BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17335_g1_i1 len=976 path=[954:0-975]

Length=976
                                                                      Score     E

ref|XP_004230770.1|  PREDICTED: U-box domain-containing protein 2...    428   4e-145   
ref|XP_006346399.1|  PREDICTED: U-box domain-containing protein 2...    427   8e-145   
ref|XP_009627648.1|  PREDICTED: U-box domain-containing protein 2...    411   2e-138   
gb|KDP32265.1|  hypothetical protein JCGZ_14786                         400   2e-134   
ref|XP_009792112.1|  PREDICTED: U-box domain-containing protein 2...    399   9e-134   
ref|XP_011092561.1|  PREDICTED: U-box domain-containing protein 2...    398   2e-133   
ref|XP_010107920.1|  U-box domain-containing protein 26                 395   3e-132   
gb|ABK93469.1|  unknown                                                 392   3e-131   Populus trichocarpa [western balsam poplar]
ref|XP_002313124.2|  U-box domain-containing family protein             392   3e-131   Populus trichocarpa [western balsam poplar]
ref|XP_011088242.1|  PREDICTED: U-box domain-containing protein 2...    392   4e-131   
ref|XP_011000686.1|  PREDICTED: U-box domain-containing protein 2...    387   3e-129   
ref|XP_002285110.1|  PREDICTED: U-box domain-containing protein 26      385   1e-128   Vitis vinifera
ref|XP_011005992.1|  PREDICTED: U-box domain-containing protein 2...    384   4e-128   
emb|CAN74163.1|  hypothetical protein VITISV_026443                     385   1e-127   Vitis vinifera
ref|XP_002306161.2|  hypothetical protein POPTR_0004s14720g             383   2e-127   Populus trichocarpa [western balsam poplar]
ref|XP_010270217.1|  PREDICTED: U-box domain-containing protein 2...    382   7e-127   
gb|EPS57772.1|  hypothetical protein M569_17045                         381   8e-127   
ref|XP_007042451.1|  Plant U-box 26                                     378   1e-125   
ref|XP_008456137.1|  PREDICTED: U-box domain-containing protein 2...    376   1e-124   
ref|XP_004140703.1|  PREDICTED: U-box domain-containing protein 2...    373   1e-123   
ref|XP_010263503.1|  PREDICTED: U-box domain-containing protein 2...    372   3e-123   
ref|XP_009341339.1|  PREDICTED: U-box domain-containing protein 26      366   3e-121   
ref|XP_007199948.1|  hypothetical protein PRUPE_ppa006352mg             364   5e-120   
ref|XP_008236490.1|  PREDICTED: U-box domain-containing protein 2...    364   5e-120   
ref|XP_004309747.1|  PREDICTED: U-box domain-containing protein 2...    362   2e-119   
emb|CDO97189.1|  unnamed protein product                                360   1e-118   
ref|XP_006422990.1|  hypothetical protein CICLE_v10028522mg             350   2e-114   
ref|XP_006487052.1|  PREDICTED: U-box domain-containing protein 2...    348   5e-114   
gb|EPS67592.1|  hypothetical protein M569_07183                         347   3e-113   
ref|XP_003518699.1|  PREDICTED: U-box domain-containing protein 2...    346   3e-113   
ref|XP_008373128.1|  PREDICTED: U-box domain-containing protein 2...    346   4e-113   
ref|XP_007153588.1|  hypothetical protein PHAVU_003G048200g             345   8e-113   
ref|XP_010690605.1|  PREDICTED: U-box domain-containing protein 26      342   3e-111   
ref|XP_003529402.1|  PREDICTED: U-box domain-containing protein 2...    341   4e-111   
ref|XP_006583889.1|  PREDICTED: U-box domain-containing protein 2...    341   1e-110   
ref|XP_010538612.1|  PREDICTED: U-box domain-containing protein 2...    334   3e-108   
ref|XP_004505237.1|  PREDICTED: U-box domain-containing protein 2...    331   4e-107   
gb|AES90137.2|  plant U-box protein                                     327   1e-105   
ref|XP_003607940.1|  U-box domain-containing protein                    324   3e-104   
emb|CDY16513.1|  BnaA08g02540D                                          319   2e-102   
ref|XP_006393215.1|  hypothetical protein EUTSA_v10011515mg             318   4e-102   
ref|XP_009107285.1|  PREDICTED: U-box domain-containing protein 26      318   1e-101   
ref|NP_175400.1|  U-box domain-containing protein 26                    315   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002894216.1|  U-box domain-containing protein                    314   2e-100   
emb|CDY50158.1|  BnaA01g26180D                                          313   3e-100   
ref|XP_006406505.1|  hypothetical protein EUTSA_v10022190mg             313   6e-100   
ref|XP_010500528.1|  PREDICTED: U-box domain-containing protein 2...    311   2e-99    
dbj|BAC42960.1|  unknown protein                                        310   8e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306175.1|  hypothetical protein CARUB_v10011740mg             310   8e-99    
ref|XP_010461826.1|  PREDICTED: U-box domain-containing protein 26      310   9e-99    
ref|XP_009145797.1|  PREDICTED: U-box domain-containing protein 25      309   2e-98    
ref|XP_006299353.1|  hypothetical protein CARUB_v10015518mg             308   3e-98    
ref|XP_002518745.1|  Spotted leaf protein, putative                     308   4e-98    Ricinus communis
ref|NP_566632.1|  U-box domain-containing protein 25                    308   4e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CDY59286.1|  BnaCnng34640D                                          308   5e-98    
ref|XP_002885309.1|  hypothetical protein ARALYDRAFT_479456             306   9e-98    
ref|XP_010468287.1|  PREDICTED: U-box domain-containing protein 2...    306   9e-98    
ref|XP_010466083.1|  PREDICTED: U-box domain-containing protein 25      307   9e-98    
dbj|BAF01749.1|  hypothetical protein                                   306   1e-97    Arabidopsis thaliana [mouse-ear cress]
gb|KFK39278.1|  hypothetical protein AALP_AA3G223600                    306   2e-97    
emb|CDX92328.1|  BnaA05g20790D                                          304   1e-96    
emb|CDX99233.1|  BnaC05g33480D                                          303   2e-96    
ref|XP_010507691.1|  PREDICTED: U-box domain-containing protein 2...    304   2e-96    
ref|XP_009111906.1|  PREDICTED: U-box domain-containing protein 2...    303   3e-96    
gb|ABV89622.1|  U-box domain-containing protein                         302   5e-96    Brassica rapa
emb|CDX95458.1|  BnaC01g33500D                                          300   3e-95    
gb|KFK35978.1|  hypothetical protein AALP_AA4G062500                    300   8e-95    
gb|EYU37659.1|  hypothetical protein MIMGU_mgv1a019070mg                286   8e-91    
ref|XP_006847114.1|  hypothetical protein AMTR_s00017p00223570          265   2e-81    
ref|XP_009416906.1|  PREDICTED: U-box domain-containing protein 26      194   2e-54    
emb|CBI32390.3|  unnamed protein product                                191   3e-53    
ref|XP_010481065.1|  PREDICTED: U-box domain-containing protein 2...    185   2e-51    
ref|XP_008784183.1|  PREDICTED: U-box domain-containing protein 2...    185   7e-51    
ref|XP_010489938.1|  PREDICTED: U-box domain-containing protein 2...    177   3e-49    
ref|XP_009403520.1|  PREDICTED: U-box domain-containing protein 2...    166   1e-43    
ref|XP_009406118.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    164   7e-43    
ref|XP_010912457.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    158   7e-41    
ref|XP_004952703.1|  PREDICTED: U-box domain-containing protein 2...    158   8e-41    
dbj|BAJ97989.1|  predicted protein                                      152   1e-38    
gb|EMS66308.1|  U-box domain-containing protein 25                      151   2e-38    
gb|EMT28323.1|  U-box domain-containing protein 25                      150   4e-38    
ref|XP_002974135.1|  ubiquitin-protein ligase, PUB26                    142   3e-35    
gb|ABK25582.1|  unknown                                                 140   2e-34    Picea sitchensis
ref|XP_003575105.1|  PREDICTED: U-box domain-containing protein 2...    140   2e-34    
gb|ABK24171.1|  unknown                                                 137   6e-34    Picea sitchensis
ref|XP_001778934.1|  predicted protein                                  130   2e-32    
ref|NP_001047085.2|  Os02g0548700                                       134   5e-32    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD16187.1|  putative immediate-early fungal elicitor protein...    134   5e-32    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453962.1|  hypothetical protein SORBIDRAFT_04g022280          131   3e-31    Sorghum bicolor [broomcorn]
ref|XP_002968838.1|  ubiquitin-protein ligase, PUB26                    130   9e-31    
ref|XP_001752821.1|  predicted protein                                  128   1e-29    
gb|AFW71736.1|  ubiquitin-protein ligase                                119   8e-27    
ref|XP_001762017.1|  predicted protein                                  119   3e-26    
ref|XP_001776109.1|  predicted protein                                  116   4e-26    
ref|XP_002991371.1|  hypothetical protein SELMODRAFT_133552             116   4e-26    
ref|XP_002988236.1|  hypothetical protein SELMODRAFT_44944              115   1e-25    
ref|NP_001148065.1|  ubiquitin-protein ligase                           114   2e-25    Zea mays [maize]
ref|XP_001751378.1|  predicted protein                                95.5    3e-20    
ref|XP_003636449.1|  U-box domain-containing protein                  97.4    5e-20    
ref|XP_004501176.1|  PREDICTED: uncharacterized protein LOC101503409  97.8    5e-20    
gb|KEH36040.1|  hypothetical protein MTR_3g110138                     96.3    2e-19    
ref|XP_003523734.1|  PREDICTED: U-box domain-containing protein 2...  94.7    5e-19    
ref|XP_001764309.1|  predicted protein                                96.3    7e-19    
ref|XP_006847226.1|  hypothetical protein AMTR_s00017p00257160        95.5    8e-19    
ref|XP_006476069.1|  PREDICTED: U-box domain-containing protein 2...  94.0    1e-18    
ref|XP_008680442.1|  PREDICTED: U-box domain-containing protein 2...  94.0    2e-18    
ref|XP_006826592.1|  hypothetical protein AMTR_s00138p00053700        94.0    3e-18    
gb|EYU29273.1|  hypothetical protein MIMGU_mgv1a021565mg              92.4    6e-18    
ref|XP_007137194.1|  hypothetical protein PHAVU_009G107700g           92.0    6e-18    
ref|XP_002976345.1|  hypothetical protein SELMODRAFT_416243           93.2    1e-17    
ref|XP_006424086.1|  hypothetical protein CICLE_v10028557mg           91.3    2e-17    
ref|XP_008466051.1|  PREDICTED: U-box domain-containing protein 26    90.1    2e-17    
ref|XP_002308611.2|  hypothetical protein POPTR_0006s25710g           90.1    3e-17    Populus trichocarpa [western balsam poplar]
gb|KDO46582.1|  hypothetical protein CISIN_1g040073mg                 90.9    4e-17    
ref|XP_002987240.1|  hypothetical protein SELMODRAFT_125560           90.9    4e-17    
ref|XP_002976407.1|  hypothetical protein SELMODRAFT_104879           90.9    4e-17    
ref|XP_011019811.1|  PREDICTED: uncharacterized protein LOC105122418  91.3    5e-17    
ref|XP_003527831.1|  PREDICTED: uncharacterized protein LOC100814020  88.6    7e-17    
ref|XP_009403145.1|  PREDICTED: U-box domain-containing protein 2...  90.5    7e-17    
ref|XP_009380073.1|  PREDICTED: U-box domain-containing protein 2...  89.7    1e-16    
ref|XP_002885649.1|  hypothetical protein ARALYDRAFT_899024           84.0    1e-16    
ref|XP_002962287.1|  hypothetical protein SELMODRAFT_403954           90.5    1e-16    
ref|XP_011090755.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     88.2    1e-16    
ref|XP_004136217.1|  PREDICTED: U-box domain-containing protein 2...  88.2    1e-16    
ref|XP_006494889.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  89.4    1e-16    
ref|XP_002513723.1|  ubiquitin-protein ligase, putative               89.0    2e-16    Ricinus communis
ref|XP_009348934.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  88.2    3e-16    
ref|XP_001783217.1|  predicted protein                                88.2    3e-16    
gb|KDP34197.1|  hypothetical protein JCGZ_07768                       87.4    3e-16    
ref|XP_009141534.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  87.4    6e-16    
emb|CDX84587.1|  BnaA03g16430D                                        87.4    6e-16    
ref|XP_010668167.1|  PREDICTED: U-box domain-containing protein 26    86.7    6e-16    
ref|XP_003522485.1|  PREDICTED: U-box domain-containing protein 2...  87.0    7e-16    
ref|XP_009133058.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     87.0    7e-16    
emb|CDY32070.1|  BnaC04g44960D                                        86.7    9e-16    
ref|XP_010028074.1|  PREDICTED: U-box domain-containing protein 30    86.7    1e-15    
ref|XP_002987189.1|  hypothetical protein SELMODRAFT_46743            81.6    2e-15    
ref|XP_006410763.1|  hypothetical protein EUTSA_v10016730mg           85.9    2e-15    
ref|XP_002452587.1|  hypothetical protein SORBIDRAFT_04g028560        86.3    2e-15    Sorghum bicolor [broomcorn]
ref|XP_002862799.1|  hypothetical protein ARALYDRAFT_920258           83.2    2e-15    
ref|XP_003636401.1|  U-box domain-containing protein                  84.0    2e-15    
ref|XP_009379827.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  85.5    3e-15    
ref|XP_002281453.1|  PREDICTED: U-box domain-containing protein 25    84.7    3e-15    Vitis vinifera
ref|XP_009419493.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  85.1    4e-15    
ref|XP_008391980.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  85.1    4e-15    
ref|XP_002524056.1|  Spotted leaf protein, putative                   85.1    4e-15    Ricinus communis
gb|KDP34438.1|  hypothetical protein JCGZ_12798                       84.7    5e-15    
ref|XP_002323382.1|  U-box domain-containing family protein           84.7    5e-15    Populus trichocarpa [western balsam poplar]
ref|XP_003517356.1|  PREDICTED: U-box domain-containing protein 3...  85.1    5e-15    
gb|ABK25393.1|  unknown                                               84.3    7e-15    Picea sitchensis
ref|NP_001147860.1|  immediate-early fungal elicitor protein CMPG1    84.3    7e-15    Zea mays [maize]
ref|XP_004142305.1|  PREDICTED: U-box domain-containing protein 2...  84.3    7e-15    
ref|XP_007137800.1|  hypothetical protein PHAVU_009G156600g           84.0    8e-15    
ref|XP_011042586.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22     84.0    8e-15    
ref|XP_011078792.1|  PREDICTED: U-box domain-containing protein 2...  84.0    9e-15    
gb|KHN31155.1|  U-box domain-containing protein 26                    81.3    1e-14    
ref|XP_006450657.1|  hypothetical protein CICLE_v10008902mg           82.8    1e-14    
ref|XP_011006317.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  83.6    1e-14    
ref|XP_003564002.1|  PREDICTED: U-box domain-containing protein 21    83.6    2e-14    
emb|CDP01660.1|  unnamed protein product                              83.2    2e-14    
ref|XP_010932523.1|  PREDICTED: U-box domain-containing protein 2...  83.2    2e-14    
ref|XP_003526867.1|  PREDICTED: U-box domain-containing protein 2...  82.8    2e-14    
ref|XP_006387887.1|  hypothetical protein POPTR_0497s00200g           82.8    2e-14    
emb|CDX79645.1|  BnaC03g19810D                                        82.4    3e-14    
emb|CDP16178.1|  unnamed protein product                              82.0    3e-14    
ref|XP_009404142.1|  PREDICTED: U-box domain-containing protein 2...  82.4    3e-14    
gb|KDP36106.1|  hypothetical protein JCGZ_08750                       82.4    3e-14    
gb|ADI46216.1|  CMPG1a                                                82.0    4e-14    
ref|XP_008793948.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  82.0    5e-14    
ref|XP_007204425.1|  hypothetical protein PRUPE_ppa1027169mg          81.6    5e-14    
ref|XP_006340423.1|  PREDICTED: U-box domain-containing protein 2...  80.5    6e-14    
ref|XP_006295808.1|  hypothetical protein CARUB_v10024934mg           81.6    6e-14    
ref|XP_009390871.1|  PREDICTED: U-box domain-containing protein 2...  81.6    6e-14    
ref|XP_010043987.1|  PREDICTED: U-box domain-containing protein 2...  81.6    6e-14    
ref|XP_010271201.1|  PREDICTED: U-box domain-containing protein 2...  81.6    7e-14    
gb|KHN13011.1|  U-box domain-containing protein 30                    81.6    7e-14    
ref|XP_011022933.1|  PREDICTED: U-box domain-containing protein 2...  81.3    8e-14    
ref|XP_008465536.1|  PREDICTED: U-box domain-containing protein 2...  81.3    8e-14    
ref|XP_008784119.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  81.3    8e-14    
ref|XP_004511816.1|  PREDICTED: U-box domain-containing protein 3...  81.3    8e-14    
ref|XP_003539260.2|  PREDICTED: U-box domain-containing protein 3...  81.6    8e-14    
ref|XP_002265439.2|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  80.9    9e-14    Vitis vinifera
ref|XP_004251095.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  80.9    1e-13    
ref|XP_011094237.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  80.9    1e-13    
ref|XP_002267438.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  80.9    1e-13    Vitis vinifera
ref|XP_010260460.1|  PREDICTED: U-box domain-containing protein 2...  80.9    1e-13    
ref|XP_010273225.1|  PREDICTED: U-box domain-containing protein 30    80.9    1e-13    
emb|CDY59599.1|  BnaCnng35300D                                        80.5    1e-13    
ref|XP_002275500.2|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  80.5    1e-13    Vitis vinifera
ref|XP_008350837.1|  PREDICTED: U-box domain-containing protein 2...  80.9    1e-13    
ref|XP_008365622.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  80.1    2e-13    
ref|XP_010279125.1|  PREDICTED: U-box domain-containing protein 2...  80.1    2e-13    
ref|XP_007047580.1|  ARM repeat superfamily protein isoform 2         79.0    2e-13    
ref|XP_010249635.1|  PREDICTED: U-box domain-containing protein 26    79.3    2e-13    
ref|XP_010091753.1|  U-box domain-containing protein 21               80.1    2e-13    
gb|KFK36486.1|  hypothetical protein AALP_AA4G130900                  79.7    2e-13    
ref|XP_004251181.1|  PREDICTED: U-box domain-containing protein 26    79.0    2e-13    
ref|XP_010505120.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     79.7    2e-13    
gb|AES94509.2|  E3 ubiquitin ligase PUB14                             79.7    3e-13    
gb|AGT17408.1|  hypothetical protein SHCRBa_230_N09_R_300             79.7    3e-13    
emb|CDX95337.1|  BnaC04g28210D                                        79.7    3e-13    
ref|XP_010516800.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  79.7    3e-13    
ref|XP_010906325.1|  PREDICTED: U-box domain-containing protein 2...  79.7    3e-13    
ref|XP_010509533.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  79.7    3e-13    
ref|XP_003611551.1|  U-box domain-containing protein                  79.7    3e-13    
gb|AAD21464.1|  unknown protein                                       79.3    3e-13    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009343248.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     79.3    3e-13    
ref|XP_006380377.1|  hypothetical protein POPTR_0007s04220g           79.3    3e-13    
ref|NP_196716.1|  uncharacterized protein                             78.6    3e-13    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009801169.1|  PREDICTED: uncharacterized protein LOC104246952  79.0    3e-13    
ref|NP_181137.2|  E3 ubiquitin-protein ligase PUB23                   79.3    3e-13    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456493.1|  PREDICTED: uncharacterized protein LOC104737947  77.4    4e-13    
ref|XP_008357389.1|  PREDICTED: U-box domain-containing protein 1...  77.8    4e-13    
ref|XP_002298264.1|  hypothetical protein POPTR_0001s22370g           79.0    4e-13    Populus trichocarpa [western balsam poplar]
ref|XP_010925800.1|  PREDICTED: U-box domain-containing protein 2...  79.3    4e-13    
ref|XP_008230336.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  79.0    4e-13    
ref|XP_008357382.1|  PREDICTED: U-box domain-containing protein 1...  77.8    5e-13    
ref|XP_004228696.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  79.0    5e-13    
ref|XP_008381777.1|  PREDICTED: U-box domain-containing protein 2...  79.0    6e-13    
ref|XP_006289615.1|  hypothetical protein CARUB_v10003173mg           77.8    6e-13    
ref|XP_007047579.1|  ARM repeat superfamily protein isoform 1         79.0    6e-13    
gb|AFW73318.1|  immediate-early fungal elicitor protein CMPG1         79.0    7e-13    
ref|XP_009803459.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  78.6    7e-13    
ref|XP_010491888.1|  PREDICTED: uncharacterized protein LOC104769387  77.4    7e-13    
ref|XP_002465578.1|  hypothetical protein SORBIDRAFT_01g041450        78.6    7e-13    Sorghum bicolor [broomcorn]
ref|XP_006364055.1|  PREDICTED: U-box domain-containing protein 2...  78.6    7e-13    
ref|XP_002991626.1|  hypothetical protein SELMODRAFT_133879           78.2    8e-13    
ref|XP_009593988.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  78.2    8e-13    
ref|XP_006399662.1|  hypothetical protein EUTSA_v10014169mg           77.4    8e-13    
ref|XP_008237598.1|  PREDICTED: U-box domain-containing protein 30    78.2    9e-13    
ref|XP_009136678.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  78.2    1e-12    
ref|XP_006348454.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  77.8    1e-12    
ref|XP_006847707.1|  hypothetical protein AMTR_s00149p00072640        77.8    1e-12    
ref|XP_010453204.1|  PREDICTED: uncharacterized protein LOC104735168  76.6    1e-12    
ref|XP_010419728.1|  PREDICTED: uncharacterized protein LOC104705421  76.6    1e-12    
emb|CDX84168.1|  BnaC04g09300D                                        77.8    1e-12    
ref|XP_009410070.1|  PREDICTED: U-box domain-containing protein 2...  77.8    1e-12    
ref|XP_009760074.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  77.8    1e-12    
ref|XP_003558390.1|  PREDICTED: U-box domain-containing protein 2...  77.8    1e-12    
ref|XP_011021423.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  77.8    1e-12    
ref|XP_002873519.1|  hypothetical protein ARALYDRAFT_487992           76.6    1e-12    
ref|XP_010106989.1|  E3 ubiquitin-protein ligase                      77.8    1e-12    
emb|CDP20283.1|  unnamed protein product                              77.8    2e-12    
ref|XP_007145787.1|  hypothetical protein PHAVU_007G267700g           77.4    2e-12    
ref|XP_006362850.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  77.4    2e-12    
ref|XP_007207456.1|  hypothetical protein PRUPE_ppa005655mg           77.4    2e-12    
ref|XP_002965206.1|  hypothetical protein SELMODRAFT_439085           77.8    2e-12    
ref|XP_006854618.1|  hypothetical protein AMTR_s00030p00159240        77.4    2e-12    
ref|XP_002526642.1|  Spotted leaf protein, putative                   77.4    2e-12    Ricinus communis
ref|XP_002881419.1|  hypothetical protein ARALYDRAFT_482563           77.4    2e-12    
ref|XP_003537115.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  77.4    2e-12    
ref|XP_009603741.1|  PREDICTED: uncharacterized protein LOC104098657  76.6    2e-12    
ref|XP_008795339.1|  PREDICTED: U-box domain-containing protein 21    77.4    2e-12    
gb|KHN48421.1|  E3 ubiquitin-protein ligase PUB23                     77.0    2e-12    
ref|XP_008357448.1|  PREDICTED: U-box domain-containing protein 1...  77.8    2e-12    
ref|XP_010551422.1|  PREDICTED: U-box domain-containing protein 21    77.0    2e-12    
ref|XP_006382863.1|  hypothetical protein POPTR_0005s06470g           77.0    2e-12    
ref|XP_009370082.1|  PREDICTED: U-box domain-containing protein 21    77.0    2e-12    
ref|XP_007015662.1|  U-box domain-containing protein 23               77.0    2e-12    
ref|XP_004303406.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  77.0    2e-12    
ref|XP_009367895.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  75.9    2e-12    
ref|XP_004502944.1|  PREDICTED: U-box domain-containing protein 2...  77.0    2e-12    
ref|XP_002267145.2|  PREDICTED: U-box domain-containing protein 30    77.0    2e-12    Vitis vinifera
ref|XP_004503116.1|  PREDICTED: U-box domain-containing protein 2...  77.0    2e-12    
ref|XP_004172231.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  77.0    3e-12    
ref|XP_006403803.1|  hypothetical protein EUTSA_v10010389mg           77.0    3e-12    
emb|CDX85708.1|  BnaA02g01050D                                        75.5    3e-12    
ref|XP_009343842.1|  PREDICTED: U-box domain-containing protein 1...  75.1    3e-12    
ref|XP_009353692.1|  PREDICTED: U-box domain-containing protein 1...  77.0    3e-12    
ref|XP_009125812.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  75.5    3e-12    
ref|XP_008780992.1|  PREDICTED: U-box domain-containing protein 2...  76.6    3e-12    
ref|XP_007207682.1|  hypothetical protein PRUPE_ppa023672mg           76.6    3e-12    
ref|XP_008385130.1|  PREDICTED: U-box domain-containing protein 1...  77.0    4e-12    
ref|XP_007152651.1|  hypothetical protein PHAVU_004G147500g           76.6    4e-12    
ref|XP_010106916.1|  U-box domain-containing protein 30               76.6    4e-12    
ref|XP_003575089.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     76.3    4e-12    
gb|KDO78935.1|  hypothetical protein CISIN_1g041252mg                 76.6    4e-12    
ref|XP_003518177.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  76.3    4e-12    
ref|XP_006426094.1|  hypothetical protein CICLE_v10025589mg           76.3    4e-12    
ref|XP_004985053.1|  PREDICTED: U-box domain-containing protein 2...  76.3    4e-12    
ref|XP_006466465.1|  PREDICTED: U-box domain-containing protein 3...  76.3    4e-12    
ref|XP_003524698.1|  PREDICTED: U-box domain-containing protein 3...  76.3    4e-12    
ref|XP_009351577.1|  PREDICTED: U-box domain-containing protein 2...  76.3    4e-12    
emb|CDY68531.1|  BnaCnng59400D                                        75.1    4e-12    
ref|XP_004953855.1|  PREDICTED: U-box domain-containing protein 2...  76.3    5e-12    
gb|KHN20357.1|  U-box domain-containing protein 30                    76.3    5e-12    
ref|XP_010541793.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  76.3    5e-12    
ref|XP_008379758.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  76.3    5e-12    
ref|XP_010463781.1|  PREDICTED: U-box domain-containing protein 31    76.3    5e-12    
ref|XP_007155812.1|  hypothetical protein PHAVU_003G233800g           76.3    5e-12    
ref|XP_007215376.1|  hypothetical protein PRUPE_ppa005711mg           76.3    5e-12    
gb|ADI46214.1|  CMPG1b                                                75.9    5e-12    
ref|XP_009353694.1|  PREDICTED: U-box domain-containing protein 1...  76.3    5e-12    
ref|XP_011089810.1|  PREDICTED: U-box domain-containing protein 13    76.3    6e-12    
dbj|BAJ91241.1|  predicted protein                                    75.9    6e-12    
gb|ACF88418.1|  unknown                                               75.9    6e-12    
ref|XP_011046430.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  75.5    7e-12    
ref|XP_006841078.1|  hypothetical protein AMTR_s00086p00031680        75.1    7e-12    
gb|KDP44223.1|  hypothetical protein JCGZ_05690                       75.9    7e-12    
ref|XP_010526330.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22     75.5    7e-12    
gb|EYU30497.1|  hypothetical protein MIMGU_mgv1a007556mg              75.5    7e-12    
gb|KFK34491.1|  hypothetical protein AALP_AA5G152500                  75.5    8e-12    
emb|CBI24432.3|  unnamed protein product                              75.1    8e-12    
emb|CAN66286.1|  hypothetical protein VITISV_011184                   75.5    8e-12    
ref|XP_004145841.1|  PREDICTED: U-box domain-containing protein 2...  75.5    8e-12    
ref|XP_002262704.2|  PREDICTED: U-box domain-containing protein 2...  75.5    8e-12    
gb|EYU38686.1|  hypothetical protein MIMGU_mgv1a020011mg              75.5    8e-12    
gb|EYU28509.1|  hypothetical protein MIMGU_mgv1a021492mg              74.7    8e-12    
ref|XP_004228691.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  75.1    9e-12    
ref|XP_010444614.1|  PREDICTED: U-box domain-containing protein 3...  75.5    9e-12    
ref|XP_008393879.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  74.7    9e-12    
gb|KDO79762.1|  hypothetical protein CISIN_1g044095mg                 74.3    9e-12    
emb|CDX91209.1|  BnaC02g03880D                                        74.3    1e-11    
ref|XP_006381941.1|  U-box domain-containing family protein           75.1    1e-11    
ref|XP_010247286.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  75.1    1e-11    
ref|XP_010106453.1|  U-box domain-containing protein 13               75.5    1e-11    
ref|XP_009592688.1|  PREDICTED: U-box domain-containing protein 2...  75.1    1e-11    
gb|EAZ00358.1|  hypothetical protein OsI_22374                        75.1    1e-11    
ref|NP_001057289.1|  Os06g0248500                                     75.1    1e-11    
ref|XP_006355051.1|  PREDICTED: U-box domain-containing protein 2...  74.7    1e-11    
ref|XP_007036951.1|  ARM repeat superfamily protein                   74.7    1e-11    
ref|XP_009115945.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22     74.7    1e-11    
ref|XP_008812599.1|  PREDICTED: U-box domain-containing protein 2...  74.7    2e-11    
emb|CDX78096.1|  BnaA09g32910D                                        74.3    2e-11    
ref|XP_008367613.1|  PREDICTED: U-box domain-containing protein 2...  74.7    2e-11    
ref|XP_009125026.1|  PREDICTED: U-box domain-containing protein 4     73.9    2e-11    
ref|NP_001234240.1|  Avr9/Cf-9 rapidly elicited protein               74.3    2e-11    
ref|XP_009375140.1|  PREDICTED: U-box domain-containing protein 3...  74.3    2e-11    
ref|XP_003533316.1|  PREDICTED: U-box domain-containing protein 2...  74.3    2e-11    
ref|XP_004490855.1|  PREDICTED: U-box domain-containing protein 2...  74.3    2e-11    
ref|XP_009396054.1|  PREDICTED: U-box domain-containing protein 4...  74.3    2e-11    
ref|XP_002510072.1|  E3 ubiquitin ligase PUB14, putative              74.3    2e-11    
ref|XP_009368334.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  73.9    2e-11    
ref|XP_006432191.1|  hypothetical protein CICLE_v10001406mg           73.9    2e-11    
ref|XP_011042684.1|  PREDICTED: U-box domain-containing protein 1...  74.3    2e-11    
gb|KDO51673.1|  hypothetical protein CISIN_1g015728mg                 73.9    2e-11    
ref|XP_006465012.1|  PREDICTED: U-box domain-containing protein 2...  73.9    2e-11    
ref|NP_001152389.1|  immediate-early fungal elicitor protein CMPG1    73.9    2e-11    
ref|XP_004494254.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  73.9    2e-11    
gb|KEH35601.1|  E3 ubiquitin ligase PUB14                             72.8    3e-11    
ref|XP_004228690.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  73.9    3e-11    
ref|XP_009599897.1|  PREDICTED: U-box domain-containing protein 1...  74.3    3e-11    
ref|XP_008220387.1|  PREDICTED: U-box domain-containing protein 3...  73.9    3e-11    
ref|XP_010936891.1|  PREDICTED: U-box domain-containing protein 2...  73.9    3e-11    
emb|CDY28679.1|  BnaCnng05650D                                        72.0    3e-11    
ref|XP_007016447.1|  U-box domain-containing protein 13 isoform 1     74.3    3e-11    
ref|XP_010059057.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  73.9    3e-11    
ref|XP_010685786.1|  PREDICTED: U-box domain-containing protein 13    73.9    3e-11    
ref|XP_007016448.1|  Plant U-box 13 isoform 2                         73.9    3e-11    
ref|XP_004294506.1|  PREDICTED: U-box domain-containing protein 1...  73.9    3e-11    
ref|XP_009139452.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  73.6    3e-11    
emb|CDP09042.1|  unnamed protein product                              73.9    3e-11    
ref|XP_010541260.1|  PREDICTED: formin-binding protein 4              72.8    3e-11    
ref|XP_009337706.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  73.6    3e-11    
ref|XP_004147364.1|  PREDICTED: U-box domain-containing protein 2...  73.6    3e-11    
ref|XP_008460887.1|  PREDICTED: U-box domain-containing protein 2...  73.6    3e-11    
gb|KEH30143.1|  armadillo/beta-catenin repeat protein                 73.9    3e-11    
gb|EPS58757.1|  hypothetical protein M569_16054                       72.8    3e-11    
ref|XP_011031181.1|  PREDICTED: U-box domain-containing protein 2...  72.8    3e-11    
ref|XP_008223401.1|  PREDICTED: U-box domain-containing protein 13    73.9    3e-11    
ref|XP_006279535.1|  hypothetical protein CARUB_v10028289mg           73.6    4e-11    
gb|KHN43695.1|  E3 ubiquitin-protein ligase PUB22                     73.6    4e-11    
ref|XP_006348457.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  73.6    4e-11    
gb|KDP37425.1|  hypothetical protein JCGZ_07952                       73.6    4e-11    
dbj|BAD16037.1|  putative immediate-early fungal elicitor protein...  73.6    4e-11    
gb|AEW09062.1|  hypothetical protein CL3508Contig1_02                 69.3    4e-11    
ref|NP_001048059.2|  Os02g0738200                                     73.6    4e-11    
emb|CDP04681.1|  unnamed protein product                              73.2    4e-11    
ref|XP_010912070.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  73.2    4e-11    
ref|XP_009415651.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  73.2    4e-11    
ref|XP_003616222.1|  U-box domain-containing protein                  73.2    4e-11    
ref|XP_009360045.1|  PREDICTED: U-box domain-containing protein 2...  73.2    4e-11    
ref|XP_009356001.1|  PREDICTED: U-box domain-containing protein 2...  73.2    4e-11    
ref|XP_002527537.1|  Spotted leaf protein, putative                   73.2    4e-11    
ref|XP_010503987.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  71.6    5e-11    
ref|XP_010270371.1|  PREDICTED: U-box domain-containing protein 2...  73.2    5e-11    
ref|XP_010911942.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  73.2    5e-11    
ref|XP_004291671.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  72.8    5e-11    
gb|AEW09063.1|  hypothetical protein CL3508Contig1_02                 68.9    5e-11    
ref|XP_010269983.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  72.8    6e-11    
gb|KHG14011.1|  U-box domain-containing 13 -like protein              73.2    6e-11    
ref|XP_006374249.1|  hypothetical protein POPTR_0015s05380g           72.8    6e-11    
gb|KFK28450.1|  hypothetical protein AALP_AA8G515900                  72.8    6e-11    
ref|XP_011090297.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  72.8    6e-11    
ref|XP_008375014.1|  PREDICTED: U-box domain-containing protein 2...  72.8    6e-11    
ref|XP_006424806.1|  hypothetical protein CICLE_v10027966mg           72.8    7e-11    
ref|XP_004498998.1|  PREDICTED: U-box domain-containing protein 4...  72.4    7e-11    
ref|XP_009395651.1|  PREDICTED: U-box domain-containing protein 3...  72.8    7e-11    
ref|XP_003602626.1|  U-box domain-containing protein                  72.4    7e-11    
ref|XP_011000261.1|  PREDICTED: U-box domain-containing protein 1...  72.8    7e-11    
ref|XP_002866695.1|  U-box domain-containing protein                  72.4    7e-11    
ref|XP_002877862.1|  U-box domain-containing protein                  72.4    8e-11    
ref|XP_006424807.1|  hypothetical protein CICLE_v10027966mg           72.8    8e-11    
ref|XP_010263015.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  72.4    8e-11    
ref|XP_008790249.1|  PREDICTED: U-box domain-containing protein 3...  72.4    8e-11    
ref|XP_006293176.1|  hypothetical protein CARUB_v10019493mg           72.4    9e-11    
ref|XP_011031180.1|  PREDICTED: U-box domain-containing protein 2...  72.0    9e-11    
ref|XP_002533776.1|  ubiquitin-protein ligase, putative               72.4    9e-11    
ref|XP_007204993.1|  hypothetical protein PRUPE_ppa003509mg           72.4    9e-11    
ref|XP_009781197.1|  PREDICTED: U-box domain-containing protein 2...  72.4    1e-10    
gb|KFK26673.1|  hypothetical protein AALP_AA8G277900                  72.4    1e-10    
gb|AEF30545.1|  CMPG                                                  72.4    1e-10    
ref|XP_011089213.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  72.0    1e-10    
ref|XP_010315681.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  72.0    1e-10    
gb|AAM61258.1|  unknown                                               72.0    1e-10    
ref|XP_004164292.1|  PREDICTED: U-box domain-containing protein 2...  72.0    1e-10    
gb|EMT16670.1|  U-box domain-containing protein 23                    72.0    1e-10    
gb|ADI46213.1|  CMPG1a                                                72.0    1e-10    
ref|XP_009600234.1|  PREDICTED: U-box domain-containing protein 2...  72.0    1e-10    
emb|CDY23218.1|  BnaA04g05410D                                        72.0    1e-10    
ref|XP_008452670.1|  PREDICTED: U-box domain-containing protein 3...  72.0    1e-10    
ref|XP_010547560.1|  PREDICTED: U-box domain-containing protein 30    72.0    1e-10    
ref|XP_007225763.1|  hypothetical protein PRUPE_ppa005536mg           72.0    1e-10    
ref|XP_010426860.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22     72.0    1e-10    
ref|XP_010515711.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  72.0    1e-10    
ref|XP_004236923.1|  PREDICTED: U-box domain-containing protein 2...  72.0    1e-10    
ref|XP_002298363.1|  armadillo/beta-catenin repeat family protein     72.4    1e-10    
ref|XP_002313440.1|  armadillo/beta-catenin repeat family protein     72.4    1e-10    
gb|KHN39481.1|  U-box domain-containing protein 20                    71.6    1e-10    
ref|XP_010090837.1|  U-box domain-containing protein 25               71.6    1e-10    
ref|XP_009770354.1|  PREDICTED: U-box domain-containing protein 2...  72.0    1e-10    
gb|ABA59556.1|  U-box protein                                         71.6    1e-10    
ref|NP_190813.1|  E3 ubiquitin-protein ligase PUB22                   71.6    1e-10    
gb|AFG69255.1|  hypothetical protein 0_14991_01                       66.2    1e-10    
ref|XP_006469285.1|  PREDICTED: U-box domain-containing protein 2...  71.6    1e-10    
ref|XP_009592440.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  71.6    2e-10    
gb|KHN43656.1|  U-box domain-containing protein 20                    71.6    2e-10    
ref|XP_008345702.1|  PREDICTED: U-box domain-containing protein 3...  71.6    2e-10    
ref|XP_008393710.1|  PREDICTED: U-box domain-containing protein 3...  71.6    2e-10    
ref|XP_004505870.1|  PREDICTED: U-box domain-containing protein 1...  72.0    2e-10    
ref|XP_004141293.1|  PREDICTED: U-box domain-containing protein 3...  71.6    2e-10    
ref|XP_010322360.1|  PREDICTED: U-box domain-containing protein 1...  71.6    2e-10    
ref|XP_009140157.1|  PREDICTED: U-box domain-containing protein 2...  71.6    2e-10    
ref|XP_003544976.1|  PREDICTED: U-box domain-containing protein 2...  71.6    2e-10    
ref|XP_004250456.1|  PREDICTED: U-box domain-containing protein 2...  71.2    2e-10    
ref|XP_009380658.1|  PREDICTED: protein spotted leaf 11-like          71.6    2e-10    
gb|AAP03884.1|  Avr9/Cf-9 rapidly elicited protein 74                 71.2    2e-10    
gb|KHN34082.1|  U-box domain-containing protein 25                    70.9    2e-10    
gb|KCW84730.1|  hypothetical protein EUGRSUZ_B01548                   71.6    2e-10    
gb|AAL32554.1|  Unknown protein                                       71.2    2e-10    
gb|EPS70404.1|  hypothetical protein M569_04358                       71.2    2e-10    
ref|XP_004241233.1|  PREDICTED: U-box domain-containing protein 1...  71.6    2e-10    
ref|NP_201393.1|  U-box domain-containing protein 31                  71.2    2e-10    
ref|XP_008799715.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  71.2    2e-10    
ref|XP_009343828.1|  PREDICTED: U-box domain-containing protein 1...  71.6    2e-10    
ref|XP_002534105.1|  Spotted leaf protein, putative                   71.2    2e-10    
ref|XP_006481606.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  70.9    2e-10    
gb|KHG16185.1|  U-box domain-containing 4 -like protein               70.9    2e-10    
ref|XP_009341425.1|  PREDICTED: U-box domain-containing protein 1...  70.1    2e-10    
ref|XP_009140158.1|  PREDICTED: U-box domain-containing protein 2...  70.9    2e-10    
ref|XP_010688093.1|  PREDICTED: U-box domain-containing protein 4...  70.5    3e-10    
ref|XP_008457035.1|  PREDICTED: U-box domain-containing protein 2...  70.9    3e-10    
ref|XP_009378957.1|  PREDICTED: U-box domain-containing protein 2...  70.9    3e-10    
ref|XP_010039237.1|  PREDICTED: U-box domain-containing protein 3...  71.2    3e-10    
ref|XP_002976406.1|  hypothetical protein SELMODRAFT_416356           70.9    3e-10    
ref|XP_007224929.1|  hypothetical protein PRUPE_ppa021688mg           69.7    3e-10    
ref|XP_009382986.1|  PREDICTED: U-box domain-containing protein 2...  70.9    3e-10    
ref|XP_010278617.1|  PREDICTED: U-box domain-containing protein 2...  67.4    3e-10    
ref|XP_004142306.1|  PREDICTED: U-box domain-containing protein 2...  69.3    3e-10    
ref|XP_004299506.1|  PREDICTED: U-box domain-containing protein 2...  70.5    3e-10    
gb|ADI46217.1|  CMPG1b                                                70.5    3e-10    
gb|EEE65449.1|  hypothetical protein OsJ_20813                        70.1    3e-10    
ref|XP_011099937.1|  PREDICTED: U-box domain-containing protein 2...  70.5    3e-10    
ref|XP_010039247.1|  PREDICTED: U-box domain-containing protein 3...  70.9    3e-10    
ref|XP_010039241.1|  PREDICTED: U-box domain-containing protein 3...  70.9    4e-10    
ref|XP_009789261.1|  PREDICTED: U-box domain-containing protein 2...  70.5    4e-10    
ref|XP_010912561.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  70.5    4e-10    
ref|XP_006448117.1|  hypothetical protein CICLE_v10015253mg           70.5    4e-10    
ref|XP_002987239.1|  hypothetical protein SELMODRAFT_426053           70.5    4e-10    
ref|XP_006404100.1|  hypothetical protein EUTSA_v10010374mg           70.5    4e-10    
ref|XP_011047794.1|  PREDICTED: U-box domain-containing protein 2...  70.5    4e-10    
emb|CDX69749.1|  BnaA10g20980D                                        69.7    4e-10    
gb|KHN25100.1|  U-box domain-containing protein 21                    70.5    4e-10    
dbj|BAK07065.1|  predicted protein                                    70.5    4e-10    
ref|XP_006350763.1|  PREDICTED: U-box domain-containing protein 1...  70.5    4e-10    
ref|XP_009777581.1|  PREDICTED: U-box domain-containing protein 1...  70.5    4e-10    
gb|KCW90449.1|  hypothetical protein EUGRSUZ_A02579                   70.1    4e-10    
ref|XP_003631249.1|  PREDICTED: U-box domain-containing protein 2...  70.5    4e-10    
gb|EPS68981.1|  hypothetical protein M569_05787                       70.5    4e-10    
emb|CDP10593.1|  unnamed protein product                              70.1    5e-10    
ref|XP_002320032.2|  hypothetical protein POPTR_0014s01670g           69.7    5e-10    
ref|XP_003530079.1|  PREDICTED: U-box domain-containing protein 2...  70.1    5e-10    
ref|XP_008796330.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  70.1    5e-10    
emb|CDY31736.1|  BnaA04g16720D                                        70.5    5e-10    
ref|XP_002974352.1|  hypothetical protein SELMODRAFT_414754           70.1    5e-10    
ref|XP_010999871.1|  PREDICTED: U-box domain-containing protein 4...  69.7    5e-10    
ref|XP_009121936.1|  PREDICTED: uncharacterized protein LOC103846711  69.7    5e-10    
ref|XP_009140947.1|  PREDICTED: U-box domain-containing protein 12    70.1    5e-10    
ref|XP_007132072.1|  hypothetical protein PHAVU_011G064700g           70.1    6e-10    
gb|EYU36264.1|  hypothetical protein MIMGU_mgv1a002554mg              70.1    6e-10    
gb|EYU30866.1|  hypothetical protein MIMGU_mgv1a026315mg              70.1    6e-10    
ref|XP_002516555.1|  conserved hypothetical protein                   69.7    6e-10    
ref|XP_002881013.1|  armadillo/beta-catenin repeat family protein     70.1    6e-10    
ref|XP_006356848.1|  PREDICTED: U-box domain-containing protein 3...  69.7    6e-10    
ref|XP_006350762.1|  PREDICTED: U-box domain-containing protein 1...  70.1    6e-10    
ref|XP_003589079.1|  U-box domain-containing protein                  69.3    6e-10    
ref|NP_565676.4|  U-box E3 ubiquitin ligase                           70.1    7e-10    
gb|AAK59543.1|  unknown protein                                       70.1    7e-10    
ref|XP_002283992.1|  PREDICTED: U-box domain-containing protein 13    70.1    7e-10    
ref|XP_006857112.1|  hypothetical protein AMTR_s00065p00128940        69.7    7e-10    



>ref|XP_004230770.1| PREDICTED: U-box domain-containing protein 26-like [Solanum lycopersicum]
Length=415

 Score =   428 bits (1100),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 231/292 (79%), Positives = 263/292 (90%), Gaps = 0/292 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA +S+KNRSVI ANNARE+LL I+FS MDS++ EL HESLAILSMFPL E E
Sbjct  124  ALRRLRGLARDSEKNRSVISANNAREILLAIVFSRMDSDASELHHESLAILSMFPLSEPE  183

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             V V+SDP RVGYLV++L +PS+DVR+NSAALIE+V++G RSPE RAQISNAD++FEG+V
Sbjct  184  CVFVASDPGRVGYLVAMLFHPSIDVRVNSAALIETVVAGMRSPEFRAQISNADDVFEGVV  243

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
            GILN PL+Y RALK+G+KALFALCL KQ+R +AV+AGAVEALIDRLQDF+KCDAERALAT
Sbjct  244  GILNYPLAYPRALKVGIKALFALCLVKQHRQRAVSAGAVEALIDRLQDFEKCDAERALAT  303

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELL RIPSGCAA A+HALTVPLLVKIILKIS RATEYAAGALLS+CSASEQAQ+EA AA
Sbjct  304  IELLSRIPSGCAALASHALTVPLLVKIILKISERATEYAAGALLSLCSASEQAQKEAVAA  363

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            GV+ QLLLLVQSDCTERAKRKAQMLLK LRDCWPED  A +DD+ CS VVPF
Sbjct  364  GVLIQLLLLVQSDCTERAKRKAQMLLKQLRDCWPEDSIANTDDFACSDVVPF  415



>ref|XP_006346399.1| PREDICTED: U-box domain-containing protein 26-like [Solanum tuberosum]
Length=415

 Score =   427 bits (1098),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 234/292 (80%), Positives = 262/292 (90%), Gaps = 0/292 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA +SDKNRSVI ANNARE+LL I+FS MDS+S EL+HESLAILSMFPL E E
Sbjct  124  ALRRLRGLARDSDKNRSVISANNAREILLAIVFSRMDSDSSELNHESLAILSMFPLSEPE  183

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             V V+SDP RV YLV++L +PS+DVR+NSAALIE V++G RS ELRAQISNAD++FEG+V
Sbjct  184  CVFVASDPERVSYLVAMLFHPSIDVRVNSAALIEIVVAGMRSSELRAQISNADDVFEGVV  243

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
            GILN PL+Y RALK+G+KALFALCL KQ+R +AVTAGAVEALIDRLQDF+KCDAERALAT
Sbjct  244  GILNYPLAYPRALKVGIKALFALCLVKQHRQRAVTAGAVEALIDRLQDFEKCDAERALAT  303

