425  SDSDRV-----------SFNGYGVN--------NTFKD--------YAKTGVTFAGYLNA  327
            S  + V           +F GYG          NT++D        YAK GVTFA Y  +
Sbjct  297  SKKENVKFASYFGIIGNNFTGYGEGAKEQTVGFNTYRDEGLTNFNNYAKKGVTFAKYNVS  356

Query  326  TDVTAAVGAAKGKMVNNKRWVEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAA  150
             ++T A            +WVEPGKFFRE MLK G        +++ P R    R + +
Sbjct  357  ANLTVA-----------NKWVEPGKFFRESMLKEG--------QERAPSRGETKRCVVS  396



>gb|AES96108.2| BURP domain protein [Medicago truncatula]
Length=382

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = -1

Query  275  KRWVEPGK--FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELP-FSAAEIGELEKI  105
            ++W +  K  FFREKML  G +M M DIRDK+ KR FL   I A+LP  +   +  L++ 
Sbjct  156  RKWAKWAKSLFFREKMLNEGVVMQMTDIRDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQF  215

Query  104  FHAVEGSAMAKMIAGTLAECERAPSRDETKRCV  6
            F   +  A  K +  TL  CERAP+R ET +CV
Sbjct  216  FRISDNGATEKRMKETLENCERAPARGETIKCV  248



>ref|XP_003613150.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
Length=413

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = -1

Query  275  KRWVEPGK--FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELP-FSAAEIGELEKI  105
            ++W +  K  FFREKML  G +M M DIRDK+ KR FL   I A+LP  +   +  L++ 
Sbjct  187  RKWAKWAKSLFFREKMLNEGVVMQMTDIRDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQF  246

Query  104  FHAVEGSAMAKMIAGTLAECERAPSRDETKRCV  6
            F   +  A  K +  TL  CERAP+R ET +CV
Sbjct  247  FRISDNGATEKRMKETLENCERAPARGETIKCV  279


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = -1

Query  215  MPMPDIRDKMPKRSFLPRNIAAELP-FSAAEIGELEKIFHAVEGSAMAKMIAGTLAECER  39
            M M DIRDK+ KR FL   I A+LP  +   +  L++ F   +  A  K +  TL  CER
Sbjct  1    MQMTDIRDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQFFRISDNGATEKRMKETLENCER  60

Query  38   APSRDETKRCV  6
            AP+R ET +CV
Sbjct  61   APARGETIKCV  71



>dbj|BAF01101.1| hypothetical protein [Arabidopsis thaliana]
Length=165

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 67/120 (56%), Gaps = 4/120 (3%)
 Frame = +1

Query  7    THRLVSSLLGARSHSANVPAIILAMAEPSTAWKIFSSSPISAAENGSSAAIFRGKNDLFg  186
            THR VS  LG  SHS     II  + E STAWKI   SP    E GS   I RGKNDL G
Sbjct  50   THRFVSPTLGGLSHSVTASVIIPPIVEFSTAWKILLISPSLEVEKGSFVIILRGKNDLLG  109

Query  187  ilsrisgigiiVPLFNIFSRKNFPGSTHLLLFTILPLAAPTAAVTSVAFR*PANVTPVLA  366
            ILS ISGIGI VP  +  S KN PGS H  LFT+LP  +PT     V     A  TP LA
Sbjct  110  ILSLISGIGITVPSLSDDSLKNLPGSIH--LFTVLP--SPTVFAVVVETLYLAKATPFLA  165



>ref|XP_003613149.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96107.1| BURP domain protein [Medicago truncatula]
Length=621

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = -1

Query  275  KRWVEPGK--FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELP-FSAAEIGELEKI  105
            ++W +  K  FFREKML  G +M M DIRDK+ KR FL   I A+LP  +   +  L++ 
Sbjct  187  RKWAKWAKSLFFREKMLNEGVVMQMTDIRDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQF  246

Query  104  FHAVEGSAMAKMIAGTLAECERAPSRDETKRCV  6
            F   +  A  K +  TL  CERAP+R ET +CV
Sbjct  247  FRISDNGATEKRMKETLENCERAPARGETIKCV  279