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELL RIPSGCAA A+HALTVPLLVKIILKIS RATEYAAGALLS+CSASEQAQ+EA AA
Sbjct  304  IELLSRIPSGCAALASHALTVPLLVKIILKISERATEYAAGALLSLCSASEQAQKEAVAA  363

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            GV+ QLLLLVQSDCTERAKRKAQMLLK LRDCWPED  A SDD+ CS VVPF
Sbjct  364  GVLIQLLLLVQSDCTERAKRKAQMLLKQLRDCWPEDSIANSDDFACSDVVPF  415



>ref|XP_009627648.1| PREDICTED: U-box domain-containing protein 26-like [Nicotiana 
tomentosiformis]
Length=417

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 230/293 (78%), Positives = 257/293 (88%), Gaps = 1/293 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA +SDKNRSVI ANNARE+LL I+F  MDS+S EL+HESLAILSMFPL E E
Sbjct  125  ALRRLRGLARDSDKNRSVISANNAREILLSIVFFRMDSDSSELNHESLAILSMFPLSEGE  184

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
               V+SDP RV YLVSLL +PS+DVR+NSAALIE V++G RS ELRAQISN D++FEG+V
Sbjct  185  CFFVASDPDRVSYLVSLLFHPSIDVRVNSAALIEVVVAGIRSSELRAQISNIDDVFEGVV  244

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
            GILN PL+Y RALK+G+KALFALCL KQ+R KAV AGAVEALIDRLQDF+KCDAERALAT
Sbjct  245  GILNYPLAYPRALKVGIKALFALCLVKQHRQKAVAAGAVEALIDRLQDFEKCDAERALAT  304

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELL RIPSGCAA A+HALTVPLLVK ILK+S RATEYAAGALLS+C ASEQAQ+EA AA
Sbjct  305  IELLARIPSGCAALASHALTVPLLVKTILKVSERATEYAAGALLSLCLASEQAQKEAVAA  364

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNC-SYVVPF  877
            GV+TQLLLLVQSDCT+RAKRKAQMLLK LRDCWPE+ TA SDDY   S VVPF
Sbjct  365  GVLTQLLLLVQSDCTDRAKRKAQMLLKQLRDCWPEESTANSDDYFAYSDVVPF  417



>gb|KDP32265.1| hypothetical protein JCGZ_14786 [Jatropha curcas]
Length=416

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 208/293 (71%), Positives = 255/293 (87%), Gaps = 1/293 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSN-MDSNSPELSHESLAILSMFPLPEA  178
            ALRRLRGLA +SDKNRSVI ++NAREV + ++F+N  DSNS +L+HE+LA+L MFPL E+
Sbjct  124  ALRRLRGLARDSDKNRSVISSHNAREVFINLVFANCTDSNSSDLNHEALALLIMFPLSES  183

Query  179  ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
            + V ++SD  R+ YLV+LL + S++VR+NSAALIE V++GT+S +LRAQIS+ DEIFEG+
Sbjct  184  DCVCIASDSGRINYLVNLLFHISIEVRVNSAALIEIVVAGTKSSDLRAQISSVDEIFEGV  243

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALA  538
            + +L  P+SY RALKIG+KALFALCL KQ RHKAV+AGA + LIDRL DFDKCDAERALA
Sbjct  244  IEMLKNPISYPRALKIGIKALFALCLVKQTRHKAVSAGAADILIDRLADFDKCDAERALA  303

Query  539  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaa  718
            T+ELLCR+P+GC AFA HALTVPLLVK ILKIS RATEYAAGALL++C++SEQ+QREA +
Sbjct  304  TIELLCRVPTGCTAFAGHALTVPLLVKKILKISDRATEYAAGALLALCTSSEQSQREAVS  363

Query  719  aGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            AG++TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED +A SDD+ CS VVPF
Sbjct  364  AGILTQLLLLVQSDCTDRAKRKAQMLLKLLRDSWPEDSSANSDDFICSEVVPF  416



>ref|XP_009792112.1| PREDICTED: U-box domain-containing protein 26-like [Nicotiana 
sylvestris]
Length=415

 Score =   399 bits (1025),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 227/293 (77%), Positives = 257/293 (88%), Gaps = 2/293 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            AL+RLRGLA +SDKNRSVI ANNARE+LL I+F  MDS+S EL+HESLA+LS+FPL E E
Sbjct  124  ALKRLRGLARDSDKNRSVISANNAREILLSIVFYRMDSDSSELNHESLALLSLFPLSEGE  183

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
               V+SDP RV YLVSLL +PS+DVR+NSAALIE V++G RS ELRAQIS+ D++FEG+V
Sbjct  184  CFFVASDPDRVSYLVSLLFHPSIDVRVNSAALIEVVVAGIRS-ELRAQISSIDDVFEGVV  242

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
            GILN PL+Y RALK+G+KALFALCL KQ+R KAV AGAVEALIDRLQDF+KCDAERALAT
Sbjct  243  GILNYPLAYPRALKVGIKALFALCLVKQHRQKAVAAGAVEALIDRLQDFEKCDAERALAT  302

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELL RIPSGCAA A+HALTVPLLVK ILK+S RATEYAAGALLS+C ASEQAQ+EAAAA
Sbjct  303  IELLSRIPSGCAALASHALTVPLLVKTILKVSERATEYAAGALLSLCLASEQAQKEAAAA  362

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNC-SYVVPF  877
            GV+TQLLLLVQSDCTERAKRKAQ+LLK LRDCWPED  A SDDY   S VVPF
Sbjct  363  GVLTQLLLLVQSDCTERAKRKAQLLLKQLRDCWPEDSIANSDDYFAYSDVVPF  415



>ref|XP_011092561.1| PREDICTED: U-box domain-containing protein 26-like [Sesamum indicum]
Length=415

 Score =   398 bits (1023),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 224/292 (77%), Positives = 254/292 (87%), Gaps = 0/292 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA +SDKNRSVI ANNAREVLL I FS++ S S +L+HE+LA+LSMF L E E
Sbjct  124  ALRRLRGLARDSDKNRSVIAANNAREVLLSIAFSDVGSESSDLNHEALAVLSMFALSEPE  183

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             + V+S+  RVGYLV LL + SVD+R+NSAA+IE+V++G RS ELRAQIS+AD +FEGIV
Sbjct  184  CLFVASESERVGYLVKLLFHSSVDIRVNSAAVIETVVAGIRSSELRAQISSADGVFEGIV  243

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
            GILN PL Y RALKIG+KALFALCL KQ+RHKAV AGAVEALIDRL +F+KCD+ERALAT
Sbjct  244  GILNYPLVYPRALKIGIKALFALCLVKQHRHKAVAAGAVEALIDRLPEFEKCDSERALAT  303

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            VELLCRIPSGCAAF +HALTVPLLVKIILKIS RATEYAAGALLS+CSASE+AQ +A AA
Sbjct  304  VELLCRIPSGCAAFESHALTVPLLVKIILKISDRATEYAAGALLSLCSASERAQADAVAA  363

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            GV+TQLLLLVQSDCTERAKRKAQMLLKLLRD WP D  A SDD+  S VVPF
Sbjct  364  GVLTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPRDSIARSDDFAGSDVVPF  415



>ref|XP_010107920.1| U-box domain-containing protein 26 [Morus notabilis]
 gb|EXC17320.1| U-box domain-containing protein 26 [Morus notabilis]
Length=416

 Score =   395 bits (1014),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 210/293 (72%), Positives = 247/293 (84%), Gaps = 1/293 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA +SDKNRSVI + N+REVLL I+F+   S+S ELS E+LA+  MFP  E E
Sbjct  124  ALRRLRGLARDSDKNRSVISSLNSREVLLDIVFAGASSDSSELSREALAVAVMFPFSEIE  183

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
               V+S+P RV YL  LL + S+DVR+NSAA+IE V++GTR+PELR+QISN DEIFEG++
Sbjct  184  CAAVASEPDRVAYLTRLLFHSSIDVRVNSAAMIEIVVAGTRTPELRSQISNVDEIFEGVI  243

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
             IL  P++Y RALK+G+KALFA+CL KQ RHKA+ AGA E LIDRL DF+KCDAERALAT
Sbjct  244  EILRSPIAYPRALKVGIKALFAMCLVKQTRHKAIAAGAAEILIDRLADFEKCDAERALAT  303

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            VELLCRIP+GC+A AAHALTVPLLVKIILKIS RATEYAAGAL+S+CSASEQ+QREA AA
Sbjct  304  VELLCRIPAGCSALAAHALTVPLLVKIILKISDRATEYAAGALVSLCSASEQSQREAVAA  363

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCS-YVVPF  877
            G++TQLLLLVQSDCT+RAKRKAQ+LLKLLRD WPED    SDD+ CS  VVPF
Sbjct  364  GILTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSIRNSDDFACSEVVVPF  416



>gb|ABK93469.1| unknown [Populus trichocarpa]
Length=413

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 211/292 (72%), Positives = 245/292 (84%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA +SDKNRSVI ++N REVL+ ++FS   S S +LSHESLAIL +FPL E +
Sbjct  124  ALRRLRGLARDSDKNRSVISSHNVREVLVNLVFST--SQSSDLSHESLAILVLFPLTEFD  181

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             V +SS+P R+ YL +LL + S++VR+NSAALIE+V++GTRS +LR QISN + IFEG++
Sbjct  182  CVGISSEPERISYLANLLFHSSIEVRVNSAALIENVIAGTRSSDLRLQISNTEIIFEGVI  241

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
             IL  PLS  RALKIG+KALFALCL KQ RHKAVTAGA E LIDRL DFDKCDAERALAT
Sbjct  242  EILKNPLSSPRALKIGIKALFALCLVKQTRHKAVTAGAAETLIDRLADFDKCDAERALAT  301

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELLCRI  GCAAFAAHALTVPLLVK ILKIS RATEYAAGALL++CSASE +Q+EA  A
Sbjct  302  IELLCRIQVGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLALCSASELSQKEAVCA  361

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            G++TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED    SDD+ CS VVPF
Sbjct  362  GILTQLLLLVQSDCTDRAKRKAQMLLKLLRDAWPEDSVGNSDDFLCSEVVPF  413



>ref|XP_002313124.2| U-box domain-containing family protein [Populus trichocarpa]
 gb|EEE87079.2| U-box domain-containing family protein [Populus trichocarpa]
Length=413

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 211/292 (72%), Positives = 245/292 (84%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA +SDKNRSVI ++N REVL+ ++FS   S S +LSHESLAIL +FPL E +
Sbjct  124  ALRRLRGLARDSDKNRSVISSHNVREVLVNLVFST--SQSSDLSHESLAILVLFPLTEFD  181

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             V +SS+P R+ YL +LL + S++VR+NSAALIE+V++GTRS +LR QISN + IFEG++
Sbjct  182  CVGISSEPERISYLANLLFHSSIEVRVNSAALIENVIAGTRSSDLRLQISNTEIIFEGVI  241

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
             IL  PLS  RALKIG+KALFALCL KQ RHKAVTAGA E LIDRL DFDKCDAERALAT
Sbjct  242  EILKNPLSSPRALKIGIKALFALCLVKQTRHKAVTAGAAETLIDRLADFDKCDAERALAT  301

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELLCRI  GCAAFAAHALTVPLLVK ILKIS RATEYAAGALL++CSASE +Q+EA  A
Sbjct  302  IELLCRIQVGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLALCSASELSQKEAVCA  361

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            G++TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED    SDD+ CS VVPF
Sbjct  362  GILTQLLLLVQSDCTDRAKRKAQMLLKLLRDAWPEDSVGNSDDFLCSEVVPF  413



>ref|XP_011088242.1| PREDICTED: U-box domain-containing protein 26-like [Sesamum indicum]
Length=415

 Score =   392 bits (1007),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 225/292 (77%), Positives = 254/292 (87%), Gaps = 0/292 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA +SDKNRSVI ANNARE+LL I+F+++ S   EL+ ESLAILSMF L E E
Sbjct  124  ALRRLRGLARDSDKNRSVIAANNAREILLSIVFADVSSEPSELNLESLAILSMFTLSEPE  183

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             + V+SD  RV YLV+LL + S+DVR+NSAA+IE V++G RSPELR QIS+AD +FEGIV
Sbjct  184  CLYVASDADRVRYLVNLLFHSSIDVRVNSAAMIEIVVAGIRSPELRVQISSADGVFEGIV  243

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
            GILN PL YSRALKIG+KALFALCL KQ+R KAV AGAVEALID+L +F+KCDAERALAT
Sbjct  244  GILNYPLLYSRALKIGIKALFALCLVKQHRQKAVAAGAVEALIDKLAEFEKCDAERALAT  303

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            VELLCRIPSGCAAFA+HALTVPLLVKIILKIS RATEYAAGALLS+CSASE+AQ+EA AA
Sbjct  304  VELLCRIPSGCAAFASHALTVPLLVKIILKISDRATEYAAGALLSLCSASERAQQEAVAA  363

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            GV+TQLLLLVQSDCTERAKRKAQMLLKLLR+ WP D  A SDDY  S VVPF
Sbjct  364  GVLTQLLLLVQSDCTERAKRKAQMLLKLLRNSWPHDSLANSDDYAGSDVVPF  415



>ref|XP_011000686.1| PREDICTED: U-box domain-containing protein 26-like isoform X1 
[Populus euphratica]
 ref|XP_011000695.1| PREDICTED: U-box domain-containing protein 26-like isoform X2 
[Populus euphratica]
Length=413

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 211/292 (72%), Positives = 247/292 (85%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA +SDKNRSVI ++N REVL+ ++FS+  S+   LSHESLAIL MFPL E +
Sbjct  124  ALRRLRGLARDSDKNRSVISSHNVREVLVNLVFSSSQSSD--LSHESLAILVMFPLTEFD  181

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             V +SS+P R+GYL +LL + S++VR+NSAALIE+V++GTRSP+LR QISN + IF+G++
Sbjct  182  CVGISSEPERIGYLANLLFHSSIEVRVNSAALIENVIAGTRSPDLRLQISNTEIIFQGVI  241

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
             IL  PLS  RALK+G+KALFALCL KQ RHKAVTAGA E LIDRL DFDKCDAERALAT
Sbjct  242  EILKNPLSSPRALKVGIKALFALCLVKQTRHKAVTAGAAETLIDRLADFDKCDAERALAT  301

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELLCRI  GCAAFAAHALTVPLLVK ILKIS RATEYAAGALL++CSASE +Q+EA  A
Sbjct  302  IELLCRIQVGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLALCSASELSQKEAVCA  361

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            G++TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED    SDD+ CS VVPF
Sbjct  362  GILTQLLLLVQSDCTDRAKRKAQMLLKLLRDAWPEDSVGNSDDFLCSDVVPF  413



>ref|XP_002285110.1| PREDICTED: U-box domain-containing protein 26 [Vitis vinifera]
Length=415

 Score =   385 bits (990),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 215/292 (74%), Positives = 253/292 (87%), Gaps = 0/292 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            A++RLRGLA +SDKNRS+I ++N +EVLL ++FS+ + +S EL HESLA+L MFPL E+E
Sbjct  124  AVKRLRGLARDSDKNRSIIGSHNVQEVLLPVIFSDSECDSAELKHESLALLVMFPLSESE  183

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
               V+S P RV +LVSLL + S++VR+NSAALIE V++GTRS +LRAQISN DEIFEGI 
Sbjct  184  CAFVASQPDRVAHLVSLLFHASIEVRVNSAALIEIVVAGTRSLDLRAQISNVDEIFEGIT  243

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
            GILN PL+Y RALK+G+KALFALCLAKQ RHKAV AGAV ALIDRL DF+KCD ERALAT
Sbjct  244  GILNYPLAYPRALKVGIKALFALCLAKQSRHKAVAAGAVTALIDRLADFEKCDVERALAT  303

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            VELLCR+P+GCAAFAAHALTVPLLV+ ILK+S RATEYAAGALLS+CSA+EQ+QREA +A
Sbjct  304  VELLCRVPAGCAAFAAHALTVPLLVRKILKVSDRATEYAAGALLSLCSAAEQSQREAVSA  363

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            GV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WPED    SDD+ CS VVPF
Sbjct  364  GVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVVNSDDFGCSDVVPF  415



>ref|XP_011005992.1| PREDICTED: U-box domain-containing protein 26-like [Populus euphratica]
Length=413

 Score =   384 bits (987),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 208/292 (71%), Positives = 244/292 (84%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA +SDKNRS+I ++N RE+L+ ++FS+  S S ELSHESLAIL MFPL E +
Sbjct  124  ALRRLRGLARDSDKNRSLISSHNVREILVNLVFSS--SQSLELSHESLAILVMFPLTEFD  181

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             V ++SDP R+  L +LL + S++VR+NSAALIE+V++GTRS +LR QISN + IFEG++
Sbjct  182  CVAIASDPERISCLANLLFHSSIEVRVNSAALIENVVAGTRSSDLRLQISNREIIFEGVI  241

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
             IL  PLS  RALKIG+K LFALCL KQ RHKAV+AGA E LIDRL D DKCDAERALAT
Sbjct  242  DILKNPLSSPRALKIGIKGLFALCLGKQTRHKAVSAGAAETLIDRLADLDKCDAERALAT  301

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELLCRI  GCAAFAAHALTVPLLVK ILKIS RATEYAAGALL++CSASEQ+Q+EA  A
Sbjct  302  IELLCRIQVGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLALCSASEQSQKEAVCA  361

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            G++TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED    SDD+ CS VVPF
Sbjct  362  GILTQLLLLVQSDCTDRAKRKAQMLLKLLRDSWPEDSVGNSDDFVCSEVVPF  413



>emb|CAN74163.1| hypothetical protein VITISV_026443 [Vitis vinifera]
Length=476

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 215/292 (74%), Positives = 253/292 (87%), Gaps = 0/292 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            A++RLRGLA +SDKNRS+I ++N +EVLL ++FS+ + +S EL HESLA+L MFPL E+E
Sbjct  185  AVKRLRGLARDSDKNRSIIGSHNVQEVLLPVIFSDSECDSAELKHESLALLVMFPLSESE  244

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
               V+S P RV +LVSLL + S++VR+NSAALIE V++GTRS +LRAQISN DEIFEGI 
Sbjct  245  CAFVASQPDRVAHLVSLLFHASIEVRVNSAALIEIVVAGTRSLDLRAQISNVDEIFEGIT  304

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
            GILN PL+Y RALK+G+KALFALCLAKQ RHKAV AGAV ALIDRL DF+KCD ERALAT
Sbjct  305  GILNYPLAYPRALKVGIKALFALCLAKQSRHKAVAAGAVTALIDRLADFEKCDVERALAT  364

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            VELLCR+P+GCAAFAAHALTVPLLV+ ILK+S RATEYAAGALLS+CSA+EQ+QREA +A
Sbjct  365  VELLCRVPAGCAAFAAHALTVPLLVRKILKVSDRATEYAAGALLSLCSAAEQSQREAVSA  424

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            GV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WPED    SDD+ CS VVPF
Sbjct  425  GVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVVNSDDFGCSDVVPF  476



>ref|XP_002306161.2| hypothetical protein POPTR_0004s14720g [Populus trichocarpa]
 gb|EEE86672.2| hypothetical protein POPTR_0004s14720g [Populus trichocarpa]
Length=413

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 207/292 (71%), Positives = 243/292 (83%), Gaps = 2/292 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA +SDKNRS+I ++N RE+L+ ++FS+  S S ELSHESLAIL MFPL E +
Sbjct  124  ALRRLRGLARDSDKNRSLISSHNVREILVNLVFSS--SQSLELSHESLAILVMFPLTEFD  181

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             V ++SDP R+  L +LL + S++VR+NSAALIE+V++GTRS +LR QISN + IFEG++
Sbjct  182  CVAIASDPERISCLANLLFHSSIEVRVNSAALIENVIAGTRSSDLRLQISNMEIIFEGVI  241

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
             IL  PLS  RALKIG+K LFALCL KQ RHKAV+AGA E LIDRL D DKCDAERALAT
Sbjct  242  DILKNPLSSPRALKIGIKGLFALCLVKQTRHKAVSAGAAETLIDRLADLDKCDAERALAT  301

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELLCRI  GCAAF AHALTVPLLVK ILKIS RATEYAAGALL++CSASEQ+Q+EA  A
Sbjct  302  IELLCRIQVGCAAFVAHALTVPLLVKTILKISDRATEYAAGALLALCSASEQSQKEAVCA  361

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            G++TQLLLLVQSDCT+RAKRKAQMLLKLLRD WPED    SDD+ CS VVPF
Sbjct  362  GILTQLLLLVQSDCTDRAKRKAQMLLKLLRDSWPEDSAGNSDDFVCSEVVPF  413



>ref|XP_010270217.1| PREDICTED: U-box domain-containing protein 26-like [Nelumbo nucifera]
Length=428

 Score =   382 bits (980),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 210/293 (72%), Positives = 242/293 (83%), Gaps = 1/293 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSP-ELSHESLAILSMFPLPEA  178
            ALRRLRGLA +SDKNRSVI A+NA + LL I+F+      P EL+HESLA+L M PL E+
Sbjct  136  ALRRLRGLARDSDKNRSVISASNAPDTLLPIVFAADKEREPDELTHESLALLVMLPLVES  195

Query  179  ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
            +   V+S P RV +L SLLS+ S++VR+N+AALIE V +GTRS E R  I NAD + EGI
Sbjct  196  QCESVASQPDRVTFLASLLSHSSIEVRVNAAALIEIVAAGTRSVEHRILIGNADGVMEGI  255

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALA  538
              IL+ PL+Y RALK+G+KALFALCL KQ RHKAV+AGAV+ALIDRL DF+KCDAERALA
Sbjct  256  TRILSNPLAYPRALKVGIKALFALCLVKQSRHKAVSAGAVDALIDRLADFEKCDAERALA  315

Query  539  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaa  718
            TVELLCRIP GCAAFA HALTVPLLVKIILKIS RATEYAAGALLS+CSAS+Q QR+A A
Sbjct  316  TVELLCRIPEGCAAFAEHALTVPLLVKIILKISDRATEYAAGALLSLCSASKQLQRDAVA  375

Query  719  aGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            AGV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WP+D  A SDD+ CS V PF
Sbjct  376  AGVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPDDSIANSDDFGCSDVSPF  428



>gb|EPS57772.1| hypothetical protein M569_17045 [Genlisea aurea]
Length=414

 Score =   381 bits (978),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 206/290 (71%), Positives = 245/290 (84%), Gaps = 0/290 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA +S+KNRSVI ANN R+V + +LF+ + S   EL+ ESL ILSMF L E E
Sbjct  124  ALRRLRGLARDSEKNRSVIAANNGRQVFISLLFAGVGSEPSELNLESLGILSMFSLLEQE  183

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             + ++SD  RV YLV+LL + S+DVR+NSAA++E  ++G RSPELRA+IS+ D +F GIV
Sbjct  184  CLYIASDLDRVRYLVNLLFHSSIDVRVNSAAVVEVTVAGIRSPELRARISSLDGVFRGIV  243

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
            GILN PL+Y  ALKIG+KALFALCLAKQ+RH+AV+AGAVE+LIDRL +F+KCDAERALAT
Sbjct  244  GILNYPLAYPHALKIGIKALFALCLAKQHRHRAVSAGAVESLIDRLAEFEKCDAERALAT  303

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            VELLCR+P GCAAFA+HALTVPLLVKIILKIS RATEYAAGALLS+CSASEQ+Q EA AA
Sbjct  304  VELLCRVPDGCAAFASHALTVPLLVKIILKISDRATEYAAGALLSLCSASEQSQGEAVAA  363

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVV  871
            GV+TQL+LLVQSDCTERAKRKAQMLLKLLR+ WP +    SDD+  S VV
Sbjct  364  GVLTQLILLVQSDCTERAKRKAQMLLKLLRNSWPLESMCNSDDFAGSDVV  413



>ref|XP_007042451.1| Plant U-box 26 [Theobroma cacao]
 gb|EOX98282.1| Plant U-box 26 [Theobroma cacao]
Length=416

 Score =   378 bits (971),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 200/292 (68%), Positives = 241/292 (83%), Gaps = 0/292 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRL+GLA +SDKNRSVI ++NARE+L+ I+FS+  S S EL+ E+LA+L MF L E+E
Sbjct  125  ALRRLKGLARDSDKNRSVISSHNAREILINIVFSDTGSGSSELNQEALALLVMFQLTESE  184

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
               ++SD  +V YL  LL + S++VR+NSA+LIE V++GTRS +LRAQISN DEIFEG+ 
Sbjct  185  CASIASDSNKVIYLSKLLFHSSIEVRVNSASLIEIVVAGTRSSDLRAQISNVDEIFEGVT  244

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
             +L    SY RALKI ++ALFALCL KQ RHKAV AGA E LIDRL D DKCDAERALAT
Sbjct  245  DLLKNLNSYPRALKISIRALFALCLVKQTRHKAVQAGAAETLIDRLADLDKCDAERALAT  304

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELLCRIPSGC+AFAAHALTVPLLVK ILKIS RATE++AGAL+++CS SEQ+QR+A +A
Sbjct  305  IELLCRIPSGCSAFAAHALTVPLLVKTILKISDRATEHSAGALVALCSESEQSQRDAVSA  364

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            G++TQLLLLVQSDCT+RAKRKAQ LLKLLRD WPED    SDD+ CS VVPF
Sbjct  365  GILTQLLLLVQSDCTDRAKRKAQTLLKLLRDSWPEDSIGNSDDFACSEVVPF  416



>ref|XP_008456137.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis melo]
Length=425

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 245/297 (82%), Gaps = 5/297 (2%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNS----PELSHESLAILSMFPL  169
            ALRRL+GLA +SDKNRS+I + NARE+LL ++FSN+DS S    P+LS ESLA+L M PL
Sbjct  128  ALRRLKGLARDSDKNRSLISSLNAREILLDVVFSNLDSGSDSFSPDLSRESLALLVMLPL  187

Query  170  PEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
             E+E V+V+SDP R+GYL  LL + S++VR+N+AALIE+V++GTR+ ELR QI   DE+F
Sbjct  188  TESECVLVASDPQRIGYLSHLLFDSSIEVRINAAALIETVIAGTRASELRTQICGIDELF  247

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAER  529
            EG+V IL  P +Y RALK+GVKALFALCL KQ RHKAV+AGA E +IDR  D +K DAER
Sbjct  248  EGVVEILRDPTAYPRALKVGVKALFALCLVKQTRHKAVSAGAAEIIIDRFPDLEKYDAER  307

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqre  709
            ALAT+EL+CR+P+GC AFAAHALTVPLLVK+ILKIS RATE A GAL+S+CSASE+ +RE
Sbjct  308  ALATIELICRVPTGCDAFAAHALTVPLLVKVILKISDRATESAVGALVSLCSASEENRRE  367

Query  710  aaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCS-YVVPF  877
            A AAG++TQLLLLVQSDCTER KRK+Q+LLKLLRD WP++    SDDY CS  VVPF
Sbjct  368  AVAAGILTQLLLLVQSDCTERVKRKSQVLLKLLRDSWPQESVGNSDDYGCSEIVVPF  424



>ref|XP_004140703.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus]
 ref|XP_004171341.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus]
 gb|KGN57520.1| hypothetical protein Csa_3G203270 [Cucumis sativus]
Length=425

 Score =   373 bits (958),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 200/297 (67%), Positives = 244/297 (82%), Gaps = 5/297 (2%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNS----PELSHESLAILSMFPL  169
            ALRRL+GLA +SDKNRS+I + NARE+LL ++FSN+DS S    P+LS ESLA+L M PL
Sbjct  128  ALRRLKGLARDSDKNRSLISSLNAREILLDVVFSNLDSGSDSFSPDLSRESLALLVMLPL  187

Query  170  PEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
             E+E V+V+SDP R+GYL  LL + S++ R+N+AALIE+V++GTR+ ELR QI   DE+F
Sbjct  188  TESECVLVASDPQRIGYLSHLLFDSSIEDRINAAALIETVIAGTRASELRTQICGIDELF  247

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAER  529
            EG+V IL  P +Y RALK+GVKALFALCL KQ RHKAV+AGA E +IDR  D +K DAER
Sbjct  248  EGVVEILRDPTAYPRALKVGVKALFALCLVKQTRHKAVSAGAAEIIIDRFPDLEKYDAER  307

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqre  709
            ALAT+EL+CRIP+GC AFAAHALTVPLLVK+ILKIS RATE A GAL+S+CSASE+ +RE
Sbjct  308  ALATIELICRIPTGCDAFAAHALTVPLLVKVILKISDRATESAVGALVSLCSASEENRRE  367

Query  710  aaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCS-YVVPF  877
            A AAG++TQLLLLVQSDCTER KRK+Q+LLKLLRD WP++    SDDY CS  VVPF
Sbjct  368  AVAAGILTQLLLLVQSDCTERVKRKSQVLLKLLRDSWPQESVGNSDDYACSEIVVPF  424



>ref|XP_010263503.1| PREDICTED: U-box domain-containing protein 26-like [Nelumbo nucifera]
Length=416

 Score =   372 bits (955),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 207/293 (71%), Positives = 241/293 (82%), Gaps = 1/293 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSN-SPELSHESLAILSMFPLPEA  178
            ALRRLRGLA +SDKNRS+I  +N  EVLL I+F+  +SN + EL+HESLA+L MFPL EA
Sbjct  124  ALRRLRGLAKDSDKNRSLISTHNVPEVLLPIVFAGPESNENDELTHESLALLVMFPLDEA  183

Query  179  ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
                V+S+  RV +L  LLS+  ++VR+N+AALIE V++GTRS E R  I NAD + EGI
Sbjct  184  HCEFVASETDRVAFLSFLLSHSCIEVRVNAAALIEMVVAGTRSLENRILIGNADGVLEGI  243

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALA  538
              ILN PL+Y RALK+G+KALFALCL KQ RH AV+AGAVEALID+L DF+KCDAERALA
Sbjct  244  TRILNHPLAYPRALKVGIKALFALCLVKQNRHMAVSAGAVEALIDKLADFEKCDAERALA  303

Query  539  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaa  718
            TVELLCRIP+G +AFA HALTVPLLVKIILKIS RATEYA GAL+S+CSASEQ QR+A A
Sbjct  304  TVELLCRIPAGRSAFAEHALTVPLLVKIILKISDRATEYATGALVSLCSASEQLQRDAVA  363

Query  719  aGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            AGV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WPED  A SDD+ CS V PF
Sbjct  364  AGVVTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSIANSDDFACSDVAPF  416



>ref|XP_009341339.1| PREDICTED: U-box domain-containing protein 26 [Pyrus x bretschneideri]
Length=395

 Score =   366 bits (939),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 200/293 (68%), Positives = 247/293 (84%), Gaps = 1/293 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA + DKNRS I + N+RE+LL ++FS+ +S S EL+HE+LA+L +FPLPE++
Sbjct  103  ALRRLRGLARDLDKNRSTISSQNSREILLELVFSDTNSESSELTHEALALLVLFPLPESD  162

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
               V+SDP R+ YL  L+ +PS++V++NSAALIE+VL+G+R+ ELRAQ+SN DEI  G+V
Sbjct  163  CAAVASDPDRIAYLSHLVQHPSMEVQVNSAALIENVLAGSRTAELRAQVSNVDEIHHGVV  222

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
             IL  P++Y RAL+IGVKA+FALCL K+ R+KAV+AGA E LI+ L DF+KCD+ERALAT
Sbjct  223  SILRNPIAYPRALRIGVKAVFALCLVKETRNKAVSAGAPETLINVLADFEKCDSERALAT  282

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELLCR+P GCAAFAAH LTVPLLVK ILKIS RATEYAAGALLS+CSASE+++ EA AA
Sbjct  283  IELLCRVPEGCAAFAAHGLTVPLLVKTILKISDRATEYAAGALLSLCSASEKSKNEAVAA  342

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCS-YVVPF  877
            GV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WPED    SDD+ CS  VVPF
Sbjct  343  GVLTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELVVPF  395



>ref|XP_007199948.1| hypothetical protein PRUPE_ppa006352mg [Prunus persica]
 gb|EMJ01147.1| hypothetical protein PRUPE_ppa006352mg [Prunus persica]
Length=416

 Score =   364 bits (934),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 200/293 (68%), Positives = 246/293 (84%), Gaps = 1/293 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA + DKNRS I + N+RE+L+ ++F++  S S EL+HE+LA+L +FPLPE++
Sbjct  124  ALRRLRGLARDLDKNRSTISSQNSREILVQLVFADTGSESSELTHEALALLVLFPLPESD  183

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
               V+SDP RV YL  L+ + S++VR+NSAALIE+VL+G+R+ ELRA+ISN DEI +G+V
Sbjct  184  CAAVASDPDRVAYLAQLVQHSSMEVRVNSAALIENVLAGSRTAELRAEISNVDEIHQGVV  243

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
             IL  P++Y RALKIG+KALFALCL KQ R+KAV+AGA E LI+ L DF+KCD+ERALAT
Sbjct  244  SILRNPIAYPRALKIGIKALFALCLVKQTRNKAVSAGAPETLINTLADFEKCDSERALAT  303

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELLCR+P GC AFAAHALTVPLLVK ILKIS RATEYAAGALLS+CSASE++Q +A AA
Sbjct  304  IELLCRVPDGCTAFAAHALTVPLLVKTILKISDRATEYAAGALLSLCSASEKSQNDAVAA  363

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCS-YVVPF  877
            GV+TQLLLLVQSDCT+RAKRKAQ+LLKLLRD WPED    SDD+ CS  VVPF
Sbjct  364  GVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELVVPF  416



>ref|XP_008236490.1| PREDICTED: U-box domain-containing protein 26-like [Prunus mume]
Length=436

 Score =   364 bits (935),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 200/293 (68%), Positives = 246/293 (84%), Gaps = 1/293 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA + DKNRS I + N+RE+L+ ++F++  S S EL+HE+LA+L +FPLPE++
Sbjct  144  ALRRLRGLARDLDKNRSTISSQNSREILVQLVFADTGSESSELTHEALALLVLFPLPESD  203

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
               V+SDP RV YL  L+ + S++VR+NSAALIE+VL+G+R+ ELRA+ISN DEI +G+V
Sbjct  204  CAAVASDPDRVAYLARLVQHSSMEVRVNSAALIENVLAGSRTAELRAEISNVDEIHQGVV  263

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
             IL  P++Y RALKIG+KALFALCL KQ R+KAV+AGA E LI+ L DF+KCD+ERALAT
Sbjct  264  SILRNPIAYPRALKIGIKALFALCLVKQTRNKAVSAGAPETLINTLADFEKCDSERALAT  323

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELLCR+P GC AFAAHALTVPLLVK ILKIS RATEYAAGALLS+CSASE++Q +A AA
Sbjct  324  IELLCRVPDGCTAFAAHALTVPLLVKTILKISDRATEYAAGALLSLCSASEKSQNDAVAA  383

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCS-YVVPF  877
            GV+TQLLLLVQSDCT+RAKRKAQ+LLKLLRD WPED    SDD+ CS  VVPF
Sbjct  384  GVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELVVPF  436



>ref|XP_004309747.1| PREDICTED: U-box domain-containing protein 26-like [Fragaria 
vesca subsp. vesca]
Length=415

 Score =   362 bits (930),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 241/291 (83%), Gaps = 2/291 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILAN-NAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEA  178
            ALRRLRGLA + DKNR++I ++ +ARE+L+ I+F +   +S EL+ E+LA+L M PL E+
Sbjct  125  ALRRLRGLARDLDKNRAIISSHISAREILVNIVFGDSGPDS-ELNREALALLVMLPLAES  183

Query  179  ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
            + V V+SDP RVG+L  LL + S++VR+NSAALIE++L+G+R+ ELRAQISN DEI  G+
Sbjct  184  DCVAVASDPDRVGFLARLLFHNSMEVRVNSAALIENLLAGSRTAELRAQISNVDEIHHGV  243

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALA  538
            + IL  P+++ RALKIG+KALFALCL KQ R KAV AGA E LI+ L DF+KCD+ERALA
Sbjct  244  IEILRNPIAHPRALKIGIKALFALCLVKQTRDKAVAAGAPETLINTLADFEKCDSERALA  303

Query  539  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaa  718
            T+ELLCR+P GCAAFAAHALTVPLLVK ILKIS RATEYAAGALLS+CS SEQ+Q +A A
Sbjct  304  TIELLCRVPEGCAAFAAHALTVPLLVKTILKISDRATEYAAGALLSLCSESEQSQNDAVA  363

Query  719  aGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVV  871
            AG+MTQLLLLVQSDCT+RAKRKAQ+LLKLLRD WPED    SDD+ CS VV
Sbjct  364  AGIMTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSDVV  414



>emb|CDO97189.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   360 bits (924),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 206/282 (73%), Positives = 243/282 (86%), Gaps = 3/282 (1%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAESVIVSSDPVR  211
            +SDKNR++I ANN  E+LL ++F    S+S +LSHE+LA+L++F L E +  +V+SDP R
Sbjct  134  DSDKNRALISANNVSELLLSVVFH---SDSADLSHEALALLALFQLSEPQCALVASDPDR  190

Query  212  VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYS  391
            V YLVSLLS+ SVDVR+NSAA+IE  +SGTRSPELR+Q+SNA+ IFEG++GILN PL+Y 
Sbjct  191  VSYLVSLLSHSSVDVRVNSAAVIEMAVSGTRSPELRSQVSNAEGIFEGVIGILNYPLAYP  250

Query  392  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  571
            RA KIGVKALFALCL KQ+R +AVTAGAV+AL+D L DF+KCDAERALATVELLCRIPSG
Sbjct  251  RASKIGVKALFALCLVKQHRQRAVTAGAVDALVDGLADFEKCDAERALATVELLCRIPSG  310

Query  572  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  751
            C AF+AHALTVPLLVKIILKIS RATEYAAGALLS+CSAS+QAQR+A  AGV+TQLLLLV
Sbjct  311  CEAFSAHALTVPLLVKIILKISDRATEYAAGALLSLCSASDQAQRDAVVAGVLTQLLLLV  370

Query  752  QSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            QSDCT+RAKRKAQMLLKLLRD WPED    SDD+ CS VV F
Sbjct  371  QSDCTDRAKRKAQMLLKLLRDSWPEDSIGNSDDFGCSDVVAF  412



>ref|XP_006422990.1| hypothetical protein CICLE_v10028522mg [Citrus clementina]
 gb|ESR36230.1| hypothetical protein CICLE_v10028522mg [Citrus clementina]
Length=418

 Score =   350 bits (897),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 203/295 (69%), Positives = 240/295 (81%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSN---SPELSHESLAILSMFPLP  172
            ALRRLRGLA +SDKNR +I ++N R +L  + F+N++ N   SPEL+HESLA+L MFPL 
Sbjct  124  ALRRLRGLARDSDKNRCLISSHNVRAILSQVFFTNINVNTASSPELAHESLALLVMFPLT  183

Query  173  EAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  352
            E E + ++SD  ++  L SLL + S++VR+NSAALIE VL+G RS ELRAQISN DEIFE
Sbjct  184  ETECMEIASDADKITSLSSLLFHSSIEVRVNSAALIEIVLAGMRSQELRAQISNLDEIFE  243

Query  353  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  532
            G++ IL    SY R LK+G+KALFALCL KQ RHKAV AGA E L+DRL DFDKCDAERA
Sbjct  244  GVIDILKNLSSYPRGLKVGIKALFALCLVKQTRHKAVAAGAAETLVDRLADFDKCDAERA  303

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqrea  712
            LATVELLCRIP+GCA FA HALTVPLLVK ILKIS RATEYAAGAL ++CSASE+ QR+A
Sbjct  304  LATVELLCRIPAGCAEFAEHALTVPLLVKTILKISDRATEYAAGALAALCSASERCQRDA  363

Query  713  aaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
             +AGV+TQLLLLVQSDCT+RAKRKAQ+LLKLLRD WP+D    SDD+ CS VVPF
Sbjct  364  VSAGVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPQDSIGNSDDFACSEVVPF  418



>ref|XP_006487052.1| PREDICTED: U-box domain-containing protein 26-like [Citrus sinensis]
 gb|KDO59728.1| hypothetical protein CISIN_1g014817mg [Citrus sinensis]
Length=418

 Score =   348 bits (894),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 202/295 (68%), Positives = 242/295 (82%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMD---SNSPELSHESLAILSMFPLP  172
            ALRRLRGLA +SDKNRS+I ++N R +L  + F+N++   ++SPEL+HESLA+L MFPL 
Sbjct  124  ALRRLRGLARDSDKNRSLISSHNVRAILSQVFFTNINVKTASSPELAHESLALLVMFPLT  183

Query  173  EAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  352
            E E + ++SD  ++  L SLL + S++VR+NSAALIE VL+G RS ELRAQISN DEIFE
Sbjct  184  ETECMEIASDADKITSLSSLLFHSSIEVRVNSAALIEIVLAGMRSQELRAQISNLDEIFE  243

Query  353  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  532
            G++ IL    SY R LK+G+KALFALCL KQ R+KAV AGA E L+DRL DFDKCDAERA
Sbjct  244  GVIDILKNLSSYPRGLKVGIKALFALCLVKQTRYKAVAAGAAETLVDRLADFDKCDAERA  303

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqrea  712
            LATVELLCRIP+GCA FA HALTVPLLVK ILKIS RATEYAAGAL ++CSASE+ QR+A
Sbjct  304  LATVELLCRIPAGCAEFAEHALTVPLLVKTILKISDRATEYAAGALAALCSASERCQRDA  363

Query  713  aaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
             +AGV+TQLLLLVQSDCT+RAKRKAQ+LLKLLRD WP+D    SDD+ CS VVPF
Sbjct  364  VSAGVLTQLLLLVQSDCTDRAKRKAQLLLKLLRDSWPQDSIGNSDDFACSEVVPF  418



>gb|EPS67592.1| hypothetical protein M569_07183, partial [Genlisea aurea]
Length=419

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 183/285 (64%), Positives = 232/285 (81%), Gaps = 0/285 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            A+RRLRGLA +S+KNRS I +++ R V + +LF+++ S   EL+ ESLAI+SM  L E +
Sbjct  134  AVRRLRGLARDSEKNRSAIASSDGRRVFVSLLFADVSSEPSELNLESLAIISMLGLSEQD  193

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             + ++SD  RV YLV+LLS+ S+DVR+NSAA IE +++G RS +LRAQI + D +FEGIV
Sbjct  194  CLYLASDLDRVKYLVNLLSHSSIDVRINSAAAIEMIVAGVRSSDLRAQIGSLDGVFEGIV  253

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
            GILN PL+   ALKIG+KALFALCLAKQ+RH AV+AGA  ++I+RL +F+KC+AE+ALAT
Sbjct  254  GILNYPLANPHALKIGIKALFALCLAKQHRHVAVSAGAAGSIINRLAEFEKCEAEKALAT  313

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            VELLCRIP G AAFA+H LT+PLLVKIILKIS RATEYA+GALLS+C+ S+Q Q EA AA
Sbjct  314  VELLCRIPDGRAAFASHPLTIPLLVKIILKISDRATEYASGALLSLCTMSDQTQAEAVAA  373

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYN  856
            GV+ QL+LLVQSDCTERAKRKAQMLLKLLR+ WP+D     DD+ 
Sbjct  374  GVLNQLILLVQSDCTERAKRKAQMLLKLLRNSWPQDDFEYHDDFG  418



>ref|XP_003518699.1| PREDICTED: U-box domain-containing protein 26-like [Glycine max]
Length=415

 Score =   346 bits (888),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 199/295 (67%), Positives = 241/295 (82%), Gaps = 6/295 (2%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ++RRLR LA +SDKNRS+I ++N R++LL I+F+N    S EL +ESLA+L MFPL E+E
Sbjct  124  SIRRLRQLARDSDKNRSLIASHNVRQILLPIVFNN---GSDELKNESLALLVMFPLGESE  180

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
               ++SD V++GYL  +L++ S DVR+NSAALIE V++GT SPELRA++S+ DEI++G+V
Sbjct  181  CASLASDSVKIGYLSRMLTHNSFDVRVNSAALIEIVVAGTHSPELRAEVSSVDEIYDGVV  240

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
             +L  P+S+ RALKIG+KALFALCL K  R KAV AG    L+DRL DF+KCDAERALAT
Sbjct  241  DLLRSPISHPRALKIGIKALFALCLVKNTRQKAVDAGTPAVLVDRLADFEKCDAERALAT  300

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            VELLCRIP+GC AFA HALTVP+LVKIILKIS RATEYAAGALLS+CS SE+ QREA AA
Sbjct  301  VELLCRIPAGCEAFAGHALTVPMLVKIILKISDRATEYAAGALLSLCSESERCQREAVAA  360

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED-FTAISDDYNCSY--VVPF  877
            GV+TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D     SDD+ CS   VVPF
Sbjct  361  GVLTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPQDSIGNNSDDFACSQVVVVPF  415



>ref|XP_008373128.1| PREDICTED: U-box domain-containing protein 26-like [Malus domestica]
Length=416

 Score =   346 bits (888),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 202/293 (69%), Positives = 243/293 (83%), Gaps = 1/293 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA + DKNRS I + N+RE+LL ++FS+ +S S EL+HE+LA+L +FPL E++
Sbjct  124  ALRRLRGLARDLDKNRSTISSQNSREILLELVFSDTNSESSELTHEALALLVLFPLLESD  183

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
               V+SDP RV YL  L+ +PS++VR+NSAALIE+VL+G+R+ ELRAQ+SN DEI  G+V
Sbjct  184  CAAVASDPDRVAYLSHLVQHPSMEVRVNSAALIENVLAGSRTAELRAQVSNVDEIHHGVV  243

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
             IL  P +Y RALKIGVKA+FALCL K+ R+KAV+AGA E LI+ L DF+K D+ERALAT
Sbjct  244  SILRNPJAYPRALKIGVKAVFALCLVKETRNKAVSAGAPETLINVLADFEKYDSERALAT  303

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaa  721
            +ELLCR+P GCAAFAAH LTVPLLVK ILKIS RATEYAAGALLS+CSASE+ Q EA AA
Sbjct  304  IELLCRVPEGCAAFAAHGLTVPLLVKTILKISDRATEYAAGALLSLCSASEKNQNEAVAA  363

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCS-YVVPF  877
            GV+TQLLLLVQSDCTERAKRKAQ+LLKLLRD WPED    SDD+ CS  VVPF
Sbjct  364  GVLTQLLLLVQSDCTERAKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELVVPF  416



>ref|XP_007153588.1| hypothetical protein PHAVU_003G048200g [Phaseolus vulgaris]
 gb|ESW25582.1| hypothetical protein PHAVU_003G048200g [Phaseolus vulgaris]
Length=413

 Score =   345 bits (886),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 197/287 (69%), Positives = 234/287 (82%), Gaps = 6/287 (2%)
 Frame = +2

Query  23   LACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAESVIVSSD  202
            LA +SDKNRS+I ++N R++LL I+F      + EL+HE+LA+L +FPL E+E   ++SD
Sbjct  131  LARDSDKNRSLISSHNVRQILLPIVFHG----ASELNHEALALLVLFPLGESECAALASD  186

Query  203  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  382
              +V YL  LLS+ S+DVR+NSAALIE V++GT SPELRA +S  DEI++G+V +L  P+
Sbjct  187  SEKVNYLSRLLSHNSLDVRVNSAALIEIVVAGTHSPELRACVSEVDEIYDGVVDLLRSPI  246

Query  383  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  562
            SY RALKIG+KALFALCL KQ RHKAV AGA   L+DRL DF+KCDAERALATVELLCRI
Sbjct  247  SYPRALKIGIKALFALCLVKQTRHKAVAAGAPAVLVDRLADFEKCDAERALATVELLCRI  306

Query  563  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLL  742
            P+GC AFA HALTVP+LVKIILKISHRATEYAAGALLS+CS SE+ QREA  AGV+TQLL
Sbjct  307  PAGCEAFAGHALTVPMLVKIILKISHRATEYAAGALLSLCSESERCQREAVTAGVLTQLL  366

Query  743  LLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSY--VVPF  877
            LLVQSDCTERAKRKAQMLLKLLRD WP+D    SDD+ CS   VVPF
Sbjct  367  LLVQSDCTERAKRKAQMLLKLLRDSWPQDCIGNSDDFACSQVVVVPF  413



>ref|XP_010690605.1| PREDICTED: U-box domain-containing protein 26 [Beta vulgaris 
subsp. vulgaris]
Length=427

 Score =   342 bits (876),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 195/296 (66%), Positives = 239/296 (81%), Gaps = 4/296 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMD-SNSPELSHESLAILSMFPLPEA  178
            +LRRLRGLA +S+KNRSVI   NAR+V + ILF + D S S EL HESLA+L++FP  + 
Sbjct  132  SLRRLRGLARDSEKNRSVISNLNARDVFVSILFDDSDESESAELKHESLALLAIFPPSDP  191