 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = -1

Query  275  KRWVEPGK--FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELP-FSAAEIGELEKI  105
            ++W +  K  FFREKML  G +M M DIRDK+ KR FL   I A+LP  +   +  L++ 
Sbjct  395  RKWAKWAKSLFFREKMLNEGVVMQMTDIRDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQF  454

Query  104  FHAVEGSAMAKMIAGTLAECERAPSRDETKRCV  6
            F   +  A  K +  TL  CERAP+R ET +CV
Sbjct  455  FRISDNGATEKRMKETLENCERAPARGETIKCV  487


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = -1

Query  215  MPMPDIRDKMPKRSFLPRNIAAELP-FSAAEIGELEKIFHAVEGSAMAKMIAGTLAECER  39
            M M DIRDK+ KR FL   I A+LP  +   +  L++ F   +  A  K +  TL  CER
Sbjct  1    MQMTDIRDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQFFRISDNGATEKRMKETLENCER  60

Query  38   APSRDETKRCV  6
            AP+R E  +CV
Sbjct  61   APARGEIIKCV  71



>emb|CDP10830.1| unnamed protein product [Coffea canephora]
Length=336

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = -1

Query  266  VEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIF-HAVE  90
            V+P  F R  +LK G+++ +PD+ +++P+ SFLP  IA+++  S AE  +L+K+F  +++
Sbjct  118  VDPSSFLRISLLKQGSMVHLPDLENQLPQHSFLPSQIASKI--SIAE-NDLQKLFPQSLK  174

Query  89   GSAMAKMIAGTLAECERAPSRDETKRCV  6
                   I  T+  C     +DE + CV
Sbjct  175  NPQTKDAIQSTIVYCNTPALKDEIQSCV  202



>gb|EEC77314.1| hypothetical protein OsI_15976 [Oryza sativa Indica Group]
Length=202

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = -1

Query  209  MPDIR-DKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTLAECERAP  33
            MPDI  +    RSFLPR+IA  +PF A  +  L   F     + +AK +  T+A+C+ +P
Sbjct  1    MPDITNESTTARSFLPRSIADRIPFEAEAVKPL---FGLEPNTTLAKAVDETVAQCQSSP  57

Query  32   SRDETKRCVT  3
            S+ ETKRCVT
Sbjct  58   SKGETKRCVT  67



>emb|CDP10831.1| unnamed protein product [Coffea canephora]
Length=238

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = -1

Query  266  VEPGKFFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIF-HAVE  90
            V+P  FF   +LK G++M + ++ +++P+ SFLP  IA++  FS  E  +L+K+F  +++
Sbjct  20   VDPSSFFEISLLKQGSMMHLSNLENQLPQHSFLPSQIASK--FSVVE-NDLQKLFPQSLK  76

Query  89   GSAMAKMIAGTLAECERAPSRDETKRCV  6
                   I  TL  C   P ++E + CV
Sbjct  77   NPRTKDAIQSTLIYCNTPPLKEEIQSCV  104



>gb|AAN60310.1| unknown [Arabidopsis thaliana]
Length=226

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y +N  G    FT YG NSNV++  F +YG  G G A  FT+Y  N NNP + F  Y  G
Sbjct  156  YSRNAAGHDDKFTVYGENSNVVEEGFNSYGTFGTGGAGDFTNYQNNVNNPTSRFTAYSDG  215

Query  584  GNGPVDTFNSY  552
            GNG   TF +Y
Sbjct  216  GNGRSQTFKTY  226


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 53/108 (49%), Gaps = 6/108 (6%)
 Frame = -1

Query  689  FKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAGGNGPVDTFNSYRQESNVGADSFNSY  510
            F NYG +  G AD+F +Y+ +GN   ++F+ Y     G  D F  Y + SNV  + FNSY
Sbjct  125  FTNYGNARAGGADSFKNYSKDGNVVTDSFRRYSRNAAGHDDKFTVYGENSNVVEEGFNSY  184

Query  509  GKKSNAADVGFVNYGKTFNGGTDKFSGYSDSDRVSFNGYGVNNTFKDY  366
            G         F NY    N  T +F+ YSD       G G + TFK Y
Sbjct  185  GTFGTGGAGDFTNYQNNVNNPTSRFTAYSDG------GNGRSQTFKTY  226