Query  179  ESVIVSSDPVRVGYLVSLLSNPS-VDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
                + SDP +VGYLVSLL +PS +D+R+NSAALIES+++GT+SP+LR+ I  ++EI+ G
Sbjct  192  NCSSIVSDPDKVGYLVSLLFHPSSIDIRVNSAALIESIIAGTKSPDLRSFICTSEEIYVG  251

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  535
            +V IL  P    RALKIGVK LFALCL+KQ+RHKA++AGAV ALI RL + DKCD ERAL
Sbjct  252  VVSILTNPTPSPRALKIGVKTLFALCLSKQHRHKAISAGAVNALISRLTELDKCDCERAL  311

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  715
            ATVELLCR+P GC++F +HALTVPLLVK ILK+S RATEYAAGALLS+ S+SE+ QREA 
Sbjct  312  ATVELLCRVPQGCSSFGSHALTVPLLVKTILKVSDRATEYAAGALLSLASSSERLQREAV  371

Query  716  aaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED--FTAISDDYNCSYVVPF  877
             AGV+TQLLLLVQSDCTERAKRKAQMLLKLLRD WP++      SDD+ CS +VPF
Sbjct  372  NAGVLTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDEKSIGNYSDDFYCSDIVPF  427



>ref|XP_003529402.1| PREDICTED: U-box domain-containing protein 26-like isoform X1 
[Glycine max]
Length=414

 Score =   341 bits (874),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 196/287 (68%), Positives = 238/287 (83%), Gaps = 5/287 (2%)
 Frame = +2

Query  23   LACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAESVIVSSD  202
            LA +SDKNRS+I ++N  ++LL I+F+N    S ELSHESLA+L MFPL E+E   ++SD
Sbjct  131  LARDSDKNRSLIASHNLLQILLPIVFNN---GSDELSHESLALLVMFPLGESECASLASD  187

Query  203  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  382
             +++GYL  +L++ S DVR+NSAAL+E V+ GT SPELRA++S+ DEI++G+V +L  P+
Sbjct  188  SMKIGYLSRMLAHNSFDVRVNSAALVEIVVVGTHSPELRAEVSSVDEIYDGVVDLLRSPI  247

Query  383  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  562
            S+ RALKIG+KALFALCL K  R KAV AGA   L+DRL DF+KCDAERALATVELLCRI
Sbjct  248  SHPRALKIGIKALFALCLVKNTRQKAVAAGAPAVLVDRLADFEKCDAERALATVELLCRI  307

Query  563  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLL  742
            P+GCAAFAAHALTVP+LVKIILKIS+RATEYAAGALLS+CS SE+ QREA AAGV+TQLL
Sbjct  308  PAGCAAFAAHALTVPMLVKIILKISNRATEYAAGALLSLCSESERCQREAVAAGVLTQLL  367

Query  743  LLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSY--VVPF  877
            LL+QSDCTERAKRKAQMLLKLLRD WP+D    SDD+ CS   VVPF
Sbjct  368  LLMQSDCTERAKRKAQMLLKLLRDSWPQDSVGNSDDFACSQVVVVPF  414



>ref|XP_006583889.1| PREDICTED: U-box domain-containing protein 26-like isoform X2 
[Glycine max]
Length=444

 Score =   341 bits (874),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 194/283 (69%), Positives = 236/283 (83%), Gaps = 3/283 (1%)
 Frame = +2

Query  23   LACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAESVIVSSD  202
            LA +SDKNRS+I ++N  ++LL I+F+N    S ELSHESLA+L MFPL E+E   ++SD
Sbjct  131  LARDSDKNRSLIASHNLLQILLPIVFNN---GSDELSHESLALLVMFPLGESECASLASD  187

Query  203  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  382
             +++GYL  +L++ S DVR+NSAAL+E V+ GT SPELRA++S+ DEI++G+V +L  P+
Sbjct  188  SMKIGYLSRMLAHNSFDVRVNSAALVEIVVVGTHSPELRAEVSSVDEIYDGVVDLLRSPI  247

Query  383  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  562
            S+ RALKIG+KALFALCL K  R KAV AGA   L+DRL DF+KCDAERALATVELLCRI
Sbjct  248  SHPRALKIGIKALFALCLVKNTRQKAVAAGAPAVLVDRLADFEKCDAERALATVELLCRI  307

Query  563  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLL  742
            P+GCAAFAAHALTVP+LVKIILKIS+RATEYAAGALLS+CS SE+ QREA AAGV+TQLL
Sbjct  308  PAGCAAFAAHALTVPMLVKIILKISNRATEYAAGALLSLCSESERCQREAVAAGVLTQLL  367

Query  743  LLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVV  871
            LL+QSDCTERAKRKAQMLLKLLRD WP+D    SDD+ CS VV
Sbjct  368  LLMQSDCTERAKRKAQMLLKLLRDSWPQDSVGNSDDFACSQVV  410



>ref|XP_010538612.1| PREDICTED: U-box domain-containing protein 26-like [Tarenaya 
hassleriana]
Length=434

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 186/308 (60%), Positives = 236/308 (77%), Gaps = 16/308 (5%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSN----MDS--NSPELSHESLAILSMF  163
            ALRRLRGLA +S+KNR++I A+NARE+L+ ILFS     +DS  +S EL  ESL +L MF
Sbjct  127  ALRRLRGLARDSEKNRALIAAHNAREILVGILFSGCGGGVDSGCDSSELVSESLGLLVMF  186

Query  164  PLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  343
             + EAE   +++DP RVG +  LL + S++VR+N+AA+IE VL+G++S +L+  IS +  
Sbjct  187  QMTEAECASIAADPNRVGLMTQLLFDSSIEVRVNAAAMIEMVLTGSKSMDLKRLISGSGT  246

Query  344  IFEGIVGILNCPLS-YSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ------  502
            IFEG++ +L  P+S + RALK+G+KALFALCL K  RH A++AGA   L+DRL       
Sbjct  247  IFEGVLDLLQNPISSFPRALKVGIKALFALCLVKHTRHLAISAGAPAVLVDRLAAGLVDR  306

Query  503  ---DFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALL  673
               DFD+C  ERALATVELLCRIP GC+AFA HALTVP+LVK IL++S RATEYAAGALL
Sbjct  307  IAADFDRCATERALATVELLCRIPVGCSAFAEHALTVPVLVKTILRVSDRATEYAAGALL  366

Query  674  SICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDY  853
             +CSA+E  +REAAAAGV+TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D   ISD++
Sbjct  367  GLCSAAEHCRREAAAAGVVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSLGISDEF  426

Query  854  NCSYVVPF  877
              S + PF
Sbjct  427  GLSEIAPF  434



>ref|XP_004505237.1| PREDICTED: U-box domain-containing protein 26-like [Cicer arietinum]
Length=415

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 188/284 (66%), Positives = 230/284 (81%), Gaps = 4/284 (1%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAESVIVSSDPVR  211
            +S+ NRS+I ++N   +LL I+F ++ S+  EL HESLA+L +FPL E+E   ++SD  +
Sbjct  134  DSEYNRSLIASHNVCHILLPIVFDHIASD--ELKHESLALLVLFPLSESECTSLASDSDK  191

Query  212  VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYS  391
            + YL  LLS+ S DVR+NSAALIE V++GT SPE+RAQ+SN D I++G+V IL  P+SY 
Sbjct  192  INYLTRLLSHSSFDVRVNSAALIEFVVAGTHSPEIRAQVSNVDGIYDGVVEILKNPISYP  251

Query  392  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  571
            RALK+G+KALFALCL KQ RH+AV AGA   L+DRL DF+KCDAERALATVELLCR+P+G
Sbjct  252  RALKVGIKALFALCLVKQTRHRAVAAGAPVVLVDRLADFEKCDAERALATVELLCRVPAG  311

Query  572  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  751
              AFA HALTVP+LVKIILKIS RATEYAAGALL++CS SE+ QREA AAGV+TQLLLLV
Sbjct  312  ITAFAGHALTVPMLVKIILKISDRATEYAAGALLALCSESERCQREAVAAGVLTQLLLLV  371

Query  752  QSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSY--VVPF  877
            QSDCTERAKRKAQ+LLKLLRD WP+D    SDD+ CS   VVPF
Sbjct  372  QSDCTERAKRKAQLLLKLLRDSWPQDSIGNSDDFACSQVVVVPF  415



>gb|AES90137.2| plant U-box protein [Medicago truncatula]
Length=410

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 184/279 (66%), Positives = 229/279 (82%), Gaps = 5/279 (2%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLLCILFSN-MDSNSPELSHESLAILSMFPLPEAESVIVSSDPV  208
            +S+ NRS+I + N R ++L ILF+N +D    EL +ESLA++ +FPL E+E   ++SD  
Sbjct  134  DSEYNRSLISSLNVRNIILPILFNNGLD----ELKNESLALIVLFPLSESECTSLASDSD  189

Query  209  RVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY  388
            ++ YL SLLS+ S DVR+NSAALIE +++GT SPE+R Q+SN D I++G+V IL  P+SY
Sbjct  190  KINYLTSLLSHDSFDVRVNSAALIEIIVAGTHSPEIRLQVSNVDGIYDGVVEILKNPISY  249

Query  389  SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPS  568
             RALKIG+KALFALCL KQ RH+AV+AGA   LIDRL DF+KCDAERALATVELLCR+P+
Sbjct  250  PRALKIGIKALFALCLVKQTRHRAVSAGAPVVLIDRLADFEKCDAERALATVELLCRVPA  309

Query  569  GCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLL  748
            GCA+FA HALTVP+LVKIILKIS RATEYAAGAL+++CS SE+ QREA AAGV+TQLLLL
Sbjct  310  GCASFAGHALTVPMLVKIILKISDRATEYAAGALMALCSESERCQREAVAAGVLTQLLLL  369

Query  749  VQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSY  865
            VQSDCTERAKRKAQ+LLKLLRD WP+D    SDD+ C +
Sbjct  370  VQSDCTERAKRKAQLLLKLLRDSWPQDSVGNSDDFACRH  408



>ref|XP_003607940.1| U-box domain-containing protein [Medicago truncatula]
Length=451

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 183/279 (66%), Positives = 228/279 (82%), Gaps = 5/279 (2%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLLCILFSN-MDSNSPELSHESLAILSMFPLPEAESVIVSSDPV  208
            +S+ NRS+I + N R ++L ILF+N +D    EL +ESLA++ +FPL E+E   ++SD  
Sbjct  134  DSEYNRSLISSLNVRNIILPILFNNGLD----ELKNESLALIVLFPLSESECTSLASDSD  189

Query  209  RVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY  388
            ++ YL SLLS+ S DVR+NSAALIE +++GT SPE+R Q+SN D I++G+V IL  P+SY
Sbjct  190  KINYLTSLLSHDSFDVRVNSAALIEIIVAGTHSPEIRLQVSNVDGIYDGVVEILKNPISY  249

Query  389  SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPS  568
             RALKIG+KALFALCL KQ RH+AV+AGA   LIDRL DF+KCDAERALATVELLCR+P+
Sbjct  250  PRALKIGIKALFALCLVKQTRHRAVSAGAPVVLIDRLADFEKCDAERALATVELLCRVPA  309

Query  569  GCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLL  748
            GCA+FA HALTVP+LVKIILKIS RATEYAAGAL+++CS SE+ QREA AAGV+TQLLLL
Sbjct  310  GCASFAGHALTVPMLVKIILKISDRATEYAAGALMALCSESERCQREAVAAGVLTQLLLL  369

Query  749  VQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSY  865
            VQSDCTERAKRKAQ+LLKLLRD WP+D    SDD+   +
Sbjct  370  VQSDCTERAKRKAQLLLKLLRDSWPQDSVGNSDDFGIWF  408



>emb|CDY16513.1| BnaA08g02540D [Brassica napus]
Length=423

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 180/297 (61%), Positives = 232/297 (78%), Gaps = 5/297 (2%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMD----SNSPELSHESLAILSMFPL  169
            A+RRLRGLA +S+KNR +I  +NARE+L+ ILF+++D    ++S E+  ESLA+L MF +
Sbjct  127  AIRRLRGLARDSEKNRVLIAGHNAREILVRILFADVDVGVETSSSEVVTESLALLVMFHM  186

Query  170  PEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
             E E   +SSDP RVG++  LL + S++ R+N+AAL+E VL+G++S +L+  IS +  +F
Sbjct  187  TEGECESISSDPGRVGFMTRLLFDSSIENRVNAAALVEMVLTGSKSTDLKMIISGSGSVF  246

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAE  526
            EG++ +L   +S  RALKIG+KALFALCL KQ RH A++AGA   LIDRL  DFD+CD E
Sbjct  247  EGVMDLLRSSVSSRRALKIGIKALFALCLVKQTRHLAISAGAPGTLIDRLAADFDRCDTE  306

Query  527  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  706
            R LATVELLCR+P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + 
Sbjct  307  RGLATVELLCRLPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERCRD  366

Query  707  eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            EAAAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D    SD++  S V PF
Sbjct  367  EAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDTLVNSDEFGRSEVAPF  423



>ref|XP_006393215.1| hypothetical protein EUTSA_v10011515mg [Eutrema salsugineum]
 gb|ESQ30501.1| hypothetical protein EUTSA_v10011515mg [Eutrema salsugineum]
Length=422

 Score =   318 bits (815),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 232/296 (78%), Gaps = 4/296 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILF--SNMDSNSPELSHESLAILSMFPLPE  175
            A+RRLRGLA +S+KNR +I  +NARE+L+ ILF      S+S EL  ESLA+L +F + E
Sbjct  127  AIRRLRGLARDSEKNRVLIAGHNAREILVRILFDAGRESSSSSELVFESLALLVIFHMTE  186

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
             E   ++SDP RVG++  LL + S++VR+N+AALIE VL+G++S +L+  IS +D +FEG
Sbjct  187  EECESIASDPGRVGFMTRLLFDSSIEVRVNAAALIEMVLTGSKSTDLKLVISGSDSVFEG  246

Query  356  IVGILNCPLSYSR-ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAER  529
            ++ +L  P+S SR ALKIG+KALFALCL KQ RH A++AGA   LIDRL  DFD+CD ER
Sbjct  247  VLDLLKNPISSSRRALKIGIKALFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDTER  306

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqre  709
             LATVELLCR+P GC+ F  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + E
Sbjct  307  GLATVELLCRLPEGCSGFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERCRDE  366

Query  710  aaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            AAAAG++TQLLLLVQS+CTERAKRKAQMLLKLLRD WP+D    SDD+  S VVPF
Sbjct  367  AAAAGLVTQLLLLVQSECTERAKRKAQMLLKLLRDSWPDDTLVNSDDFGRSEVVPF  422



>ref|XP_009107285.1| PREDICTED: U-box domain-containing protein 26 [Brassica rapa]
Length=472

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 180/297 (61%), Positives = 232/297 (78%), Gaps = 5/297 (2%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMD----SNSPELSHESLAILSMFPL  169
            A+RRLRGLA +S+KNR +I  +NARE+L+ ILF+++D    ++S E+  ESLA+L MF +
Sbjct  176  AIRRLRGLARDSEKNRVLIAGHNAREILVRILFADVDVGVETSSSEVVTESLALLVMFHM  235

Query  170  PEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
             E E   +SSDP RVG++  LL + S++ R+N+AAL+E VL+G++S +L+  IS +  +F
Sbjct  236  TEGECESISSDPGRVGFMTRLLFDSSIENRVNAAALVEMVLTGSKSTDLKMIISGSGSVF  295

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAE  526
            EG++ +L   +S  RALKIG+KALFALCL KQ RH A++AGA   LIDRL  DFD+CD E
Sbjct  296  EGVMDLLRSSVSSRRALKIGIKALFALCLVKQTRHLAISAGAPGTLIDRLAADFDRCDTE  355

Query  527  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  706
            R LATVELLCR+P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + 
Sbjct  356  RGLATVELLCRLPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERCRD  415

Query  707  eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            EAAAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D    SD++  S V PF
Sbjct  416  EAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDTLVNSDEFGRSEVAPF  472



>ref|NP_175400.1| U-box domain-containing protein 26 [Arabidopsis thaliana]
 sp|Q9FXA4.1|PUB26_ARATH RecName: Full=U-box domain-containing protein 26; AltName: Full=Plant 
U-box protein 26 [Arabidopsis thaliana]
 gb|AAG13057.1|AC011807_16 Hypothetical protein [Arabidopsis thaliana]
 gb|ABI93922.1| At1g49780 [Arabidopsis thaliana]
 gb|AEE32475.1| U-box domain-containing protein 26 [Arabidopsis thaliana]
Length=421

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 179/295 (61%), Positives = 230/295 (78%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESL--AILSMFPLPE  175
            A+RRLRGLA +S+KNR +I  +NARE+L+ ILF+++++ S      S   A+L +  + E
Sbjct  127  AIRRLRGLARDSEKNRVLIAGHNAREILVRILFADIETTSLSSELVSESLALLVLLHMTE  186

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
             E   V+SDP RVG++  LL + S+++R+N+AALIE VL+G +S +L+  IS +D IFEG
Sbjct  187  TECEAVASDPSRVGFMTRLLFDSSIEIRVNAAALIEMVLTGAKSMDLKLIISGSDSIFEG  246

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERA  532
            ++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD ER 
Sbjct  247  VLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDTERG  306

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqrea  712
            LATVELLCR+P GCAAF  HALTVPL+VK IL++S RATEYAAGALL++C+A E+ + EA
Sbjct  307  LATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCRDEA  366

Query  713  aaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            AAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D T  SDD+N S V PF
Sbjct  367  AAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTVHSDDFNRSEVAPF  421



>ref|XP_002894216.1| U-box domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70475.1| U-box domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=421

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 178/295 (60%), Positives = 231/295 (78%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESL--AILSMFPLPE  175
            A+RRLRGLA +S+KNR +I  +NARE+L+ ILF+++++ S      S   A+L +  + E
Sbjct  127  AIRRLRGLARDSEKNRVLIAGHNAREILVRILFADVETTSSSSELVSESLALLVLLHMTE  186

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
             E   ++SDP RVG++  LL + S+++R+N+AALIE VL+G++S +L+  IS +D IFEG
Sbjct  187  TECEAIASDPGRVGFMTRLLFDSSIEIRVNAAALIEMVLTGSKSMDLKLIISGSDSIFEG  246

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERA  532
            ++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD ER 
Sbjct  247  VLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDTERG  306

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqrea  712
            LATVELLCR+P GCAAF  HALTVPL+VK IL++S RATEYAAGALL++C+A E+ + EA
Sbjct  307  LATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCRDEA  366

Query  713  aaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            AAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D T  SDD+N S V PF
Sbjct  367  AAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTVNSDDFNRSEVAPF  421



>emb|CDY50158.1| BnaA01g26180D [Brassica napus]
Length=417

 Score =   313 bits (802),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 179/296 (60%), Positives = 226/296 (76%), Gaps = 10/296 (3%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRG A +S+KNR +I A+NA+E+L+ ILFS+ D +S EL  ESLA+L MFP+ E +
Sbjct  128  ALRRLRGFARDSEKNRVLIAAHNAKEILIRILFSD-DIDSSELVSESLALLVMFPMTEHD  186

Query  182  S-VIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
              V + SDP RV +L  LL + SV+ R+N+AALIE  ++G++       +S+++ IFEG+
Sbjct  187  KCVSIISDPGRVEFLTRLLFDSSVETRVNAAALIEMAVTGSKE-----TVSSSESIFEGV  241

Query  359  VGILNCPLSY--SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAER  529
            + +L  P S    RALKIG+KALFALCL+KQ R  AV+AGA E LIDRL    D+CD ER
Sbjct  242  LDLLRNPASSYPRRALKIGIKALFALCLSKQTRRIAVSAGAPEILIDRLAAGLDRCDTER  301

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqre  709
            ALATVE+LCR P GCAAF  HALTVP+LVK IL++S RATEYAAGALL++C+A E+ + E
Sbjct  302  ALATVEILCRSPEGCAAFGEHALTVPVLVKTILRVSDRATEYAAGALLALCTAEERWRDE  361

Query  710  aaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            AAAAGV+ QLLL+VQS+CTERAKRKAQ LLKLLRD WP+   A SDD+ CS VVPF
Sbjct  362  AAAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVVPF  417



>ref|XP_006406505.1| hypothetical protein EUTSA_v10022190mg [Eutrema salsugineum]
 gb|ESQ47958.1| hypothetical protein EUTSA_v10022190mg [Eutrema salsugineum]
Length=420

 Score =   313 bits (801),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 183/296 (62%), Positives = 233/296 (79%), Gaps = 7/296 (2%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRG A +S+KNR +I A+NA+E+L+ ILFS+   +SPE+  ESLA+L MFP+ E +
Sbjct  128  ALRRLRGFARDSEKNRVLIAAHNAKEILIRILFSD---DSPEVVSESLALLVMFPMTEPD  184

Query  182  S-VIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
              V ++SDP RV +L  LL + S++ R+N+AALIE V +G++SP+L+   SN++ +FEG+
Sbjct  185  QCVSIASDPGRVEFLTRLLFDSSLETRVNAAALIEMVSTGSKSPDLKGMFSNSESVFEGV  244

Query  359  VGILNCPLSY--SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAER  529
            + +L  P+S    RALKIG+K LFALCL K  RH AV+AGA E LIDRL  DFD+CD ER
Sbjct  245  LDLLRNPISSYPRRALKIGIKTLFALCLPKNTRHIAVSAGAPEILIDRLAADFDRCDTER  304

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqre  709
            ALATVELLCR+P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + E
Sbjct  305  ALATVELLCRLPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWRDE  364

Query  710  aaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            AAAAGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP+   A SDD+ CS VVPF
Sbjct  365  AAAAGVVVQLLLIVQSECTERAKKKAQKLLKLLRDSWPDYSFANSDDFVCSQVVPF  420



>ref|XP_010500528.1| PREDICTED: U-box domain-containing protein 26-like [Camelina 
sativa]
Length=422

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 177/296 (60%), Positives = 232/296 (78%), Gaps = 4/296 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESL--AILSMFPLPE  175
            A+RRLRGLA +S+KNR +I A+NAREVL+ ILF+++++ S      S   A+L +  + E
Sbjct  127  AIRRLRGLARDSEKNRVLIAAHNAREVLVRILFADVETTSSSSELVSESLALLVVLHMTE  186

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
             E   V+SDP RVG++  LL + S+++R+N+AAL+E VL+G++S +L+  IS +D IFEG
Sbjct  187  TECEAVASDPGRVGFMTRLLFDSSIEIRVNAAALVEMVLTGSKSTDLKLVISGSDSIFEG  246

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERA  532
            ++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD ER 
Sbjct  247  VLDLLRNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAAGILIDRLAADFDRCDTERG  306

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqrea  712
            LATVELLCR+P GCAAF  HALTVPL+VK IL++S RATEYAAGALL++C+A E+ + EA
Sbjct  307  LATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEERFRDEA  366

Query  713  aaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAI-SDDYNCSYVVPF  877
            AAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D + + SDD+  + V PF
Sbjct  367  AAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSSTVNSDDFGRTEVAPF  422



>dbj|BAC42960.1| unknown protein [Arabidopsis thaliana]
Length=421

 Score =   310 bits (793),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 228/295 (77%), Gaps = 3/295 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESL--AILSMFPLPE  175
            A+RRLRGLA +S+KNR +I  +NA E+L+ ILF+++++ S      S   A+L +  + E
Sbjct  127  AIRRLRGLARDSEKNRVLIAGHNAGEILVRILFADIETTSLSSELVSESLALLVLLHMTE  186

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
             E   V+SDP RVG++  LL + S+++R+N+AALIE VL+G +S +L+  IS +D IFEG
Sbjct  187  TECEAVASDPSRVGFMTRLLFDSSIEIRVNAAALIEMVLTGAKSMDLKLIISGSDSIFEG  246

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERA  532
            ++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AG    LIDRL  DFD+CD ER 
Sbjct  247  VLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGVPGILIDRLAADFDRCDTERG  306

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqrea  712
            LATVELLCR+P GCAAF  HALTVPL+VK IL++S RATEYAAGALL++C+A E+ + EA
Sbjct  307  LATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCRDEA  366

Query  713  aaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            AAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D T  SDD+N S V PF
Sbjct  367  AAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTVHSDDFNRSEVAPF  421



>ref|XP_006306175.1| hypothetical protein CARUB_v10011740mg [Capsella rubella]
 gb|EOA39073.1| hypothetical protein CARUB_v10011740mg [Capsella rubella]
Length=422

 Score =   310 bits (793),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 232/296 (78%), Gaps = 4/296 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHES---LAILSMFPLP  172
            A+RRLRGLA +S+KNR +I  +NARE+L+ ILF++++++S   S      LA+L +  + 
Sbjct  127  AIRRLRGLARDSEKNRVLIAGHNAREILVRILFADVETSSSPSSELVSESLALLVVLHMT  186

Query  173  EAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  352
            E E   V+SDP RVG++  LL + S+++R+N+AALIE VL+G++S +L+  IS +D IF 
Sbjct  187  ETECEAVASDPGRVGFMTRLLFDSSIEIRVNAAALIEMVLTGSKSMDLKLIISGSDSIFV  246

Query  353  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAER  529
            G++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD ER
Sbjct  247  GVLDLLKNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDTER  306

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqre  709
             LATVELLCR+P GCAAF  HALTVPL+VK IL++S RATEYAAGALL++C+A E+ + E
Sbjct  307  GLATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCRDE  366

Query  710  aaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            AAAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D TA SDD+  + V PF
Sbjct  367  AAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSTANSDDFARTEVAPF  422



>ref|XP_010461826.1| PREDICTED: U-box domain-containing protein 26 [Camelina sativa]
Length=422

 Score =   310 bits (793),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 232/296 (78%), Gaps = 4/296 (1%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESL--AILSMFPLPE  175
            A+RRLRGLA +S+KNR +I A+NAREVL+ ILF+++++ S      S   A+L +  + E
Sbjct  127  AIRRLRGLARDSEKNRVLIAAHNAREVLVRILFADVETTSSSSELVSESLALLVVLHMTE  186

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
             E   V+SDP RVG+L  LL + S+++R+N+AAL+E VL+G++S +L+  IS +D IFEG
Sbjct  187  TECEAVASDPGRVGFLTRLLFDSSIEIRVNAAALVEMVLTGSKSTDLKLVISGSDSIFEG  246

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERA  532
            ++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD ER 
Sbjct  247  VLDLLRNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDTERG  306

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqrea  712
            LATVELLCR+P GCAAF  HALTVPL+VK IL++S RATEYAAGALL++C+A E+ + EA
Sbjct  307  LATVELLCRLPEGCAAFGEHALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCRDEA  366

Query  713  aaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAI-SDDYNCSYVVPF  877
            AAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D + + SDD+  + V PF
Sbjct  367  AAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDSSTVNSDDFGRTEVAPF  422



>ref|XP_009145797.1| PREDICTED: U-box domain-containing protein 25 [Brassica rapa]
 ref|XP_009145799.1| PREDICTED: U-box domain-containing protein 25 [Brassica rapa]
Length=422

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/287 (59%), Positives = 219/287 (76%), Gaps = 8/287 (3%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES-VIVSSDPV  208
            +S+KNR +I A+NA+E+L+ ILFS++   +PEL  ESLA+L +FP+ E +  V + SDP 
Sbjct  139  DSEKNRVLIAAHNAKEILIRILFSDV---APELVSESLALLVIFPMTEPDQCVSIISDPG  195

Query  209  RVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY  388
            RVG+L  LL + S++ R+N+AALIE V++GT++ +++  +  ++ IFEG++ +L  P   
Sbjct  196  RVGFLTRLLFDSSIETRVNAAALIEMVVTGTKAADIKGTVLTSECIFEGVIDLLRNPTVT  255

Query  389  S---RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLC  556
            S   RALKIGVKALFALCL K  RH AV++GA E LIDRL    D+CD ERALATVELLC
Sbjct  256  SSPRRALKIGVKALFALCLVKNTRHLAVSSGAPEILIDRLAAGLDRCDTERALATVELLC  315

Query  557  RIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQ  736
            R P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EA AAGV+ Q
Sbjct  316  RTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWREEAVAAGVVVQ  375

Query  737  LLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            LLL+VQS+CTERAKRK Q LLKLLRD WP+   A SDD+ CS VVPF
Sbjct  376  LLLMVQSECTERAKRKGQKLLKLLRDSWPDYSFANSDDFGCSEVVPF  422



>ref|XP_006299353.1| hypothetical protein CARUB_v10015518mg [Capsella rubella]
 gb|EOA32251.1| hypothetical protein CARUB_v10015518mg [Capsella rubella]
Length=425

 Score =   308 bits (789),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 183/301 (61%), Positives = 229/301 (76%), Gaps = 12/301 (4%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRG A +S+KNR +I A+NA  +L+ ILFS  ++ S EL  ESLA+L M P+ E  
Sbjct  128  ALRRLRGFARDSEKNRVLIAAHNATGILIMILFS--ETTSSELVSESLALLVMLPITEPN  185

Query  182  SVI-VSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
             ++ +SSDP RV +L  LL + S++ R+N+AALIE V +GT+S +L    SN++ +FEG+
Sbjct  186  QLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSADLVGMFSNSESVFEGV  245

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERAL  535
            + +L  P+S  RALKIG+KALFALCLAKQ RH A+TAGA E LIDRL  DFD+CD ERAL
Sbjct  246  LDLLRNPISSRRALKIGIKALFALCLAKQTRHLAITAGAPEILIDRLAADFDRCDTERAL  305

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  715
            ATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EAA
Sbjct  306  ATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLTLCTAEERWREEAA  365

Query  716  aaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT-------AISDDYNCSYVVP  874
             AGV+ QLLL+VQS+CTERAK+KAQ LLKLLR+ WP D+        A SDD+ CS VVP
Sbjct  366  GAGVVVQLLLMVQSECTERAKKKAQKLLKLLRNSWP-DYNHHNNSSFANSDDFACSQVVP  424

Query  875  F  877
            F
Sbjct  425  F  425



>ref|XP_002518745.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF43670.1| Spotted leaf protein, putative [Ricinus communis]
Length=420

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 163/254 (64%), Positives = 213/254 (84%), Gaps = 4/254 (2%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            A+RRL+ LA +SDKNRS+I ++NA  +L+ +LFSN  S   +L+HE+++++ MFPL E+E
Sbjct  124  AIRRLKSLARDSDKNRSLISSHNATNLLVNLLFSNTSS---DLTHEAMSLVVMFPLTESE  180

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             + ++S+  R+ +L +LL + S+++R+NSAALIE+V++GT+S +LRAQ SN DEI EG++
Sbjct  181  CISIASNTERIIFLANLLFHSSIEIRVNSAALIETVIAGTKSSDLRAQFSNVDEIVEGVI  240

Query  362  GILNCPLS-YSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALA  538
             +L  P+S Y RALKIG+KALFALCL KQ RHKAV+AGAVE LIDRL DFDKCDAERALA
Sbjct  241  ELLKRPISNYPRALKIGIKALFALCLVKQTRHKAVSAGAVETLIDRLADFDKCDAERALA  300

Query  539  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaa  718
            T+ELLCR+P G A FA HALTVPLLVK ILKIS RATEYAAGALL++C+ASE++QREA +
Sbjct  301  TIELLCRVPEGVAEFAEHALTVPLLVKTILKISDRATEYAAGALLALCTASEKSQREAVS  360

Query  719  aGVMTQLLLLVQSD  760
            AG++TQLLLLVQSD
Sbjct  361  AGILTQLLLLVQSD  374



>ref|NP_566632.1| U-box domain-containing protein 25 [Arabidopsis thaliana]
 sp|Q9LT79.1|PUB25_ARATH RecName: Full=U-box domain-containing protein 25; AltName: Full=Plant 
U-box protein 25 [Arabidopsis thaliana]
 dbj|BAB02462.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM63504.1| unknown [Arabidopsis thaliana]
 gb|ABG25071.1| At3g19380 [Arabidopsis thaliana]
 gb|AEE76233.1| U-box domain-containing protein 25 [Arabidopsis thaliana]
Length=421

 Score =   308 bits (788),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 227/296 (77%), Gaps = 6/296 (2%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRG A +SDKNR +I A+NA E+L+ ILFS  ++ S EL  ESLA+L M P+ E  
Sbjct  128  ALRRLRGFARDSDKNRVLIAAHNATEILIKILFS--ETTSSELVSESLALLVMLPITEPN  185

Query  182  SVI-VSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
              + +SSDP RV +L  LL + S++ R+N+AALIE V +GT+S +L+  ISN++ +FEG+
Sbjct  186  QFVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSADLKGSISNSESVFEGV  245

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERAL  535
            + +L  P+S  RALKIG+K LFALC  K  RH A+TAGA E LIDRL  DFD+CD ERAL
Sbjct  246  LDLLRNPISSRRALKIGIKTLFALCSVKSTRHIAITAGAPEILIDRLAADFDRCDTERAL  305

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  715
            ATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EAA
Sbjct  306  ATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWREEAA  365

Query  716  aaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE-DFTAISDDYNC-SYVVPF  877
             AGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP+ +  A SDD+ C S VVPF
Sbjct  366  GAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNSFANSDDFGCSSQVVPF  421



>emb|CDY59286.1| BnaCnng34640D [Brassica napus]
Length=423

 Score =   308 bits (788),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 180/297 (61%), Positives = 232/297 (78%), Gaps = 5/297 (2%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMD----SNSPELSHESLAILSMFPL  169
            A+RRLRGLA +S+KNR +I  +NARE+L+ ILF+++D    ++S E+  ESLA+L MF +
Sbjct  127  AIRRLRGLARDSEKNRVLIAGHNAREILVRILFADVDVGVETSSSEVVSESLALLVMFHM  186

Query  170  PEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
             E E   +SSDP RVG++  LL + S++ R+N+AAL+E VL+G++S +L+  IS +  +F
Sbjct  187  TEGECDSISSDPDRVGFMTRLLFDSSIENRVNAAALVEMVLTGSKSTDLKMIISGSGSVF  246

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAE  526
            EG++ +L   +S  RALKIG+KALFALCL KQ RH A++AGA   LIDRL  DFD+CD E
Sbjct  247  EGVMDLLRSSVSSRRALKIGIKALFALCLVKQTRHLAISAGAPGTLIDRLAADFDRCDTE  306

Query  527  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  706
            R LATVELLCR+P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + 
Sbjct  307  RGLATVELLCRLPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERCRD  366

Query  707  eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            EAAAAG++TQLLLLVQSDCTERAKRKAQMLLKLLRD WP+D     D++  S VVPF
Sbjct  367  EAAAAGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPDDTLVNDDEFGRSEVVPF  423



>ref|XP_002885309.1| hypothetical protein ARALYDRAFT_479456 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61568.1| hypothetical protein ARALYDRAFT_479456 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   306 bits (784),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 230/298 (77%), Gaps = 8/298 (3%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEA-  178
            ALRRLRG A +SDKNR +I A+NA EVL+ ILFS  ++ S EL  ESLA+L M P+ E  
Sbjct  102  ALRRLRGFARDSDKNRVLIAAHNATEVLIRILFS--ETTSSELVSESLALLVMLPITEPN  159

Query  179  ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRA--QISNADEIFE  352
            + V +SSDP RV +L  LL + S+D R+N+AALIE V +GT+S +L+    ISN++ +FE
Sbjct  160  QCVSISSDPGRVEFLTRLLFDSSIDTRVNAAALIEIVSTGTKSADLKGMFSISNSESVFE  219

Query  353  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAER  529
            G++ +L  P+S  RALKIG+K LFALCL K  RH A+TAGA E LIDRL  DFD+CD ER
Sbjct  220  GVLDLLRNPISSRRALKIGIKTLFALCLVKSTRHIAITAGAPEILIDRLAADFDRCDTER  279

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqre  709
            ALATVELLCR P GCAAF  HALTVPLLVK IL++S R+TEYAAGALL++C+A E+ + E
Sbjct  280  ALATVELLCRSPEGCAAFGEHALTVPLLVKTILRVSDRSTEYAAGALLALCTAEERWREE  339

Query  710  aaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE-DFTAISDDYNC-SYVVPF  877
            AAAAGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP+ +  A SDD+ C S VVPF
Sbjct  340  AAAAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNSFANSDDFGCSSQVVPF  397



>ref|XP_010468287.1| PREDICTED: U-box domain-containing protein 25-like, partial [Camelina 
sativa]
Length=412

 Score =   306 bits (785),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 182/300 (61%), Positives = 225/300 (75%), Gaps = 11/300 (4%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRG A +SDKNR +I A+NA  VL+ ILFS  ++ S EL  ESLA+L M P+ E  
Sbjct  116  ALRRLRGFARDSDKNRVLIAAHNATAVLIMILFS--ETTSSELVSESLALLVMLPITEPN  173

Query  182  SVI-VSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
             ++ +SSDP RV +L  LL + S++ R+N+AALIE V +GT+S + +   SN + +FEG+
Sbjct  174  QLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVTTGTKSEDPKGTFSNYESVFEGV  233

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERAL  535
            + +L  P+S  RALKIG+KALF+LC AKQ RH A+ AGA E LIDRL  DFD+CD ERAL
Sbjct  234  LDLLRNPISSRRALKIGIKALFSLCSAKQTRHLAINAGAPEILIDRLAADFDRCDTERAL  293

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  715
            ATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL+IC+  E+ + EAA
Sbjct  294  ATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLAICTEEERWREEAA  353

Query  716  aaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT------AISDDYNCSYVVPF  877
             AGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP D+       A SDD+ CS VVPF
Sbjct  354  GAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWP-DYNNHNSSFANSDDFACSQVVPF  412



>ref|XP_010466083.1| PREDICTED: U-box domain-containing protein 25 [Camelina sativa]
Length=424

 Score =   307 bits (786),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 182/300 (61%), Positives = 225/300 (75%), Gaps = 11/300 (4%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRG A +SDKNR +I A+NA  VL+ ILFS  ++ S EL  ESLA+L M P+ E  
Sbjct  128  ALRRLRGFARDSDKNRVLIAAHNATAVLIMILFS--ETTSSELVSESLALLVMLPITEPN  185

Query  182  SVI-VSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
             ++ +SSDP RV +L  LL + S++ R+N+AALIE V +GT+S + +   SN + +FEG+
Sbjct  186  QLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVTTGTKSEDPKGTFSNYESVFEGV  245

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERAL  535
            + +L  P+S  RALKIG+KALF+LC AKQ RH A+ AGA E LIDRL  DFD+CD ERAL
Sbjct  246  LDLLRNPISSRRALKIGIKALFSLCSAKQTRHLAINAGAPEILIDRLAADFDRCDTERAL  305

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  715
            ATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL+IC+  E+ + EAA
Sbjct  306  ATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLAICTEEERWREEAA  365

Query  716  aaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT------AISDDYNCSYVVPF  877
             AGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP D+       A SDD+ CS VVPF
Sbjct  366  GAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWP-DYNNHNSSFANSDDFACSQVVPF  424



>dbj|BAF01749.1| hypothetical protein [Arabidopsis thaliana]
Length=419

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 181/296 (61%), Positives = 226/296 (76%), Gaps = 6/296 (2%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRG A +SDKNR +I  +NA E+L+ ILFS  ++ S EL  ESLA+L M P+ E  
Sbjct  126  ALRRLRGFARDSDKNRVLIATHNATEILIKILFS--ETTSSELVSESLALLVMLPITEPN  183

Query  182  SVI-VSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
              + +SSDP RV +L  LL + S++ R+N+AALIE V +GT+S +L+  ISN++ +FEG+
Sbjct  184  QFVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSADLKGSISNSESVFEGV  243

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERAL  535
            + +L  P+S  RALKIG+K LFALC  K  RH A+TAGA E LIDRL  DFD+CD ERAL
Sbjct  244  LDLLRNPISSRRALKIGIKTLFALCSVKSTRHIAITAGAPEILIDRLAADFDRCDTERAL  303

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  715
            ATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EAA
Sbjct  304  ATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWREEAA  363

Query  716  aaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE-DFTAISDDYNC-SYVVPF  877
             AGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP+ +  A SDD+ C S VVPF
Sbjct  364  GAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYNSFANSDDFGCSSQVVPF  419



>gb|KFK39278.1| hypothetical protein AALP_AA3G223600 [Arabis alpina]
Length=418

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 232/295 (79%), Gaps = 6/295 (2%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRG A +SDKNR +I A+NA E+L+ ILF++++ +S EL  ESLA+L MFP+ + E
Sbjct  127  ALRRLRGFARDSDKNRVLIAAHNAGEILIRILFNSVNDSS-ELVSESLALLVMFPITDPE  185

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
            S+  +SDP RV +L  LL + S++ R+N+AALIE VL+GT+S +L+  ISN++ +F+G++
Sbjct  186  SI--ASDPNRVEFLTRLLYDSSIETRVNAAALIEMVLTGTKSSDLKEAISNSESVFQGVL  243

Query  362  GILNCPLSY--SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL-QDFDKCDAERA  532
             IL  P+S    RALKIG+KALFALCL+K  RH AV +GA E LIDRL  DFD+C+ ERA
Sbjct  244  DILRNPISSYPRRALKIGIKALFALCLSKTARHIAVFSGAPEILIDRLASDFDRCETERA  303

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqrea  712
            LATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL+IC+A E+ + EA
Sbjct  304  LATVELLCRSPEGCAAFGDHALTVPLLVKTILRVSDRATEYAAGALLAICTAEERWREEA  363

Query  713  aaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            AAAGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP+   A S  + CS VVPF
Sbjct  364  AAAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWPDYSFANSHHFACSQVVPF  418



>emb|CDX92328.1| BnaA05g20790D [Brassica napus]
Length=423

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 170/288 (59%), Positives = 217/288 (75%), Gaps = 9/288 (3%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES-VIVSSDPV  208
            +S+KNR +I A+NA+E+L+ ILFS++   +PEL  ESLA+L MFP+ E E  V + SDP 
Sbjct  139  DSEKNRVLIAAHNAKEILIRILFSDV---APELVSESLALLVMFPMTEPEQCVSIISDPG  195

Query  209  RVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPEL-RAQISNADEIFEGIVGILNCPLS  385
            RVG+L  LL + S++ R+N+AALIE V++GT++ ++ +  +   + IFEG++ +L  P  
Sbjct  196  RVGFLTRLLFDSSIETRVNAAALIEMVVTGTKTADIIKGTVLTTEYIFEGVIDLLRNPTV  255

Query  386  YS---RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELL  553
             S   RALKIGVKALFALCL K  R  AV++GA E LIDRL    D+CD ERALATVELL
Sbjct  256  TSSPRRALKIGVKALFALCLVKNTRQLAVSSGAPEILIDRLAAGLDRCDTERALATVELL  315

Query  554  CRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMT  733
            CR P GC AF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EA AAGV+ 
Sbjct  316  CRTPEGCVAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWREEAVAAGVVV  375

Query  734  QLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            QLLL+VQS+CTERAKRKAQ LLKLLRD WP+   A S+D+ CS VVPF
Sbjct  376  QLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSNDFGCSEVVPF  423



>emb|CDX99233.1| BnaC05g33480D [Brassica napus]
Length=421

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 172/289 (60%), Positives = 220/289 (76%), Gaps = 12/289 (4%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEA---ESVIVSSD  202
            +S+KNR +I A+NA+E+L+ ILFS+    SPEL  E+LA+L+MFP+ E    ES+I  SD
Sbjct  138  DSEKNRVLIAAHNAKEILIRILFSD---ESPELVSEALALLAMFPMTEPGQCESII--SD  192

Query  203  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  382
              RVG+L  LL + S++ R+N+AALIE V++G+++ +++  +  ++ IFEG++ +L  P 
Sbjct  193  AGRVGFLTRLLFDSSIETRVNAAALIEMVVTGSKTADIKGTVLTSECIFEGVIDLLRNPT  252

Query  383  SYS---RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVEL  550
              S   RALKIGVKALFALCLAK  R  AV++GA E LIDRL    D+CDAERALATVEL
Sbjct  253  VTSSPRRALKIGVKALFALCLAKNTRRIAVSSGAPEILIDRLAAGLDRCDAERALATVEL  312

Query  551  LCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVM  730
            LCR   GCAAF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EA AAGV+
Sbjct  313  LCRTAEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWRDEAVAAGVV  372

Query  731  TQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
             QLLL+VQS+CTERAKRKAQ LLKLLRD WP+   A SDD+ CS VVPF
Sbjct  373  VQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVVPF  421



>ref|XP_010507691.1| PREDICTED: U-box domain-containing protein 25-like [Camelina 
sativa]
Length=425

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 181/301 (60%), Positives = 224/301 (74%), Gaps = 12/301 (4%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRG A +SDKNR +I A+NA  VL+ ILFS  ++ S EL  ESLA+L M P+ E  
Sbjct  128  ALRRLRGFARDSDKNRVLIAAHNATAVLVIILFS--ETTSSELVSESLALLVMLPITEPN  185

Query  182  SVI-VSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
             ++ +SSDP RV +L  LL + S++ R+N+AALIE V +GT+S + +   SN + +FEG+
Sbjct  186  QLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSEDPKGTFSNYESVFEGV  245

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERAL  535
            + +L  P+S  RALKIG+KALF+LC AKQ RH A+ AGA E LIDRL  DFD+CD ERAL
Sbjct  246  LNLLRNPISSRRALKIGIKALFSLCSAKQTRHLAINAGAPEILIDRLAADFDRCDTERAL  305

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  715
            ATVELLCR P GCAAF  HALTVPLLVK IL++S RATEYAAGALL+IC+  E+ + EAA
Sbjct  306  ATVELLCRTPEGCAAFGEHALTVPLLVKTILRVSDRATEYAAGALLAICTEEERWREEAA  365

Query  716  aaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT-------AISDDYNCSYVVP  874
             AGV+ QLLL+VQS+CTERAK+KAQ LLKLLRD WP D+        A SDD+ CS V P
Sbjct  366  GAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSWP-DYNNHNNNSFANSDDFACSQVAP  424

Query  875  F  877
            F
Sbjct  425  F  425



>ref|XP_009111906.1| PREDICTED: U-box domain-containing protein 25-like [Brassica 
rapa]
Length=417

 Score =   303 bits (775),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 173/290 (60%), Positives = 220/290 (76%), Gaps = 10/290 (3%)
 Frame = +2

Query  20   GLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES-VIVS  196
            G A +S+KNR +I A+NA+E+L+ ILFS+ D +S EL  ESLA+L MFP+ E +  V + 
Sbjct  134  GFARDSEKNRVLIAAHNAKEILIRILFSD-DIDSSELVSESLALLVMFPMTEHDKCVSII  192

Query  197  SDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNC  376
            SDP RV +L  LL + SV+ R+N+AALIE  ++G++       +S+++ IFEG++ +L  
Sbjct  193  SDPGRVEFLTRLLFDSSVETRVNAAALIEMAVTGSKE-----TVSSSESIFEGVLDLLRN  247

Query  377  PLSY--SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVE  547
            P S    RALKIG+KALFALCL+K  RH AV+AGA E LIDRL    D+CD ERALATVE
Sbjct  248  PASSYPRRALKIGIKALFALCLSKNTRHVAVSAGAPEILIDRLAAGLDRCDTERALATVE  307

Query  548  LLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGV  727
            +LCR P GCAAF  HALTVP+LVK IL++S RATEYAAGALL++C+A E+ + EAAAAGV
Sbjct  308  ILCRSPEGCAAFGEHALTVPVLVKTILRVSDRATEYAAGALLALCTAEERWRDEAAAAGV  367

Query  728  MTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            + QLLL+VQS+CTERAKRKAQ LLKLLRD WP+   A SDD+ CS VVPF
Sbjct  368  VVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVVPF  417



>gb|ABV89622.1| U-box domain-containing protein [Brassica rapa]
Length=417

 Score =   302 bits (774),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 173/290 (60%), Positives = 220/290 (76%), Gaps = 10/290 (3%)
 Frame = +2

Query  20   GLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES-VIVS  196
            G A +S+KNR +I A+NA+E+L+ ILFS+ D +S EL  ESLA+L MFP+ E +  V + 
Sbjct  134  GFARDSEKNRVLIAAHNAKEILIRILFSD-DIDSSELVXESLALLVMFPMTEHDKCVSII  192

Query  197  SDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNC  376
            SDP RV +L  LL + SV+ R+N+AALIE  ++G++       +S+++ IFEG++ +L  
Sbjct  193  SDPGRVEFLTRLLFDSSVETRVNAAALIEMAVTGSKE-----TVSSSESIFEGVLDLLRN  247

Query  377  PLSY--SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVE  547
            P S    RALKIG+KALFALCL+K  RH AV+AGA E LIDRL    D+CD ERALATVE
Sbjct  248  PASSYPRRALKIGIKALFALCLSKNTRHVAVSAGAPEILIDRLAAGLDRCDTERALATVE  307

Query  548  LLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGV  727
            +LCR P GCAAF  HALTVP+LVK IL++S RATEYAAGALL++C+A E+ + EAAAAGV
Sbjct  308  ILCRSPEGCAAFGEHALTVPVLVKTILRVSDRATEYAAGALLALCTAEERWRDEAAAAGV  367

Query  728  MTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            + QLLL+VQS+CTERAKRKAQ LLKLLRD WP+   A SDD+ CS VVPF
Sbjct  368  VVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVVPF  417



>emb|CDX95458.1| BnaC01g33500D [Brassica napus]
Length=417

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 172/290 (59%), Positives = 219/290 (76%), Gaps = 10/290 (3%)
 Frame = +2

Query  20   GLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES-VIVS  196
            G A +S+KNR +I A+NA+E+L+ ILFS+ D +S EL  ESLA+L MFP+ E +  V + 
Sbjct  134  GFARDSEKNRVLIAAHNAKEILIRILFSD-DIDSSELVSESLALLVMFPMTEHDKCVSII  192

Query  197  SDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNC  376
            SDP RV +L  LL + SV+ R+N+AALIE  ++G++       +SN++ IFEG++ +L  
Sbjct  193  SDPGRVEFLTRLLFDSSVETRVNAAALIEMAVTGSKE-----TVSNSESIFEGVLDLLRN  247

Query  377  PLSY--SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVE  547
            P S    RALKIG+KALFALCL+K  RH AV+AGA E LIDRL    D+CD ERALATVE
Sbjct  248  PASSYPRRALKIGIKALFALCLSKNTRHVAVSAGAPEILIDRLAAGLDRCDTERALATVE  307

Query  548  LLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGV  727
            +LCR   GCAAF  HALTVP+LVK IL++S RATEYAAGALL++C+A ++ + EAAAAGV
Sbjct  308  ILCRSLEGCAAFGEHALTVPVLVKTILRVSDRATEYAAGALLALCTAEDRWRDEAAAAGV  367

Query  728  MTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            + QLLL+VQS+CTERAKRKAQ LLKLLRD WP+   A SDD+ CS VVPF
Sbjct  368  VVQLLLMVQSECTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVVPF  417



>gb|KFK35978.1| hypothetical protein AALP_AA4G062500 [Arabis alpina]
Length=432

 Score =   300 bits (767),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 225/306 (74%), Gaps = 14/306 (5%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSP------------ELSHESL  145
            A+RRLRGLA +S+KNR +I A+NA+E+L+ ILFS++D+               EL  ES+
Sbjct  127  AIRRLRGLARDSEKNRVLIAAHNAKEILINILFSDVDAGKSSSSPSSSPYPSSELVTESV  186

Query  146  AILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQ  325
            A+L +F L E E V ++SD  RV ++  LL +  +D R+N+AALIE VL+G +S +L+  
Sbjct  187  ALLVIFHLTETECVSIASDLGRVKFITRLLFDSLIDNRVNAAALIEMVLTGVKSHDLKLM  246

Query  326  ISNADEIFEGIVGILNCPLSYSR-ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ  502
            IS +D +FEG++ +L  P S SR ALKIG+K++FALCL KQ RH AV+AG    LIDRL 
Sbjct  247  ISGSDSVFEGVLDLLKNPNSSSRRALKIGIKSVFALCLVKQSRHLAVSAGVPAVLIDRLA  306

Query  503  -DFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI  679
             DFD+CD ER LATVELLCR+P GCAAF+ HALTV  LVK IL++S RATEYAAGALL++
Sbjct  307  ADFDRCDTERGLATVELLCRLPEGCAAFSEHALTVDFLVKTILRVSERATEYAAGALLAL  366

Query  680  CsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNC  859
            C+A E+ + EA   G++TQLLLLVQSDCTERAKRKAQMLLKLLRD WPE+    SD++  
Sbjct  367  CTAEERCREEAVTVGLVTQLLLLVQSDCTERAKRKAQMLLKLLRDSWPENNLGNSDEFGR  426

Query  860  SYVVPF  877
            S V PF
Sbjct  427  SEVAPF  432



>gb|EYU37659.1| hypothetical protein MIMGU_mgv1a019070mg, partial [Erythranthe 
guttata]
Length=327

 Score =   286 bits (731),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRGLA +SDKNRSVI A NARE+LL ++F+++ S   EL+ ES+AILSMF L E E
Sbjct  124  ALRRLRGLARDSDKNRSVIAALNAREILLSVVFADVVSQPSELNLESIAILSMFTLSEPE  183

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             + V+SDP RV YLV+LL + S+DVR+NSAA+IE+V++G RSPE R QIS +D +FEGIV
Sbjct  184  CLYVASDPDRVCYLVNLLFHSSIDVRVNSAAVIENVVAGIRSPEFRTQISCSDGVFEGIV  243

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
            GIL+ P++Y+RALK+G+KALFALCL KQ+RHKAV AGAVEALIDRL +F+KCDAERALAT
Sbjct  244  GILSYPVAYNRALKVGIKALFALCLVKQHRHKAVAAGAVEALIDRLAEFEKCDAERALAT  303

Query  542  VELLCRIPSGCAAFAAHALTVPLL  613
            VELLCR PSGCAAFA+HALTVPLL
Sbjct  304  VELLCRFPSGCAAFASHALTVPLL  327



>ref|XP_006847114.1| hypothetical protein AMTR_s00017p00223570 [Amborella trichopoda]
 gb|ERN08695.1| hypothetical protein AMTR_s00017p00223570 [Amborella trichopoda]
Length=420

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/298 (52%), Positives = 207/298 (69%), Gaps = 12/298 (4%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVI--LANNAREVLLCILFSNMDS-----NSPELSHESLAILSMF  163
            L+RL  L  ES  NR+ I    ++    +L +   + ++     NS +L  E+++++++ 
Sbjct  128  LQRLNALTKESPHNRAHISLAMHDPHPAILLLALHDPNTIHDPQNSDDLVQEAISLIALA  187

Query  164  PLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  343
            P P   SV+ +S+   +  L  LL + S+DVR N+AA++E+ LS  R  E RA I   D 
Sbjct  188  PEPYCASVVSNSN--HLSRLSVLLVHASLDVRANTAAIVEAALSSGR--ESRAIIGATDG  243

Query  344  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  523
            +   +V +L  PL++ RALK+ VK+LF+LCLAK  R  A+ AGA  AL++RL D D+CDA
Sbjct  244  LIPALVNLLREPLAHPRALKLAVKSLFSLCLAKPNRELAIEAGAASALVERLVDLDRCDA  303

Query  524  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  703
            ERALAT+ELLCR P+GCAAF AHAL VPLLVK+ILK+S RATE AAGALL++C+ SE  Q
Sbjct  304  ERALATIELLCRTPAGCAAFEAHALAVPLLVKMILKVSDRATESAAGALLAVCATSEATQ  363

Query  704  reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVPF  877
            +EA   GV+TQLLLLVQS+CT RAKRKAQ+LLKLLRD WP++  A S DY CS +VPF
Sbjct  364  KEAVTVGVVTQLLLLVQSECTARAKRKAQLLLKLLRDAWPDESVANS-DYACSDIVPF  420



>ref|XP_009416906.1| PREDICTED: U-box domain-containing protein 26 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 140/297 (47%), Positives = 187/297 (63%), Gaps = 16/297 (5%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSN------MDSNSPELSHESLAILSMF  163
            ALRRL  LA ES+KNR+VI  +  R  LL I F         D++ P L  E++A+LSM 
Sbjct  123  ALRRLCALARESEKNRAVISTHETRSALLEIAFEGGEQPGCSDADQPAL--EAMAVLSML  180

Query  164  PLPEAESVIVSSDPVRVGYLVSLL-SNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  340
            PL EAES +V++ P R+  L  ++  +PS + R+N+AA+IESV +GTRS E RA I   D
Sbjct  181  PLSEAESAVVATRPERLHRLGEIVKGHPSSEARINAAAVIESVATGTRSAETRATIGGMD  240

Query  341  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  520
             +  G+V ++  P    RA+++G++ L A+CLAK+ R +AV AGA  A++ R+ +    D
Sbjct  241  GVMGGLVALVEQP-GNPRAVRVGIRGLLAMCLAKENRARAVAAGAAAAVVRRMGELSSSD  299

Query  521  AERALATVELLCRIPSGCAAFAAHALTVPLLVK-----IILKISHRATEYAAGALLSICs  685
             ERALATVELLCR   G  A  A        V      +  K S RA E+AAGAL+++  
Sbjct  300  LERALATVELLCRGEGGREAVVAGWGGGAAAVAALVRLMAWKASGRAAEHAAGALVAVLG  359

Query  686  aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTAISDDY  853
             SE  QREA AAGV+  LLL+VQ  C++RAKRKAQ+LLKLLR  WP  DF A SDD+
Sbjct  360  GSEALQREAVAAGVVAHLLLMVQGGCSDRAKRKAQLLLKLLRPAWPYRDFIANSDDF  416



>emb|CBI32390.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +2

Query  419  LFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHAL  598
            +F L  ++  RHKAV AGAV ALIDRL DF+KCD ERALATVELLCR+P+GCAAFAAHAL
Sbjct  226  MFPLSESECARHKAVAAGAVTALIDRLADFEKCDVERALATVELLCRVPAGCAAFAAHAL  285

Query  599  TVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAK  778
            TVPLLV+ ILK+S RATEYAAGALLS+CSA+EQ+QREA +AGV+TQLLLLVQSDCTERAK
Sbjct  286  TVPLLVRKILKVSDRATEYAAGALLSLCSAAEQSQREAVSAGVVTQLLLLVQSDCTERAK  345

Query  779  RKAQMLLKLLRDCWPEDFTAISDDYNCSYV  868
            RKAQ+LLKLLRD WPED    SDD+ CS V
Sbjct  346  RKAQLLLKLLRDSWPEDSVVNSDDFGCSDV  375


 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            A++RLRGLA +SDKNRS+I ++N +EVLL ++FS+ + +S EL HESLA+L MFPL E+E
Sbjct  174  AVKRLRGLARDSDKNRSIIGSHNVQEVLLPVIFSDSECDSAELKHESLALLVMFPLSESE  233



>ref|XP_010481065.1| PREDICTED: U-box domain-containing protein 26-like [Camelina 
sativa]
Length=361

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 141/193 (73%), Gaps = 3/193 (2%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESL--AILSMFPLPE  175
            A+RRLRGLA +S+KNR +I A+NAREVL+ ILF+++++ S      S   A+L +  + E
Sbjct  127  AIRRLRGLARDSEKNRVLIAAHNAREVLVRILFADVETTSSSSELVSESLALLVVLHMTE  186

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
             E   V+SDP RVG+L  LL + S+++R+N+AAL+E VL+G++S +L+  IS +D IFEG
Sbjct  187  TECEAVASDPGRVGFLTRLLFDSSIEIRVNAAALVEMVLTGSKSTDLKLVISGSDSIFEG  246

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL-QDFDKCDAERA  532
            ++ +L  P+S  RALKIG+KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD ER 
Sbjct  247  VLDLLRNPISSRRALKIGIKAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDTERG  306

Query  533  LATVELLCRIPSG  571
            LATVEL+    +G
Sbjct  307  LATVELILSHQTG  319



>ref|XP_008784183.1| PREDICTED: U-box domain-containing protein 25-like [Phoenix dactylifera]
Length=416

 Score =   185 bits (469),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 136/293 (46%), Positives = 194/293 (66%), Gaps = 12/293 (4%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLR LA ESDKNR+VI  +  R  L+ I F + DS+   L  E++ +L+M  L E E
Sbjct  123  ALRRLRSLARESDKNRTVISTHETRSALIVIAFEDPDSD---LGLEAIRVLAMCSLTEGE  179

Query  182  SVIVSSDPVRVGYLVSLL-SNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
            S  V+  P R+  LV ++  +P+++ R+++AA++E+V +G RS E RA +   + + EG+
Sbjct  180  SAEVAGRPERLRRLVEVMREHPAMEARISAAAVLEAVAAGARSAEARAAVGATEGVMEGL  239

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF--DKCDAERA  532
            VG++    S +RA+++G++ LF+LCLAK+ R +AV AGA  A++ R+ D   ++ DAERA
Sbjct  240  VGLVEEKGSSARAVRVGIRGLFSLCLAKENRGRAVAAGAAAAVVRRIVDLAAERGDAERA  299

Query  533  LATVELLCRIPSG-----CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq  697
            LATVELLCR   G       A    A    L+  +  K S RA E+AAGAL+++   SE 
Sbjct  300  LATVELLCRTEGGREAVVAGAGGGAAAVEALVRAMAGKASERAAEHAAGALVAVVGGSEC  359

Query  698  aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTAISDDY  853
             QREA  AGV+TQLLL+VQ  C++RAKRKAQ+LLKLLR  WP +D+ A SDD+
Sbjct  360  LQREAVGAGVVTQLLLMVQGGCSDRAKRKAQVLLKLLRSAWPHDDYIANSDDF  412



>ref|XP_010489938.1| PREDICTED: U-box domain-containing protein 25-like, partial [Camelina 
sativa]
Length=302

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 127/177 (72%), Gaps = 4/177 (2%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLRG A +SDKNR +I A+NA  VL+ ILFS  ++ S EL  ESLA+L M P+ E  
Sbjct  128  ALRRLRGFARDSDKNRVLIAAHNATAVLIMILFS--ETTSSELVSESLALLVMLPITEPN  185

Query  182  SVI-VSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
             ++ +SSDP RV +L  LL + S++ R+N+AALIE V +GT+S + +   SN + +FEG+
Sbjct  186  QLVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVTTGTKSEDPKGTFSNYESVFEGV  245

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL-QDFDKCDAE  526
            + +L  P+S  RALKIG+KALF+LC AKQ RH A+ AGA E LIDRL  DFD+CD E
Sbjct  246  LDLLRNPISSRRALKIGIKALFSLCSAKQTRHLAINAGAPEILIDRLAADFDRCDTE  302



>ref|XP_009403520.1| PREDICTED: U-box domain-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 173/294 (59%), Gaps = 11/294 (4%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSH---ESLAILSMFPLP  172
            ALRRL  L  ES+KNR VI  +  R  L+ I F   +S  P+      +++A+LSM  + 
Sbjct  125  ALRRLGSLVRESEKNRVVISTDETRSALVEIAFEGEESGCPDADQPAMDAMAVLSMLSMT  184

Query  173  EAESVIVSSDPVRVGYLVSLL-SNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
            EAES  V++ P R+  L  ++  +PS + R+N+A +IE+V +G RS E RA +   + + 
Sbjct  185  EAESAGVAARPERLRRLGEVVRGHPSTEARINAATVIEAVAAGARSAETRAAVGGTEGVM  244

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAER  529
            EG+V ++       RA ++G++ LFALCLAK+ R +A+ AGA  A++ R+ +    D ER
Sbjct  245  EGLVELV-AQRGNGRAGRVGIRGLFALCLAKENRGRALAAGAAAAVVGRVAELASSDVER  303

Query  530  ALATVELLCRIPSG-----CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase  694
            ALATVELLCR   G                 L+  +  K S RA E+AA  L+++   SE
Sbjct  304  ALATVELLCREDGGRDAVVAGWGGGAVAVAALVRVMAGKASGRAAEHAAAVLVAVLGGSE  363

Query  695  qaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTAISDDY  853
                EA AAGV+  LLL+VQ  C+ERAKRKAQ+LLKL R  WP  D  + SDD+
Sbjct  364  ALHAEAVAAGVVAHLLLMVQGGCSERAKRKAQLLLKLFRSAWPRHDTISNSDDF  417



>ref|XP_009406118.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
25-like [Musa acuminata subsp. malaccensis]
Length=421

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 136/296 (46%), Positives = 184/296 (62%), Gaps = 16/296 (5%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMD------SNSPELSHESLAILSMFP  166
            LRRLR LA ESDKNR+VI  +  R  L+ I F   +      ++ P L  E++A+L+M P
Sbjct  125  LRRLRSLARESDKNRAVISTHETRSALVEIAFEGGEQLELPEADQPAL--EAMAVLAMLP  182

Query  167  LPEAESVIVSSDPVRVGYLVSLLS-NPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  343
            L E ESV V+S P R+  L  ++  + S++ R+N+AA+IE+V  G RS E RA +   + 
Sbjct  183  LTETESVAVASRPERLCRLGEMVRRHASMEARINAAAVIEAVAVGARSAETRASVGGTNG  242

Query  344  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  523
            +  G+V +        RA+++G++ LFALCLAK+ R +AV AGA  A++ RL +    DA
Sbjct  243  VVVGLVALAE-QRGNPRAVRVGIRGLFALCLAKENRGRAVAAGAAAAVVGRLGELASSDA  301

Query  524  ERALATVELLCRIPSGCAAFAA-----HALTVPLLVKIILKISHRATEYAAGALLSICsa  688
            ERALATVELLCR+  G  A  A      A  V L+  +  K S RA E+AAGALL++   
Sbjct  302  ERALATVELLCRVEGGREAVVAGWGGGDAAVVALVRAMAGKASWRAAEHAAGALLAVLGP  361

Query  689  seqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE-DFTAISDDY  853
            SE  Q  A AAGV+  LL+LVQ  C++RA RKAQ+LLKLLR  WP  D  A SDD+
Sbjct  362  SEALQMVAVAAGVVGHLLMLVQGGCSDRAXRKAQLLLKLLRSAWPHYDSIANSDDF  417



>ref|XP_010912457.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
25-like [Elaeis guineensis]
Length=411

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 130/293 (44%), Positives = 183/293 (62%), Gaps = 17/293 (6%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALRRLR LA ESDKNR+VI  +  R  L+ I F +     P+L  E++ +L+M  L E E
Sbjct  123  ALRRLRSLAQESDKNRAVISTHETRSALIEIAFED---PHPDLGLEAMGVLAMCSLTEGE  179

Query  182  SVIVSSDPVRVGYLVSLL-SNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
            S  V+  P R+  LV ++  +P+++ R+++AA++E+V +       RA +   + + EG+
Sbjct  180  SAEVAGRPERLRRLVEVMREHPAMEARISAAAVLEAVAA-----GARAAVGATEGVMEGL  234

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKC--DAERA  532
            VG+L    S +RA++ G++ LF+LCLAK+ R +AV AGA  A++   +       DAERA
Sbjct  235  VGLLEEKGSSARAVRAGIRGLFSLCLAKENRGRAVAAGAAAAVVXADRGAGGXARDAERA  294

Query  533  LATVELLCRIPSG-----CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq  697
            LATVELLCR   G       A    A  V L+  +  K S RA E+AAGAL+++   SE 
Sbjct  295  LATVELLCRTEGGREAVVAGAGGGAAAVVALVRAMAGKASERAAEHAAGALVAVVGGSEW  354

Query  698  aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTAISDDY  853
             QREA  AG++TQLLL+VQ  C++RAKRKAQ+LLKLLR  WP  D  A SDD+
Sbjct  355  LQREAVGAGLVTQLLLMVQGGCSDRAKRKAQLLLKLLRSAWPHHDSIANSDDF  407



>ref|XP_004952703.1| PREDICTED: U-box domain-containing protein 26-like [Setaria italica]
Length=408

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 119/281 (42%), Positives = 169/281 (60%), Gaps = 5/281 (2%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAESVIVSSDPVR  211
            ESDKNR V+     R  L+ + F +    S EL  E++A+L++  L EAE+  V     R
Sbjct  130  ESDKNRLVMATRETRAALVEVAFGSGSGASEELEAEAMAVLALVGLGEAEAAEVVGREER  189

Query  212  VGYLVSLLS-NPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY  388
            V  L  +L+    ++ R+N+ A++E+  S     E RA +  A+ + EG+V +     ++
Sbjct  190  VTRLGKVLAAGGPLEARVNAGAVVEAAAS-ASGAEARAVLGAAEGVMEGLVALAE-EKAH  247

Query  389  SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPS  568
            +RA+++G++ LFALCLAK+ R +AV+AGA  AL  R+ +    + ERALA VE LCR   
Sbjct  248  ARAVRVGIRGLFALCLAKENRPRAVSAGAASALARRVSEGGAGEPERALAAVERLCRAEG  307

Query  569  GCAAFAAHALTVPLLVKIILK-ISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLL  745
            G  A  A A   P  V  +++ +S RA E+AAGAL+++   SE  Q EA  AG M+QLLL
Sbjct  308  GRDAVVAGAGGGPAAVAALVRAMSGRAAEHAAGALVAVVGGSEALQVEAVRAGAMSQLLL  367

Query  746  LVQSDCTERAKRKAQMLLKLLRDCWP-EDFTAISDDYNCSY  865
            +VQ  C+ERAKRKAQ LLKLLR  WP  D  A SDD+   Y
Sbjct  368  MVQGGCSERAKRKAQHLLKLLRSAWPTTDCIANSDDFLQPY  408



>dbj|BAJ97989.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=407

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 170/292 (58%), Gaps = 10/292 (3%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES  184
            L++LR LA ESDKNR V+  +  R  L+ + F      +   +   LA++ M    EAE+
Sbjct  121  LKKLRALARESDKNRLVMATHETRAALVEMAFGGSAEEAQAEAMAVLALVGMG---EAEA  177

Query  185  VIVSSDPVRVGYLVSLLS--NPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
            V V     RV  L  +L     +++ ++N+ A++E+  +     E R  +  AD + EG+
Sbjct  178  VDVVGREDRVTRLAKVLGSQGTTLEAKVNAGAVVEAAAA-VSGAEARVVLGAADGVIEGL  236

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFD-KCDAERAL  535
            V +++   + +RA+++G++ LFALCLAK+ R +AV+AGA  AL  R+ +     + ERAL
Sbjct  237  VALVD-EKANARAVRVGIRGLFALCLAKENRQRAVSAGAASALARRVAEGGCAGELERAL  295

Query  536  ATVELLCRIPSGC-AAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqrea  712
            A VE L R   G  A  +       +++ ++  +S RA E+AAGAL+++   SE  Q EA
Sbjct  296  AAVERLSRTDGGREAVISGAGGGAAVVIALVRAMSGRAAEHAAGALVAVVGGSEVLQLEA  355

Query  713  aaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTAISDDYNCSY  865
              AG M+QLL++VQ  C+ERAKRKAQ LLKLLR  WP  D  A SDD+   Y
Sbjct  356  VRAGAMSQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSDDFLRPY  407



>gb|EMS66308.1| U-box domain-containing protein 25 [Triticum urartu]
Length=407

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 170/292 (58%), Gaps = 10/292 (3%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES  184
            LR+LR LA ESDKNR V+  +  R  L+ + F      +   +   LA++ M    EAE+
Sbjct  121  LRKLRALARESDKNRLVMATHETRAALVEMAFGGSAEEAQAEAMAVLALVGMG---EAEA  177

Query  185  VIVSSDPVRVGYLVSLLS--NPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
            V V     RV  L  +L     +++ ++N+ A++E+  +     E R  +  AD + EG+
Sbjct  178  VDVVGREERVTRLGKVLGSQGTTLEAKVNAGAVVEAAAA-VSGAEARVVLGAADGVIEGL  236

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFD-KCDAERAL  535
            V +++   + +RA++IG++ LFALCLAK+ R +AV+AGA  AL  R+ +     + ERAL
Sbjct  237  VALVD-EKANARAVRIGIRGLFALCLAKENRQRAVSAGAASALARRVAEGGCAGELERAL  295

Query  536  ATVELLCRIPSGCAAFAAHALT-VPLLVKIILKISHRATEYAAGALLSICsaseqaqrea  712
            A VE L R   G  A  + A     +++ ++  +S RA E+AAGAL+++   SE  Q EA
Sbjct  296  AAVERLSRTEGGREAVVSGAGGGAAVVIALVRAMSGRAAEHAAGALVAVVGGSEGLQLEA  355

Query  713  aaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTAISDDYNCSY  865
              AG M+QLL++VQ  C+ERAKRKAQ LLKLLR  WP  D  A S D+   Y
Sbjct  356  VRAGAMSQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSADFLQPY  407



>gb|EMT28323.1| U-box domain-containing protein 25 [Aegilops tauschii]
Length=407

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 170/292 (58%), Gaps = 10/292 (3%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES  184
            LR+LR LA ESDKNR V+  +  R  L+ + F      +   +   LA++ M    EAE+
Sbjct  121  LRKLRALARESDKNRLVMATHETRAALVEMAFGGSAEEAQAEAMAVLALVGMG---EAEA  177

Query  185  VIVSSDPVRVGYLVSLLS--NPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
            V V     RV  L  +L     +++ ++N+ A++E+  +     E R  +  AD + EG+
Sbjct  178  VDVVGREDRVTRLGKVLGSQGTTLEAKVNAGAVVEAAAA-VSGAEARVVLGAADGVIEGL  236

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFD-KCDAERAL  535
            V +++   + +RA++IG++ +FALCLAK+ R +AV+AGA  AL  R+ +     + ERAL
Sbjct  237  VALVD-EKANARAVRIGIRGVFALCLAKENRQRAVSAGAASALARRVAEGGCAGELERAL  295

Query  536  ATVELLCRIPSGCAAFAAHALT-VPLLVKIILKISHRATEYAAGALLSICsaseqaqrea  712
            A VE L R   G  A  + A     L++ ++  +S RA E+AAGAL+++   SE  Q EA
Sbjct  296  AAVERLSRTEGGREAVVSGAGGGAALVIALVRAMSGRAAEHAAGALVAVVGGSEVLQLEA  355

Query  713  aaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTAISDDYNCSY  865
              AG M+QLL++VQ  C+ERAKRKAQ LLKLLR  WP  D  A S D+   Y
Sbjct  356  VRAGAMSQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSADFLQPY  407



>ref|XP_002974135.1| ubiquitin-protein ligase, PUB26, partial [Selaginella moellendorffii]
 gb|EFJ25090.1| ubiquitin-protein ligase, PUB26, partial [Selaginella moellendorffii]
Length=405

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 125/283 (44%), Positives = 169/283 (60%), Gaps = 11/283 (4%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALR LR LA E+DKNR +++  NA   L  I       +S ++   SLA+L + PL ++E
Sbjct  127  ALRSLRALAKENDKNRGLMVEANAVSAL--IHHDQHLGDSLDVEESSLAVLVLLPLKDSE  184

Query  182  SVIVSSDPVRVGYLVSLLS-NPSVDVRMNSAALIESVLSGTRSPEL-RAQISNADEIFEG  355
               ++    R+G +  ++    S+D R+N+A L+E + S   +PE  +  +     + EG
Sbjct  185  RRSIAQCRRRLGAVSRIVRRGRSMDARINAAVLVEKIASD--APEAAKLAMGQIPGLLEG  242

Query  356  IVGILNCPLS--YSRALKIGVKALFALCL--AKQYRHKAVTAGAVEALIDRLQDFDKCDA  523
            +V +L    S    RA K GVKALF+LCL  A     +AV+AGA  AL++ L      DA
Sbjct  243  LVDLLRGDHSAVSPRAPKSGVKALFSLCLCSAASNSERAVSAGAAAALVEHLPAAQHGDA  302

Query  524  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIIL-KISHRATEYAAGALLSICsaseqa  700
            +R L  +ELLCR  +G    A HAL VP LV  I  + S +A E AAG LL++CS SE+ 
Sbjct  303  DRTLGALELLCRTRAGREVVAQHALAVPALVAAIQCRSSFQAAECAAGTLLAVCSGSEEV  362

Query  701  qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  829
            Q  AA AGV+TQLLLL+QSDCT+RAKRKA  LLKLLR  W ED
Sbjct  363  QLAAAEAGVLTQLLLLIQSDCTDRAKRKAVELLKLLRRWWAED  405



>gb|ABK25582.1| unknown [Picea sitchensis]
Length=413

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 159/295 (54%), Gaps = 19/295 (6%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAIL-SMFPLPEAE  181
            LR +  LA   ++NR V+      + L+ IL       +P+   E+L++L ++   P+  
Sbjct  124  LRAIARLAQGCERNREVLFNAGVADGLVSILLDG--HGAPDFCVEALSVLLALSRSPKLL  181

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
             V V    +      SL S     VR+N+  L+E  L          Q S      +G++
Sbjct  182  QVFVDEQRMLDLAAFSLNSTAPPGVRLNALLLLEKTLV--------FQPSGGHVGVKGLM  233

Query  362  -GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALA  538
             G++    +Y    K+ +KAL ALCL ++ R +AV AG V+A+++ L +  +  AERALA
Sbjct  234  EGLVRSLPNYQ---KLVIKALLALCLTERNRGEAVRAGVVDAILELLPNLKEVCAERALA  290

Query  539  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq---aqre  709
            T++LLC +  G  A   HAL VPLL+ +ILK+S R TEYA  AL +IC   +    A+  
Sbjct  291  TLDLLCTVSEGRRALREHALAVPLLLDMILKVSDRGTEYAVSALCAICVHEDGGIDAREN  350

Query  710  aaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVP  874
            A  +G  TQLLLL+QSDCT RAKRKA  LLK+L   W E    I D+ NC +  P
Sbjct  351  AIQSGAFTQLLLLLQSDCTSRAKRKALQLLKVLHKVWGEGSCNIPDE-NCIFSSP  404



>ref|XP_003575105.1| PREDICTED: U-box domain-containing protein 25-like [Brachypodium 
distachyon]
Length=412

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 122/295 (41%), Positives = 175/295 (59%), Gaps = 9/295 (3%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALR+LR LA ESDKNR V+  +  R  L+ + F        E   E++A+LS+  + EAE
Sbjct  120  ALRKLRALARESDKNRLVMATHETRAALVEMAFGAGGGGE-EAQAEAMAVLSLIGMGEAE  178

Query  182  SVIVSSDPVRVGYLVSLLSNP----SVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
            +V V     RV  L  LL +     +++ R+N+ A++E+  +     E R  +  A+ + 
Sbjct  179  AVEVVGREERVARLGKLLGSSQGIMTLEARVNAGAVVEAAAA-VSGAEARVVLGVAEGVM  237

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFD-KCDAE  526
            EG+V +++   + +RA+++G++ LFALCLAK+ R +AV AGA  AL  R+ +     + E
Sbjct  238  EGLVALVDEKGNNARAVRVGIRGLFALCLAKENRPRAVAAGAASALARRVAEGGCAGEPE  297

Query  527  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILK-ISHRATEYAAGALLSICsaseqaq  703
            RALA VE LCR   G  A  + A      V  +++ +S RA E+AAGAL+++   SE  Q
Sbjct  298  RALAAVERLCRTEGGRDAVVSGAGGGATAVTALVRAMSGRAAEHAAGALVAVVGGSEALQ  357

Query  704  reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTAISDDYNCSY  865
             EA  AG M+QLLL+VQ  C+ERAKRKAQ LLKLLR  WP  D  A SDD+   Y
Sbjct  358  VEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSDDFLNPY  412



>gb|ABK24171.1| unknown [Picea sitchensis]
Length=308

 Score =   137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 156/290 (54%), Gaps = 19/290 (7%)
 Frame = +2

Query  20   GLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAIL-SMFPLPEAESVIVS  196
            G +   ++NR V+      + L+ IL       +P+   E+L++L ++   P+   V V 
Sbjct  24   GASWGCERNREVLFNACVADGLVSILLDG--HGAPDFCVEALSVLLALSRSPKLLQVFVD  81

Query  197  SDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV-GILN  373
               +      SL S     VR+N+  L+E  L          Q S    + +G++ G++ 
Sbjct  82   EQRMLDLAAFSLNSTAPPGVRLNALLLLEKTLV--------FQPSGGHVVVKGLMEGLVR  133

Query  374  CPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELL  553
               +Y    K+ +KAL ALCL ++ R +AV AG V+A+++ L +  +  AERALAT++LL
Sbjct  134  SLPNYQ---KLVIKALLALCLTERNRGEAVRAGVVDAILELLPNLKEVCAERALATLDLL  190

Query  554  CRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs---aseqaqreaaaaG  724
            C +  G  A   HAL VPLL+ +ILK+S R T YA  AL +IC        A++ A  +G
Sbjct  191  CTVSEGRRALREHALAVPLLLDMILKVSDRGTGYAVSALCAICVHEDGGIDARKNAIQSG  250

Query  725  VMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVP  874
              TQLLLL+QSDCT RAKRKA  LLK+L   W E    I D+ NC +  P
Sbjct  251  AFTQLLLLLQSDCTSRAKRKALQLLKVLHKVWGEGSCNIPDE-NCIFSSP  299



>ref|XP_001778934.1| predicted protein [Physcomitrella patens]
 gb|EDQ56270.1| predicted protein [Physcomitrella patens]
Length=206

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 114/203 (56%), Gaps = 24/203 (12%)
 Frame = +2

Query  251  DVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGI-------LNCPLSYSRALKI-  406
            D R N+ +L+E +              + +E F+G +G        LN  L   + LK+ 
Sbjct  7    DARENACSLLEKL--------------SLNEAFKGTIGACSGVMEALNTTLPDEKHLKLV  52

Query  407  --GVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  580
                K L ALCL ++ R +AV  GAV +L++ L       AE+ALAT+ELL  I  G AA
Sbjct  53   KMATKTLLALCLLQENRFRAVEVGAVASLLEMLPRTRSATAEKALATLELLGTIEEGKAA  112

Query  581  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSD  760
               HAL VP+LV++IL +S R TEYAAG L S+C  +   +  A A G  T+LLLL+QSD
Sbjct  113  IIDHALAVPVLVELILTVSDRGTEYAAGTLSSMCRDNMAMREAAVAHGAPTKLLLLIQSD  172

Query  761  CTERAKRKAQMLLKLLRDCWPED  829
            CT RA RKA  LLK+L   W +D
Sbjct  173  CTARANRKANQLLKVLHKLWVQD  195



>ref|NP_001047085.2| Os02g0548700 [Oryza sativa Japonica Group]
 dbj|BAF08999.2| Os02g0548700 [Oryza sativa Japonica Group]
Length=417

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 178/299 (60%), Gaps = 15/299 (5%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES  184
            LR+LR LA +SDKNR V+  +  R  L+ + F   ++   E+  E++A+L+M  L EAE+
Sbjct  122  LRKLRALARDSDKNRLVMATHETRAALVDMAFGT-NAGGEEVEAEAMAVLAMVGLGEAEA  180

Query  185  VIVSSDPVRVGYLVSLL--------SNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  340
            V V     RV  L  LL        +  +++ R+N+ A++E+V + + + + RA +  A+
Sbjct  181  VEVVGRRERVARLGELLVSGEGAATTTATLECRVNAGAVVEAVAAVSGA-DARAVLGAAE  239

Query  341  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  520
             + EG+V ++    +++RA+++G++ LFALCLAK+ R +AV AGA  AL  R+ +     
Sbjct  240  GVMEGLVALVE-EKAHARAVRVGIRGLFALCLAKENRPRAVAAGAAAALARRVAEGGGGA  298

Query  521  A--ERALATVELLCRIPSGC-AAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  691
               ERALA VE LCR   G  A  A        +  ++  +S R+ E+AAGAL+++   S
Sbjct  299  GEPERALAAVERLCRTEGGRDAVVAGAGGGAAAVCALVRAMSGRSAEHAAGALVAVVGGS  358

Query  692  eqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTAISDDYNCSY  865
            E  Q EA  AG M+QLLL+VQ  C+ERAKRKAQ LLKLLR  WP  D  A SDD+   Y
Sbjct  359  EPLQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPAADSIANSDDFLQPY  417



>dbj|BAD16187.1| putative immediate-early fungal elicitor protein CMPG1 [Oryza 
sativa Japonica Group]
 dbj|BAD16270.1| putative immediate-early fungal elicitor protein CMPG1 [Oryza 
sativa Japonica Group]
Length=423

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 120/299 (40%), Positives = 178/299 (60%), Gaps = 15/299 (5%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES  184
            LR+LR LA +SDKNR V+  +  R  L+ + F   ++   E+  E++A+L+M  L EAE+
Sbjct  128  LRKLRALARDSDKNRLVMATHETRAALVDMAFGT-NAGGEEVEAEAMAVLAMVGLGEAEA  186

Query  185  VIVSSDPVRVGYLVSLL--------SNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  340
            V V     RV  L  LL        +  +++ R+N+ A++E+V + + + + RA +  A+
Sbjct  187  VEVVGRRERVARLGELLVSGEGAATTTATLECRVNAGAVVEAVAAVSGA-DARAVLGAAE  245

Query  341  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  520
             + EG+V ++    +++RA+++G++ LFALCLAK+ R +AV AGA  AL  R+ +     
Sbjct  246  GVMEGLVALVE-EKAHARAVRVGIRGLFALCLAKENRPRAVAAGAAAALARRVAEGGGGA  304

Query  521  A--ERALATVELLCRIPSGC-AAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  691
               ERALA VE LCR   G  A  A        +  ++  +S R+ E+AAGAL+++   S
Sbjct  305  GEPERALAAVERLCRTEGGRDAVVAGAGGGAAAVCALVRAMSGRSAEHAAGALVAVVGGS  364

Query  692  eqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTAISDDYNCSY  865
            E  Q EA  AG M+QLLL+VQ  C+ERAKRKAQ LLKLLR  WP  D  A SDD+   Y
Sbjct  365  EPLQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPAADSIANSDDFLQPY  423



>ref|XP_002453962.1| hypothetical protein SORBIDRAFT_04g022280 [Sorghum bicolor]
 gb|EES06938.1| hypothetical protein SORBIDRAFT_04g022280 [Sorghum bicolor]
Length=407

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 117/283 (41%), Positives = 167/283 (59%), Gaps = 10/283 (4%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAESVIVSSDPVR  211
            ESDKNR V+  +  R  L+   F    S + E+  E++A+L++  L EAE+  V     R
Sbjct  130  ESDKNRLVMATHETRAALVEAAFG---SGAEEVQAEAMAVLALVGLGEAEAAAVVGREER  186

Query  212  VGYLVSLLS---NPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  382
            V  L  +L+      ++ R+N+ A+ E+  S     E RA +  A+ + +G+V ++    
Sbjct  187  VARLGKVLAAGVGVPLEARVNAGAVAEAAAS-ASGAEARAVLGAAEGVMDGLVALVE-EK  244

Query  383  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  562
            + +RA+++G++ALFALCLAK+ R +AV AGA  AL  R+ +    + ERALA VE LCR 
Sbjct  245  ANARAVRVGIRALFALCLAKENRPRAVAAGAASALARRVAEGGAGEPERALAAVERLCRA  304

Query  563  PSGCAAFAAHALTVPLLVKIILK-ISHRATEYAAGALLSICsaseqaqreaaaaGVMTQL  739
              G  A  A A      V  +++ +S RA E+AAGAL+++   SE  Q EA  AG M+QL
Sbjct  305  EGGRDAVVAGAGGGSAAVTALVRAMSGRAAEHAAGALVAVVGGSEALQVEAVRAGAMSQL  364

Query  740  LLLVQSDCTERAKRKAQMLLKLLRDCWPE-DFTAISDDYNCSY  865
            LL+VQ  C+ERAKRKAQ LLKLLR  WP  D  A SDD+   Y
Sbjct  365  LLMVQGGCSERAKRKAQHLLKLLRSAWPNTDCIANSDDFLQHY  407



>ref|XP_002968838.1| ubiquitin-protein ligase, PUB26 [Selaginella moellendorffii]
 gb|EFJ29954.1| ubiquitin-protein ligase, PUB26 [Selaginella moellendorffii]
Length=396

 Score =   130 bits (326),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 160/283 (57%), Gaps = 34/283 (12%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            ALR LR LA E+DKNR ++                           SLA+L + PL ++E
Sbjct  127  ALRSLRALAKENDKNRGLM-------------------------ESSLAVLVLLPLKDSE  161

Query  182  SVIVSSDPVRVGYLVSLLS-NPSVDVRMNSAALIESVLSGTRSPEL-RAQISNADEIFEG  355
               ++    R+G +  ++    S+D R+N+A L+E + S   +PE  +  +     + EG
Sbjct  162  RRSIAQCRRRLGAVSRIVRRGRSMDARINAAVLVEKIASD--APEAAKLAMGQIPGLLEG  219

Query  356  IVGILNCPLS--YSRALKIGVKALFALCL--AKQYRHKAVTAGAVEALIDRLQDFDKCDA  523
            +V +L    S    RA K GVKALF+LCL  A     +AV+AGA  AL++ L      DA
Sbjct  220  LVDLLRGDHSAVSPRAPKSGVKALFSLCLCSAASNSERAVSAGAAAALVEHLPAAQHGDA  279

Query  524  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIIL-KISHRATEYAAGALLSICsaseqa  700
            +R L  +ELLCR  +G    A HAL VP LV  I  + S +A E AAG LL++CS SE+ 
Sbjct  280  DRTLGALELLCRTRAGREVVAQHALAVPALVAAIQCRSSFQAAECAAGTLLAVCSGSEEV  339

Query  701  qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  829
            Q  AA AGV+TQLLLL+QSDCT+RAKRKA  LLKLLR  W ED
Sbjct  340  QLAAAEAGVLTQLLLLIQSDCTDRAKRKAVELLKLLRRWWAED  382



>ref|XP_001752821.1| predicted protein [Physcomitrella patens]
 gb|EDQ82325.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 136/241 (56%), Gaps = 7/241 (3%)
 Frame = +2

Query  110  DSNSPELSHESLAILSMFPLPEAESVIVS-SDPVRVGYLVSLLSNPSVDVRMNSAALIES  286
            D+++P L  ESLA LS+  L E ES     + P  +  ++  +       R N+  ++E 
Sbjct  341  DNHAPSLLEESLAALSV--LSEEESTTQQMTTPEFLTVVMWHIRKGRKLARENACVILER  398

Query  287  VLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVT  466
            +   +     +  +  +  + EG+  IL     + + +K+  + L ALCL ++ R +A  
Sbjct  399  L---SLKEGFKETMGASPGVLEGLNSIL-LHEKHLKLVKLATRTLLALCLLRENRLRAAE  454

Query  467  AGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRA  646
            AGAV ++++ L       AE+ALAT+ELL     G AA   HAL VP+LV++ILK+S R 
Sbjct  455  AGAVASILEMLPLARSAVAEKALATLELLSTTEEGKAAIIDHALAVPVLVELILKVSDRG  514

Query  647  TEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
            TEYAAG L +ICS +   Q  A   G  T+LLLL+QSDCT RAKRKA  LLK+L   W +
Sbjct  515  TEYAAGTLSAICSDNLAMQEAAVEHGAPTKLLLLIQSDCTARAKRKANQLLKVLHKLWMQ  574

Query  827  D  829
            +
Sbjct  575  N  575



>gb|AFW71736.1| ubiquitin-protein ligase [Zea mays]
Length=418

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 112/288 (39%), Positives = 156/288 (54%), Gaps = 11/288 (4%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLL---CILFSNMDSNSPELSHESLAILSMFPLPEAESVIVSSD  202
            ESDKNR V+  +  R  L+       S   + S EL  E++A+L++  L EAE+  V   
Sbjct  130  ESDKNRLVMATHETRAALVEAAFGSGSGSGAASEELETEAMAVLALVGLGEAEAAEVVGR  189

Query  203  PVRVGYLVSLLSNPS-VDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNC-  376
              RV  L  +L     ++ R+N+ A++E+V S +   E RA +  A+ + +G+V +    
Sbjct  190  EERVARLGKVLGGGGPLEARVNAGAVVEAVASAS-GAEARAALGGAEGVMDGLVALAEEE  248

Query  377  PLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLC  556
              + +RA+++GV+ALFALCLAK+ R +AV AGA  AL  R+ +    + ERALA VE LC
Sbjct  249  KANNARAVRVGVRALFALCLAKENRARAVAAGAAAALARRVAEGGAGEPERALAAVERLC  308

Query  557  RIPSG----CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaG  724
            R   G     A        V  LV+ +          A  A++     SE  Q EA  AG
Sbjct  309  RAEGGRDAVVAGAGGGPAAVAALVRAMSGRGAEHAAGALAAVVVGAGGSEALQAEAVRAG  368

Query  725  VMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE-DFTAISDDYNCSY  865
             M +LLL+VQ  C+ERAKRKAQ LLKLLR  WP  D  A SDD+   Y
Sbjct  369  AMGRLLLMVQGGCSERAKRKAQHLLKLLRSAWPSADCVANSDDFLQHY  416



>ref|XP_001762017.1| predicted protein [Physcomitrella patens]
 gb|EDQ73121.1| predicted protein [Physcomitrella patens]
Length=587

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 94/158 (59%), Gaps = 14/158 (9%)
 Frame = +2

Query  398  LKIGVKALFALCLAKQYRHK--------------AVTAGAVEALIDRLQDFDKCDAERAL  535
            +K+  K L ALCL ++ R +              AV  GAV +L++ L       AE+ L
Sbjct  416  VKLATKTLLALCLLRENRRRFSKSYTVQLLALSRAVEVGAVASLLEMLPWVGSATAEKVL  475

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  715
            AT+ELL  I  G AA   HAL VP+LV++ILK+S R TEYAAG L  +CS S   +  A 
Sbjct  476  ATLELLGTIEEGKAAIIDHALAVPVLVELILKVSDRGTEYAAGTLSMMCSDSIAMREAAV  535

Query  716  aaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  829
            A G  T+LLLL+QSDCT RAKRKA  LLK+L   W +D
Sbjct  536  AHGAPTKLLLLIQSDCTARAKRKASQLLKVLHKLWVQD  573



>ref|XP_001776109.1| predicted protein [Physcomitrella patens]
 gb|EDQ59020.1| predicted protein [Physcomitrella patens]
Length=410

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 154/291 (53%), Gaps = 13/291 (4%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            +LR+LR LA E ++NR  I        L   +       S E   +++AI+    L + +
Sbjct  113  SLRKLRMLAKECERNRKRIAEAGGVGTLAAAMGRGEMDMSVEACEDAVAIIVHLQLGDGD  172

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
               +S +P  + +L  +L++ S++ ++N+A +I ++     +P ++A + +       IV
Sbjct  173  KRALS-EPKMLSHLGFVLASGSLEGKVNAADIIHALCK--ENPRVKAAVGDLPGAIRAIV  229

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALAT  541
             +L   L Y RA++ G++ L ++CL+++ R  A+    +  L+  L + DK + ER  A 
Sbjct  230  NLLREDL-YPRAVQSGLRCLQSMCLSRRNRVTAINCRTITTLVALLPNTDKRNKERVFAL  288

Query  542  VELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr--eaa  715
            +E+L     G  A + HAL +P++VK +L +SHRATEYA  AL  + S +        A 
Sbjct  289  LEILANCAEGREAISNHALAIPVMVKSMLGVSHRATEYAVAALWLVLSYASNRNVINTAL  348

Query  716  aaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYV  868
             AG  T LL+L+ S C++ AK++AQ  +KLL +        + D Y C +V
Sbjct  349  QAGAFTNLLMLLSSQCSQLAKKRAQDSVKLLNE-------VVLDTYTCRHV  392



>ref|XP_002991371.1| hypothetical protein SELMODRAFT_133552 [Selaginella moellendorffii]
 gb|EFJ07483.1| hypothetical protein SELMODRAFT_133552 [Selaginella moellendorffii]
Length=417

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 94/301 (31%), Positives = 157/301 (52%), Gaps = 18/301 (6%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFS-------NMDSNSPELS--HESLAILS  157
            LR LR    ES+KNR  I    A   L  ++ S       +  SN  +L    +++A+L 
Sbjct  125  LRNLRASCKESEKNRKCIAGAGAIPALSSLVSSFQPRISFDRPSNLEDLQCCEDAVAVLV  184

Query  158  MFPLPEAESVIVSS-DPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISN  334
            +    E ES+  S  +P  +  L  +L   + + ++N+A L+E V +   S   ++ +  
Sbjct  185  ILLPLEIESLRKSIINPSLLAVLSWILHRRNTEGQINAARLLELVATDDES---KSMVGA  241

Query  335  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDK  514
             + +  G+V ++    +Y RA++  + AL A+   ++   KAV  G V  LI+ L +  +
Sbjct  242  TERLIPGLVKLVKEDSAYPRAVRASLTALLAIVSCRKNLVKAVQGGVVPPLIELLSEASR  301

Query  515  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase  694
             + ERALA +E + R   G  A   H+L+VP+LVKIIL +S  A+E A G LL +C A +
Sbjct  302  LNTERALAVLEFVARCAEGREALMDHSLSVPMLVKIILTVSDLASERAVGILLLMCQADD  361

Query  695  qaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVP  874
               + AA+ G  TQ++LL+Q+D T     +A+  LKLLR   P +       ++ ++ +P
Sbjct  362  SVVQAAASEGAFTQMILLIQADNTSETNHRARQFLKLLRGAVPRECM-----HDFAFTMP  416

Query  875  F  877
            F
Sbjct  417  F  417



>ref|XP_002988236.1| hypothetical protein SELMODRAFT_44944, partial [Selaginella moellendorffii]
 gb|EFJ10655.1| hypothetical protein SELMODRAFT_44944, partial [Selaginella moellendorffii]
Length=392