>ref|XP_011074238.1| PREDICTED: BURP domain-containing protein 16-like [Sesamum indicum]
Length=334

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 59/129 (46%), Gaps = 5/129 (4%)
 Frame = -1

Query  395  YGVNNTFKDYAKTGVTFAGYLNATDVTAAVGAAKGKMVNNKRWVEPGKFFREKMLKSGTI  216
            +  ++ F   AK   TFA        T  + +A    V  KR  +P  FFR   LK+G +
Sbjct  76   FSADSHFCSLAKLSCTFATAKYTQQNTYGINSAAVDQV--KRSEDPFSFFRVSTLKTGNL  133

Query  215  MPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAKMIAGTLAECERA  36
            + +P++++ +P R+FLP  I + +P +   I E    F         + I  TLA C  A
Sbjct  134  VHLPNLQETLPDRTFLPPQIVSSIPLTYEGITE---AFPEWGVGPTKETIQTTLAYCNAA  190

Query  35   PSRDETKRC  9
                ETK C
Sbjct  191  AIEGETKSC  199



>emb|CDP18474.1| unnamed protein product [Coffea canephora]
Length=312

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 42/83 (51%), Gaps = 0/83 (0%)
 Frame = -1

Query  251  FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAK  72
            FF EK L  G+ M M  +       +FLPR +A  +PFS+  I E+   F     SA AK
Sbjct  94   FFLEKDLHRGSSMDMQFVESVKSTTAFLPREVADSIPFSSKSIPEILNRFSVNPRSAQAK  153

Query  71   MIAGTLAECERAPSRDETKRCVT  3
             I  T+AECE    + E K C T
Sbjct  154  AIMETIAECEVPAMKGEDKTCAT  176



>ref|XP_009367928.1| PREDICTED: BURP domain-containing protein 3-like [Pyrus x bretschneideri]
Length=406

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = -1

Query  251  FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAK  72
            FF EK ++ GT M +         ++F+PR IA  +PFS+ ++ E+   F    GS  A 
Sbjct  191  FFLEKDMRPGTTMKL-HFTTNSNTQTFVPREIAESIPFSSNKLPEIFNQFSVKSGSVEAD  249

Query  71   MIAGTLAECERAPSRDETKRCVT  3
            +I GT+ ECE    R E K C T
Sbjct  250  IIKGTILECENPAIRGEEKYCAT  272



>ref|XP_003613151.1| Polygalacturonase-1 non-catalytic subunit beta [Medicago truncatula]
 gb|AES96109.1| polygalacturonase non-catalytic protein [Medicago truncatula]
Length=203

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = -1

Query  209  MPDIRDKMPKRSFLPRNIAAELP-FSAAEIGELEKIFHAVEGSAMAKMIAGTLAECERAP  33
            M DI+DK+ KR FL   I A+LP  +   +  L++ F   +  A  K +  TL  CERAP
Sbjct  1    MTDIKDKIHKRQFLSPTIIAKLPSLTTKNMNLLKQFFRISDNGATEKRMKETLENCERAP  60

Query  32   SRDETKRCV  6
            +R ET +CV
Sbjct  61   ARGETIKCV  69



>emb|CBI28514.3| unnamed protein product [Vitis vinifera]
Length=272

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 49/107 (46%), Gaps = 0/107 (0%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            Y ++  G    F +YG   N MD +F  YG         F  Y+   N P+  F +Y + 
Sbjct  153  YSRDSAGHNDNFDNYGPEGNTMDLSFNGYGSGATRGVGEFKKYSEESNVPNVRFNSYSSD  212

Query  584  GNGPVDTFNSYRQESNVGADSFNSYGKKSNAADVGFVNYGKTFNGGT  444
            GN    +F SY  ESN G   F SYGK S  +   F +YG+  N  T
Sbjct  213  GNTRKQSFRSYSTESNAGDQYFTSYGKNSQGSPNEFTSYGENTNETT  259


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 57/129 (44%), Gaps = 16/129 (12%)
 Frame = -1