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 93/283 (33%), Positives = 149/283 (53%), Gaps = 13/283 (5%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFS-------NMDSNSPELS--HESLAILS  157
            LR LR    ESDKNR  I    A   L  ++ S       +  SN  +L    +++A+L 
Sbjct  113  LRNLRASCKESDKNRKCIAGAGAIPALSGLVSSFQPRISFDRPSNLEDLQCCEDAVAVLV  172

Query  158  MFPLPEAESVIVSS-DPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISN  334
            +    E ES+  S  +P  +  L  +L   + + ++N+A L+E V +   S   ++ +  
Sbjct  173  ILLPLEIESLRKSIINPSLLAVLSWILHRRNTEGQINAARLLELVATDDES---KSMMGA  229

Query  335  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDK  514
             + +  G+V ++    +Y RA++  + AL A+   ++   KAV  G V  LI+ L +  +
Sbjct  230  TERLIPGLVKLVKEDSAYPRAVRASLTALLAIVSCRKNLVKAVQGGVVPPLIELLSEASR  289

Query  515  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase  694
             + ERALA +E + R   G  A   H+L+VP+LVKIIL +S  A+E A G LL +C A +
Sbjct  290  LNTERALAVLEFVARCAEGREALMDHSLSVPMLVKIILTVSDLASERAVGILLLMCQADD  349

Query  695  qaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP  823
               + AA+ G  TQ++LL+Q+D T     +A+  LKLLR   P
Sbjct  350  SVVQAAASEGAFTQMILLIQADNTSETNHRARQFLKLLRGAVP  392



>ref|NP_001148065.1| ubiquitin-protein ligase [Zea mays]
 gb|ACG29626.1| ubiquitin-protein ligase [Zea mays]
Length=416

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 113/286 (40%), Positives = 157/286 (55%), Gaps = 9/286 (3%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLLCILF-SNMDSNSPELSHESLAILSMFPLPEAESVIVSSDPV  208
            ESDKNR V+  +  R  L+   F S   + S EL  E++A+L++  L EAE+  V     
Sbjct  130  ESDKNRLVMATHETRAALVEAAFGSGSGAASEELEAEAMAVLALVGLGEAEAAEVVGREE  189

Query  209  RVGYLVSLLSNPS-VDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNC-PL  382
            RV  L  +L     ++ R+N+ A++E+V S +   E RA +  A+ + +G+V +      
Sbjct  190  RVARLGKVLGGGGPLEARVNAGAVVEAVASAS-GAEARAALGGAEGVMDGLVALAEEEKA  248

Query  383  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  562
            + +RA+++GV+ALFALCLAK+ R +AV AGA  AL  R+ +    + ERALA VE LCR 
Sbjct  249  NNARAVRVGVRALFALCLAKENRARAVAAGAAAALARRVAEGGAGEPERALAAVERLCRA  308

Query  563  PSG----CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVM  730
              G     A        V  LV+ +          A  A++     SE  Q EA  AG M
Sbjct  309  EGGRDAVVAGAGGGPAAVAALVRAMSGRGAEHAAGALAAVVVGAGGSEALQAEAVRAGAM  368

Query  731  TQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE-DFTAISDDYNCSY  865
             +LLL+VQ  C+ERAKRKAQ LLKLLR  WP  D  A SDD+   Y
Sbjct  369  GRLLLMVQGGCSERAKRKAQHLLKLLRSAWPSADCVANSDDFLQHY  414



>ref|XP_001751378.1| predicted protein [Physcomitrella patens]
 gb|EDQ83695.1| predicted protein [Physcomitrella patens]
Length=146

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = +2

Query  521  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  700
            AE+ALA +ELL  I  G AA   +AL VP+LV++ILK+S R TEYAAG L  +CS S   
Sbjct  30   AEKALAILELLGTIEEGKAAIIDYALAVPVLVELILKVSDRGTEYAAGTLRMMCSDSIAM  89

Query  701  qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
            +  A A G  T+LLL +QSDCT RAKRKA  LLK+L   W +
Sbjct  90   REAAVAHGAPTKLLLHIQSDCTARAKRKASQLLKVLHKIWTQ  131



>ref|XP_003636449.1| U-box domain-containing protein [Medicago truncatula]
Length=288

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 76/140 (54%), Gaps = 0/140 (0%)
 Frame = +2

Query  392  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  571
            R  K   K LFALCL++  R  AV AGAV A+++   + +   AERALA +EL+C +P G
Sbjct  138  RESKPATKILFALCLSEANRRVAVEAGAVGAVVESAPELEGAPAERALAALELMCTVPEG  197

Query  572  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  751
                 AHAL VP++V ++ K   R  EYA G L  I        + A    V   + L +
Sbjct  198  AEEVRAHALAVPVMVTVMGKTGARGKEYAIGVLAVIYGGDMGDMQTAPPEEVARAVELAL  257

Query  752  QSDCTERAKRKAQMLLKLLR  811
            Q DC+ R KRK   LLK L+
Sbjct  258  QGDCSARGKRKGAQLLKTLQ  277



>ref|XP_004501176.1| PREDICTED: uncharacterized protein LOC101503409 [Cicer arietinum]
Length=308

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 77/141 (55%), Gaps = 0/141 (0%)
 Frame = +2

Query  392  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  571
            R  K   K LFALCL++  R  AV AGAV A+++   + D   AERALA +EL+C +P G
Sbjct  158  REAKPATKILFALCLSEANRRVAVEAGAVGAVVESAPELDGAPAERALAALELMCTVPEG  217

Query  572  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  751
                 AHAL VP++V ++ K   R  EYA G L  I       Q  A    V   + L +
Sbjct  218  AEEVRAHALAVPVMVTVMGKTGARGKEYAIGVLAVIYGGDVGEQLTAPPEEVARAVELAL  277

Query  752  QSDCTERAKRKAQMLLKLLRD  814
            Q +C+ R KRK   LLK+L+ 
Sbjct  278  QGECSARGKRKGAQLLKMLQH  298



>gb|KEH36040.1| hypothetical protein MTR_3g110138 [Medicago truncatula]
Length=302

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 76/140 (54%), Gaps = 0/140 (0%)
 Frame = +2

Query  392  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  571
            R  K   K LFALCL++  R  AV AGAV A+++   + +   AERALA +EL+C +P G
Sbjct  152  RESKPATKILFALCLSEANRRVAVEAGAVGAVVESAPELEGAPAERALAALELMCTVPEG  211

Query  572  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  751
                 AHAL VP++V ++ K   R  EYA G L  I        + A    V   + L +
Sbjct  212  AEEVRAHALAVPVMVTVMGKTGARGKEYAIGVLAVIYGGDMGDMQTAPPEEVARAVELAL  271

Query  752  QSDCTERAKRKAQMLLKLLR  811
            Q DC+ R KRK   LLK L+
Sbjct  272  QGDCSARGKRKGAQLLKTLQ  291



>ref|XP_003523734.1| PREDICTED: U-box domain-containing protein 25-like [Glycine max]
Length=287

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 78/139 (56%), Gaps = 1/139 (1%)
 Frame = +2

Query  401  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  580
            K   K LFALCL+   R  AV AGAV A+++   D D   AERALA +EL+C +P G   
Sbjct  132  KPATKILFALCLSDANRRVAVEAGAVSAVVEAAPDLDGAPAERALAALELMCTLPEGAEE  191

Query  581  FAAHALTVPLLVKIILKISHRATEYAAGALLSI-CsaseqaqreaaaaGVMTQLLLLVQS  757
              AHAL VP++V ++ K + R  EYA GAL  +  +A  +    A    V   + L +Q 
Sbjct  192  LRAHALAVPVMVTMMAKTAARGKEYAIGALAVVYGAAGAENHYTAPPEEVARAVELALQG  251

Query  758  DCTERAKRKAQMLLKLLRD  814
            +C+ R +RK   LLK L+ 
Sbjct  252  ECSARGRRKGTQLLKTLQQ  270



>ref|XP_001764309.1| predicted protein [Physcomitrella patens]
 gb|EDQ70863.1| predicted protein [Physcomitrella patens]
Length=440

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 80/287 (28%), Positives = 149/287 (52%), Gaps = 21/287 (7%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVI--------LANNAREVLLCILFSNMDSNSPELS-HESLAIL  154
            +L+ L  LA E ++NR  I        LA    ++ + + +S   +   E++  E+LA +
Sbjct  132  SLKNLWSLAKECERNRRCIEKVGAVPILAKALAQLWVGMRYSAGCNRGREVACEEALATI  191

Query  155  SMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISN  334
            ++  L + +   + + P  +  LV LL++ S+D ++N+A +I ++      P ++  +++
Sbjct  192  ALLQLDDGDRRALVA-PESLECLVFLLTSGSLDAKLNAADVIHTLCE--EDPHVKTAVAS  248

Query  335  ADEIFEGIVGILN---CPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  505
                 +G+V +L    CP    RA++ G++ L  +CL +  R  A+   A+  +++ L +
Sbjct  249  LPGAMKGLVNLLKDDLCP----RAVQAGLRCLLCVCLPRSNRVMAIECRAISVVVELLPN  304

Query  506  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs  685
             +K   E A A +E+L     G  A + HAL +P++VK +L +S R TE A   L  + S
Sbjct  305  TEKRTKELAFAVMEILANCAEGREAISNHALAIPMIVKSMLGVSQRVTECAVSTLWVVLS  364

Query  686  ase--qaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
             +        A  AG    LL+L+  +C++RAK KA+  L+LL + W
Sbjct  365  YASNRSVTNTALQAGAFANLLMLLPGECSQRAKHKARDSLRLLNENW  411



>ref|XP_006847226.1| hypothetical protein AMTR_s00017p00257160 [Amborella trichopoda]
 gb|ERN08807.1| hypothetical protein AMTR_s00017p00257160 [Amborella trichopoda]
Length=400

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 85/277 (31%), Positives = 154/277 (56%), Gaps = 9/277 (3%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSN------MDSNSPELSHESL-AILSMF  163
            ++++R L+ ESD+NR  ++      +LL I+F++      +   +  ++ E+L A+L++ 
Sbjct  104  MQKIRSLSAESDENRVSMVQMGYLPLLLKIMFTDHSMKYFLSIENSCIAEEALDAVLNLL  163

Query  164  PLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  343
            P  +   +++  +   +  L+ LL   ++ ++++   L+ ++ S     EL  +I     
Sbjct  164  PNSQLGPLLLLREASAMNALLVLLKGGTMKIKISICQLMVAISSSHDLKELCYEIGQNQV  223

Query  344  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  523
            I +G++ ++     +  AL  G++AL +L L+       + AG +++L++ +   DK + 
Sbjct  224  ILQGLISVMQHS-HHVGALNAGIRALSSLALSLTTVEITIEAGIIDSLVECVMQADKSNV  282

Query  524  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsaseqa  700
              ALA +E L RI SG      + L + +LVK++ ++S H  +E A G LL IC  S  A
Sbjct  283  SLALAAIEHLSRIESGKKVLRENPLAIRVLVKLVFRVSDHEGSENAIGCLLVICEESLSA  342

Query  701  qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLR  811
            Q  A   G++TQLLLL+QS C  RAK KA++LLKLLR
Sbjct  343  QEVAINEGILTQLLLLLQSQCNSRAKTKARVLLKLLR  379



>ref|XP_006476069.1| PREDICTED: U-box domain-containing protein 26-like [Citrus sinensis]
Length=328

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 89/172 (52%), Gaps = 6/172 (3%)
 Frame = +2

Query  341  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  520
            E+  G+VG L        A KI    L ALCLA+  R  AV AGAV A+I+ + + D   
Sbjct  159  ELMRGVVGNLKNKAGAKPATKI----LLALCLAESNRRVAVEAGAVGAVIEVVAELDGAA  214

Query  521  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  700
             ERALA +EL+C +  G     AHAL VP++V ++ +++ R  EYA   L  I    +Q 
Sbjct  215  GERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQL  274

Query  701  qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYN  856
               A    V   + L +Q +CT R +RK   LLK L++    D T   D+ N
Sbjct  275  VVAAPPEEVARAVELALQGNCTPRGRRKGTQLLKSLKEYGQPDTT--QDEMN  324



>ref|XP_008680442.1| PREDICTED: U-box domain-containing protein 26-like [Zea mays]
Length=360

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 93/281 (33%), Positives = 134/281 (48%), Gaps = 53/281 (19%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLLCILF-SNMDSNSPELSHESLAILSMFPLPEAESVIVSSDPV  208
            ESDKNR V+  +  R  LL   F S   + S EL  E++A+L++  L E E+V V     
Sbjct  130  ESDKNRLVMATHETRAALLEAAFGSGSGAASEELEAEAMAVLALVGLGEEEAVEVVGREE  189

Query  209  RVGYLVSLLSNP-SVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLS  385
            RV  L  +L+   S++ R+N+ A++E+        + RA +  A+ +  G+V ++    S
Sbjct  190  RVARLGKVLAGGGSLEARVNAGAVVEAAAL-ASGADARAVLGAAEGVMAGLVTLVEEKAS  248

Query  386  YSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIP  565
             +RA+++G  A                         R +    C  E A  T        
Sbjct  249  -ARAVRVGTGAW-----------------------GRGRGSSSCTPEPAAVTA-------  277

Query  566  SGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLL  745
                              ++  +S RA E+AAGAL+++   SE  Q EA  AG M QLL+
Sbjct  278  ------------------LVRAMSGRAAEHAAGALVAVVGGSEALQVEAVRAGAMGQLLM  319

Query  746  LVQSDCTERAKRKAQMLLKLLRDCWP-EDFTAISDDYNCSY  865
            +VQ  C+ERAKRKAQ LLKLLR  WP  D TA SDD+   Y
Sbjct  320  MVQGGCSERAKRKAQHLLKLLRSAWPTTDCTANSDDFLQHY  360



>ref|XP_006826592.1| hypothetical protein AMTR_s00138p00053700 [Amborella trichopoda]
 gb|ERM93829.1| hypothetical protein AMTR_s00138p00053700 [Amborella trichopoda]
Length=428

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 147/287 (51%), Gaps = 21/287 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFS------NMDSNSPELSHESLAILSMF-  163
            +R+L+    ES++NR  + ++ A  VL  I           +S+   L  E +A+L +  
Sbjct  133  VRKLKISVRESERNRRCVASSQAGRVLASIFLQIAGKSRAGNSDCRALMEEIMALLMVLT  192

Query  164  PLP-EAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  340
            PL  EA S + S + +    L+  L   ++++R NSA LI+ + S     EL       D
Sbjct  193  PLTLEAFSFLSSREILLC--LIEGLRQGNLELRKNSALLIKEIASNG---ELTIDFRKID  247

Query  341  EIFEGIVGILNCPLSYSRALKIGVKALFALCLA-KQYRHKAVTAGAVEALIDRLQDFDKC  517
             +FE ++ I+  P+  S +LK  +  +F +C + ++ R KAV  G + A++D L D D+ 
Sbjct  248  GLFESLLQIIRDPICSS-SLKASLITVFYVCSSDEEIRAKAVKLGFISAILDILPDSDRS  306

Query  518  DAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase-  694
              E+A+A ++ LC+   G A  + HAL VPL+VK I ++S   TE +   L  +C   E 
Sbjct  307  VCEKAMAAIDALCKSKEGRAKASEHALMVPLVVKKIFRVSDLVTELSVTVLWRLCKDEEC  366

Query  695  --qaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKL---LRDCW  820
              ++  EA   G   +LLLL+Q  C  + K K   LLK+    R+ W
Sbjct  367  KLKSVSEALQVGAFQKLLLLLQVGCEGKIKEKVTDLLKVTNSYRERW  413



>gb|EYU29273.1| hypothetical protein MIMGU_mgv1a021565mg [Erythranthe guttata]
Length=345

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 85/153 (56%), Gaps = 1/153 (1%)
 Frame = +2

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  535
            + G++ C L    A K   K L ALCL +  R  AV AGAV A+++ L D +   AER+L
Sbjct  183  VGGVVAC-LREGVARKAASKVLLALCLVEMNRRAAVEAGAVTAVVEALTDAEIAVAERSL  241

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  715
            A +ELLC    G A   AHAL VP++V+++ ++  R  E+A   L  I    E+    A 
Sbjct  242  AALELLCTTAEGTAEVRAHALAVPMMVQVMGRMEGRGKEHAISVLAVIYGGLEEGVAVAP  301

Query  716  aaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  814
            A  V   ++L +Q DC+ R +RK   LLK+L+ 
Sbjct  302  AEQVARAVMLALQGDCSARGRRKGAHLLKILQQ  334



>ref|XP_007137194.1| hypothetical protein PHAVU_009G107700g [Phaseolus vulgaris]
 gb|ESW09188.1| hypothetical protein PHAVU_009G107700g [Phaseolus vulgaris]
Length=315

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 77/138 (56%), Gaps = 0/138 (0%)
 Frame = +2

Query  401  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  580
            K   K LFALCL+   R  AV  GAV A+++   + D   AERALA +EL+C +P G   
Sbjct  166  KPATKILFALCLSDVNRRVAVETGAVSAVVEAALELDGAPAERALAALELMCTLPDGAHE  225

Query  581  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSD  760
              AHAL VP++V ++ K + RA EYA G L  +   S   Q  A    V   + L +Q +
Sbjct  226  VRAHALAVPVMVTMMGKTAARAKEYAIGVLAVVYGGSASDQHTAPPEEVARAVELALQGE  285

Query  761  CTERAKRKAQMLLKLLRD  814
            C+ RA+RK   L+K L+ 
Sbjct  286  CSARARRKGAQLMKTLKQ  303



>ref|XP_002976345.1| hypothetical protein SELMODRAFT_416243 [Selaginella moellendorffii]
 gb|EFJ22605.1| hypothetical protein SELMODRAFT_416243 [Selaginella moellendorffii]
Length=465

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 104/178 (58%), Gaps = 10/178 (6%)
 Frame = +2

Query  299  TRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAV  478
            ++S E +    +A    E +VG+L+      + +K GVKAL ALCL+K  R  AV AG V
Sbjct  264  SQSEEQQVDTLDAGSFLEAVVGLLS--EREEQLVKCGVKALLALCLSKDNRVAAVKAGVV  321

Query  479  EALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYA  658
             +L++ L +     +ER LAT+ELL     G AA   HAL +PLL+ +IL++S R TEYA
Sbjct  322  ASLLELLTEAKGVTSERILATLELLSTTLEGRAAILRHALAIPLLLSMILRVSDRGTEYA  381

Query  659  AGALLS-ICsaseqaqreaaaaGVM-------TQLLLLVQSDCTERAKRKAQMLLKLL  808
            AG L S IC+ +         A  M       T LLLL+QS CT+RA+RKA  LLK+L
Sbjct  382  AGVLCSVICTDTSTPLDSNEEALEMAFQARASTSLLLLLQSHCTQRARRKAVKLLKVL  439



>ref|XP_006424086.1| hypothetical protein CICLE_v10028557mg [Citrus clementina]
 gb|ESR37326.1| hypothetical protein CICLE_v10028557mg [Citrus clementina]
Length=407

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 87/278 (31%), Positives = 144/278 (52%), Gaps = 11/278 (4%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEA--  178
            LRRLR +  +S++NRS + A  A E L  I+ +  D+ S E   E+L+IL    + E+  
Sbjct  118  LRRLRSITLQSERNRSCLEAAGAIEFLATII-TKSDAGSDECD-EALSILYHLNISESYL  175

Query  179  ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
            +S+++++    +  L+ +L   +   R  +  L++S+       +L   IS   E F  I
Sbjct  176  KSIVINNGEEFLESLMRVLKCGNYQSRSYAIMLLKSIFEVADPFQL---ISVKQEFFTEI  232

Query  359  VGILNCPLSYSR-ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF-DKCDAERA  532
            V +L     +S+ A K  +K L  LC   + R KAV  G V  L+D L D  ++   E  
Sbjct  233  VNVLRDHHQFSQQASKAALKLLVELCPWGRNRIKAVEGGGVSVLVDLLLDVTERRVCELM  292

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq--r  706
            L  ++LLCR   G A    H   + ++ K IL++SH A++ A   L S+C  S  A+  +
Sbjct  293  LNVLDLLCRCAEGRAELLKHGAGLAVVSKKILRVSHAASDRAVRILCSVCKFSATARVLQ  352

Query  707  eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            E    GV+++L L++Q D + + K +A+ +LKL    W
Sbjct  353  EMLQVGVVSKLCLVLQVDASVKTKERAREILKLNARAW  390



>ref|XP_008466051.1| PREDICTED: U-box domain-containing protein 26 [Cucumis melo]
Length=326

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 92/170 (54%), Gaps = 8/170 (5%)
 Frame = +2

Query  341  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  520
            E+  G++   N       A KI    L ALCLA+  RH AV AGAV A+I+ L + +   
Sbjct  159  ELMRGLIESFNIKTGSKPATKI----LLALCLAEGNRHVAVEAGAVGAVIESLPEMEDAA  214

Query  521  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  700
            AERALA++EL+C +  G A   AHAL+VP +V ++ +++ R  E A   L  I      +
Sbjct  215  AERALASLELMCTVAEGAAEVRAHALSVPAMVTMMGRMAARGKESAISVLGVIYDNGVSS  274

Query  701  qreaaaaG----VMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTA  838
            + ++A       V   ++L +Q D + R +RK   LLK L++   E FTA
Sbjct  275  EAKSAVTAPPEEVARAVVLALQGDSSVRGRRKGARLLKTLQEQQDEFFTA  324



>ref|XP_002308611.2| hypothetical protein POPTR_0006s25710g [Populus trichocarpa]
 gb|EEE92134.2| hypothetical protein POPTR_0006s25710g [Populus trichocarpa]
Length=352

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 83/165 (50%), Gaps = 9/165 (5%)
 Frame = +2

Query  335  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDK  514
            + E+  G+V  L         +K   K L ALCLA+  RH AV AGAV  +++   + D 
Sbjct  178  SPELMRGVVANLK----NKAGVKPATKVLLALCLAEANRHVAVEAGAVGTVVEVAMELDG  233

Query  515  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI-----  679
              AERALA +EL C +  G A    HAL VP++V ++ K++ R  EYA  AL  I     
Sbjct  234  SPAERALAALELTCTVAEGAAELRNHALAVPVMVTMMGKMAGRGKEYAISALAVIYGSGG  293

Query  680  CsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  814
              +  +    A    V   +   +Q DCT R +RK   LLK L++
Sbjct  294  VGSDGEQTLHAPPEEVARAVAFALQGDCTARGRRKGAQLLKALQE  338



>gb|KDO46582.1| hypothetical protein CISIN_1g040073mg [Citrus sinensis]
Length=407

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 87/278 (31%), Positives = 144/278 (52%), Gaps = 11/278 (4%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEA--  178
            LRRLR +  +S++NRS + A  A E L  I+ +  D+ S E   E+L+IL    + E+  
Sbjct  118  LRRLRSITLQSERNRSCLEAAGAIEFLATII-TKSDAGSDECD-EALSILYHLNVSESYL  175

Query  179  ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
            +S+++++    +  L+ +L   +   R  +  L++S+       +L   IS   E F  I
Sbjct  176  KSIVINNGEEFLESLMRVLKCGNYQSRSYAIMLLKSIFEVADPFQL---ISVKQEFFTEI  232

Query  359  VGILNCPLSYSR-ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF-DKCDAERA  532
            V +L     +S+ A K  +K L  LC   + R KAV  G V  L+D L D  ++   E  
Sbjct  233  VNVLRDHHQFSQQASKAALKLLVELCPWGRNRIKAVEGGGVSVLVDLLLDVTERRVCELM  292

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq--r  706
            L  ++LLCR   G A    H   + ++ K IL++SH A++ A   L S+C  S  A+  +
Sbjct  293  LNVLDLLCRCAEGRAELLKHGAGLAVVSKKILRVSHAASDRAVRILCSVCKFSATARVLQ  352

Query  707  eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            E    GV+++L L++Q D + + K +A+ +LKL    W
Sbjct  353  EMLQVGVVSKLCLVLQVDASVKTKERAREILKLNARAW  390



>ref|XP_002987240.1| hypothetical protein SELMODRAFT_125560 [Selaginella moellendorffii]
 gb|EFJ11816.1| hypothetical protein SELMODRAFT_125560 [Selaginella moellendorffii]
Length=434

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 109/223 (49%), Gaps = 9/223 (4%)
 Frame = +2

Query  203  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  382
            P  +  +  LL    +  R+++AALIE +    +  E R  +     IFEG+V ++    
Sbjct  191  PRNLAAIARLLQRGDLHTRVSAAALIEELCCADK--EARGAVGATAGIFEGLVRLVGEDH  248

Query  383  SYSR---ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELL  553
            S  R   A++  ++A+ A+C   + R + V  G V  L + L + DK   E  LA +E L
Sbjct  249  SQRRHRPAIRGSLRAVLAVCPPLKNRVRLVETGVVAPLAELLVEADKVTTEAILAALECL  308

Query  554  CRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa--seqaqreaaaaGV  727
            C    G AA A HAL VP + + + K+S  ATEYA   L ++C     E  +R     G+
Sbjct  309  CGCAEGRAAVARHALAVPAVARKLFKVSDMATEYAIDVLWAVCKYCPDEIVKRRMVEVGL  368

Query  728  MTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE--DFTAISDD  850
              +L   +Q  C  R K KA  LLKLL   + E  D +  ++D
Sbjct  369  FPKLFFFLQIGCNPRTKHKAGDLLKLLHRAYRECIDGSGSNND  411



>ref|XP_002976407.1| hypothetical protein SELMODRAFT_104879 [Selaginella moellendorffii]
 gb|EFJ22667.1| hypothetical protein SELMODRAFT_104879 [Selaginella moellendorffii]
Length=434

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 109/223 (49%), Gaps = 9/223 (4%)
 Frame = +2

Query  203  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  382
            P  +  +  LL    +  R+++AALIE +    +  E R  +     IFEG+V ++    
Sbjct  191  PRNLAAIARLLQRGDLHTRVSAAALIEELCCADK--EARGAVGATAGIFEGLVRLVGEDH  248

Query  383  SYSR---ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELL  553
            S  R   A++  ++A+ A+C   + R + V  G V  L + L + DK   E  LA +E L
Sbjct  249  SQRRHRPAIRGSLRAVLAVCPPLKNRVRLVETGVVAPLAELLVEADKVTTEAILAALECL  308

Query  554  CRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa--seqaqreaaaaGV  727
            C    G AA A HAL VP + + + K+S  ATEYA   L ++C     E  +R     G+
Sbjct  309  CGCAEGRAAVARHALAVPAVARKLFKVSDMATEYAIDVLWAVCKYCPDEIVKRRMVEVGL  368

Query  728  MTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE--DFTAISDD  850
              +L   +Q  C  R K KA  LLKLL   + E  D +  ++D
Sbjct  369  FPKLFFFLQIGCNPRTKHKAGDLLKLLHRAYRECIDGSGSNND  411



>ref|XP_011019811.1| PREDICTED: uncharacterized protein LOC105122418 [Populus euphratica]
Length=530

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 87/175 (50%), Gaps = 9/175 (5%)
 Frame = +2

Query  341  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  520
            E+  G+V  L         LK   K L ALCLA+  RH AV AGAV  +++   + D   
Sbjct  358  ELMRGVVANLK----NKAGLKPATKVLLALCLAEANRHVAVEAGAVGTVVEVAMELDGAP  413

Query  521  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI-----Cs  685
            AERALA +EL C +  G A    HAL VP++V ++ K++ R  EYA  AL  I       
Sbjct  414  AERALAALELTCTVAEGAAELRNHALAVPVMVTMMGKMAGRGKEYAISALAVIYGGGGVE  473

Query  686  aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDD  850
            +  +    A    V   + L ++ DCT R +RK   LLK L++    D T   ++
Sbjct  474  SDGEQTLHAPPEEVARAVALALRGDCTARGRRKGAQLLKALQEYGRVDSTQEGNE  528



>ref|XP_003527831.1| PREDICTED: uncharacterized protein LOC100814020 [Glycine max]
Length=307

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 75/140 (54%), Gaps = 2/140 (1%)
 Frame = +2

Query  401  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  580
            K   K LFALCL+   R  AV  GAV A+++   D D   AERALA +EL+C +P G   
Sbjct  151  KPATKILFALCLSDANRRVAVETGAVSAVVEAAPDLDGAPAERALAALELMCTLPEGAEE  210

Query  581  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaa--aGVMTQLLLLVQ  754
              AHAL VP++V ++ K + R  EYA G L  +  +    +    A    V   + L +Q
Sbjct  211  LRAHALAVPVMVTMMAKTAARGKEYAIGVLAVVYGSVGGGEEHHTAPPEEVARAVELALQ  270

Query  755  SDCTERAKRKAQMLLKLLRD  814
             +C+ R +RK   LLK L+ 
Sbjct  271  GECSARGRRKGAQLLKTLQQ  290



>ref|XP_009403145.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=439

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 91/278 (33%), Positives = 140/278 (50%), Gaps = 12/278 (4%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLA--ILSMFPL--P-E  175
            +++ L  ES++NR  I +  A   +L   FS + + S E S    A  ILS  PL  P +
Sbjct  146  KIKALGKESERNRRCIGSAGA-GCVLASCFSELATESFERSRAGAAEEILSALPLFFPLD  204

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
             +S    S    +  +VS+L +  +D R+N+A ++  +LS +  P     ++  D + E 
Sbjct  205  QDSCRQLSSLKSLESIVSVLRSGDLDARVNAALVLRELLS-SLPPRRINGVAGTDGLVEA  263

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKA-VTAGAVEALIDRLQDFDKCDAERA  532
            +  ++  P+S  RA K  + A F L  +      A V  G + +L++ L D DK   E+A
Sbjct  264  LSKLIQNPIS-PRATKASLVAAFYLVDSSDRAAGALVDTGIIPSLLEILVDSDKGMCEKA  322

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa---q  703
            LA ++ +     G      HALTVP+LVK +L++S  ATE+A  AL  +C   ++     
Sbjct  323  LAVLDGVLGCSRGREMAYGHALTVPVLVKKMLRVSDMATEFAVSALWKLCRNEKRGGGCS  382

Query  704  reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDC  817
             EA   G   + LLLVQ  C+   K KA  LLKLL  C
Sbjct  383  MEAVRVGAFQKSLLLVQVGCSGATKEKANDLLKLLNGC  420



>ref|XP_009380073.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 87/283 (31%), Positives = 140/283 (49%), Gaps = 19/283 (7%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCIL--FSNMDSNSP--ELSHESL-AILSMFPLPE  175
            +++ LA ES++NR    +N    VL      F+   S SP  E+  E+L A+ ++ PL E
Sbjct  142  KVKNLASESERNRRCFASNGMNGVLAATFNAFAGASSESPAAEILEEALEALATLLPLGE  201

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
              +  + S P  +  LVS+L + S   R+N+A +++ +L+   +      I+    + E 
Sbjct  202  EAASRIGS-PESLNRLVSILQHGSWAARLNAALVVKELLASNGAGA--DVIAGTKGLVEA  258

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYR--HKAVTAGAVEALIDRLQDFDKCDAER  529
            +  ++  P+S  RA K  + ++F + + +  R   + V  G V  LI+ L   +K   E+
Sbjct  259  LAKLVEEPIS-PRAAKASLVSIFYM-INRDERAASRVVDLGLVPVLIEVLVGPEKSMCEK  316

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqre  709
            ALA +++L    SG      HALT+P+L K + ++S  ATE    AL  +C   E     
Sbjct  317  ALAVLDVLLGCGSGREKAYGHALTMPVLAKKMFRVSDMATELVVSALWKLCRDDEVGGEG  376

Query  710  -------aaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDC  817
                   A  AG   +LLLL+Q  C E  K +A  LLKLL  C
Sbjct  377  RGRCLQDALQAGAFQKLLLLLQVGCGEATKERATNLLKLLNGC  419



>ref|XP_002885649.1| hypothetical protein ARALYDRAFT_899024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61908.1| hypothetical protein ARALYDRAFT_899024 [Arabidopsis lyrata subsp. 
lyrata]
Length=96

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 42/87 (48%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = +2

Query  233  LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  412
            L + S+++++N AALIE VL+G++  +L+  IS +D IFEG++ +L   +S  RAL+IG+
Sbjct  5    LFDSSIEIKVNGAALIEMVLTGSKLMDLKLIISGSDSIFEGVLDLLKILISSRRALQIGI  64

Query  413  KALFALCLAKQYRHKAVTAGAVEALID  493
            KA+FALCL KQ +H A++ GA   LID
Sbjct  65   KAIFALCLVKQKKHLAISTGAPGILID  91



>ref|XP_002962287.1| hypothetical protein SELMODRAFT_403954 [Selaginella moellendorffii]
 gb|EFJ37547.1| hypothetical protein SELMODRAFT_403954 [Selaginella moellendorffii]
Length=630

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 99/215 (46%), Gaps = 47/215 (22%)
 Frame = +2

Query  344  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  523
            I    V +L  P + ++ +++ +K++  +CL+K  R  AV AGAVEAL+D L D    D 
Sbjct  410  ILGACVALLKDPSAEAKLVRLALKSMLGICLSKPNRIPAVKAGAVEALLDTLVDLHGVDG  469

Query  524  -------------ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAG  664
                         ERALAT+ELLC    G AA  +    +  LV ++L +S RATEYAAG
Sbjct  470  GEFCSKSGIVVNVERALATLELLCTSSEGRAAICSQPNFISELVGLVLGVSERATEYAAG  529

Query  665  ALLSI---------------------------------CsaseqaqreaaaaGVMTQLLL  745
             L ++                                        Q  A   G   Q+LL
Sbjct  530  VLCAVLCDNLGSEDGTTAAAASFAAGAARITSSATFNGLGEHSSVQEMAVKGGAPAQMLL  589

Query  746  LVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDD  850
            ++QSDC++RA+RKA  LLK L   + E+   I  D
Sbjct  590  VMQSDCSDRARRKAAKLLKALHK-YGENHNTIHSD  623



>ref|XP_011090755.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Sesamum indicum]
Length=328

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 83/252 (33%), Positives = 124/252 (49%), Gaps = 34/252 (13%)
 Frame = +2

Query  113  SNSPELSHESLAILSMFPLPEAESVIVSSDP-VRVGYLVSLLSNPSVDVRMNSAALIESV  289
            SNSP +SH S      +  P+AE+V   S+P +++  +  LL+N S++   + A L  S 
Sbjct  82   SNSP-ISHHS------YSQPKAEAV---SEPDLKLEVVPPLLTNASLEELFHVAELQFS-  130

Query  290  LSGTRSPEL-------RAQISNADEIFEGIVGILNCP----------LSYSRALKIGVKA  418
             SG+ +  L       R+ + N     +G      CP          L    A K   K 
Sbjct  131  -SGSDAGRLGAVHLLERSLVPNPRSAVDGC----PCPAAVVVGVVACLREGMARKPASKV  185

Query  419  LFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHAL  598
            L ALCL +  R  AV AGAV A+++ L D +     R LA +ELLC    G A   AHAL
Sbjct  186  LLALCLVEGNRRVAVEAGAVTAVVEALTDAESAVLWRLLAALELLCTTAEGAAEVRAHAL  245

Query  599  TVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAK  778
             VP++V+++ ++  R  E+A   L  I    E+    A A  V   ++L +Q DC+ R +
Sbjct  246  AVPMMVQVMGRMEGRGKEHAISVLAVIYGGLEEGVGVAPAEEVARSVMLALQGDCSARGR  305

Query  779  RKAQMLLKLLRD  814
            RK   LLK+L++
Sbjct  306  RKGAQLLKILQE  317



>ref|XP_004136217.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus]
 ref|XP_004173965.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus]
 gb|KGN60328.1| hypothetical protein Csa_3G895740 [Cucumis sativus]
Length=324

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 92/169 (54%), Gaps = 8/169 (5%)
 Frame = +2

Query  341  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  520
            E+  G++   N       A KI    L ALCLA+  RH AV AGAV A+I+ L + +   
Sbjct  156  ELMRGLIESFNIKTGSKPATKI----LLALCLAEGNRHVAVEAGAVGAVIESLPEMEDAA  211

Query  521  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  700
            AERALA++EL+C +  G A   +HAL+VP +V ++ +++ R  E A   L  I  +   +
Sbjct  212  AERALASLELMCTVAEGAAEVRSHALSVPAMVTMMGRMAARGKESAISVLGVIFDSGVSS  271

Query  701  qreaaaaG----VMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  835
            + ++        V   ++L +Q D + R +RK   LLK L++   ++F+
Sbjct  272  EAKSGVTAPPEEVARAVVLALQGDSSVRGRRKGARLLKTLQEQQADEFS  320



>ref|XP_006494889.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Citrus sinensis]
Length=407

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 86/278 (31%), Positives = 141/278 (51%), Gaps = 11/278 (4%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEA--  178
            LRRLR +  +S++NRS + A  A E  L    +  D  S E   E+L+IL    + E+  
Sbjct  118  LRRLRSITLQSERNRSCLEAAGAIE-FLATTITKSDDGSDECD-EALSILYHLNVSESYL  175

Query  179  ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
            +S+++++    +  L+ +L   +   R  +  L++S+       +L   IS   E F  I
Sbjct  176  KSIVINNGEEFLESLMRVLKCGNYQSRSYAIMLLKSIFEVADPFQL---ISVKQEFFTEI  232

Query  359  VGILNCPLSYSR-ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF-DKCDAERA  532
            V +L     +S+ A K  +K L  LC   + R KAV  G V  L+D L D  ++   E  
Sbjct  233  VNVLRDHHQFSQQASKAALKLLVELCPWGRNRIKAVEGGGVSVLVDLLLDVTERRVCELM  292

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq--r  706
            L  ++LLCR   G A    H   + ++ K IL++SH A++ A   L S+C  S  A+  +
Sbjct  293  LNVLDLLCRCAEGRAELLKHGAGLAVVSKKILRVSHAASDRAVRILCSVCKFSATARVLQ  352

Query  707  eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            E    GV+++L L++Q D + + K +A+ +LKL    W
Sbjct  353  EMLQVGVVSKLCLVLQVDASVKTKERAREILKLNARAW  390



>ref|XP_002513723.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF48670.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=414

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 84/287 (29%), Positives = 144/287 (50%), Gaps = 19/287 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDS-------NSPEL---SHESLAIL  154
            LRR+R +  ES++NRS + A  A ++L  I+ ++  +       + PE    S E+L+IL
Sbjct  115  LRRIRSITLESERNRSFLEAAGAVDILASIVVNDNSTSVEISIDDDPEFTRASDEALSIL  174

Query  155  SMFPLPEAE--SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQI  328
             +  + +++  ++I     V V  L+ +L + +   R  S  L++S+       +L   I
Sbjct  175  YLLKISDSKLKNLIAKDRGVFVESLIQILKHSNYQSRAYSTMLLKSIFEVADPIQL---I  231

Query  329  SNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL-QD  505
            +   EI   +V +L   +S   + K  +K L  +C   + R KAV  GAV  LI+ L + 
Sbjct  232  TIRPEILTEVVHVLRDQISQQTS-KAALKLLVEVCPWGRNRIKAVEGGAVTVLIELLLET  290

Query  506  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs  685
             D+   E  L  ++LLC    G A F  H   + ++ K IL++SH A++ A   L SIC 
Sbjct  291  SDRRSCELTLIILDLLCGCAEGRAEFLKHGAGLAIVSKKILRVSHVASDRAVRILCSICR  350

Query  686  aseq--aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
             S      +E    GV+ +L L++Q D   ++K +A+ +L+L    W
Sbjct  351  FSATPRVLQEMLQVGVVAKLCLVLQVDSGCKSKERAREILRLHSRVW  397



>ref|XP_009348934.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Pyrus x bretschneideri]
Length=406

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 86/294 (29%), Positives = 144/294 (49%), Gaps = 13/294 (4%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHE-SLAILSMFPLPE-A  178
            LR LR ++ +S+ N+  I A  A E L   + +N+ ++   + +E +L+IL    L E  
Sbjct  117  LRELRSISSDSEANKKSIEAAGAVEFLASTIINNIKNDRENVENEDALSILHNLNLSEDV  176

Query  179  ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD-EIFEG  355
               ++  +   V  L+ L+   S + R  +  L+ S+     S     +++N   E F  
Sbjct  177  LKTLIGKEGEFVEALIKLMQRGSYESRAYAVMLLRSIFEVAES----TRMANVKPEFFAE  232

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF--DKCDAER  529
            +V +LN  +S  +A K  ++ L  LC   + R KAV AGAV  LI+ L D   D+   E 
Sbjct  233  VVQVLNDQIS-QQASKATLQLLIQLCPWGRNRIKAVEAGAVMVLIELLLDTSSDRRTLEM  291

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq--  703
             L  ++++C    G A    H   + ++ K I+++S  A+E A   L SIC  S  +   
Sbjct  292  TLMVLDMICGCAEGRAELLTHGAGLAVVSKKIMRVSKVASERAVRILFSICKFSATSSVL  351

Query  704  reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSY  865
            +E    GV+ +L L++Q D   + K KA+ +LKL    W ++ T I  +   SY
Sbjct  352  QEMMQLGVVAKLCLVLQVDSGSKTKDKAREVLKLHGRTW-KNSTCIPSNLVSSY  404



>ref|XP_001783217.1| predicted protein [Physcomitrella patens]
 gb|EDQ51985.1| predicted protein [Physcomitrella patens]
Length=388

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 144/281 (51%), Gaps = 17/281 (6%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVL----------LCILFSNMDSNSPELSHESLAI  151
            +L++L  LA ES++NR  I    A  +L          +C   S  + +  E   + LAI
Sbjct  112  SLKKLWSLAKESERNRKCIEEIGAVPILAEALAQLGVDMC-YSSRCNRDREEACEDVLAI  170

Query  152  LSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQIS  331
            +++  + + +   +++ P  +  L  +L++ S++ + N+A +I ++      P L+  + 
Sbjct  171  IALMRVGDGDKKALAA-PKSLACLAFVLASGSLEAKANAADVIHTLCE--EDPHLKIAVG  227

Query  332  NADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFD  511
            +     E  V +L   L Y R ++ G++ L ++CL ++ R  A+   A+  L++ L + +
Sbjct  228  DLPGAIEAFVDLLKENL-YPRVVQAGLRCLLSVCLPRRNRVIAIECRALSVLVELLPNTE  286

Query  512  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  691
            K + + A   +E++     G  A + HA  +P++VK +L +S R TE A   L  + S +
Sbjct  287  KRNKDLAFEVLEIMANCAEGREAISNHATAIPMIVKSMLGVSQRVTECAVSTLWVVLSYA  346

Query  692  eq--aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
                    A  AG  T LL+L+ S+C++R K+KA+  LKLL
Sbjct  347  SNRNVINTALQAGAFTNLLVLLPSECSQRTKQKARDSLKLL  387



>gb|KDP34197.1| hypothetical protein JCGZ_07768 [Jatropha curcas]
Length=350

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 88/173 (51%), Gaps = 14/173 (8%)
 Frame = +2

Query  374  CPLSYSRAL------KIGVKA----LFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  523
            CPL   R +      K G KA    L ALCLA+  RH AV AG V  +++   + +   A
Sbjct  177  CPLELMRGVVVNLKNKAGAKAATKILLALCLAEGNRHVAVKAGTVGTVVEVTMELEGPVA  236

Query  524  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase--q  697
            ERALA +EL+C +  G A   AHAL +P++V  + ++  R  EYA  AL  +       +
Sbjct  237  ERALAALELMCTVEEGAAELRAHALAMPVMVAKMGEMEGRGKEYAISALSVVYGGGVLDE  296

Query  698  aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYN  856
               +A    V   ++L +Q DCT RA+RK   LLK L++    D T    D N
Sbjct  297  QVHQAPPEEVARAVILALQGDCTARARRKGAQLLKALQEFGRADST--QQDVN  347



>ref|XP_009141534.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Brassica rapa]
 emb|CDY40422.1| BnaA04g20950D [Brassica napus]
Length=412

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 146/289 (51%), Gaps = 21/289 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSN----SPELSHESLAILSMFPLP  172
            L+RLR +  E+  N+  + A    E L  I+ +N   N    S  L+ E+L++L  + L 
Sbjct  116  LKRLRQIVSENKTNKRCLEAAGVPEFLATIVSNNESENVFDSSMSLTDEALSLL--YHLE  173

Query  173  EAESVI---VSSDPVR--VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNA  337
             +E+V+   +++   R  V  L+ ++     + R  +  L++++L       +   ++  
Sbjct  174  TSETVLKNLLNNKKGRDIVSSLIKIMQRGMYESRAYATLLLKNILEVAEPMHI---MNLK  230

Query  338  DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----  505
              +F  +V IL+  +S ++A K  +  L  +C   + RHKAV AGA+  +I+ L D    
Sbjct  231  PSVFTEVVQILDDRIS-NKATKAALHILVNICPWGRNRHKAVEAGAISMMIELLMDESFS  289

Query  506  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs  685
             D+   E A+  ++LLC+   G A F  H   + ++ K IL+IS  A++ A   LLS+  
Sbjct  290  SDRRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRISQTASDRAVRVLLSVGR  349

Query  686  --aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
              A+     E    GV+++L L++Q +C  + K KA+ LLKL    W +
Sbjct  350  FCATPSLLHEMLQLGVVSKLCLVLQVNCGSKTKEKAKELLKLHARVWKD  398



>emb|CDX84587.1| BnaA03g16430D [Brassica napus]
Length=409

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 79/286 (28%), Positives = 143/286 (50%), Gaps = 18/286 (6%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSN-MDSNSPELSHESLAILSMFPLPEAE  181
            L+RLR +  E+  N+  +      E L  I+ +N +DS+   LS E+L++L  + L  +E
Sbjct  116  LKRLRQIVSETTTNKRCLEVAGVPEFLATIISNNGVDSSMVSLSDEALSLL--YHLESSE  173

Query  182  SVIVSSDPVRVG-----YLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  346
             V+ +    + G      L+ ++     + R  +  L++++L      ++   ++    +
Sbjct  174  RVLKNLLNNKKGGNIVKSLIKIMQRGIYESRAYATLLLKNILEVADPMQI---MTLKPSV  230

Query  347  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FDK  514
            F  +V IL+  +S+ +A K  +  L  +C   + RHKAV AGA+  +I+ L D     D+
Sbjct  231  FTEVVQILDDRISH-KATKAAMHVLVTICPWGRNRHKAVEAGAISVIIELLMDESFSSDR  289

Query  515  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--a  688
               E A+  +++LC+   G A F  H   + ++ K IL++S  A++ A   LLS+    A
Sbjct  290  RGPEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCA  349

Query  689  seqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
            +     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  350  TPALLHEMLQLGVVEKLFLVLQISCGSKTKEKAKELLKLHARVWKD  395



>ref|XP_010668167.1| PREDICTED: U-box domain-containing protein 26 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 82/156 (53%), Gaps = 4/156 (3%)
 Frame = +2

Query  380  LSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCR  559
            ++ + + K   K L ALCLA+  R  AV  GA   ++D L D D    ERALA +EL+C 
Sbjct  209  MTRTSSAKSATKILLALCLAEGNRRVAVECGAPTRVVDALPDLDGAVVERALAALELMCT  268

Query  560  IPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaG----V  727
            +P G A   AHAL VP+LV  + ++  R  EYA   L ++    E+  +   AA      
Sbjct  269  VPEGAAEVRAHALAVPMLVATMGRMEGRGREYAISVLTAVYGGGEEDHQVWEAAPPEEVA  328

Query  728  MTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  835
               +L + Q +C+ R KRK   LLK+L++    D T
Sbjct  329  RAVVLAMQQGNCSARGKRKGAQLLKVLQENGRVDLT  364



>ref|XP_003522485.1| PREDICTED: U-box domain-containing protein 26-like [Glycine max]
Length=393

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 72/233 (31%), Positives = 121/233 (52%), Gaps = 12/233 (5%)
 Frame = +2

Query  149  ILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQI  328
            IL + PL   E + +  D  ++   + L    +  V+ +   +I+S+ S  ++ E+   +
Sbjct  163  ILKLLPLVSLEPLNMIKDESKLATFLLLFEKGTSSVKTSLCHIIDSIAS-PQTEEVCHML  221

Query  329  SNADEIFEGIVGIL--NCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL-  499
             ++ ++   IV ++  NC +S     K+ +KA+ ALC  +  R   V  GA++ +I  + 
Sbjct  222  GHSHKLVHEIVVLVRQNCEVS-----KVAIKAMLALCSLQSNRENLVREGAIDGVITYIS  276

Query  500  --QDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGAL  670
              +   K  A  A+A ++ L  + S   A   H   V  LVK++ ++ +   +E A G L
Sbjct  277  GCETRQKNAAPLAMAIIKKLLVLESAKEALVNHPNGVETLVKMVFRVCNQECSESAVGIL  336

Query  671  LSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  829
              IC    +A+ EA  AGV+TQLL L+QS C  + K KA+MLLKLLR  W E+
Sbjct  337  AIICCDFGRAREEAIEAGVLTQLLFLLQSQCGTKTKTKARMLLKLLRSKWIEE  389



>ref|XP_009133058.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Brassica rapa]
Length=409

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 79/286 (28%), Positives = 143/286 (50%), Gaps = 18/286 (6%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSN-MDSNSPELSHESLAILSMFPLPEAE  181
            L+RLR +  E+  N+  +      E L  I+ +N +DS+   LS E+L++L  + L  +E
Sbjct  116  LKRLRQIVSENTTNKRCLEVAGVPEFLATIISNNGVDSSMVSLSDEALSLL--YHLESSE  173

Query  182  SVIVSSDPVRVG-----YLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  346
             V+ +    + G      L+ ++     + R  +  L++++L      ++   ++    +
Sbjct  174  RVLKNLLNNKKGGNIVKSLIKIMQRGIYESRAYATLLLKNILEVADPMQI---MTLKPSV  230

Query  347  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FDK  514
            F  +V IL+  +S+ +A K  +  L  +C   + RHKAV AGA+  +I+ L D     D+
Sbjct  231  FTEVVQILDDRISH-KATKAAMHVLVTICPWGRNRHKAVEAGAISVIIELLMDESFSSDR  289

Query  515  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--a  688
               E A+  +++LC+   G A F  H   + ++ K IL++S  A++ A   LLS+    A
Sbjct  290  RGPEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCA  349

Query  689  seqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
            +     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  350  TPALLHEMLQLGVVEKLFLVLQISCGSKTKEKAKELLKLHARVWKD  395



>emb|CDY32070.1| BnaC04g44960D [Brassica napus]
Length=412

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 84/290 (29%), Positives = 144/290 (50%), Gaps = 23/290 (8%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSN----SPELSHESLAILSMFPLP  172
            L+RLR +  E+  N+  + A    E L  I+ +N   N    S  L+ E+L++L  + L 
Sbjct  116  LKRLRQIVSENKTNKRCLEAAGVPEFLATIVSNNESQNVFDSSMSLTDEALSLL--YHLE  173

Query  173  EAESVI---VSSDPVR--VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNA  337
             +E+V+   ++    R  V  L++++     + R  +  L++++L           I N 
Sbjct  174  TSETVLKNLLNKKKGRDIVSSLINIMQRGMYESRAYATLLLKNILEVAEP----MHIMNL  229

Query  338  DE-IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD---  505
               +F  +V IL   +S+ +A K  +  L  +C   + RHKAV AGA+  +I+ L D   
Sbjct  230  KPLVFTEVVQILEDRISH-KATKAALHILVNICPWGRNRHKAVEAGAIYVMIELLMDESF  288

Query  506  -FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC  682
              D+   E A+  ++LLC+   G A F  H   + ++ K IL+IS  A++ A   LLS+ 
Sbjct  289  SSDRRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRISQTASDRAVRVLLSVG  348

Query  683  s--aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
               A+     E    GV+++L L++Q +C  + K KA+ LLKL    W +
Sbjct  349  RFCATPALLHEMLQLGVVSKLCLVLQVNCGSKTKEKAKELLKLHARVWKD  398



>ref|XP_010028074.1| PREDICTED: U-box domain-containing protein 30 [Eucalyptus grandis]
 gb|KCW54733.1| hypothetical protein EUGRSUZ_I00687 [Eucalyptus grandis]
Length=447

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/224 (30%), Positives = 121/224 (54%), Gaps = 6/224 (3%)
 Frame = +2

Query  137  ESLAILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPEL  316
            E++AIL    L ++ES      P ++  +V +L+  S++ ++N   LIE+++      + 
Sbjct  208  EAIAILVNLSL-DSESRTNLMQPAKISLVVDMLNEGSMETKINCTRLIETLM---EEKDF  263

Query  317  RAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDR  496
            R++I ++  +  G++ ++     Y+     G++ L  +CL KQ R   V+ GAV  L+D 
Sbjct  264  RSEIVSSHSLLVGLMRLVK-EKRYANGTLPGLRLLRTICLHKQVRSLFVSVGAVPQLVDL  322

Query  497  LQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLS  676
            L + D    E AL  +E L  +P G  A      T+P +V++++++S   T+YA   L +
Sbjct  323  LPNLDSECLELALFILETLSSLPEGQLALKDCQSTIPSMVRLLMRVSEMCTQYALSILWA  382

Query  677  ICsaseqa-qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKL  805
            +CS + Q     A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  383  VCSLAPQECSSVAVDAGLAAKLLLVIQSGCDPVLKQRSSELLKL  426



>ref|XP_002987189.1| hypothetical protein SELMODRAFT_46743, partial [Selaginella moellendorffii]
 gb|EFJ11765.1| hypothetical protein SELMODRAFT_46743, partial [Selaginella moellendorffii]
Length=144

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 85/140 (61%), Gaps = 8/140 (6%)
 Frame = +2

Query  413  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  592
            KAL ALCL+K  R  AV AG V +L++ L +     +ER LAT+ELL     G AA   H
Sbjct  1    KALLALCLSKDNRVAAVKAGVVASLLELLTEAKGVTSERMLATLELLSTTLEGRAAILRH  60

Query  593  ALTVPLLVKIILKISHRATEYAAGALLS-ICsaseqaqreaaaaGVM-------TQLLLL  748
            AL +PLL+ +IL++S R TEYAAG L S IC+ +         A  M       T LLLL
Sbjct  61   ALAIPLLLSMILRVSDRGTEYAAGVLCSVICTETSTPLDSNEEALEMAFQARASTSLLLL  120

Query  749  VQSDCTERAKRKAQMLLKLL  808
            +QS CT+RA+RKA  LLK+L
Sbjct  121  LQSHCTQRARRKAVKLLKVL  140



>ref|XP_006410763.1| hypothetical protein EUTSA_v10016730mg [Eutrema salsugineum]
 gb|ESQ52216.1| hypothetical protein EUTSA_v10016730mg [Eutrema salsugineum]
Length=412

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 143/287 (50%), Gaps = 21/287 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSN----SPELSHESLAILSMFPLP  172
            L+RLR +  E+  N+  + A    E L  I+ +N   N    S  L+ E+L++L  + L 
Sbjct  116  LKRLRQIVSENATNKRCLEAAGVPEFLATIVSNNDLENGFDSSNSLTDEALSLL--YHLE  173

Query  173  EAESVIVS-----SDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNA  337
             +E+V+ +      +   V  L+ ++     + R  +  L++++L      ++   ++  
Sbjct  174  TSETVLKNLFNNNKENDIVNSLIKIMERGIYESRAYATLLLKNILEVADPMQI---MTLK  230

Query  338  DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----  505
              +F  +V IL+  +S+ +A K  +  L  +C   + RHKAV AGA+  +I+ L D    
Sbjct  231  PTVFTEVVQILDDQISH-KATKAAMHILVNICPWGRNRHKAVEAGAISVIIELLMDDSFS  289

Query  506  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs  685
             D+   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+  
Sbjct  290  SDRRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGK  349

Query  686  --aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
              A+     E    GV+T+L L++Q  C  + K KA+ LLKL    W
Sbjct  350  FCATPALLNEMLQLGVVTKLCLVLQVSCGSKTKEKAKELLKLHARVW  396



>ref|XP_002452587.1| hypothetical protein SORBIDRAFT_04g028560 [Sorghum bicolor]
 gb|EES05563.1| hypothetical protein SORBIDRAFT_04g028560 [Sorghum bicolor]
Length=462

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 92/309 (30%), Positives = 135/309 (44%), Gaps = 38/309 (12%)
 Frame = +2

Query  11   RLRGLACESDKNR----------------SVILANNAREVLLCILFSNMDSNSPELSHES  142
            R R L  ESD+NR                S ++   A   LL  L   +D        E 
Sbjct  164  RARALGKESDRNRRCLAAAGAARALSSAFSQLVGQPALASLLTALGGALD--------EI  215

Query  143  LAILSMF-PLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELR  319
            LA L +F PL E     ++S P  +  +VS+LS+     +  +A ++  + S +  PE  
Sbjct  216  LAALVVFFPLGEESRSHIAS-PASLNAVVSILSHGETTAKAGAAVVLREIASSS-DPECL  273

Query  320  AQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL  499
              +S  D I + ++ +L  P+S        V A + +  +     + V  G VE L++ L
Sbjct  274  DAMSETDGIHDALIKLLQRPVSAQATKAAMVTAYYLVTNSGLAASRLVDLGMVELLVELL  333

Query  500  QDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI  679
             D DK   E+ALA ++ L     G     AHAL VP+LVK +  +S  ATE+A  AL  +
Sbjct  334  VDADKGTTEKALAVLDSLLLTEEGRGKACAHALAVPVLVKKMQHVSDMATEFAVSALWRL  393

Query  680  Csaseqa---qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDD  850
            C +       + EA   G   +LLLL+Q  C    K +A  LL+LL         A  D 
Sbjct  394  CKSFSGEGPCKAEALQLGAFQKLLLLLQVGCMGVTKERASELLRLL--------NASRDG  445

Query  851  YNCSYVVPF  877
              C   V F
Sbjct  446  VECIETVDF  454



>ref|XP_002862799.1| hypothetical protein ARALYDRAFT_920258 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39057.1| hypothetical protein ARALYDRAFT_920258 [Arabidopsis lyrata subsp. 
lyrata]
Length=225

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 86/165 (52%), Gaps = 42/165 (25%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            A+ RLR LA   +KNR +I  +NARE+L+ IL                 +L      E E
Sbjct  100  AICRLRELA-RDEKNRVLIAGHNAREILVRIL-----------------VLLHMTETECE  141

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV  361
            +++                        N AALIE VL+G++  +L+  IS +D IFEG++
Sbjct  142  ALV------------------------NGAALIEMVLTGSKLMDLKLIISGSDSIFEGVL  177

Query  362  GILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDR  496
             +L   +S  RAL+IG+KA+FALCL KQ +H A++ GA   LID 
Sbjct  178  DLLKILISSRRALQIGIKAIFALCLVKQKKHLAISTGAPGILIDH  222



>ref|XP_003636401.1| U-box domain-containing protein [Medicago truncatula]
 gb|KEH36028.1| hypothetical protein MTR_3g110088 [Medicago truncatula]
Length=289

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 70/140 (50%), Gaps = 13/140 (9%)
 Frame = +2

Query  392  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  571
            R  K   K LFALCL++  R  AV AGAV              AERALA +EL+C +P G
Sbjct  152  RESKPATKILFALCLSEANRRVAVEAGAV-------------GAERALAALELMCTVPEG  198

Query  572  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  751
                 AHAL VP++V ++ K   R  EYA G L  I        + A    V   + L +
Sbjct  199  AEEVRAHALAVPVMVTVMGKTGARGKEYAIGVLAVIYGGDMGDMQTAPPEEVARAVELAL  258

Query  752  QSDCTERAKRKAQMLLKLLR  811
            Q DC+ R KRK   LLK L+
Sbjct  259  QGDCSARGKRKGAQLLKTLQ  278



>ref|XP_009379827.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=399

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 144/281 (51%), Gaps = 19/281 (7%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            AL+RL+ +  ESD+NR  +  + A ++L+ I+    + N      E+LAIL    +    
Sbjct  115  ALQRLKSVVLESDRNRRFVEESGAADLLVSIIREQEECND---GDEALAILCSLQISGER  171

Query  182  --SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIES---VLSGTRSPELRAQISNADEI  346
               ++  +D + +G L S+LS  +   +  +  L++S   V+S ++  +LR      +E 
Sbjct  172  LLDLLRRNDDL-IGTLTSILSQRNDQSQAYALLLLKSLVPVMSPSKMSDLR------EEF  224

Query  347  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL-QDFDKCDA  523
            F GIV  L   +S  +A K  ++ L  +C  K+ + KAV AGAV  LI+ L  + ++   
Sbjct  225  FSGIVKGLQDKVS-RQATKAALQILAGVCCCKRNKVKAVRAGAVFVLIELLLGETERRRC  283

Query  524  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq--  697
            E  LA ++ LC    G A   AHA  + ++ K IL++S  A+  +A  L S+   S    
Sbjct  284  EMLLAVLDQLCGCAEGRAEVVAHAAGISVVSKKILRVSKLASAMSARILCSVAKLSPSPP  343

Query  698  aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
              +E    G +++L LL+Q DC  R K KAQ +LKL    W
Sbjct  344  VLQEMLQVGAVSKLCLLLQVDCGVRLKDKAQEILKLHSRVW  384



>ref|XP_002281453.1| PREDICTED: U-box domain-containing protein 25 [Vitis vinifera]
Length=344

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 84/158 (53%), Gaps = 8/158 (5%)
 Frame = +2

Query  344  IFEGIVGILNCPLSYSRA-LKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  520
            +  G+VG L       RA  +   K L ALCLA+  RH AV AGAV  +++ + + +   
Sbjct  184  VMRGVVGCLK-----DRAGARPATKVLLALCLAEGNRHVAVEAGAVAEVVEAMSEMEGAV  238

Query  521  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  700
            AERALA +EL+C +  G A   AHAL+VP+++ ++  ++ R  E A   L  I   +   
Sbjct  239  AERALAALELMCTVAEGAAELRAHALSVPMMISMMESMAGRGKECAISILAVIYIGAGDQ  298

Query  701  qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  814
               +    V   + L +Q DC+ R KRK   LL+ L++
Sbjct  299  APPSEE--VARAVALALQGDCSARGKRKGAQLLRALQE  334



>ref|XP_009419493.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 94/309 (30%), Positives = 146/309 (47%), Gaps = 22/309 (7%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSN--------SPELSHESLAILS  157
            +LR LR +  ESD+NR  + A       L  +  N  S         S     E+L +L 
Sbjct  113  SLRELRTIVSESDRNRRCVEATPGVVDFLASVIVNYGSEGETGDGSESASACDEALVLLQ  172

Query  158  MFPLPEAE--SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQIS  331
               + E     V V +  + +  L  +L   +   R N+  ++ S+L     P  R+ I 
Sbjct  173  TLEISEEGLLDVFVKNGGI-MESLSMILRRSNYQSRSNAMLILNSLLGVI--PPARS-IG  228

Query  332  NADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALID-RLQDF  508
               E+F+ IV ++   +S  +A K  + AL  LCL  + R KAV AGAV AL++  L+  
Sbjct  229  LGGELFQEIVNVVRDRIS-QQATKAALHALLRLCLYGKSRVKAVEAGAVHALVELLLESP  287

Query  509  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  688
             K   E ALA ++ LC    G A    H   +P + K IL++S  A+E A   L S+   
Sbjct  288  QKRVCELALAGLDWLCGCADGRAELVRHRAAIPAVSKKILRVSQLASEKAVRILHSVARH  347

Query  689  seqaq--reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCS  862
            S  A   +E    GV+++L L++Q  C  + + KA+ +LKL    W +D   +S  Y+ +
Sbjct  348  SATAAVLQEMMNVGVVSKLCLVLQVGCGGKMEEKAREILKLHSRVW-KDSPCLSPLYSST  406

Query  863  YVVPF*SYC  889
            Y +   SYC
Sbjct  407  YPM---SYC  412



>ref|XP_008391980.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Malus domestica]
 ref|XP_008360600.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Malus domestica]
Length=406

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 85/294 (29%), Positives = 142/294 (48%), Gaps = 13/294 (4%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPEL-SHESLAILSMFPLPE-A  178
            LR LR ++ +S+ N+  I A  A E L   + +N+ ++   + + E+L IL    L E  
Sbjct  117  LRELRSISSDSEANKKSIEAAGAGEFLASTIINNIKNDRENVENEEALXILHNLNLSEDV  176

Query  179  ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD-EIFEG  355
               ++  +   V  L+ L+   S + R  +  L+ S+     S     +++N   E F  
Sbjct  177  LKTLIGKEGEFVEALIKLMQRGSYESRAYAVMLLRSIFEVADS----TRMANVKPEXFAE  232

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF--DKCDAER  529
            +V +LN  +S  +A K  ++ L  LC   + R KA  AGAV  LI+ L D   D+   E 
Sbjct  233  VVQVLNDQIS-QQASKATLQLLIXLCPWGRNRIKAXEAGAVMVLIELLLDTSSDRRTXEM  291

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq--  703
             L  ++++C    G A    H   + ++ K I+++S  A+E A   L SIC  S  +   
Sbjct  292  TLMVLDMICGCAEGRAELLNHGAGLAVVSKKIMRVSKVASERAVRILFSICKFSATSSVL  351

Query  704  reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSY  865
            +E    GV+ +L L++Q D   + K KA+ +LKL    W ++ T I  +   SY
Sbjct  352  QEMMQLGVVAKLCLVLQVDSGSKTKDKAREVLKLHGRTW-KNSTCIPSNLVSSY  404



>ref|XP_002524056.1| Spotted leaf protein, putative [Ricinus communis]
 ref|XP_002524059.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF38266.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF38269.1| Spotted leaf protein, putative [Ricinus communis]
Length=413

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 91/288 (32%), Positives = 142/288 (49%), Gaps = 20/288 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILF---------SNMDSNSPE---LSHESLA  148
            LR+LR +A  +D N+  + A  A E L  I+          S++D    E   LS E+L+
Sbjct  114  LRKLRSIANVNDTNKRCMEAAGAVEFLASIVNNFTSLSFEESSLDGAGIEIARLSDEALS  173

Query  149  ILSMFPLPEAE-SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQ  325
            IL    L E+    ++  +   +  L  ++ N + + R  +  L++S L      +L   
Sbjct  174  ILYSLQLSESGLRNLIGKNGEVIQSLTRVMQNGNYESRAYAVLLLKSALEVADPMQL---  230

Query  326  ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  505
            +S   E+F  IV +L+  +S+ +A K  ++ L  LC   + R KA  A AV  LID L D
Sbjct  231  VSLRPELFVEIVQVLSDQISH-QASKAALQLLINLCPWGRSRLKATEAKAVSTLIDLLLD  289

Query  506  F-DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC  682
              +K   E ALA ++LLC+   G A    H   + ++ K IL++S  A+E A   LLSI 
Sbjct  290  SSEKRTCEMALAVLDLLCQCAEGRAELLKHGAGLAVVSKKILRVSQVASEKAVRILLSIS  349

Query  683  saseqaqr--eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
              S  +    E    GV+ +L L++Q DC  + K KA+ +LKL    W
Sbjct  350  KFSATSTVLHEMLQIGVVAKLCLVLQVDCGSKGKDKAREVLKLHARAW  397



>gb|KDP34438.1| hypothetical protein JCGZ_12798 [Jatropha curcas]
Length=395

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 92/291 (32%), Positives = 154/291 (53%), Gaps = 21/291 (7%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESL--------AILS  157
            AL+ ++ L+ E     S ++      +L  ++F +++S   +LS ES+        +IL 
Sbjct  107  ALKSIQSLSDELISRNSCLIQLGFLPLLFELVFGSVES---KLSQESINFAEKSLSSILK  163

Query  158  MFP-LPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISN  334
            + P L E ES+    +  ++     LL   S  ++     LIE + S   + EL A I  
Sbjct  164  LLPILGELESLNTLKEESKLESFRILLEQGSSMMQEGLCHLIEGISSSLETKELCAIIGE  223

Query  335  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDK  514
              +I +G++ ++      S   + G+KA++ALC  +  R   V AG +  L+  + + ++
Sbjct  224  NRQILQGLILLVQ---QTSGVPEAGIKAIYALCSLESNRENLVQAGVINGLLMYISNTER  280

Query  515  CD-----AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS-HRATEYAAGALLS  676
             +     A +A+AT+E+L R+ +   A   +   V  LVK++ ++S H  +E A  +L+ 
Sbjct  281  RENVRNLAPKAMATIEILLRVETAKDAVINNPNGVSSLVKMVFRVSDHEGSESAVRSLMV  340

Query  677  ICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  829
            ICS S QA+ EA   GV+TQLLLL+QS C+ R K  A+MLLKLLR  W E+
Sbjct  341  ICSDSLQAREEAICRGVLTQLLLLLQSQCSVRTKTNARMLLKLLRSKWNEE  391



>ref|XP_002323382.1| U-box domain-containing family protein [Populus trichocarpa]
 gb|EEF05143.1| U-box domain-containing family protein [Populus trichocarpa]
Length=412

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 85/288 (30%), Positives = 147/288 (51%), Gaps = 21/288 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPEL-----------SHESLAI  151
            LR+LR  A E++ N+  + A  A E L+ +L +N  S S E+           S E+L+I
Sbjct  114  LRKLRSFANENETNKRCMEAAGAVEFLVSML-NNFHSLSFEVTSDDGFEISRPSDEALSI  172

Query  152  LSMFPLPEA--ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQ  325
            L    + E+  +++++  +   +  L  ++   + + R  +  L++S+L    + +L   
Sbjct  173  LYGLQISESGLKNLVMGRNGEFIETLTKVMQGGNYESRAYAVFLLKSMLEVADTLKL---  229

Query  326  ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  505
            IS   E+F+ IV +L   +S+ +A K  ++ L +LC   + R KA+ A AV  LID L D
Sbjct  230  ISLKHELFDEIVQVLRDQISH-QASKATLQLLISLCPWGRNRIKAIEAKAVPVLIDLLLD  288

Query  506  F-DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC  682
              +K   E  L  ++LLC+   G A    H   + ++ K IL++S  A+E A   +LSI 
Sbjct  289  SPEKRTCEMVLMVLDLLCQCAEGRAELLGHGAGLAIVSKKILRVSQVASERAVRIILSIS  348

Query  683  saseqaq--reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
              S      +E    G++ +L L++Q DC  + K KA+ +LK+    W
Sbjct  349  KYSITTSVLQEMLQIGIVAKLCLVLQVDCGSKIKDKAREVLKMQARVW  396



>ref|XP_003517356.1| PREDICTED: U-box domain-containing protein 30-like [Glycine max]
Length=449

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 110/202 (54%), Gaps = 5/202 (2%)
 Frame = +2

Query  203  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  382
            P +V  +V +L+  S++ ++N   LIES++      + R+++ ++  +  G++ ++    
Sbjct  231  PAKVSLMVDILNEGSIETKINCTRLIESLI---EEKDFRSEVISSHSLLVGLMRLVK-DK  286

Query  383  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  562
             +S  +  G+  L  +CL K+ R+  V+ GAV  L++ L   +    E AL  ++ L  +
Sbjct  287  RHSNGVCPGLSLLRTICLHKEVRNLLVSIGAVSQLVELLSGMEPDCTELALCVLDALASV  346

Query  563  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQL  739
            P G  A    + T+P++VK++++IS   T+YA   L S+C  S       A  AG+  +L
Sbjct  347  PEGRVALKDCSNTIPIMVKLLMRISENCTQYALSILWSVCKLSPDECSSIAVDAGLAAKL  406

Query  740  LLLVQSDCTERAKRKAQMLLKL  805
            LL++QS C    K+++  LLKL
Sbjct  407  LLVIQSGCNPILKQQSAELLKL  428



>gb|ABK25393.1| unknown [Picea sitchensis]
Length=417

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 79/285 (28%), Positives = 141/285 (49%), Gaps = 17/285 (6%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSN---MDS---NSPELSHESLAILSMF  163
             L++LR LA ES+ NR  I        L+ ++  N   M+S     P    E+L IL   
Sbjct  121  GLKKLRSLADESEANRRCIAVCGGDSALISVIEMNTVEMESGCYQCPMACDEALGILYKL  180

Query  164  PLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  343
            P+ +  +  +S     +  +  +L   S + R  SA L+++V S  +    +  ++  D+
Sbjct  181  PMADETAETLSRSKT-LKPISWILKKGSCNGRFYSAMLLKTVSSSGQKILQQLVVNADDD  239

Query  344  IFEGIVGILN---CPLSYSRALKIGVKALFALC-LAKQYRHKAVTAGAVEALIDRLQDFD  511
            + EG++ +L    C  + + +L+I    L A+C  +++ R KA+ AGA+  LI+ L +  
Sbjct  240  LIEGLLQLLTEEVCLQATTSSLEI----LMAICSPSRKNRIKAIEAGAIYILIELLPESQ  295

Query  512  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  691
            + + E+ L  +++LC    G A    HA+ +  + K I ++S  ATE A   L S+C  S
Sbjct  296  RMNCEKMLCLLDILCECAEGRATTIDHAMGIASISKKIFRVSQVATEKAIRILWSLCKFS  355

Query  692  eqa--qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
                   E    G + +L +L+Q +CT + K+KA+ +L+     W
Sbjct  356  PTPRLLNEMVQIGAVYKLCVLLQLECTSKTKQKAREMLRAHGKYW  400



>ref|NP_001147860.1| immediate-early fungal elicitor protein CMPG1 [Zea mays]
 gb|ACG28921.1| immediate-early fungal elicitor protein CMPG1 [Zea mays]
Length=452

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 126/274 (46%), Gaps = 9/274 (3%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCILFSNMD---SNSPELSHESLAILSMFPLPEAE  181
            + R L  ESD+NR  + A  A  VL       +D   S    L      ++  FPL E  
Sbjct  157  KARALGKESDRNRRCLAAGGAARVLSSAFLRLVDQPASFGGALGEILATLVVFFPLDEVC  216

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALI--ESVLSGTRSPELRAQISNADEIFEG  355
               ++S P  +  +VS+LS+       +SAA++  E   S    PE    +S    + + 
Sbjct  217  RSHIAS-PASLDAIVSILSHDGEATTKSSAAVVLREIASSSDSDPECLDALSVTSGVHDA  275

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  535
            ++ +L  P+S        V A + +  +     + V  G V+ L++ L D DK   E+AL
Sbjct  276  LIKLLQKPVSAQATKAALVTAYYLVRGSDLAARRLVDLGMVDLLVEMLVDADKGTTEKAL  335

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa---qr  706
            A ++ L     G     AHAL VP+LVK +  +S  ATE+A  AL  +C +       + 
Sbjct  336  AVLDSLLLTEEGRGKACAHALAVPVLVKKMQHVSEMATEFAVSALWRLCKSFSGEGPCKA  395

Query  707  eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
            EA   G   +LLLL+Q  C    K +A  LL+LL
Sbjct  396  EALQLGAFQKLLLLLQVGCMGVTKERASELLRLL  429



>ref|XP_004142305.1| PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus]
 ref|XP_004168550.1| PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus]
 gb|KGN49607.1| hypothetical protein Csa_5G023870 [Cucumis sativus]
Length=444

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 83/293 (28%), Positives = 141/293 (48%), Gaps = 32/293 (11%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCIL--FSNMDSNSP--ELSHESLAILSM-FPL  169
            + +++ L  ES++N+  I+AN     L  I   FSN ++     E+  E L+ +++ FPL
Sbjct  140  VEKIKKLGKESERNKKCIIANGTGNTLSSIFEAFSNPETFEKRIEILEEILSAMTVAFPL  199

Query  170  PEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
             E ES+        +  LV  L    +  R NS  +++ ++S    PE   ++       
Sbjct  200  QE-ESIKHLKSETSLQSLVWFLKGGDISGRRNSVLVLKEIISSY--PEKVDELGEIQGAL  256

Query  350  EGIVGILNCPL-SYSR--ALKIGVKALFALCLA---KQYRHKAVTAGAVEALIDRLQDFD  511
            EG++ ++  P+ S SR  +L I    + +   +   +++  + +  G V  L++ L D +
Sbjct  257  EGLIKLIKDPICSSSRKASLFITYHVIASTSSSSNRERFTKELLQMGLVSLLLETLVDAE  316

Query  512  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  691
            +   ERAL   + +C    G     AHALT+P++VK IL++S  ATE      LS+C   
Sbjct  317  RSVCERALGAFDGICETKQGREEAYAHALTMPVIVKKILRVSDLATE------LSVCIVW  370

Query  692  eqaqreaa------------aaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  814
            +  + E+               G   +LLLL+Q  C+E  K KA  LLKLL +
Sbjct  371  KLVKHESKEEEDGGIKVEALQVGAFQKLLLLLQVGCSEWTKEKATELLKLLNN  423



>ref|XP_007137800.1| hypothetical protein PHAVU_009G156600g [Phaseolus vulgaris]
 gb|ESW09794.1| hypothetical protein PHAVU_009G156600g [Phaseolus vulgaris]
Length=392

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 118/231 (51%), Gaps = 8/231 (3%)
 Frame = +2

Query  149  ILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQI  328
            I+ + PL   E++ +  D  ++   + L    +  V+ +   LI+S  S  ++ E+   +
Sbjct  162  IIKLLPLVSLEALNMIKDESKLATFLLLFEKGTSSVKTSLCHLIDSTAS-PQTEEVCHML  220

Query  329  SNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL---  499
             ++  +   IV ++      S   K+ +KA+ +LC  +  R   V AGA++ +I  +   
Sbjct  221  GHSQNLLREIVVLVR---QGSEVSKVAIKAMLSLCSLQSNRDNLVRAGAIDGVIIYISGC  277

Query  500  QDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLS  676
            +   K  A  A+A ++ L  + S   A   H   V  LVK++ K+ +   +E A G L  
Sbjct  278  ETRQKNLAPFAMAIIKNLLVLESAKEALVNHPYGVATLVKLVFKVCNQECSESAVGILAI  337

Query  677  ICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  829
            +C    +A+ EA  AGV+TQLL L+QS C  + K KA+MLLKLLR  W E+
Sbjct  338  VCRDFGRAREEAIGAGVLTQLLFLLQSQCDPKTKTKARMLLKLLRSKWIEE  388



>ref|XP_011042586.1| PREDICTED: E3 ubiquitin-protein ligase PUB22 [Populus euphratica]
Length=412

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 84/288 (29%), Positives = 147/288 (51%), Gaps = 21/288 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPEL-----------SHESLAI  151
            LR+LR  A E++ N+  + A  A E L+ +L +N  S S E+           S E+L+I
Sbjct  114  LRKLRSFANENETNKRCMEAAGAVEFLVSML-NNFHSLSFEVTSDDGFEISRPSDEALSI  172

Query  152  LSMFPLPEA--ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQ  325
            L    + E+  +++++  +   +  L  ++   + + R  +  L++S+L    + +L   
Sbjct  173  LYGLQISESGLKNLVMGRNGEFIETLTKVMQGGNYESRAYAVFLLKSMLEVADTLKL---  229

Query  326  ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  505
            IS   E+F+ IV +L   +S+ +A K  ++ L +LC   + R KA+ A AV  LID L D
Sbjct  230  ISLKHELFDEIVQVLRDQISH-QASKATLQLLISLCPWGRNRIKAIEAKAVPVLIDLLLD  288

Query  506  F-DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC  682
              ++   E  L  ++LLC+   G A    H   + ++ K IL++S  A+E A   +LSI 
Sbjct  289  SPERRTCEMVLMVLDLLCQCAEGRAELLGHGAGLAIVSKKILRVSQMASERAVRIILSIS  348

Query  683  saseqaq--reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
              S      +E    G++ +L L++Q DC  + K KA+ +LK+    W
Sbjct  349  KYSITTSVLQEMLQIGIVAKLCLVLQVDCGSKIKDKAREVLKMQARVW  396



>ref|XP_011078792.1| PREDICTED: U-box domain-containing protein 26-like [Sesamum indicum]
Length=387

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 78/254 (31%), Positives = 136/254 (54%), Gaps = 13/254 (5%)
 Frame = +2

Query  80   VLLCILFSNMDSNSPELSHESLA-ILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDV  256
            +LL ++F N +S +   + ++L   L + P  +  ++ +     +    VSL    S+ +
Sbjct  142  LLLELVFRNTESLNLRFAEKALVCALKLMPFSDIRTINILKQESKQAVFVSLFQQGSMSI  201

Query  257  RMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCL  436
            + +   ++E++ S  +  EL  ++  + ++ +G+V +L          + G++A+  L L
Sbjct  202  KKSLCLMVEAISSSVQ--ELCEKLGMSVQLVQGLVHLLQ------HKSEAGIRAVSGLAL  253

Query  437  AKQYRHKAVTAGAVEALIDRLQDFD---KCDAERALATVELLCRIPSGCAAFAAHALTVP  607
             ++ R      GAVE LID L   +   +  A  A++T+E L  +P+       H   V 
Sbjct  254  MERNRENLAREGAVEGLIDYLSTAEIHKRSLAPMAMSTIENLLSVPTAKDVIINHPSGVK  313

Query  608  LLVKIILKIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRK  784
             +VK++ ++S H+ +E A  +LL ICS S+ A+ +A   GV+TQLLLL+QS C  R K K
Sbjct  314  AIVKMVFRVSDHQGSESAVNSLLLICSDSKSAREKAIVDGVLTQLLLLLQSQCNGRIKTK  373

Query  785  AQMLLKLLRDCWPE  826
            A+MLLKLLR  W E
Sbjct  374  ARMLLKLLRSMWNE  387



>gb|KHN31155.1| U-box domain-containing protein 26 [Glycine soja]
Length=217

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 113/216 (52%), Gaps = 12/216 (6%)
 Frame = +2

Query  200  DPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGIL--N  373
            D  ++   + L    +  V+ +   +I+S+ S  ++ E+   + ++ ++   IV ++  N
Sbjct  4    DESKLATFLLLFEKGTSSVKTSLCHIIDSIAS-PQTEEVCHMLGHSHKLVHEIVVLVRQN  62

Query  374  CPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL---QDFDKCDAERALATV  544
            C +S     K+ +KA+ ALC  +  R   V  GA++ +I  +   +   K  A  A+A +
Sbjct  63   CEVS-----KVAIKAMLALCSLQSNRENLVREGAIDGVITYISGCETRQKNAAPLAMAII  117

Query  545  ELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSICsaseqaqreaaaa  721
            + L  + S   A   H   V  LVK++ ++ +   +E A G L  IC    +A+ EA  A
Sbjct  118  KKLLVLESAKEALVNHPNGVETLVKMVFRVCNQECSESAVGILAIICCDFGRAREEAIEA  177

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  829
            GV+TQLL L+QS C  + K KA+MLLKLLR  W E+
Sbjct  178  GVLTQLLFLLQSQCGTKTKTKARMLLKLLRSKWIEE  213



>ref|XP_006450657.1| hypothetical protein CICLE_v10008902mg [Citrus clementina]
 gb|ESR63897.1| hypothetical protein CICLE_v10008902mg [Citrus clementina]
Length=328

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 89/172 (52%), Gaps = 6/172 (3%)
 Frame = +2

Query  341  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  520
            E+  G+VG L        A KI    L ALCLA+  R  AV AGAV A+I+ + + D   
Sbjct  159  ELMRGVVGNLKNKAGAKPATKI----LLALCLAESNRRVAVEAGAVGAVIEVVAELDAAA  214

Query  521  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  700
             ERALA +EL+C +  G     AHAL VP++V ++ +++ R  EYA   L  I    +Q 
Sbjct  215  GERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQP  274

Query  701  qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYN  856
               A    V   + L +Q +CT R +RK   LLK L++    D T   D+ N
Sbjct  275  VLAAPPEEVARAVELALQGNCTPRGRRKGTQLLKSLKEYGQPDTT--QDEMN  324



>ref|XP_011006317.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Populus euphratica]
Length=415

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 144/290 (50%), Gaps = 22/290 (8%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPEL------------SHESL  145
            +LRRLR +  ES++NRS +    A + L  IL  N DS S ++            S E+L
Sbjct  114  SLRRLRSITLESERNRSCLEEAGAVDFLATIL-KNGDSTSIDIASDDGESEFSRASDEAL  172

Query  146  AILSMFPLPEAE--SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELR  319
             IL    + + +  ++I +     +  L+ +L + S   R  +  L++SV        L 
Sbjct  173  NILYHLKISQRKLKNLITNDGDQFLESLLQILKHSSYQSRAYATMLLKSVFEVADPMHL-  231

Query  320  AQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL  499
              IS   E+F  +V +LN  +S  ++ K  +K L  +C   + R KAV   AV  LI+ L
Sbjct  232  --ISIRPEMFVELVRVLNDQIS-QQSSKAALKLLVEVCPWGRNRIKAVEGSAVSVLIELL  288

Query  500  QD-FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLS  676
             D  DK   E  LA ++LLC    G A    H   + ++ K IL++SH A++ A   L S
Sbjct  289  LDKSDKRACELVLAVLDLLCGCAEGRAQLLKHGAGLAVVSKKILRVSHVASDKAVRILYS  348

Query  677  IC--saseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            I   SA+ +  +E    GV+ +L L++Q D + ++K +A+ +LKL    W
Sbjct  349  ISRFSATTRVLQEMLQVGVVAKLCLVLQVDSSFKSKERAREILKLHSRVW  398



>ref|XP_003564002.1| PREDICTED: U-box domain-containing protein 21 [Brachypodium distachyon]
Length=449

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 89/277 (32%), Positives = 133/277 (48%), Gaps = 17/277 (6%)
 Frame = +2

Query  11   RLRGLACESDKNRSVIL-ANNAREVLLCILFSNMDSNSPE------LSHESLAILSMFPL  169
            R R L  ESD+NR  +  A  AR+  L   F  + +   E      L     A+   FPL
Sbjct  157  RARALGKESDRNRRCLASAGAARK--LSSAFGRLAAAGGEPVEGGALGKVLAALTVFFPL  214

Query  170  P-EAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  346
              E+   IV+S    +  LVS+LS+  +  R ++A ++  V S          IS A  +
Sbjct  215  DDESRRCIVASS---LTTLVSVLSHGDLAARASAAIVLREVASSAADRATVEAISRAPGM  271

Query  347  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE  526
             + +VG++  P+S  +A K  +   + L   +    +    G V  L + L D DK  +E
Sbjct  272  CDALVGLVRNPVS-PQATKAALVTAYYLASDRAAASRFAELGVVSVLAELLVDADKGTSE  330

Query  527  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  706
            +ALA ++ +    +G  +  AHAL VP+LVK + ++S  ATE+A  AL  +C A   A  
Sbjct  331  KALAALDGVLCADAGLESARAHALVVPVLVKKMFRVSDMATEFAVSALWRLCHAGADAGA  390

Query  707  ---eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
               EA   G   +LLLL+Q  C    K +A  LLKLL
Sbjct  391  CRVEALRVGAFQKLLLLLQVGCGGPTKERASELLKLL  427



>emb|CDP01660.1| unnamed protein product [Coffea canephora]
Length=442

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 134/278 (48%), Gaps = 17/278 (6%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESL------AILSMFPLP  172
            ++R LA ES++N+  ++ N    VL    F     +S E  HE L      A+  MFPL 
Sbjct  147  KIRNLAKESERNKKRVVENGVGYVLSSS-FETFAGDSME-KHEVLLKEILSALTWMFPLG  204

Query  173  -EAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
             E +S + SS  +R   +   L    +  R ++  +++ +L+ +   ++   +   + I 
Sbjct  205  IEGQSKLGSSASLRC--IAWFLHGEDLSTRQHAVIVLKELLANSLDHQISDGLIEIEGIS  262

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKA---VTAGAVEALIDRLQDFDKCD  520
            E +  IL  P+  + A K  +   + +  +++    A   V  G V  +++ L D +K  
Sbjct  263  EALFKILEVPIGPT-ATKASLMVTYYMLQSEKSEKLASRFVEMGLVSLVLEILVDGEKRT  321

Query  521  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  700
            +E+AL  +E +C    G     ++ALT+PLLVK IL++S   TE+A   L  +C   E  
Sbjct  322  SEKALGVLEAICNWEEGREKACSNALTMPLLVKKILRVSEMGTEFAVSTLSKLCKEVEDE  381

Query  701  q--reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
                EA   G   +LL+++Q  C E  K K   LLKL+
Sbjct  382  NPVIEALEVGAFQKLLVVLQVGCGENTKEKITELLKLM  419



>ref|XP_010932523.1| PREDICTED: U-box domain-containing protein 21-like [Elaeis guineensis]
Length=445

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 84/305 (28%), Positives = 142/305 (47%), Gaps = 25/305 (8%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELS-----HESLAILSMF-P  166
            + ++R L  ES++NR  I++  A  VL    F  + S S E S      E L+ L+ F P
Sbjct  144  VEKIRNLGRESERNRRRIVSGGAGRVL-SASFGELASRSFESSTTGELEEILSALASFLP  202

Query  167  LPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  346
            L E    ++ S P  +  +V LL +  +  R+N+  +++ ++S   +  +   ++  + +
Sbjct  203  LDEEARWLIGS-PESLKSIVLLLRSGDLAARLNAVLVLKELVSSLDTEHVNI-VAETEGL  260

Query  347  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE  526
             E +V ++  P+S        V + + +  +++   + V  G V  L++ L D DK   E
Sbjct  261  IEALVKLIENPISPRTTKASLVASFYLVSSSERTAMRFVEMGMVSLLLEILVDSDKSLCE  320

Query  527  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq-  703
            +AL  ++ L +   G      H+LTVP+LVK I ++S   TE+A  AL  +C   +    
Sbjct  321  KALVVLDGLLQSKKGREMAYDHSLTVPILVKKISRVSDMETEFAVSALWKLCKNYKHETG  380

Query  704  --------reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDC--WPE-----DFTA  838
                     EA   G   ++LLL+Q  C    K KA  LLKLL     W E     DF  
Sbjct  381  ERAGEGCLMEALQVGAFQKILLLLQVGCNGTTKEKASELLKLLNGLRGWGECIETMDFKG  440

Query  839  ISDDY  853
            +   +
Sbjct  441  LKRPF  445



>ref|XP_003526867.1| PREDICTED: U-box domain-containing protein 25-like isoform X1 
[Glycine max]
 ref|XP_006581770.1| PREDICTED: U-box domain-containing protein 25-like isoform X2 
[Glycine max]
Length=394

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 76/254 (30%), Positives = 125/254 (49%), Gaps = 14/254 (6%)
 Frame = +2

Query  95   LFSNMDSNSPELSHESLA---ILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMN  265
            +F    S S  +    LA   IL + PL   E + +  D  ++   + L    +  V+ +
Sbjct  142  VFGTQLSKSHNMEFTELALSCILKLLPLVSLEPLNMIKDESKLATFLLLFEKGTSSVKTS  201

Query  266  SAALIESVLSGTRSPELRAQISNADEIFEGIVGIL--NCPLSYSRALKIGVKALFALCLA  439
               LI+S  S  ++ E+   + ++ ++   IV ++  NC +S      + +KA+ ALC  
Sbjct  202  LCHLIDSTAS-PQTEEVCHMLGHSHKLVHEIVVLVRQNCEVSKV----VAIKAMLALCSL  256

Query  440  KQYRHKAVTAGAVEALIDRL---QDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPL  610
            +  R   V  GA++  I  +   +   K  A  A+A ++ L  + S   A   H   V  
Sbjct  257  QSNRENLVREGAIDGAITYISGCETRQKNAAPLAMAIIKKLLVLDSAKEALVNHPNGVET  316

Query  611  LVKIILKI-SHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKA  787
            LVK++ ++ +   +E A G L  +C    +A+ EA  AGV+TQLL L+QS C  + K KA
Sbjct  317  LVKMVFRVCNQECSESAVGILAIVCCDFGRAREEAIGAGVLTQLLFLLQSQCGTKTKTKA  376

Query  788  QMLLKLLRDCWPED  829
            +MLLKLLR  W E+
Sbjct  377  RMLLKLLRSKWIEE  390



>ref|XP_006387887.1| hypothetical protein POPTR_0497s00200g [Populus trichocarpa]
 gb|ERP46801.1| hypothetical protein POPTR_0497s00200g [Populus trichocarpa]
Length=415

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 89/290 (31%), Positives = 144/290 (50%), Gaps = 22/290 (8%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPEL------------SHESL  145
            +LRRLR +  ES++NR  +    A + L  IL  N DS S ++            S E+L
Sbjct  114  SLRRLRSITLESERNRICLEEAGAVDFLATIL-KNGDSTSVDIASDDNESEFSRASDEAL  172

Query  146  AILSMFPLPEAE--SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELR  319
             IL    + + +  ++I +     +  L+ +L + S   R  +  L++SV        L 
Sbjct  173  NILYHLKISQRKLKNLITNDGDQFLESLLQILKHSSYQSRAYATMLLKSVFEVADPMHL-  231

Query  320  AQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL  499
              IS   E+F  +V +LN  +S  ++ K  +K L  +C   + R KAV   AV  LI+ L
Sbjct  232  --ISIRPEMFVELVRVLNDQIS-QQSSKAALKLLVEVCPWGRNRIKAVEGSAVSVLIELL  288

Query  500  QD-FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLS  676
             D  +K   E  LA ++LLC    G A    H   + ++ K IL++SH A++ A   L S
Sbjct  289  LDKSEKRACELVLAVLDLLCGCAEGRAELLKHGAGLAVVSKKILRVSHVASDKAVRILYS  348

Query  677  IC--saseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            IC  SA+ +  +E    GV+ +L L++Q D + ++K +A+ +LKL    W
Sbjct  349  ICRFSATSRVLQEMLQVGVVAKLCLVLQVDSSFKSKERAREILKLHSRVW  398



>emb|CDX79645.1| BnaC03g19810D [Brassica napus]
Length=408

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 76/285 (27%), Positives = 140/285 (49%), Gaps = 17/285 (6%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES  184
            L+RLR +  E+  N+  +      E L  I+ +N   +S  LS E+L++L  + L  +E+
Sbjct  116  LKRLRQIVSENATNKRCLEVAGVPEFLATIISNNGFDSSMSLSDEALSLL--YHLESSET  173

Query  185  VIVSSDPVRVG-----YLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
            V+ +    + G      L  ++     + R  +  L++++L      ++   ++    +F
Sbjct  174  VLKNLLNNKKGGNIVKSLTKIMQRGIYESRAYATLLLKNILEVADPMQI---MTLKPSVF  230

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FDKC  517
              +V IL+  +S+ +A K  +  L   C   + RHKAV AG +  +I+ L D     D+ 
Sbjct  231  TEVVQILDDRISH-KATKAAMHILVTTCPWGRNRHKAVEAGVISVIIELLLDESFSSDRR  289

Query  518  DAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--as  691
              E A+  +++LC+   G A F  H   + ++ K IL++S  A++ A   LLS+    A+
Sbjct  290  GPEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCAT  349

Query  692  eqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
                +E    GV+ ++ L++Q  C  + K KA+ LLKL    W +
Sbjct  350  PALLQEMLQLGVVEKMFLVLQVSCGSKTKEKAKELLKLHARVWKD  394



>emb|CDP16178.1| unnamed protein product [Coffea canephora]
Length=364

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 78/138 (57%), Gaps = 0/138 (0%)
 Frame = +2

Query  401  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  580
            K   K L ALCL +  RH AV AGAV  ++D + D +   AER+LA +ELLC +  G A 
Sbjct  216  KSASKVLLALCLVEGNRHAAVEAGAVGVVVDAMADLEGAVAERSLAALELLCTVAEGAAE  275

Query  581  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSD  760
              +HAL VP++V+++ ++  R  EYA   L  I          A    V   ++L +Q D
Sbjct  276  LRSHALAVPMMVEVMGRMEGRGKEYAISVLAVIFGGCTDGAVVAPPEEVARAVMLALQGD  335

Query  761  CTERAKRKAQMLLKLLRD  814
            C+ R +RKA  LLK+L++
Sbjct  336  CSARGRRKAAQLLKILQE  353



>ref|XP_009404142.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=439

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 80/279 (29%), Positives = 142/279 (51%), Gaps = 17/279 (6%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCILFS----NMDSNSPELSHESLAILSMFPLPEA  178
            ++R LA ES++NR    +N A  VL     +    + + ++ E+S E LA L+     + 
Sbjct  143  KVRNLARESERNRRCFASNGASRVLAATFGAVAGGSSECSAAEVSEEILAALATVSPLDE  202

Query  179  ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGI  358
            E+      P  +G LVS+L++ ++  R+++A +++ +L+ +   ++ A ++    + E +
Sbjct  203  EAASHMGSPESLGCLVSILTHGNLAARLSAALVVKQLLASS-GAKVDA-VAGTKGLVEAL  260

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKA--VTAGAVEALIDRLQDFDKCDAERA  532
              ++  P+ + +A K  + A+F + ++   R  A  V  G V  L++ L + +K   E+A
Sbjct  261  AKLVKEPI-FPQATKASLVAIFYM-VSHDERTAAQVVDLGLVPVLVEALVEPEKSMNEKA  318

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq---  703
            LA +E L     G      HALTVP+LVK + ++S  ATE    AL  +C    +     
Sbjct  319  LAVLEGLLSCEGGREKARQHALTVPVLVKKMFRVSDMATELVVSALWKLCRNEGEEGEGK  378