Query  764  YGKNGNGAATGFTSYGNNSNVMDTAFKNYGESGNGDADTFTSYAFNGNNPDNTFKNYGAG  585
            YG  G+G    F +Y +   V   +F+ Y     G  D F +Y   GN  D +F  YG+G
Sbjct  127  YGTGGHGGTDSFKNYTDYFPV--DSFRRYSRDSAGHNDNFDNYGPEGNTMDLSFNGYGSG  184

Query  584  GNGPVDTFNSYRQESNVG--------------ADSFNSYGKKSNAADVGFVNYGKTFNGG  447
                V  F  Y +ESNV                 SF SY  +SNA D  F +YGK   G 
Sbjct  185  ATRGVGEFKKYSEESNVPNVRFNSYSSDGNTRKQSFRSYSTESNAGDQYFTSYGKNSQGS  244

Query  446  TDKFSGYSD  420
             ++F+ Y +
Sbjct  245  PNEFTSYGE  253



>gb|KHN15367.1| Dehydration-responsive protein RD22 [Glycine soja]
Length=367

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 47/85 (55%), Gaps = 2/85 (2%)
 Frame = -1

Query  251  FFREKMLKSGTIMPMPDIR--DKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAM  78
            FF EK L  GT + +   R        SFLPR++A  +PFS+ ++ E+   F   EGS  
Sbjct  151  FFLEKDLHYGTKLNLHFTRYFTSSVDASFLPRSVADSIPFSSNKVNEVLNKFSIKEGSDE  210

Query  77   AKMIAGTLAECERAPSRDETKRCVT  3
            A+ +  T++ECE    + E KRCVT
Sbjct  211  AQTVKNTISECEVPGIKGEEKRCVT  235



>ref|NP_001238316.1| BURP domain-containing protein precursor [Glycine max]
 gb|ACD49739.1| BURP domain-containing protein [Glycine max]
Length=367

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 47/85 (55%), Gaps = 2/85 (2%)
 Frame = -1

Query  251  FFREKMLKSGTIMPMPDIR--DKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAM  78
            FF EK L  GT + +   R        SFLPR++A  +PFS+ ++ E+   F   EGS  
Sbjct  151  FFLEKDLHYGTKLNLHFTRYFTSSVDASFLPRSVADSIPFSSNKVNEVLNKFSIKEGSDE  210

Query  77   AKMIAGTLAECERAPSRDETKRCVT  3
            A+ +  T++ECE    + E KRCVT
Sbjct  211  AQTVKNTISECEVPGIKGEEKRCVT  235



>gb|ACU20207.1| unknown [Glycine max]
Length=367

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 47/85 (55%), Gaps = 2/85 (2%)
 Frame = -1

Query  251  FFREKMLKSGTIMPMPDIR--DKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAM  78
            FF EK L  GT + +   R        SFLPR++A  +PFS+ ++ E+   F   EGS  
Sbjct  151  FFLEKDLHYGTKLNLHFTRYFTSSVDASFLPRSVADSIPFSSNKVNEVLNKFSIKEGSDE  210

Query  77   AKMIAGTLAECERAPSRDETKRCVT  3
            A+ +  T++ECE    + E KRCVT
Sbjct  211  AQTVKNTISECEVPGIKGEEKRCVT  235



>ref|XP_009338715.1| PREDICTED: BURP domain-containing protein 3-like isoform X1 [Pyrus 
x bretschneideri]
Length=406

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (52%), Gaps = 1/83 (1%)
 Frame = -1

Query  251  FFREKMLKSGTIMPMPDIRDKMPKRSFLPRNIAAELPFSAAEIGELEKIFHAVEGSAMAK  72
            FF EK ++ GT M +         ++F+PR  A  +PFS+ ++ E+   F    GS  A 
Sbjct  191  FFLEKDMRPGTTMKL-HFTTNSKTQTFVPRETAESIPFSSNKLPEIFNQFSVKSGSVEAD  249

Query  71   MIAGTLAECERAPSRDETKRCVT  3
            +I GT+ ECE    R E K C T
Sbjct  250  IIKGTILECENPAIRGEEKYCAT  272



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1359111752208