Query  704  ----reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
                +EA   G   +LLLL+Q  C+   K KA  L+K L
Sbjct  379  GRCLQEALRVGAFQKLLLLLQVGCSGETKEKATDLIKQL  417



>gb|KDP36106.1| hypothetical protein JCGZ_08750 [Jatropha curcas]
Length=417

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 142/290 (49%), Gaps = 22/290 (8%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCIL-------FSNMDSNSPE-------LSHES  142
            L++LR +A  +D N+  + +    E L  I+       F    S++ E       LS E+
Sbjct  116  LKKLRSMANVNDTNKRCMESAGVVEFLASIVNTYNSLSFEEYSSSNLEEINEAISLSDEA  175

Query  143  LAILSMFPLPEAE-SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELR  319
            L+ L    L E+   V++S +   +  L  +L N + + R  S  L++S+L      +L 
Sbjct  176  LSFLYGLQLSESGLKVLISKNAEIIDSLTRILKNGNYESRAYSVLLLKSILEVADPIQL-  234

Query  320  AQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL  499
              I+   E+F  IV IL   +S+ +A K  ++ L  LC   + R KAV A AV  LI+ L
Sbjct  235  --INLRQELFVEIVQILRDQISH-QATKSSLRLLVNLCPWGRNRVKAVAANAVSVLINLL  291

Query  500  QDF-DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLS  676
             D  +K   E AL  ++L+C+   G A    H   + ++ K IL++S  A+E A   LLS
Sbjct  292  LDSSEKRVCEMALMVLDLVCQCAEGRAELLGHGAGLAVVSKKILRVSQVASEKAVRILLS  351

Query  677  ICsaseqaq--reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            I   S      +E    GV+ +L L++Q DC  + K KA+ +LKL    W
Sbjct  352  ISKFSATNNVLQEMLQIGVVAKLCLVLQVDCGIKNKEKAREVLKLHARAW  401



>gb|ADI46216.1| CMPG1a [Solanum tuberosum]
Length=422

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 77/277 (28%), Positives = 136/277 (49%), Gaps = 14/277 (5%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCILFS-NMDSNSPELSHES--LAILSMF-PLP-E  175
            R++ LA ESD+N+   + N   +VL       +   N+   S E   L+ L++F PL  +
Sbjct  127  RVKNLASESDRNKCCFITNGIGKVLSSAFLELSKGRNAKNASTEEVILSTLTLFLPLDVK  186

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
            +++++ S   +R   +   L N S+  R N+  ++  ++      ++   + N +   EG
Sbjct  187  SKTILGSISSLRC--IAWFLKNGSLSSRRNAVLVLREIMKLEEKEKVEILL-NIEGALEG  243

Query  356  IVGILNCPL--SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAER  529
            +V ++  P+  + ++A  + +  +     ++  R + V  G VE LI+ L D DK   E+
Sbjct  244  LVKLVKEPICPNTTKASLLTIYHMVINSSSQSLRSRFVDVGLVELLIEILVDCDKSICEK  303

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq----  697
            AL  ++ +     G      +AL+VP+LVK +L++S  ATE++   L  IC         
Sbjct  304  ALGVLDGILSYEEGVKRAYNYALSVPVLVKKLLRVSDLATEFSVSILWKICKNENNGDCG  363

Query  698  aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
               EA   G   +LLL++Q  C+E  K K   LLKLL
Sbjct  364  VLVEALQVGAFQKLLLMLQVGCSEITKEKGSELLKLL  400



>ref|XP_008793948.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Phoenix dactylifera]
Length=401

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 140/299 (47%), Gaps = 35/299 (12%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            +LR+L+ L  ES++NR  + A      +L  +  N  S +P    + + I       + E
Sbjct  95   SLRKLKELVSESERNRRCVEAAPGVVGILASIIDNSSSGTPSGDQDGILIGD----DDVE  150

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQ------------  325
            S     + + + YL+ L     +D+ + +   IES+ S  R    R++            
Sbjct  151  STNARDEALSILYLLQLSEQHLLDLAVRNGDFIESLTSILRQSNYRSRAYAILLLKSLLG  210

Query  326  -ISNA------DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEA  484
             I+ A      +E+F+ +VG+L   +S+ +A K  ++ L  LCL    R KA  AGAV  
Sbjct  211  VIAPAHLAGVREELFQDVVGVLRDRISH-QANKAALQVLAGLCLWGSNRIKAANAGAVPV  269

Query  485  LIDRLQDFDKCDAERALATVELL-----CRIPSGCAAFAAHALTVPLLVKIILKISHRAT  649
            L++ L D    + ER +  + L+     C    G A    HA  + ++ K IL++S  A+
Sbjct  270  LVELLLD----EPERRICELVLMALGRVCGCAEGRAELVGHAAGIAVVSKKILRVSEVAS  325

Query  650  EYAAGALLSIC--saseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            E     L S+   SA+    +E    GV+++L L++Q DC  + K KA+ +L+L    W
Sbjct  326  ERGVKILYSVARFSATTAVLQEMLQIGVVSKLCLVLQFDCGMKMKEKAREILRLHSRVW  384



>ref|XP_007204425.1| hypothetical protein PRUPE_ppa1027169mg [Prunus persica]
 gb|EMJ05624.1| hypothetical protein PRUPE_ppa1027169mg [Prunus persica]
Length=405

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 87/293 (30%), Positives = 140/293 (48%), Gaps = 11/293 (4%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPE-AE  181
            L  +R +A  S+ N+  I A  A E L  ++ +N+ +N+   S E+L+IL    L E A 
Sbjct  116  LGEIRSMASHSEANKRSIKAAGASEFLSSMIINNVRNNNNFESEEALSILYNLNLSEDAL  175

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISN-ADEIFEGI  358
              +V  +   +  L+ L+   S + R  +  L  S+      P    +++N   E F  +
Sbjct  176  KTLVGKEGEFIDALIKLMQRGSYESRAYAVMLFRSMFEVADDP---MKMTNLRPEFFIEV  232

Query  359  VGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF--DKCDAERA  532
            V +LN  +S  +A K  ++ L  LC   + R KAV AGAV  LI+ L D   D+   E  
Sbjct  233  VQVLNDQIS-QQASKATLQLLIKLCPWGRNRIKAVEAGAVNVLIELLLDTSADRRTLEMT  291

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq--aqr  706
            L  ++++C    G A    H   + ++ K I+++S   +E A   L SIC  S      +
Sbjct  292  LMVLDMICACAEGRADLLNHGAGLAVISKKIMRVSKVGSERAVRILFSICKFSATPSVLQ  351

Query  707  eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSY  865
            E    GV+ +L L++Q D   + K KA+ +LKL    W ++ T I      SY
Sbjct  352  EMMQLGVVAKLCLVLQVDSGSKTKEKAREILKLHARTW-KNSTCIPSSLVSSY  403



>ref|XP_006340423.1| PREDICTED: U-box domain-containing protein 26-like, partial [Solanum 
tuberosum]
Length=299

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 107/218 (49%), Gaps = 29/218 (13%)
 Frame = +2

Query  200  DPVRVGYLV--SLLSNP--SVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGI  367
            D V+  YL+  SL+ NP  +VD   NS A  ++VL G                      +
Sbjct  92   DKVKAMYLLEHSLVPNPVAAVDGGGNSVACPDTVLRG----------------------V  129

Query  368  LNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVE  547
            + C L   R  K   K L ALCL++  RH AV  GAV  ++D L D D   AER+LA +E
Sbjct  130  VGC-LKDRRVAKSASKVLLALCLSENNRHVAVEVGAVGVVVDSLSDLDVAAAERSLAALE  188

Query  548  LLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSICsas-eqaqreaaaa  721
            LLC +  G      HAL VP++V+++ ++   R  EYA   L  I   + + A   A   
Sbjct  189  LLCTMAEGAEEVRDHALAVPMMVEVMGRMDGSRGKEYAISVLAVIYGGACDGAPLAAPPE  248

Query  722  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  835
             V   ++L +Q DC+ R +RK   LLK+L++    D T
Sbjct  249  EVARAVMLALQGDCSARGRRKGAQLLKILQNHGRPDPT  286



>ref|XP_006295808.1| hypothetical protein CARUB_v10024934mg [Capsella rubella]
 gb|EOA28706.1| hypothetical protein CARUB_v10024934mg [Capsella rubella]
Length=408

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 77/287 (27%), Positives = 143/287 (50%), Gaps = 21/287 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES  184
            L+RLR +  E+  N+  + A    E L  I+ ++ ++     + E+L +L  + L  +E+
Sbjct  116  LKRLRQIVSENATNKRCLEAAGVPEFLANIVSNDSENGLGSFTDEALNLL--YHLETSEA  173

Query  185  VIVS-------SDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  343
            V+ +       +D V+   L  ++     + R+ +  L++++L      ++   ++   E
Sbjct  174  VLKNLLNNKKGNDIVK--SLTKIMQRGIYESRVYATLLLKNILEVADPMQI---MTLKPE  228

Query  344  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  511
            +F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D     D
Sbjct  229  VFTEVVEILDDRIS-RKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSSD  287

Query  512  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  685
            +   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+    
Sbjct  288  RRGPEMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKYC  347

Query  686  aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
            A+     E    GV+++L L++Q  C  + K KA+ LLKL    W +
Sbjct  348  ATPALLNEMLQLGVVSKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  394



>ref|XP_009390871.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=433

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 83/279 (30%), Positives = 138/279 (49%), Gaps = 18/279 (6%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSP----ELSHESLAILSMF-PLPE  175
            ++   A ESD+NR  +  +    VL     +   ++S      +  E LA ++M  PL E
Sbjct  137  KVTNWAKESDRNRRRLAFDGMTRVLAATFVAFARASSDVAVVRILEEVLAAMAMLLPLDE  196

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLS--GTRSPELRAQISNADEIF  349
              +  + S P  +  LVS+L    V  R+++A  ++ +L+  G R+      I+    + 
Sbjct  197  EAAACIGSSPESLKRLVSVLRCGDVAARLHAALTVKELLASGGARAD----AIAATKGMG  252

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLA-KQYRHKAVTAGAVEALIDRLQDFDKCDAE  526
            E +V ++  P+S SRA+K  + ++F +  + ++   + V  G V  L++ L D +K   E
Sbjct  253  EALVKLVKRPIS-SRAMKASLVSIFYMVNSDEKTATRIVDLGLVPVLVEILVDDEKSMCE  311

Query  527  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  706
            +ALA ++ L     G      HALTVP+L K + ++S  ATE+   AL  +C   +   R
Sbjct  312  KALAVLDGLLSCERGRENACGHALTVPVLAKKMFRVSDMATEFVVSALWKLCKDHKGGGR  371

Query  707  e-----aaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
            E     A  AG   +LLLL+Q  C E  K +   LL+LL
Sbjct  372  ERCLLDALQAGTFHKLLLLLQVGCGEATKERVTDLLRLL  410



>ref|XP_010043987.1| PREDICTED: U-box domain-containing protein 21-like [Eucalyptus 
grandis]
Length=448

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 86/281 (31%), Positives = 136/281 (48%), Gaps = 17/281 (6%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCIL-----FSNMDSNSPELSHESLAILS-MFPLP  172
            +++ L+ ES++N+    +N    VL          S+ D  + ++S E L+ L+ M PL 
Sbjct  148  KMKALSKESERNKKCFKSNGTGSVLAAAFEAFSETSSQDEENDDISKEILSALTLMLPLS  207

Query  173  -EAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSA-ALIESVLSGTRSPELRAQISNADEI  346
             EA+S + S  P  +  +V  L+N  +    NSA  L E V S  R  E  A+I  A E 
Sbjct  208  VEAKSCLGS--PSSLHCMVGYLTNSDLSSGWNSALVLREIVSSDKRKVEALAEIEGALES  265

Query  347  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYR-HKAVTAGAVEALIDRLQDFDKCDA  523
               +V    CP +   +L +    + +   AK     + V  G V  L++ L D D+  +
Sbjct  266  LFKVVKEPICPAATRSSLIVIYHMVTSSHPAKDMIISRFVQMGLVSLLVETLVDADRSMS  325

Query  524  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  703
            E+AL  ++ +C    G  A   ++L VP+LVK +L++S  ATE++   L  + +  E  +
Sbjct  326  EKALGVLDGICDNEEGKEAVRDNSLAVPVLVKKLLRVSDLATEFSVSVLWKLMAIGESGE  385

Query  704  ------reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
                   EA   G   +LLLL+Q  C ER K KA   +KLL
Sbjct  386  DGGGVLAEALQVGAFQKLLLLLQVGCGERTKEKATQAVKLL  426



>ref|XP_010271201.1| PREDICTED: U-box domain-containing protein 21-like [Nelumbo nucifera]
Length=443

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 87/282 (31%), Positives = 135/282 (48%), Gaps = 22/282 (8%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCILFSNM----DSNSPELSHESLAILSMFPL-PE  175
            +++ L  E+++N+  I+ N A  VL     +      + N   L     A+  M PL  E
Sbjct  146  KIKRLGKENERNKRCIVGNGAGRVLAAAFDAFAAASFEKNVAALEKILSAMPWMLPLDSE  205

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSG-TRSPELRAQISNADEIFE  352
            A+S + S  P  +  +V  L++ S+  R N+  +++ +LS   +   L A+I  A++   
Sbjct  206  AQSYLAS--PASLRCMVWFLNSGSLSGRQNAVLVLKELLSSDQKHVSLLAEIEGANQALV  263

Query  353  GIVGILNCPLSYSRALKIGVKALFALC----LAKQYRHKA--VTAGAVEALIDRLQDFDK  514
             ++    CP     A K  + A+F +     L+   R K+  V  G V  L+D L D DK
Sbjct  264  KLIKEPICPT----ATKASLVAIFQMVSPSNLSSSDRIKSGFVEMGLVSLLLDILVDSDK  319

Query  515  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa--  688
               E+AL  ++ LC          ++ALT+P+LVK IL+IS  ATE++   L  +C    
Sbjct  320  SLCEKALGVLDGLCSCQEAREKAYSNALTMPVLVKKILRISDLATEFSVSILWKLCKNRN  379

Query  689  --seqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
                    EA   G   +LLLL+Q  C E  K KA  LLKLL
Sbjct  380  PDEGSIVIEALQVGAFQKLLLLLQVGCGEGTKEKATELLKLL  421



>gb|KHN13011.1| U-box domain-containing protein 30 [Glycine soja]
Length=449

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 110/202 (54%), Gaps = 5/202 (2%)
 Frame = +2

Query  203  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  382
            P +V  +V +L+  S++ ++N   LIES++      + R+++  +  +  G++ ++    
Sbjct  231  PAKVSLMVDILNEGSIETKINCTRLIESLI---EEKDFRSEVILSHSLLVGLMRLVK-DK  286

Query  383  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  562
             ++  +  G+  L  +CL K+ R+  V+ GAV  L++ L   +    E AL  ++ L  +
Sbjct  287  RHNNGVCPGLSLLRTICLHKEVRNLLVSIGAVSQLVELLSGMEPDCLELALCVLDALASV  346

Query  563  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQL  739
            P G  A    + T+P++VK++++IS   T+YA   L S+C  S +     A  AG+  +L
Sbjct  347  PEGRVALKDCSNTIPIMVKLLMRISENCTQYALSILWSVCKLSPEECSSIAVDAGLAAKL  406

Query  740  LLLVQSDCTERAKRKAQMLLKL  805
            LL++QS C    K+++  LLKL
Sbjct  407  LLVIQSGCNPILKQQSAELLKL  428



>ref|XP_011022933.1| PREDICTED: U-box domain-containing protein 26-like [Populus euphratica]
Length=397

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 76/248 (31%), Positives = 136/248 (55%), Gaps = 8/248 (3%)
 Frame = +2

Query  101  SNMDSNSPELSHESLA-ILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAAL  277
            S +   S + + ++L+ +L +  L E E + +  +  ++     L    +  ++ +   +
Sbjct  149  SRLSEGSAKFAEQALSCVLRLLSLDEYECLNMLKEESKLESFQFLFDQGTSKIKRSLCQI  208

Query  278  IESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHK  457
            IE++ S   + EL A++ N  ++ +G++ +++     S A   G+KA+ ALC  +  R  
Sbjct  209  IEAISSSLETRELCAKLGNNRKLLKGLILLVHQTYGASEA---GIKAISALCCLESNREN  265

Query  458  AVTAGAVEALIDRL---QDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIIL  628
             V  G +  L+  +   Q  ++  A +A+AT+ELL  + S   A       +  L+K++ 
Sbjct  266  MVQEGGINGLLTYIYEAQRHERNLAPKAMATIELLLGLESAKEALINDPNGIKALIKMVF  325

Query  629  KIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKL  805
            ++S H+ +E A  +L+ IC+ S QA+ EA  AGV+TQLLLL+QS C+ R K KA+MLLKL
Sbjct  326  RVSDHQGSESAIRSLMIICTDSLQAREEAIGAGVLTQLLLLLQSQCSGRTKTKARMLLKL  385

Query  806  LRDCWPED  829
            L   W E+
Sbjct  386  LGSKWDEE  393



>ref|XP_008465536.1| PREDICTED: U-box domain-containing protein 21-like [Cucumis melo]
Length=445

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 135/288 (47%), Gaps = 21/288 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCIL--FSNMDSNSP--ELSHESLAILSM-FPL  169
            + +++ L  ES++N+  I+AN        I   FSN ++     E+  E L+ ++M FPL
Sbjct  140  VEKIKNLGKESERNKKCIIANGTGNTFSSIFEAFSNPETFEKRIEILEEILSAMTMVFPL  199

Query  170  PEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
             E ES+        +  L   L    +  R NS  +++ ++S    PE   ++       
Sbjct  200  QE-ESIKHLKSETSLQSLAWFLKGGDISGRRNSVLVLKEIISSY--PEKVDELGVIQGAL  256

Query  350  EGIVGILNCPL---SYSRALKIGVKALFALCLAK---QYRHKAVTAGAVEALIDRLQDFD  511
            EG++ ++  P+   S   +L I    + +   +    ++    +  G V  L++ L D +
Sbjct  257  EGLIKLIKDPICSSSKKASLFITYHVIASTSSSSNQGRFTKALLQMGLVSLLLETLVDAE  316

Query  512  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  691
            +   ERAL   + +C    G     AHALT+P++VK IL++S  ATE +   +  +    
Sbjct  317  RSVCERALGAFDGICETKQGREEAYAHALTMPVIVKKILRVSDLATELSVSIVWKLVKNE  376

Query  692  eqaqr-------eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  814
             + ++       EA   G   +LLLL+Q  C+E  K KA  LLKLL +
Sbjct  377  SKEEKEDGGIEVEALQVGAFQKLLLLLQVGCSEWTKEKATELLKLLNN  424



>ref|XP_008784119.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Phoenix dactylifera]
Length=419

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 82/295 (28%), Positives = 137/295 (46%), Gaps = 26/295 (9%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCI------------------LFSNMDSNSPE  127
            ALR+L+ +  ESD+N+  + A  A + L  +                  LF ++  +   
Sbjct  113  ALRKLKAIISESDRNKRCVEAAGAVDFLASVIEESRSNPREREQEQDEGLFDDVTGSVSA  172

Query  128  LSHESLAILSMFPLPEAESV-IVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTR  304
               E+L IL    + E   + ++  +   +  L ++L   +   R ++  LI+S+LS   
Sbjct  173  AHDEALNILYSLQVSEQSLLHLIERNNDFMESLATILRRSNYQSRTHAMLLIKSLLSVMA  232

Query  305  SPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEA  484
               L+     + E+F  +V +L   +SY  A K  V+ L  L    + R KAV AGAV  
Sbjct  233  PARLKG---FSKELFGEVVKVLRDQISYP-ATKAAVQVLGGLSPWGRNRVKAVEAGAVRV  288

Query  485  LIDRLQDFDKCDA-ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAA  661
            +I+ L D  +  A E  L  ++ LCR   G A    HA  + ++ K +L++S  A+E   
Sbjct  289  VIELLLDKTERRACEMMLVVLDQLCRCAEGRAEMVGHAAGIAVVTKKLLRVSRVASERVV  348

Query  662  GALLSIC--saseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            G L S    S +    +E    G + +L +L+Q DC E+AK K + +L+L    W
Sbjct  349  GILYSAARFSPTRAVLQEMKQVGAVAKLCMLLQVDCGEKAKEKVKEMLRLHSKVW  403



>ref|XP_004511816.1| PREDICTED: U-box domain-containing protein 30-like [Cicer arietinum]
Length=449

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 108/202 (53%), Gaps = 5/202 (2%)
 Frame = +2

Query  203  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  382
            P ++  +V +L+  S++ ++N   LIES++      + R++I ++  +  G++ ++    
Sbjct  231  PAKISLMVDILNEGSIETKINCTRLIESLI---EEKDFRSEIISSHSLLVGLMRLVK-DK  286

Query  383  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  562
             +S  +  G+  L  +C  K+ +   V+ GAV  L++ L   +    E AL  ++ L  I
Sbjct  287  RHSNGICPGLSLLRTVCFYKEVKSLLVSIGAVSQLVELLSGMEHECLELALCVLDSLSSI  346

Query  563  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQL  739
            P G  A      T+P++VK++++IS   T+YA   L S+C  + +     A  AG+  +L
Sbjct  347  PEGRVALKDCVRTIPIMVKLLMRISENCTQYALSILWSVCKLAPEECSSIAVDAGLAAKL  406

Query  740  LLLVQSDCTERAKRKAQMLLKL  805
            LL++QS C    K+++  LLKL
Sbjct  407  LLVIQSGCNPILKQQSAELLKL  428



>ref|XP_003539260.2| PREDICTED: U-box domain-containing protein 30-like [Glycine max]
Length=514

 Score = 81.6 bits (200),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 110/202 (54%), Gaps = 5/202 (2%)
 Frame = +2

Query  203  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  382
            P +V  +V +L+  S++ ++N   LIES++      + R+++  +  +  G++ ++    
Sbjct  296  PAKVSLMVDILNEGSIETKINCTRLIESLI---EEKDFRSEVILSHSLLVGLMRLVK-DK  351

Query  383  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  562
             ++  +  G+  L  +CL K+ R+  V+ GAV  L++ L   +    E AL  ++ L  +
Sbjct  352  RHNNGVCPGLSLLRTICLHKEVRNLLVSIGAVSQLVELLSGMEPDCLELALCVLDALASV  411

Query  563  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQL  739
            P G  A    + T+P++VK++++IS   T+YA   L S+C  S +     A  AG+  +L
Sbjct  412  PEGRVALKDCSNTIPIMVKLLMRISENCTQYALSILWSVCKLSPEECSSIAVDAGLAAKL  471

Query  740  LLLVQSDCTERAKRKAQMLLKL  805
            LL++QS C    K+++  LLKL
Sbjct  472  LLVIQSGCNPILKQQSAELLKL  493



>ref|XP_002265439.2| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Vitis vinifera]
Length=411

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 135/284 (48%), Gaps = 18/284 (6%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCIL----FSNMDSNSPE------LSHESLAILSM  160
            +LR LA ESD N+  I +  A E L  I+    F+  +  S +       S E+L+IL  
Sbjct  117  KLRALAAESDANKRCIESAGAVEFLASIVSKANFTTFEEESDKGLESRSASSEALSILHY  176

Query  161  FPLPEAE-SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNA  337
              L EA    +V  +   VG LV +L   + + R  +  L+ S+L      +L   I+  
Sbjct  177  LLLSEAGLKKLVGKNGEFVGCLVRVLQRGNYESRAYAVMLLSSMLQVADPIQL---IALK  233

Query  338  DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALID-RLQDFDK  514
             E F   V +L   +S+ +A K  +K L  +C   + + KAV AGAV  L +  L   +K
Sbjct  234  PEFFVEAVQVLQDHISH-QATKATLKLLIEVCPWGRNKVKAVEAGAVSILTELLLASSEK  292

Query  515  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase  694
               E  L  ++ LC    G A    HA  + ++ K IL++SH A+E A   L SI   S 
Sbjct  293  RACEMILTVLDQLCGCAEGRAELLKHAAGMAIVSKKILRVSHVASERAVRILYSISKFSA  352

Query  695  qaq--reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
                 +E +  GV+ +L L++Q DC  R K K + +L+L    W
Sbjct  353  TPSVLQEMSQLGVVAKLCLVLQVDCGSRTKEKTRDILRLHARAW  396



>ref|XP_004251095.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Solanum lycopersicum]
Length=404

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 84/283 (30%), Positives = 141/283 (50%), Gaps = 19/283 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE-  181
            LRR++ +A  S+ N+  + +    + L  I+    +   PE S E+L IL      + E 
Sbjct  115  LRRIKSIARVSESNKMCLESAGVVDFLTSIVMKKKEE--PEASDEALNILFHLNPSDTEL  172

Query  182  -SVIVS-SDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF-E  352
              +I S +D   +  L+  L+N  V  R N+ AL+ S LS        AQ+     ++ +
Sbjct  173  KKLINSHNDNQFLDSLLQFLNNGHVQSRTNAIALLRSTLSMADP----AQLIGIQPVYIK  228

Query  353  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA-ER  529
            GIV ILN  +S  +A K+ +K L  LC   + R KA+  GAV ALI+ L D ++    E 
Sbjct  229  GIVCILNDKVS-QQATKLALKLLVELCPWGRNRIKAIENGAVFALIELLLDTNERRVCEL  287

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATE------YAAGALLSICsas  691
             L  ++ LC    G +    H   + ++ K IL++SH A++      Y+    L+ C  S
Sbjct  288  ILTALDHLCTCADGRSELLRHGGGIAIVSKKILRVSHLASDRGVRILYSISKFLATC-YS  346

Query  692  eqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
             +  +E    G++++L L++Q D + + K KA+ +L+L    W
Sbjct  347  TKVLQEMLQVGIVSKLCLVLQVDVSPKTKEKAKEILRLHSRVW  389



>ref|XP_011094237.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Sesamum indicum]
Length=413

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 82/286 (29%), Positives = 139/286 (49%), Gaps = 17/286 (6%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFS-NMDSNSPELSHESLAILS--------  157
            L+RLR +A ++  NR  +      E L  ++    + ++  E+S ESL+ L         
Sbjct  115  LKRLRSIASQNQTNRRCMETAGTAEFLASLVVQKTLQASRDEVSEESLSELRKACEEALS  174

Query  158  -MFPLPEAESVIVS-SDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQIS  331
             ++ L  +ES + S ++   V  L  ++ + S + R  +  L++S+L      ++  ++ 
Sbjct  175  ILYGLQLSESSLKSLTNNEFVESLTRIMQSGSYESRAYAVMLLKSMLEAADPAQVLIKLQ  234

Query  332  NADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALID-RLQDF  508
               + F G+  ILN  +   +A K  +K L ++C   + R KAV AGAV  LID  L+  
Sbjct  235  --PQFFVGLAQILNDQIC-QKASKATLKVLISVCPWARNRIKAVEAGAVPVLIDLLLESS  291

Query  509  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  688
            DK   E  L  ++LLC+   G A    H   + ++ K IL++S  A+E A   L S+   
Sbjct  292  DKRACEMTLTVLDLLCQCAEGRAELLKHGAGLAIVSKKILRVSQVASERAVRILHSVSKF  351

Query  689  seq--aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            S      +E    GV+ +L L++Q DC  R K +A+ +LK     W
Sbjct  352  SATPGVLQEMLQIGVVAKLGLVLQVDCGSRTKERAREMLKSYARAW  397



>ref|XP_002267438.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Vitis vinifera]
Length=411

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 135/284 (48%), Gaps = 18/284 (6%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCIL----FSNMDSNSPE------LSHESLAILSM  160
            +LR LA ESD N+  I +  A E L  I+    F+  +  S +       S E+L+IL  
Sbjct  117  KLRALATESDANKRCIESAGAVEFLASIVSKANFTTFEEESDKGLESRSASSEALSILHY  176

Query  161  FPLPEAE-SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNA  337
              L EA    +V  +   VG LV +L   + + R  +  L+ S+L      +L   I+  
Sbjct  177  LLLSEAGLKKLVGKNGEFVGCLVRVLQRGNYESRAYAVMLLSSMLQVADPIQL---IALK  233

Query  338  DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALID-RLQDFDK  514
             E F   V +L   +S+ +A K  +K L  +C   + + KAV AGAV  L +  L   +K
Sbjct  234  PEFFVEAVQVLQDHISH-QATKATLKLLIEVCPWGRNKVKAVEAGAVSILTELLLASSEK  292

Query  515  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase  694
               E  L  ++ LC    G A    HA  + ++ K IL++SH A+E A   L SI   S 
Sbjct  293  RACEMILTVLDQLCGCAEGRAELLKHAAGMAIVSKKILRVSHVASERAVRILYSISKFSA  352

Query  695  qaq--reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
                 +E +  GV+ +L L++Q DC  R K K + +L+L    W
Sbjct  353  TPSVLQEMSQLGVVAKLCLVLQVDCGSRTKEKTRDILRLHARAW  396



>ref|XP_010260460.1| PREDICTED: U-box domain-containing protein 26-like [Nelumbo nucifera]
Length=407

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 137/248 (55%), Gaps = 5/248 (2%)
 Frame = +2

Query  101  SNMDSNSPELSHESLA-ILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAAL  277
            +N+D    EL+  +L  IL+MFP  +  S+ +  +   +   + LL + +  ++ +   L
Sbjct  157  ANLDQEDSELAEGALTCILNMFPFSKLCSLNMLKEDSNLASFLVLLDHGTAKIKTSLCHL  216

Query  278  IESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHK  457
            +  + S + + +L        +I  G++ +L+     S A    VKA+ ALC  +  +  
Sbjct  217  VGLIASSSETRDLCVVFGQNPKILRGLITLLH---QNSEASNAAVKAISALCYLELNQEN  273

Query  458  AVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKIS  637
             VT G V+ LI  +   +   +  ALAT+ELL  + SG  A   +  TV  LVK++ ++S
Sbjct  274  VVTEGGVDGLIAYISGTNISQSSMALATLELLLGLESGKKAAVNNPSTVHALVKMVFRVS  333

Query  638  -HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  814
             H  +E A G+LL IC  S + + EA +AGV+TQLLLL+QS C+ R+K KA++LLKLLR 
Sbjct  334  DHEGSENAVGSLLIICYDSLKVREEAISAGVLTQLLLLLQSQCSCRSKNKARVLLKLLRS  393

Query  815  CWPEDFTA  838
             W E  +A
Sbjct  394  MWAESPSA  401



>ref|XP_010273225.1| PREDICTED: U-box domain-containing protein 30 [Nelumbo nucifera]
Length=452

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 120/234 (51%), Gaps = 10/234 (4%)
 Frame = +2

Query  119  SPELSH----ESLAILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIES  286
             P  SH    ES+ IL    L ++ES +    P ++  +V +L+  S++ ++N   LIE 
Sbjct  203  GPFTSHAVGSESIGILVNLNL-DSESKVNLMQPAKISLMVDILNEGSIETKINCTRLIEM  261

Query  287  VLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVT  466
            ++         +++ ++  +  G++ ++     +      G+  L  +C   Q R+  V+
Sbjct  262  LMD---EKNFSSEVVSSPSLLVGLLRLIK-DKRHPNGTSAGLGLLKTICSHNQVRNLVVS  317

Query  467  AGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRA  646
             GAV  L++ L + +    E AL  +++LC +P G +A    + T+P +V++++++S   
Sbjct  318  VGAVPQLVELLPNLNPDCLESALFILDILCTLPEGRSALKVCSNTIPNMVRLLMRVSESC  377

Query  647  TEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKL  805
            T+YA   L  +C  + +     A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  378  TQYALSILWEVCKLAPEECAAIAVEAGLAAKLLLVIQSGCNPALKQRSSELLKL  431



>emb|CDY59599.1| BnaCnng35300D [Brassica napus]
Length=409

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 139/284 (49%), Gaps = 14/284 (5%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILF-SNMDSNSPELSHESLAILSMFPLPEA-  178
            L+RLR +  E+  N+  + A N  E L  I+  SN   +S  L  E+L++L      E  
Sbjct  116  LKRLRQIVSENTTNKRCLEAANVPEFLAKIVSNSNRFDSSRSLMDEALSLLYHLDTSETA  175

Query  179  -ESVIVSSDPVR-VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  352
             +S++ +      V  L  ++     + R  +  L++ +L      ++   I    E+F 
Sbjct  176  RKSLLNNKKGTNLVKTLTKIMQRGIYESRAYATFLLKKILEVADPMQI---ILLERELFN  232

Query  353  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FDKCD  520
             +V IL+  +S+ +A K  ++ L  +C   + RHKAV AGA+  +I+ L D     ++  
Sbjct  233  EVVQILHDQISH-KATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDETFSSERRT  291

Query  521  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--ase  694
             E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLSI    A+ 
Sbjct  292  LEMAMVVLDMLCQCAEGRAEFLNHCAAIAVVSKKILRVSQITSERAVRVLLSIGRFCATP  351

Query  695  qaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
               ++    GV+ ++ L++Q  C  + K KA+ LLKL    W E
Sbjct  352  SLLQDMLQLGVVAKMCLVLQVSCGNKTKEKAKELLKLHARVWRE  395



>ref|XP_002275500.2| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Vitis vinifera]
Length=414

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 86/287 (30%), Positives = 139/287 (48%), Gaps = 19/287 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSN--------MDSNSPEL---SHESLAI  151
            L+RLR +A ESD+N+  + A  A E L  I+  +        ++  S E    S E+L+I
Sbjct  115  LQRLRSIAFESDRNKKCLEAAGAVEFLASIIKKDESAVIEVVLEDGSREFTRASDEALSI  174

Query  152  LSMFPLPEAE-SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQI  328
            L      EA    +VSS+   +  LV +L   +   R  +A L++S+       +L   I
Sbjct  175  LYQLETSEAALKSLVSSNYGFIESLVHVLKCGNYQSRAYAAMLLKSIFQVADPIQL---I  231

Query  329  SNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF  508
            + + E+F  IV +L   +S  +A K  +K L  LC   + R KAV AG    LI+ L D 
Sbjct  232  NASPELFTEIVHVLRDGIS-QQASKAALKLLVELCPWGRNRIKAVVAGVSHVLIEHLLDT  290

Query  509  -DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs  685
             +K   E  L  ++ LC    G A    H   + ++ K IL++S   T+ A   L S+  
Sbjct  291  SEKRTCELILVVLDQLCSCAEGRAELLKHGAGLAIVSKKILRVSQVGTDRAVKILASVSK  350

Query  686  aseqaq--reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
             S  ++  +E    GV+++L L++Q D +++ K K + +L L    W
Sbjct  351  FSATSRVLQEMLQVGVVSKLCLVLQVDSSKKTKEKTREILNLHSRVW  397



>ref|XP_008350837.1| PREDICTED: U-box domain-containing protein 21-like [Malus domestica]
Length=443

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 134/285 (47%), Gaps = 24/285 (8%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILS--------MFP  166
            ++  LA ES++N+  I+A+    VL        ++ S    H+++A+L         +FP
Sbjct  142  KINALAKESERNKRCIVASGTGSVLA----GAFNAFSSSQHHQNVAVLEEILSALTLVFP  197

Query  167  LPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMN-SAALIESVLSGTRSPELRAQISNADE  343
            L +  ++ + S P  +  +V  L +  +  R N S  L E+ +S     +    ++  + 
Sbjct  198  LDKEANLYLGS-PASLCCMVWFLESGDLSQRRNASLVLKETAVSSDHDHQKTDALAEIEG  256

Query  344  IFEGIVGILN---CPLSYSRALKIG---VKALFALCLAKQYRHKAVTAGAVEALIDRLQD  505
              E +V ++    CP S   +L I    V +  +    +Q + + V  G V  L D L D
Sbjct  257  ALEALVKLIKEPVCPTSTKASLVIMYRMVNSSSSSPSKEQIKERFVEMGLVSLLSDILVD  316

Query  506  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs  685
             ++   E+AL  ++ LC    G      HALT+P++VK IL++S  ATE++   L  +C 
Sbjct  317  AERSICEKALGVLDGLCGSKQGREKAYLHALTMPVVVKKILRVSDLATEFSVSILWKLCK  376

Query  686  aseqaq----reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
               +       EA   G   +LLLL+Q  C ER K KA  LL+ L
Sbjct  377  NETREDGGVLVEALQVGAFQKLLLLLQVGCAERTKDKATDLLRAL  421



>ref|XP_008365622.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Malus domestica]
Length=406

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 81/294 (28%), Positives = 141/294 (48%), Gaps = 13/294 (4%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPEL-SHESLAILSMFPLPE-A  178
            L  LR ++ +S+ N+  I A  A E L   + +N+ ++   + + E+L+IL    L E  
Sbjct  117  LSELRSISSQSEANKRSIEAAGAGEFLASTIINNIKNDRENVENEEALSILYNLNLXEDV  176

Query  179  ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE-IFEG  355
               ++  +   V  L+ L+   S + R  +  L+ S+     S     +++N     F  
Sbjct  177  LKTLIGKEGEFVEALIKLMQRGSDESRTYAVMLLRSMFEVADS----MRMTNVKPAFFVQ  232

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF--DKCDAER  529
            +V +LN  +S  +A K  ++ L   C   + R KAV +GAV  LI+ L D   D+   E 
Sbjct  233  VVQVLNDQIS-QQASKATLQLLIQFCQWGRNRTKAVESGAVMVLIELLLDTSSDRRTLEM  291

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa--seqaq  703
             L  +++LC    G A    H+  + ++ K I+++S  A+E A   L SIC    +    
Sbjct  292  TLLVLDMLCSCAEGRAELLTHSAGLAVVSKKIMRVSKVASERAVKILFSICKFSPTSNVL  351

Query  704  reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSY  865
            +E    G++ +L L++Q D   + K KA+ +LKL    W ++ T I  +   SY
Sbjct  352  QEMMQXGIVAKLCLVLQVDSGSKTKEKAREILKLHARTW-KNSTCIPSNLVSSY  404



>ref|XP_010279125.1| PREDICTED: U-box domain-containing protein 21-like [Nelumbo nucifera]
Length=440

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 127/275 (46%), Gaps = 11/275 (4%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCILFSNMD----SNSPELSHESLAILSMFPLP-E  175
            +++ L  ES++N+  I+ N    VL     +        N+  L     A+  M PL  E
Sbjct  146  KIKNLGKESERNKRCIVGNGTGRVLAATFEAFAAASFEKNTDVLEEILSALTWMLPLDLE  205

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
            A+S +    P+R   +V    +  +  R N+  +++ + S  R   L A+   A E    
Sbjct  206  AQSYLGLPAPLRC--MVWFSKSGGLSGRQNAVLVLKELSSDQRHVSLLARTEGASEALVK  263

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  535
            ++    CP +   +L +  + + +   + + R + V    +  L+D L D DK   E+AL
Sbjct  264  LIKEPICPTATKASLVVIYRMVSSSVSSDKIRSRFVDMDLISLLLDILVDSDKSLCEKAL  323

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase----qaq  703
              ++ LC          AHALT+P+LVK IL+IS  ATE+    L  +C   +       
Sbjct  324  GVLDGLCSCQEAREKAYAHALTMPVLVKKILRISDLATEFTVSILWKLCKNKKIDEGSIL  383

Query  704  reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
             EA   G   +LLLL+Q  C ER K KA  LLKLL
Sbjct  384  VEALQVGAFQKLLLLLQVGCGERTKEKATELLKLL  418



>ref|XP_007047580.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX91737.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
Length=311

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/233 (28%), Positives = 120/233 (52%), Gaps = 10/233 (4%)
 Frame = +2

Query  122  PELSH----ESLAILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESV  289
            P  SH    E++ IL    L ++ES      P ++  +V +L+  SV+ ++N   L++ +
Sbjct  63   PFTSHAVGSEAIGILVNLEL-DSESNTNLMQPTKISLMVDMLNEGSVETKINCTRLMDKL  121

Query  290  LSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTA  469
            +      E R++  ++  +  G++ ++     +S  +  G+  L ++CL KQ R   V+ 
Sbjct  122  M---EEKEFRSESISSHRLLVGVMRLVK-DKRHSNGILPGLSFLRSICLLKQVRSLIVSI  177

Query  470  GAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRAT  649
            GAV  L++ L   +    E AL  ++ L  +P G  A    A T+P  V++++++S   T
Sbjct  178  GAVSQLVELLPSLEPDCLELALFILDTLSSLPEGKVALKDCANTIPNTVRLLMRVSESCT  237

Query  650  EYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKL  805
            +YA   L S+C  + +     A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  238  QYALSILWSVCKLAPEECSSVAVEAGLAAKLLLVIQSGCNPVLKQRSAELLKL  290



>ref|XP_010249635.1| PREDICTED: U-box domain-containing protein 26 [Nelumbo nucifera]
Length=341

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 104/203 (51%), Gaps = 25/203 (12%)
 Frame = +2

Query  227  SLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKI  406
            SL+ NP  D              G+R P      +    +  G+V  L  P     A K+
Sbjct  160  SLVPNPPAD--------------GSRDP------TCPPSVMSGVVRFLKDPAGAKPATKV  199

Query  407  GVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFA  586
                L ALCLA+  RH AV AGAV  +++ + + +   AERALA +ELLC +P G +   
Sbjct  200  ----LLALCLAECNRHVAVEAGAVAEVVETVAELEGSAAERALAALELLCTVPEGASELR  255

Query  587  AHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCT  766
            AHAL VP+LV+++ K++ R  E+   ++L++       +  A    V   ++L +Q +C+
Sbjct  256  AHALAVPMLVEMVTKMAGRGKEHGI-SVLAVIFGGGGEEGVAPPEEVGRAVVLALQGECS  314

Query  767  ERAKRKAQMLLKLLRDCWPEDFT  835
             RA+RK   +LK+L++    D T
Sbjct  315  ARARRKGAQILKVLQENGRLDLT  337



>ref|XP_010091753.1| U-box domain-containing protein 21 [Morus notabilis]
 gb|EXB45116.1| U-box domain-containing protein 21 [Morus notabilis]
Length=441

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 132/295 (45%), Gaps = 26/295 (9%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESL--AILSMFPL-P  172
            ++++++    ES++NR  I+ N A  VL   L S   S S     E +  A+  MFP   
Sbjct  137  SVKKIQKWGAESERNRRCIMVNGAANVLANALESFATSGSDMSGFEEILSALNWMFPFGE  196

Query  173  EAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLS--GTRSPELRAQISNADEI  346
            EA   + S   +R   LVS L +  + V+ NSA ++  +LS    R  E+ A I     I
Sbjct  197  EARKYLGSEASLRC--LVSFLKHDDLSVKQNSAMVLTELLSYGDKRHLEVIANIEGLVLI  254

Query  347  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQY------RHKAVTAGAVEALIDRLQDF  508
                +    CP    +  K  +  +F L  +  Y      +   V  G V  ++  L DF
Sbjct  255  LMDFIRKQICP----KITKASLMLIFHLVSSSYYTSSETIKSAFVEMGLVSLILGILVDF  310

Query  509  DK-CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs  685
             K    E AL  ++ +C    G      +ALT+P+LVK +L++S  AT ++  A+  +C 
Sbjct  311  GKGVIIENALGVMDGICGFEKGRKEAFGNALTIPVLVKKLLRVSDVATAFSISAICKLCK  370

Query  686  ase--------qaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
                           EA   G   +LLL++Q  C E  K+KA  LLKLL    P+
Sbjct  371  NVNEEDDVQGRSVLVEALQVGAFQKLLLIIQVSCCEETKKKATELLKLLNPYRPQ  425



>gb|KFK36486.1| hypothetical protein AALP_AA4G130900 [Arabis alpina]
Length=412

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 143/289 (49%), Gaps = 21/289 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSN----SPELSHESLAILSMFPLP  172
            L+RLR +  E+  N+  + A    E L  I+ +N   N    S  ++ E+L++L  + L 
Sbjct  116  LKRLRQIVSENATNKRCLEAAGVPEFLATIVSNNDLENGFDSSRSMTDEALSLL--YHLE  173

Query  173  EAESVIVSSDPVR-----VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNA  337
             +E+V+ +    +     V  L  ++     + R  +  L++++L      ++   +S  
Sbjct  174  TSETVLKNLLNNKKCNDIVNSLTKIMQRGIYESRAYATLLLKNILEVADPMQI---MSLK  230

Query  338  DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----  505
             E+F  +V IL+  +S+ +A+K  +  L  +C   + RHKAV A A+  +I+ L D    
Sbjct  231  PEVFIEVVQILDDQISH-KAMKAAMHILVNICPWGRNRHKAVDAAAISVIIELLMDESFS  289

Query  506  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs  685
             ++   E AL  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+  
Sbjct  290  SERRGPEMALVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGK  349

Query  686  --aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
              A+     E    GV+ ++ L++Q  C  + K KA+ LLKL    W +
Sbjct  350  FCATPNLLNEMLQLGVVAKMCLVLQVSCGSKTKDKAKELLKLHARVWKD  398



>ref|XP_004251181.1| PREDICTED: U-box domain-containing protein 26 [Solanum lycopersicum]
Length=334

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 89/168 (53%), Gaps = 6/168 (4%)
 Frame = +2

Query  338  DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKC  517
            D +  G+VG L       R  K   K L ALCL++  RH AV  GAV A++D L D D  
Sbjct  160  DTVLRGVVGCLK----DRRIAKSASKVLLALCLSENNRHVAVEVGAVGAVVDILSDLDVA  215

Query  518  DAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSICsas-  691
             AER+LA +ELLC +  G      HAL VP++V+++ ++   R  EYA   L  I   + 
Sbjct  216  AAERSLAALELLCTVAEGAEEVRVHALAVPMMVEVMGRMDGSRGKEYAISVLAVIYGGAC  275

Query  692  eqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  835
            + A   A    V   ++L +Q DC+ R +RK   LLK+L++    D T
Sbjct  276  DGAPLAAPPEEVARAVMLALQGDCSARGRRKGAQLLKILQNYGRPDPT  323



>ref|XP_010505120.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Camelina sativa]
Length=416

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 141/293 (48%), Gaps = 30/293 (10%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILS------MFP  166
            L+RLR +  E+  N+  + A    E L     +N+ SN  E   +SL  L+      ++ 
Sbjct  121  LKRLRQIMSENATNKRCLEAAGVPEFL-----ANIVSNDSENGFQSLGSLTDESLNLLYH  175

Query  167  LPEAESVIVS-------SDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQ  325
            L  +E+V+ +       +D V+   L  ++     + R  +  L++++L      ++   
Sbjct  176  LETSETVLKNLLNNKKGNDIVK--SLTKIMQRGIYESRAYATLLLKNILEVADPMQI---  230

Query  326  ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  505
            ++   E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D
Sbjct  231  MTLKPEVFTEVVEILDDRIS-RKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMD  289

Query  506  ----FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALL  673
                 D+   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LL
Sbjct  290  ESFSSDRRGPEMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLL  349

Query  674  SICs--aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
            S+    A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  350  SVGKFCATPALLNEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  402



>gb|AES94509.2| E3 ubiquitin ligase PUB14 [Medicago truncatula]
Length=451

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/234 (28%), Positives = 120/234 (51%), Gaps = 10/234 (4%)
 Frame = +2

Query  119  SPELSH----ESLAILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIES  286
             P  SH    E + IL    L ++ES      P ++  +V +L+  S++ ++N   LIE+
Sbjct  202  GPFTSHAVGSEVIGILVSLTL-DSESKKNLMQPAKISLMVDILNEGSIETKINCTRLIET  260

Query  287  VLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVT  466
            ++      + R++I ++  +  G++ ++     +S  +  G+  L  +C  K+ +   V+
Sbjct  261  LI---EEKDFRSEIISSHSLLVGLMRLVK-DKRHSNGICPGLSLLRTVCFYKEVKILLVS  316

Query  467  AGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRA  646
             GAV  L++ L   D    E AL  ++ L  IP G  A      T+P++V+++++IS   
Sbjct  317  IGAVSQLVELLSGMDHDCLELALCVLDSLSSIPEGRVALKECVNTIPIMVRLLMRISESC  376

Query  647  TEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKL  805
            T+YA   L S+C  + +     A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  377  TQYALSILWSVCKLAPEECSSIAVDAGLAAKLLLVIQSGCNPILKQQSAELLKL  430



>gb|AGT17408.1| hypothetical protein SHCRBa_230_N09_R_300 [Saccharum hybrid cultivar 
R570]
Length=449

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 74/233 (32%), Positives = 119/233 (51%), Gaps = 17/233 (7%)
 Frame = +2

Query  146  AILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRS-PELRA  322
            A++ M PL E E+      P  +G LV++  N S+  R+N+   I  V+S   +  +L  
Sbjct  199  ALVCMMPLDE-EAARTLGLPTSLGSLVAIAENGSLAGRLNAVLAIREVVSCDGAFTDLSG  257

Query  323  QISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLA-KQYRHKAVTAGAVEALIDRL  499
            ++   DEI + +  I+  P+   +A K G+ A++ L L  ++   +   AG V  L++ L
Sbjct  258  KV---DEIVDALAKIIKAPIC-PQATKAGMVAIYHLALYDERVAARLAAAGLVPVLVEAL  313

Query  500  QDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI  679
             D DK  +E+ALA ++ +     G A+  AHAL VP+LVK + ++S  AT+ A  A+  +
Sbjct  314  VDADKSMSEKALAVLDAVLASEEGRASARAHALAVPMLVKKMFRVSDLATQLAVSAMWRL  373

Query  680  Csaseqaqreaaa----------aGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
              A    + E  A           G   +LLLL+Q  C +  K KA  LLK+L
Sbjct  374  GKAHSDGEEEEDAVTRCLVEALRVGAFQKLLLLLQVGCRDATKEKATELLKML  426



>emb|CDX95337.1| BnaC04g28210D [Brassica napus]
Length=409

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 140/285 (49%), Gaps = 16/285 (6%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMD--SNSPELSHESLAILSMFPLPEA  178
            L+RLR +A E++ N+  + A    E L  I+ SN++   +S  L  E+L++L      E 
Sbjct  116  LKRLRQIASENNTNKRCLEAAEVPEFLANII-SNLNRFDSSRSLMDEALSLLYHLNASET  174

Query  179  --ESVIVSSDPVR-VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
              +S++ +      V  L  ++     + R  +  L++ +L      ++   I    E+F
Sbjct  175  ARKSLLNNKKGTNLVKTLTKIMQRGIYESRAYATLLLKKILEVADPMQI---ILLERELF  231

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGA----VEALIDRLQDFDKC  517
              +V IL+  +S+ +A K  ++ L   C   + RHKAV AGA    +E L+D     ++ 
Sbjct  232  TEVVQILHDQISH-KATKSAMQILMITCPWGRNRHKAVEAGAASMIIELLLDESFSSERR  290

Query  518  DAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq  697
            + E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLS+      
Sbjct  291  NVEMAMVVLDVLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITSERAVRVLLSVGRFCAT  350

Query  698  --aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
                +E    GV+ +L L++Q+ C  + K KA+ LLKL    W E
Sbjct  351  PCLLQEMLQLGVVAKLCLVLQASCGNKTKEKAKELLKLHARVWRE  395



>ref|XP_010516800.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Camelina sativa]
Length=416

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 141/293 (48%), Gaps = 30/293 (10%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILS------MFP  166
            L+RLR +  E+  N+  + A    E L     +N+ SN  E   +SL  L+      ++ 
Sbjct  121  LKRLRQIMSENATNKRCLEAAGVPEFL-----ANIVSNDSENGFQSLGSLTDESLNLLYH  175

Query  167  LPEAESVIVS-------SDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQ  325
            L  +E+V+ +       +D V+   L  ++     + R  +  L++++L      ++   
Sbjct  176  LETSETVLKNLLNNKKGNDIVK--SLTKIMQRGIYESRAYATLLLKNILEVADPMQI---  230

Query  326  ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  505
            ++   E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D
Sbjct  231  MTLKPEVFTEVVEILDDRIS-RKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMD  289

Query  506  ----FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALL  673
                 D+   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LL
Sbjct  290  ESFSSDRRGPEMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLL  349

Query  674  SICs--aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
            S+    A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  350  SVGKFCATPALLNEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  402



>ref|XP_010906325.1| PREDICTED: U-box domain-containing protein 21-like [Elaeis guineensis]
Length=441

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 135/276 (49%), Gaps = 12/276 (4%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLC----ILFSNMDSNSPELSHESLAILSM-FPLPE  175
            +++ L  ES++N   I++  A  VL      +   + D+++  +  E L+ L+  FPL E
Sbjct  146  KIKALGRESERNWRCIVSGGAGRVLSASFSELAAGSFDNSTSGVLEEILSALAACFPLDE  205

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
                 + S P  +  LV +L+   +  R+N+  +++ ++S   +  +   +++ D + E 
Sbjct  206  EAHWHIGS-PESLNSLVLILNCGDLAGRLNAVLMLKELVSSLDADRINV-VADTDGLIEA  263

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  535
            +V ++  P+S        V   +    ++    K V  G V  L++ L D DK   E+AL
Sbjct  264  LVKLIEKPISPQTTKASLVTTFYLASSSEMTAVKFVEMGLVSLLLEILVDSDKSMCEKAL  323

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq----  703
            A ++ +     G    + H+L VP+LVK + ++S  AT +A  AL  +C   EQ +    
Sbjct  324  AVLDGVLESKKGRETASDHSLAVPVLVKKMFRVSDMATGFAVSALWKLCKNYEQERGEGC  383

Query  704  -reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
              EA   G   +LLLL+Q  CT   K KA  LLKLL
Sbjct  384  LVEALQVGAFQKLLLLLQVGCTGTTKEKASELLKLL  419



>ref|XP_010509533.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Camelina sativa]
Length=416

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 141/293 (48%), Gaps = 30/293 (10%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILS------MFP  166
            L+RLR +  E+  N+  + A    E L     +N+ SN  E   +SL  L+      ++ 
Sbjct  121  LKRLRQIMSENATNKRCLEAAGVPEFL-----ANIVSNESENEFQSLGSLTDESLNLLYH  175

Query  167  LPEAESVIVS-------SDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQ  325
            L  +E+V+ +       +D V+   L  ++     + R  +  L++++L      ++   
Sbjct  176  LETSETVLKNLLNNKKGNDIVK--SLTKIMQRGIYESRAYATLLLKNILEVADPMQI---  230

Query  326  ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  505
            ++   E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D
Sbjct  231  MTLKPEVFTEVVEILDDRIS-RKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMD  289

Query  506  ----FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALL  673
                 D+   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LL
Sbjct  290  ESFSSDRRGPEMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLL  349

Query  674  SICs--aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
            S+    A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  350  SVGKFCATPALLNEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  402



>ref|XP_003611551.1| U-box domain-containing protein [Medicago truncatula]
Length=471

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 108/202 (53%), Gaps = 5/202 (2%)
 Frame = +2

Query  203  PVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL  382
            P ++  +V +L+  S++ ++N   LIE+++      + R++I ++  +  G++ ++    
Sbjct  233  PAKISLMVDILNEGSIETKINCTRLIETLI---EEKDFRSEIISSHSLLVGLMRLVK-DK  288

Query  383  SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRI  562
             +S  +  G+  L  +C  K+ +   V+ GAV  L++ L   D    E AL  ++ L  I
Sbjct  289  RHSNGICPGLSLLRTVCFYKEVKILLVSIGAVSQLVELLSGMDHDCLELALCVLDSLSSI  348

Query  563  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQL  739
            P G  A      T+P++V+++++IS   T+YA   L S+C  + +     A  AG+  +L
Sbjct  349  PEGRVALKECVNTIPIMVRLLMRISESCTQYALSILWSVCKLAPEECSSIAVDAGLAAKL  408

Query  740  LLLVQSDCTERAKRKAQMLLKL  805
            LL++QS C    K+++  LLKL
Sbjct  409  LLVIQSGCNPILKQQSAELLKL  430



>gb|AAD21464.1| unknown protein [Arabidopsis thaliana]
Length=406

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 141/285 (49%), Gaps = 19/285 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES  184
            L+RLR +  E+  N+  + A    E L  I+ SN DS +  L+ E+L +L  + L  +E+
Sbjct  116  LKRLRQIVSENATNKRCLEAAGVPEFLANIV-SN-DSENGSLTDEALNLL--YHLETSET  171

Query  185  VIVSSDPVR-----VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
            V+ +    +     V  L  ++     + R+ +  L++++L      +    ++   E+F
Sbjct  172  VLKNLLNNKKDNNIVKSLTKIMQRGMYESRVYATLLLKNILEVA---DPMQSMTLKPEVF  228

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FDKC  517
              +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D     ++ 
Sbjct  229  TEVVQILDDRIS-QKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFTSERR  287

Query  518  DAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--as  691
              E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+    A+
Sbjct  288  GPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCAT  347

Query  692  eqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
                 E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  348  PALLHEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  392



>ref|XP_009343248.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Pyrus x bretschneideri]
Length=406

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 141/294 (48%), Gaps = 13/294 (4%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPEL-SHESLAILSMFPLPE-A  178
            L  LR ++ +S+ N+  I A  A E L   + +N+ ++   + + E+L+IL    L E  
Sbjct  117  LSELRSISSQSEANKRSIEAAGAGEFLASTIINNIKNDRENVENEEALSILYNLNLSEDV  176

Query  179  ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE-IFEG  355
               ++  +   V  L+ L+   S + R  +  L+ S+     S     +++N     F  
Sbjct  177  LKTLIGKEGEFVEALIKLMQRGSDESRTYAVMLLRSMFEVADS----MRMTNVKPGFFVQ  232

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF--DKCDAER  529
            +V +LN  +S  +A K  ++ L  LC   + R KAV +GAV  LID L D   D+   E 
Sbjct  233  VVRVLNDQIS-QQASKATLQLLIQLCPWGRNRIKAVESGAVMVLIDLLLDTSSDRRTLEM  291

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq--  703
             L  +++LC    G A    H   + ++ K I+++S  A+E A   L  IC  S  +   
Sbjct  292  TLLVLDMLCGCAEGRAELLTHGAGLAVVSKKIMRVSKVASERAVKILFFICKFSATSNVL  351

Query  704  reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSY  865
            +E    G++ +L L++Q D   + K KA+ +LKL    W ++ T I  +   SY
Sbjct  352  QEMMQLGIVAKLCLVLQVDSGSKTKEKAREILKLHARTW-KNSTCIPSNLVSSY  404



>ref|XP_006380377.1| hypothetical protein POPTR_0007s04220g [Populus trichocarpa]
 gb|ERP58174.1| hypothetical protein POPTR_0007s04220g [Populus trichocarpa]
Length=397

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 135/248 (54%), Gaps = 8/248 (3%)
 Frame = +2

Query  101  SNMDSNSPELSHESLA-ILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAAL  277
            S +   S + + ++L+ +L +  L E E + +  +  ++     L    +  ++ +   +
Sbjct  149  SRLSEGSAKFAEQALSCVLRLLSLGEYECLNMLREESKLESFQFLFDQGTSKIKRSLCQI  208

Query  278  IESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHK  457
            IE++ S   + EL A++    ++ +G++ +++     S A   G+KA+ ALC  +  R  
Sbjct  209  IEAISSSLETRELCAKLGKNRKLLKGLILLVHQTYGASEA---GIKAISALCCLESNREN  265

Query  458  AVTAGAVEALIDRLQDFDKCD---AERALATVELLCRIPSGCAAFAAHALTVPLLVKIIL  628
             V  G +  L+  + D  + +   A +A+AT+ELL  + S   A       +  L+K++ 
Sbjct  266  MVQEGGINGLLTYIYDAQRHERNLAPKAMATIELLLGLESAKEALINDPNGIKALIKMVF  325

Query  629  KIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKL  805
            ++S H+ +E A  +L+ IC+ S QA+ EA  AGV+TQLLLL+QS C+ R K KA+MLLKL
Sbjct  326  RVSDHQGSESAIRSLMIICTDSLQAREEAIGAGVLTQLLLLLQSQCSGRTKTKARMLLKL  385

Query  806  LRDCWPED  829
            L   W E+
Sbjct  386  LGSKWDEE  393



>ref|NP_196716.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87715.1| putative protein [Arabidopsis thaliana]
 gb|AAO22790.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42420.1| unknown protein [Arabidopsis thaliana]
 gb|AED91694.1| uncharacterized protein AT5G11550 [Arabidopsis thaliana]
Length=314

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 84/160 (53%), Gaps = 10/160 (6%)
 Frame = +2

Query  362  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  535
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  145  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  204

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq----  703
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA  ++LS+            
Sbjct  205  AALELMCTTAEGAAEVRAHAMTVPAMVAVMARLAGRGREYAI-SILSVVYGKGGEGGDSG  263

Query  704  ---reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  814
                 A A  V   + L ++ +CT R KRK   LLK L +
Sbjct  264  EEIAVAPAEEVARAVALALEGECTARGKRKGAQLLKTLEE  303



>ref|XP_009801169.1| PREDICTED: uncharacterized protein LOC104246952 [Nicotiana sylvestris]
Length=352

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 96/165 (58%), Gaps = 6/165 (4%)
 Frame = +2

Query  326  ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  505
            ++  + + +G+VG L    +  +  K   K L ALCL++  RH AV AGAV  +++ L D
Sbjct  166  VTCPETVMKGVVGCL----TDRKISKSASKVLLALCLSENNRHVAVEAGAVGVVVEVLSD  221

Query  506  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSIC  682
             +   AER+LA +ELLC +  G     +HAL VP++V+++ ++  +R  EYA G L  I 
Sbjct  222  LEVAAAERSLAALELLCTVAEGAEEVRSHALAVPMMVEVMGRLEGNRGKEYAIGVLTVIY  281

Query  683  sas-eqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  814
              + + A   A A  V   ++L +QSDC+ R +RK   LLK+L++
Sbjct  282  GGACDGAPVTAPAEEVARAVMLALQSDCSARGRRKGAQLLKILQN  326



>ref|NP_181137.2| E3 ubiquitin-protein ligase PUB23 [Arabidopsis thaliana]
 sp|Q84TG3.1|PUB23_ARATH RecName: Full=E3 ubiquitin-protein ligase PUB23; AltName: Full=Plant 
U-box protein 23; AltName: Full=U-box domain-containing 
protein 23 [Arabidopsis thaliana]
 gb|AAO64764.1| At2g35930 [Arabidopsis thaliana]
 dbj|BAE99354.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09178.1| E3 ubiquitin-protein ligase PUB23 [Arabidopsis thaliana]
Length=411

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 141/285 (49%), Gaps = 19/285 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES  184
            L+RLR +  E+  N+  + A    E L  I+ SN DS +  L+ E+L +L  + L  +E+
Sbjct  121  LKRLRQIVSENATNKRCLEAAGVPEFLANIV-SN-DSENGSLTDEALNLL--YHLETSET  176

Query  185  VIVSSDPVR-----VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
            V+ +    +     V  L  ++     + R+ +  L++++L      +    ++   E+F
Sbjct  177  VLKNLLNNKKDNNIVKSLTKIMQRGMYESRVYATLLLKNILEVA---DPMQSMTLKPEVF  233

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FDKC  517
              +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D     ++ 
Sbjct  234  TEVVQILDDRIS-QKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFTSERR  292

Query  518  DAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--as  691
              E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+    A+
Sbjct  293  GPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCAT  352

Query  692  eqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
                 E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  353  PALLHEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  397



>ref|XP_010456493.1| PREDICTED: uncharacterized protein LOC104737947, partial [Camelina 
sativa]
Length=269

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 80/158 (51%), Gaps = 7/158 (4%)
 Frame = +2

Query  362  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  535
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  101  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  160

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  715
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA   L  +         E  
Sbjct  161  AALELMCTTKEGAAEVRAHAMTVPAMVAVMARLAGRGREYAISILSVVYGKGGDDSGEEI  220

Query  716  aaGVMTQL-----LLLVQSDCTERAKRKAQMLLKLLRD  814
            A     ++     L L   +CT R +RK   LLK L +
Sbjct  221  AVAPAEEVARAVALALEGGECTARGRRKGTQLLKTLEE  258



>ref|XP_008357389.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 
[Malus domestica]
Length=305

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 124/248 (50%), Gaps = 24/248 (10%)
 Frame = +2

Query  83   LLCILFSNMDSNSPELSHESLAILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRM  262
            LL  L S  DS + E  H   A+L++    + +  I+SS  V    +V +L+N  ++ R 
Sbjct  52   LLVGLLSTPDSRTQE--HAVTALLNLSLCEDNKGSIISSGAVP--GIVHVLTNGGMEARE  107

Query  263  NSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY--SRALKIGVK----ALF  424
            N+AA++ S+            I + +++  G  G +  PL    S   + G K    ALF
Sbjct  108  NAAAILFSL-----------SIVDENKVMIGASGAI-PPLVTLLSEGTQGGKKDAAIALF  155

Query  425  ALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTV  604
             LC+    + KAV AG V  L+  L +      +  LA + +L   P G AA  A A  V
Sbjct  156  NLCIYHGNKGKAVRAGVVSTLMKLLTEPGGGMVDEGLAILAILSSHPEGKAAIGA-AEAV  214

Query  605  PLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRK  784
            P+LV++I   S R  E AA  L+++CS  +Q   EA   GV + LL L Q + T+R KRK
Sbjct  215  PVLVEVIGTGSLRNRENAAAVLVNLCSGDQQRIVEAQELGVTSSLLELAQ-NGTDRGKRK  273

Query  785  AQMLLKLL  808
            A  LL+L+
Sbjct  274  AAQLLELM  281



>ref|XP_002298264.1| hypothetical protein POPTR_0001s22370g [Populus trichocarpa]
 gb|EEE83069.1| hypothetical protein POPTR_0001s22370g [Populus trichocarpa]
Length=415

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 85/279 (30%), Positives = 137/279 (49%), Gaps = 20/279 (7%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLLCILFSN--------MDSNSPEL---SHESLAILSMFPLPEA  178
            ES++NRS +      + L  IL ++         D N  E    S E+L IL    + + 
Sbjct  124  ESERNRSCLEEAGVVDFLASILKTDNSTSVQIDSDDNESEFTRASDEALNILYHLKISQR  183

Query  179  E--SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  352
            +  ++I++     +  L+ +L + S   R  +  L++SV        L   IS   E+F 
Sbjct  184  QLKNLIINDSDRFLESLLQILKHSSYQSRAYATMLLKSVFEVADPTHL---ISIRPEMFV  240

Query  353  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF-DKCDAER  529
             IV +L+  +S  +A K  +K L  +C   + R KAV  GAV  LI+ L D  DK   E 
Sbjct  241  EIVRVLDDQIS-QQASKAALKLLVEICPWGRNRIKAVEGGAVSVLIELLLDTSDKRACEL  299

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC--saseqaq  703
             LA +ELLC    G A    H   + ++ K IL++SH A++ A   L SIC  SA+ +  
Sbjct  300  ILAVLELLCGCADGRAELLKHGAGLAVVSKKILRVSHVASDKAVRILCSICRFSATSRVL  359

Query  704  reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            +E    G + +L L++Q D + ++K +A+ +LK+    W
Sbjct  360  QEMLQVGAVAKLCLILQVDSSLKSKERAREILKVHSKVW  398



>ref|XP_010925800.1| PREDICTED: U-box domain-containing protein 21-like [Elaeis guineensis]
Length=445

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 70/283 (25%), Positives = 138/283 (49%), Gaps = 22/283 (8%)
 Frame = +2

Query  11   RLRGLACESDKNR--------SVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFP  166
            +++ L  ES++NR          IL+N+ RE+      S ++S +  +     A++ +FP
Sbjct  146  KIKALGMESERNRLCIASCGSGRILSNSFRELARG---STVNSTTGVMEEILSAVVGLFP  202

Query  167  LPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  346
            L ++E+      P  +  +VS+L    +  ++N+  +++ +++   + ++   ++  D +
Sbjct  203  L-DSEAHRHIGAPESLEAIVSILKTGDLGGKLNAVLVLKELVASVDAEQINV-VAETDGL  260

Query  347  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE  526
             E +V ++  P+S        V   + +  +++   + V  G V  L++ L D++K   E
Sbjct  261  IEALVKLVEKPISPQTTKASLVATFYLVSSSERTAERFVEMGLVSLLLEILVDWEKSMYE  320

Query  527  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr  706
            +AL  ++ +     G      H+LTVP+LVK + ++S  AT +A  AL  +C   ++   
Sbjct  321  KALGVLDGVLDYKRGREMAYDHSLTVPVLVKKMFRVSDMATGFAVSALWKLCMNYKKEGG  380

Query  707  eaaaaGVMTQ---------LLLLVQSDCTERAKRKAQMLLKLL  808
            + A  G + +         LLLL+Q  C    K KA  LLKLL
Sbjct  381  DRAGEGFLVEALEVGAFQKLLLLLQVGCNGTTKEKASELLKLL  423



>ref|XP_008230336.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Prunus mume]
Length=408

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 86/279 (31%), Positives = 137/279 (49%), Gaps = 12/279 (4%)
 Frame = +2

Query  5    LRRLRGLA-CESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEA-  178
            LRRLR +A  +S++N+S + A  A E +  I+ +   S+ P +   ++ +L +    EA 
Sbjct  116  LRRLRSIAITQSERNKSCLEAAGAVEYVASII-NKAPSDDPSIIEVAVEVLFLLKGSEAG  174

Query  179  --ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  352
              + +    D   V  LV  L   +   R ++  L++SV       +L   +S   E F 
Sbjct  175  LKDLISNDGDNNIVESLVKALKFKNFQSRAHAIILLKSVFKVADPIQL---MSVKVECFH  231

Query  353  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL-QDFDKCDAER  529
             IV +L+  +S  +A K  +K L  LC   + R KAV  GAV  LI+ L +  +K  +E 
Sbjct  232  EIVHVLDDRIS-QQASKAALKLLVELCPWGRNRIKAVEGGAVAVLIEALLETHEKRASEL  290

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq--aq  703
             L  ++ LC    G A    H   + ++ K IL++SH A++ A   L SIC  S      
Sbjct  291  ILILLDQLCGCAEGRAELLKHGAGLAIVSKKILRVSHVASDRAVRILSSICRFSATCGVL  350

Query  704  reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            +E    GV+ +L L++Q DC  + K KA+ +LKL    W
Sbjct  351  QEMLQVGVVAKLCLVLQVDCRFKTKEKAREVLKLHSRVW  389



>ref|XP_008357382.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 
[Malus domestica]
Length=307

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 124/248 (50%), Gaps = 24/248 (10%)
 Frame = +2

Query  83   LLCILFSNMDSNSPELSHESLAILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRM  262
            LL  L S  DS + E  H   A+L++    + +  I+SS  V    +V +L+N  ++ R 
Sbjct  54   LLVGLLSTPDSRTQE--HAVTALLNLSLCEDNKGSIISSGAVP--GIVHVLTNGGMEARE  109

Query  263  NSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY--SRALKIGVK----ALF  424
            N+AA++ S+            I + +++  G  G +  PL    S   + G K    ALF
Sbjct  110  NAAAILFSL-----------SIVDENKVMIGASGAI-PPLVTLLSEGTQGGKKDAAIALF  157

Query  425  ALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTV  604
             LC+    + KAV AG V  L+  L +      +  LA + +L   P G AA  A A  V
Sbjct  158  NLCIYHGNKGKAVRAGVVSTLMKLLTEPGGGMVDEGLAILAILSSHPEGKAAIGA-AEAV  216

Query  605  PLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRK  784
            P+LV++I   S R  E AA  L+++CS  +Q   EA   GV + LL L Q + T+R KRK
Sbjct  217  PVLVEVIGTGSLRNRENAAAVLVNLCSGDQQRIVEAQELGVTSSLLELAQ-NGTDRGKRK  275

Query  785  AQMLLKLL  808
            A  LL+L+
Sbjct  276  AAQLLELM  283



>ref|XP_004228696.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Solanum lycopersicum]
Length=409

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 87/300 (29%), Positives = 145/300 (48%), Gaps = 18/300 (6%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPE------LSHESLAILSMF  163
            +L+ LR +A E+D N+  + +  A E L  I+ +N +    E      +  E+L+IL   
Sbjct  114  SLKTLRSIAFENDANKRCMESAGAMEFLASIINNNSNEVFEEEEGFMSIKDEALSILYQL  173

Query  164  PLPEA--ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLS-GTRSPELRAQISN  334
             L E    S+I+S +   +  L  ++ + S + R  +  L++ +    T +P L    S 
Sbjct  174  KLSENGLRSLIMSGNGGFIESLTRVMQHGSYESRAYAIMLMKDMFEVSTPTPLL----SL  229

Query  335  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD-FD  511
              E F  +V +L   +S  +A+K  ++ L   C   + R KA  AGAV  L+D L D  +
Sbjct  230  KKEFFIQVVQVLRDEIS-QKAMKASLQVLVNACPFGRNRVKAAEAGAVRVLVDLLLDSSE  288

Query  512  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas  691
            K   E  L  ++ LC+   G A    H   + ++ K IL++S   +E A   L SI   S
Sbjct  289  KRVCELMLILLDQLCQSAEGRAELLNHPGGLAIVSKKILRVSKVGSERAIKILHSISKFS  348

Query  692  eq--aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSY  865
                  +E  + GV+T+L L++Q DC  +AK +A+ +LK     W  +   IS++   SY
Sbjct  349  STPSVVQEMLSLGVVTKLCLVLQVDCGSKAKERAREILKFHAKAW-RNSPCISNNLLSSY  407



>ref|XP_008381777.1| PREDICTED: U-box domain-containing protein 21-like [Malus domestica]
Length=442

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 81/285 (28%), Positives = 138/285 (48%), Gaps = 25/285 (9%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILS--------MFP  166
            +++ LA ES++N+  I+A     VL    FS + SNS    H+++A+L         +FP
Sbjct  142  KIKALAKESERNKRCIVATGTGSVLAGA-FSAL-SNSQH--HQNVAVLEEILSALTLVFP  197

Query  167  LPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSA-ALIESVLSGTRSPELRAQISNADE  343
            L + E+ +    P  +  +V  L +  +  R N+A  L E+ +S     +    ++  + 
Sbjct  198  L-DGEASLYLGSPASLRCMVWFLESGDLSQRRNAALVLKETAVSSDHDHQKTDALAEIEG  256

Query  344  IFEGIVGILNCPLSYSRALKIGVKALFALC-----LAKQ-YRHKAVTAGAVEALIDRLQD  505
              E +V ++  P+  + + K  +  ++ +      L+K+  + + V    V  L D L D
Sbjct  257  ALEALVKLIKEPVCAT-STKASLVIIYQMVNSSSSLSKEKIKERFVEMELVSLLSDFLVD  315

Query  506  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs  685
             ++   ERAL  ++ LC    G      HALT+P++VK IL++S  ATE++   L  +C 
Sbjct  316  AERSICERALGVLDRLCGSKQGREKAYLHALTMPVVVKKILRVSDLATEFSVSILWKLCK  375

Query  686  aseqa----qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
               +       E+   G   +LLLL+Q  C ER K KA  LLK L
Sbjct  376  NETREDGGVVVESLQVGAFQKLLLLLQVGCAERTKEKATDLLKAL  420



>ref|XP_006289615.1| hypothetical protein CARUB_v10003173mg [Capsella rubella]
 gb|EOA22513.1| hypothetical protein CARUB_v10003173mg [Capsella rubella]
Length=313

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 84/160 (53%), Gaps = 10/160 (6%)
 Frame = +2

Query  362  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  535
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  144  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  203

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq----  703
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA  ++LS+            
Sbjct  204  AALELMCTTTEGAAEVRAHAMTVPAMVAVMARLAGRGREYAI-SILSVVYGKGGGGGGGG  262

Query  704  ---reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  814
                 A A  V   + L ++ +CT R +RK   LLK L +
Sbjct  263  EEIAVAPAEEVARAVALALEGECTARGRRKGAQLLKTLEE  302



>ref|XP_007047579.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91736.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=451

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 65/233 (28%), Positives = 120/233 (52%), Gaps = 10/233 (4%)
 Frame = +2

Query  122  PELSH----ESLAILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESV  289
            P  SH    E++ IL    L ++ES      P ++  +V +L+  SV+ ++N   L++ +
Sbjct  203  PFTSHAVGSEAIGILVNLEL-DSESNTNLMQPTKISLMVDMLNEGSVETKINCTRLMDKL  261

Query  290  LSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTA  469
            +      E R++  ++  +  G++ ++     +S  +  G+  L ++CL KQ R   V+ 
Sbjct  262  M---EEKEFRSESISSHRLLVGVMRLVK-DKRHSNGILPGLSFLRSICLLKQVRSLIVSI  317

Query  470  GAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRAT  649
            GAV  L++ L   +    E AL  ++ L  +P G  A    A T+P  V++++++S   T
Sbjct  318  GAVSQLVELLPSLEPDCLELALFILDTLSSLPEGKVALKDCANTIPNTVRLLMRVSESCT  377

Query  650  EYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKL  805
            +YA   L S+C  + +     A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  378  QYALSILWSVCKLAPEECSSVAVEAGLAAKLLLVIQSGCNPVLKQRSAELLKL  430



>gb|AFW73318.1| immediate-early fungal elicitor protein CMPG1 [Zea mays]
Length=477

 Score = 79.0 bits (193),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 126/274 (46%), Gaps = 9/274 (3%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCILFSNMD---SNSPELSHESLAILSMFPLPEAE  181
            + R L  ESD+NR  + A  A   L       +D   S    L      ++  FPL E  
Sbjct  182  KARALGKESDRNRRCLAAGGAARALSSAFLRLVDQPASFGGALGEILATLVVFFPLDEEC  241

Query  182  SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALI--ESVLSGTRSPELRAQISNADEIFEG  355
               ++S P  +  +VS+LS+       +SAA++  E   S    PE    +S  + + + 
Sbjct  242  RSHIAS-PASLDAIVSILSHDGEATSKSSAAVVLREIASSSDSDPECLDALSETNGVHDA  300

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  535
            ++ +L  P+S        V A + +  +     + V  G VE L++ L D DK   E+AL
Sbjct  301  LIKLLQKPVSAQATKAALVTAYYLVRGSDLAARRLVDLGMVELLVEMLVDADKGTTEKAL  360

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa---qr  706
            A ++ L     G     AHAL VP+LVK +  +S  ATE+A  AL  +C +       + 
Sbjct  361  AVLDSLLLTEEGRGKACAHALAVPVLVKKMQHVSEMATEFAVSALWRLCKSFSGEGPCKA  420

Query  707  eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
            EA   G   +LLLL+Q  C    K +A  LL+LL
Sbjct  421  EALQLGAFQKLLLLLQVGCMGVTKERASELLRLL  454



>ref|XP_009803459.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nicotiana 
sylvestris]
Length=407

 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 83/281 (30%), Positives = 134/281 (48%), Gaps = 13/281 (5%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNM-----DSNSPELSHESLAIL-SMFP  166
            LRRLR +A  ++ N+  + +      L  ++         DS   + S E+L IL  + P
Sbjct  115  LRRLRSIAHANESNKKCLESAGVVAFLASVIKKREVALVEDSEFTKASDEALNILFHLNP  174

Query  167  LPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  346
              E     +S D   +  L+  L   +   R  +  L++S  +     +L   I    E 
Sbjct  175  SDEELKRFISQDEQFLDSLLHFLKCGNFQSRAYAIMLLKSAFNVADPAQL---IGIKPEY  231

Query  347  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF-DKCDA  523
            F+ IVGILN  +S  +A K  +K L  LC   + R KA   GAV ALI+ L D  ++   
Sbjct  232  FKAIVGILNDKIS-EQATKAALKILVELCPWGRNRIKAAENGAVLALIELLLDTKERRGC  290

Query  524  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  703
            E  LA ++ LC    G A   +H   + ++ K IL++SH A++ A   L SI   S  ++
Sbjct  291  ELILAVLDHLCSCAEGRAELLSHGAGIAIVSKKILRVSHVASDRAVRILCSISKFSATSK  350

Query  704  --reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
              +E    GV+++L L++Q D + + K K + +L+L    W
Sbjct  351  VLQEMLQVGVVSKLCLVLQVDTSPKTKEKTKEILRLHSRVW  391



>ref|XP_010491888.1| PREDICTED: uncharacterized protein LOC104769387 [Camelina sativa]
Length=313

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 80/160 (50%), Gaps = 10/160 (6%)
 Frame = +2

Query  362  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  535
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  144  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  203

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  715
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA  ++LS+            
Sbjct  204  AALELMCTTKEGAAEVRAHAMTVPAMVAVMARLAGRGREYAI-SILSVVYGKGGGDDSGE  262

Query  716  aaGVMTQ-------LLLLVQSDCTERAKRKAQMLLKLLRD  814
               V           L L   +CT R +RK   LLK L +
Sbjct  263  EIAVAPAEEVARAVALALEGGECTARGRRKGTQLLKTLEE  302



>ref|XP_002465578.1| hypothetical protein SORBIDRAFT_01g041450 [Sorghum bicolor]
 gb|EER92576.1| hypothetical protein SORBIDRAFT_01g041450 [Sorghum bicolor]
Length=454

 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 119/233 (51%), Gaps = 17/233 (7%)
 Frame = +2

Query  146  AILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRS-PELRA  322
            A++ M PL E E+      P  +G LV++  N ++  R+N+   I+ V+S   +  +L  
Sbjct  204  ALVCMMPLDE-EAARTLGLPSSLGSLVAIAENGTLAGRLNAVLAIKEVVSCDGAFTDLSG  262

Query  323  QISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLA-KQYRHKAVTAGAVEALIDRL  499
            ++   DEI + +  I+  P+   +A K G+ A + L L  ++   +   AG V  LI+ L
Sbjct  263  KV---DEIVDALAKIIKSPIC-PQATKAGMVATYHLALYDERVAARLAAAGLVPVLIEAL  318

Query  500  QDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI  679
             D DK  +E+ALA ++ +     G A+  AHAL VP+LVK + ++S  AT+ A  A+  +
Sbjct  319  VDADKSMSEKALAVLDAVLASEEGRASARAHALAVPMLVKKMFRVSDLATQLAVSAMWRL  378

Query  680  Csaseqaqreaaa----------aGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
              A    + E  A           G   +LLLL+Q  C +  K KA  LLKLL
Sbjct  379  GKAHSDGEEEENAVTRCLVEALRVGAFQKLLLLLQVGCRDATKEKATELLKLL  431



>ref|XP_006364055.1| PREDICTED: U-box domain-containing protein 21-like [Solanum tuberosum]
Length=451

 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 137/277 (49%), Gaps = 14/277 (5%)
 Frame = +2

Query  11   RLRGLACESDKNRSVILANNAREVLLCILFS-NMDSNSPELSHES--LAILSMF-PLP-E  175
            R++ LA ESD+N+   + N   +VL       +   N+   S E   L+ L++F PL  +
Sbjct  156  RVKNLASESDRNKCCFITNGIGKVLSSAFLELSKGKNAKNASTEEVILSTLTLFLPLDVK  215

Query  176  AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
            +++++ S   +R   +   L N S+  R N+  ++  ++      ++   + N +   EG
Sbjct  216  SKTILGSISSLRC--IAWFLKNGSLSSRRNAVLVLREIMKLEEKEKVEILL-NIEGALEG  272

Query  356  IVGILNCPL--SYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAER  529
            +V ++  P+  + ++A  + +  +     ++  R + V  G VE LI+ L D DK   E+
Sbjct  273  LVKLVKEPICPNTTKASLLTIYHMVNNSSSQSSRSRFVDVGLVELLIEILVDCDKSICEK  332

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq----  697
            AL  ++ +     G      +AL+VP+LVK +L++S  ATE++   L  IC         
Sbjct  333  ALGVLDGILSYEEGVKRAYNYALSVPVLVKKLLRVSDLATEFSVSILWKICKNENNGDCG  392

Query  698  aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
               EA   G   +LLL++Q  C+E  K KA  LLKLL
Sbjct  393  VLVEALQVGAFQKLLLMLQVGCSEITKEKASELLKLL  429



>ref|XP_002991626.1| hypothetical protein SELMODRAFT_133879 [Selaginella moellendorffii]
 gb|EFJ07380.1| hypothetical protein SELMODRAFT_133879 [Selaginella moellendorffii]
Length=407

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 121/238 (51%), Gaps = 19/238 (8%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSN--MDSNSP------ELSHESLAILS  157
            AL +L+  A ES KN   I+   A  VL  +L +    D+  P      +   E++AIL+
Sbjct  116  ALSKLKSKARESTKNSRAIVDAGAVTVLSGVLSAPYPQDARDPPDKAWLQPIEEAIAILA  175

Query  158  MFPLP-EAESVIVSSDPVR-VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQIS  331
              P    +   ++S  P+R + +++ + S P +   M++ A+++ + S   +   +  I 
Sbjct  176  YLPASYNSRRALISPKPLRSISWILCMGSPPGM---MSAIAVLDGLASDKGA---QIAIG  229

Query  332  NADEIFEGIVGILNCPLSYSRAL-KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF  508
            +   + +G+V IL    + ++ L    ++AL  +CL  + R +A   GAV AL++ L D 
Sbjct  230  STAGVIDGLVAILR--RNGNQVLVNSSLRALLGICLPLRNRARAARTGAVAALVELLPDT  287

Query  509  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC  682
                AE  L  +ELLC    G AA   HAL +P +VK IL++S  AT  A G L ++C
Sbjct  288  SGGVAEHILIVLELLCGCAEGRAAIDDHALAIPAIVKKILRVSDSATANAVGILWAVC  345



>ref|XP_009593988.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nicotiana 
tomentosiformis]
Length=407

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 83/281 (30%), Positives = 134/281 (48%), Gaps = 13/281 (5%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNM-----DSNSPELSHESLAIL-SMFP  166
            LRRLR +A  ++ N+  + +  A + L  ++         DS   + S E+L IL  + P
Sbjct  115  LRRLRSIAHANESNKKCLESAGAVDFLASMIKKREVALVEDSEFTKASDEALNILFHLNP  174

Query  167  LPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  346
              E      S D   +  L+  L   +   R  +  L++S  +     +L   I    E 
Sbjct  175  SDEELKRFTSQDEQFLDSLLHFLKCGNFQSRAYAIMLLKSAFNVADPAQL---IGMKPEY  231

Query  347  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF-DKCDA  523
            F+ IVGILN  +S  +A K  +K L  LC   + R KA   GAV ALI+ L D  ++   
Sbjct  232  FKAIVGILNDKIS-QQATKAALKILVELCPWGRNRIKATENGAVLALIELLLDTKERRGC  290

Query  524  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  703
            E  L+ ++ LC    G A   +H   + ++ K IL++SH A++ A   L SI   S  ++
Sbjct  291  ELILSILDHLCSCAEGRAELLSHGAGIAIVSKKILRVSHVASDKAVRILCSISKFSATSK  350

Query  704  --reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
              +E    GV+++L L++Q D + + K K + +L L    W
Sbjct  351  VLQEMLQVGVVSKLCLVLQVDTSPKTKEKTKEILSLHSRVW  391



>ref|XP_006399662.1| hypothetical protein EUTSA_v10014169mg [Eutrema salsugineum]
 gb|ESQ41115.1| hypothetical protein EUTSA_v10014169mg [Eutrema salsugineum]
Length=311

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 74/141 (52%), Gaps = 3/141 (2%)
 Frame = +2

Query  401  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  580
            K   K L ALCLA+  RH AV AGA  A+++     +    ERALA +EL+C    G A 
Sbjct  160  KYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERALAALELMCTTAEGAAE  219

Query  581  FAAHALTVPLLVKIILKISHRATEYAAGALLSI---CsaseqaqreaaaaGVMTQLLLLV  751
              AHA+TVP +V ++ +++ R  EYA   L  +      S +    A A  V   + L +
Sbjct  220  VRAHAMTVPAMVAVMARLAGRGREYAISILTVVYGRGGVSGEEIAVAPAEEVARAVSLAL  279

Query  752  QSDCTERAKRKAQMLLKLLRD  814
            + +CT R +RK   LLK L +
Sbjct  280  EGECTARGRRKGAHLLKTLEE  300



>ref|XP_008237598.1| PREDICTED: U-box domain-containing protein 30 [Prunus mume]
Length=449

 Score = 78.2 bits (191),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 65/233 (28%), Positives = 122/233 (52%), Gaps = 10/233 (4%)
 Frame = +2

Query  122  PELSH----ESLAILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESV  289
            P  SH    E +AIL    L ++ES      P ++  +V +L+  S++ ++N   LI+ +
Sbjct  201  PFTSHVVGSEVIAILVNLTL-DSESRTSLMQPAKISLMVDILNEGSIETKINCTRLIKML  259

Query  290  LSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTA  469
            +      + R++I ++  +  G++ ++     ++  +  G+  L  +CL K+ R   V+ 
Sbjct  260  M---EEKDFRSEIISSHSLLVGLMRLVK-DKRHTAGILPGLSLLRTICLHKEVRGFMVSI  315

Query  470  GAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRAT  649
            GAV  L+D L   D    E AL  ++ L  +P G +A    + T+P +V+++++IS   T
Sbjct  316  GAVPQLVDCLPSLDHECLELALFILDALSSLPEGISALKDCSNTIPNMVRLLMRISESCT  375

Query  650  EYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKL  805
            ++A   L S+C  + +     A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  376  QFALSILWSVCKHAPEECSSIALDAGLAAKLLLVIQSGCGPVLKQQSAELLKL  428



>ref|XP_009136678.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Brassica rapa]
Length=423

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 80/298 (27%), Positives = 142/298 (48%), Gaps = 28/298 (9%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSN---------------SPELSHE  139
            L+RLR +  E+  N+  + A    E L  I+ +++D++               S  L  E
Sbjct  116  LKRLRQIVSENPTNKRCLEAAGVPEFLANIVSNSVDTSNDLCQSNMLENRFDSSRSLMDE  175

Query  140  SLAILSMFPLPEA--ESVIVSSDPVR-VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSP  310
            +L+IL      E   +S++ +      V  L  ++   + + R  +A L++ +L      
Sbjct  176  ALSILYHLDTSEEARKSLLNNKKGTNLVMTLTKIMQRGNYESRAYAAFLLKKILEVADPM  235

Query  311  ELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALI  490
            ++   I    E+F  +V IL+  +S+ +A    ++ L  +C   + RHKAV AGAV  +I
Sbjct  236  QI---ILLERELFNEVVQILSDQISH-KATTSAMQILVIICPWGRNRHKAVAAGAVSMII  291

Query  491  DRLQD----FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYA  658
            + L D     ++ ++E A+  +++LC+   G A F  H   + ++ K IL++S   +E A
Sbjct  292  ELLMDETFSSERRNSEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITSERA  351

Query  659  AGALLSICsaseq--aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
               LLSI          +E    GV+ ++ L++Q  C  + K KA+ LLKL    W E
Sbjct  352  VRVLLSIGRFCATPCLLQEMLQLGVVAKMCLVLQVSCGNKTKEKAKELLKLHARVWRE  409



>ref|XP_006348454.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Solanum tuberosum]
Length=406

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 84/301 (28%), Positives = 145/301 (48%), Gaps = 16/301 (5%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPE----LSHESLAILSMFPL  169
            +L+RLR +A E+D N+  + +  A E L  I+ ++ +    E       E+L+IL    L
Sbjct  113  SLKRLRSIASENDANKRCMESAGATEFLAFIINNSNEVFEEEGFMSTKDEALSILYQLKL  172

Query  170  PEA--ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADE  343
             E    S+I+S +   +  L  ++ + S + R  +  L++ +     +P L   +S   E
Sbjct  173  SEQGLRSLIISGNGEFIESLTRVMQHGSYESRAYAVMLMKDMFE-VSTPNLL--LSLKQE  229

Query  344  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD-FDKCD  520
             F  +V +L   +S  +A K  ++ L   C   + + KA  AGA+  L+D L D  +K  
Sbjct  230  FFIQVVQVLRDEIS-QKATKASLQVLVNTCPFGRNKVKAAEAGAIRVLVDLLLDSSEKRS  288

Query  521  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq-  697
             E  L  ++ LC+   G A    H   + ++ K IL++S   +E A   L SI   S   
Sbjct  289  CELMLILLDQLCQSAEGRAELLNHPGGLAIVSKKILRVSKVGSERAIKILHSISKFSSTP  348

Query  698  -aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTAISDDYNCSYVVP  874
               +E  + GV+ +L L++Q DC  +AK +A+ +LK     W  +   I ++ + SY  P
Sbjct  349  SVIQEMLSLGVVAKLCLVLQVDCGSKAKERAKEILKFHAKAW-TNSPCIPNNLSSSY--P  405

Query  875  F  877
            F
Sbjct  406  F  406



>ref|XP_006847707.1| hypothetical protein AMTR_s00149p00072640 [Amborella trichopoda]
 gb|ERN09288.1| hypothetical protein AMTR_s00149p00072640 [Amborella trichopoda]
Length=418

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 75/282 (27%), Positives = 144/282 (51%), Gaps = 12/282 (4%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVL----LCILFSNMDSN-SPELSHESLAILSMFP  166
            AL++ R +   S +N+S+++     EVL    L +L  N D+  S     E+L+IL++ P
Sbjct  116  ALKKTRSVVEFSPENQSLLIEAGGIEVLSNILLQVLLDNPDNFLSFRACEEALSILNLLP  175

Query  167  LPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD-E  343
              +  S+ + + P  V  L  ++ + + + R+++  ++  +       +L A  S+ D +
Sbjct  176  FTDHRSIAILTKPDSVRSLAVMIQSGAAESRLHALLILRKI--AKNGCDLGAIFSDHDLD  233

Query  344  IFEGIVGILNCPLSYSRALKIGVKALFAL-CLAKQYRHKAVTAGAVEALIDRLQDFDKCD  520
            I + ++ IL+  +  + A+   ++ L  L  ++++ R KA+ AGAV  +I+ L D ++  
Sbjct  234  ILKALLEILSDGID-NHAMNASLEVLMELIVVSRKNRLKAIEAGAVCLIIELLPDSNRPR  292

Query  521  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  700
             E+ L  ++LLC I  G +A A HA+ + ++ K I+++S  AT+     L  ICS     
Sbjct  293  CEKMLMVLKLLCEISEGRSALADHAMGIAVISKKIVRVSDMATKLGVKILWLICSFYPTQ  352

Query  701  qre--aaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            +        G +++L  L+Q+      K KA  +LKL    W
Sbjct  353  KILDDLLHFGSVSKLCGLMQAYGNSSTKEKALKILKLHGKSW  394



>ref|XP_010453204.1| PREDICTED: uncharacterized protein LOC104735168 [Camelina sativa]
Length=309

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 80/158 (51%), Gaps = 7/158 (4%)
 Frame = +2

Query  362  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  535
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  141  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  200

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  715
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA   L  +         E  
Sbjct  201  AALELMCTTKEGAAEVRAHAMTVPAMVAVMARLAGRGREYAISILSVVYGKGGDDSGEEI  260

Query  716  aaGVMTQL-----LLLVQSDCTERAKRKAQMLLKLLRD  814
            A     ++     L L   +CT R +RK   LLK L +
Sbjct  261  AVAPAEEVARAVALALEGGECTARGRRKGTQLLKTLEE  298



>ref|XP_010419728.1| PREDICTED: uncharacterized protein LOC104705421 [Camelina sativa]
Length=312

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 80/158 (51%), Gaps = 7/158 (4%)
 Frame = +2

Query  362  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  535
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  144  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  203

Query  536  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  715
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA   L  +         E  
Sbjct  204  AALELMCTTKEGAAEVRAHAMTVPAMVAVMARLAGRGREYAISILSVVYGKGGDDSGEEI  263

Query  716  aaGVMTQL-----LLLVQSDCTERAKRKAQMLLKLLRD  814
            A     ++     L L   +CT R +RK   LLK L +
Sbjct  264  AVAPAEEVARAVALALEGGECTARGRRKGTQLLKTLEE  301



>emb|CDX84168.1| BnaC04g09300D [Brassica napus]
Length=406

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 79/283 (28%), Positives = 139/283 (49%), Gaps = 15/283 (5%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEA--  178
            L+RLR +  E+  N+  + A    E L  ++ SN DS S  L+ E+L++L      E   
Sbjct  116  LKRLRHIVSENASNKRCLEAAGVPEFLATVV-SNKDS-SMILTDEALSLLYHLDTSETGL  173

Query  179  ESVIVSSDPVR-VGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEG  355
            ++++ S      V  L+ ++     + R  +  L++++L      ++   ++    +F  
Sbjct  174  KNLLNSKKGNDIVNSLMKIMQRGIYESRAYATFLLKNILEVADPMQI---MTLKPAVFTE  230

Query  356  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FDKCDA  523
            +V IL+  +S+ +A K  +  L  +C   + RHKAV AG +  +I+ L D     D+   
Sbjct  231  VVQILDDRISH-KATKSALHILVNVCPWGRNRHKAVEAGVISMIIELLMDESFSSDRRGP  289

Query  524  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--aseq  697
            E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   L S+    A+  
Sbjct  290  EMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLFSVGRFCATPA  349

Query  698  aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
               E    GV+ +L L++Q  C  + K KA+ LLKL    W E
Sbjct  350  LLNEMLQLGVVAKLCLVLQVSCGSKTKDKAKELLKLHARAWKE  392



>ref|XP_009410070.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=437

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 136/274 (50%), Gaps = 9/274 (3%)
 Frame = +2

Query  8    RRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPE-----LSHESLAILSMFPLP  172
            R+++ L  ES++NR  I++  A  VL    FS + + S E     +  E LA L+ F   
Sbjct  144  RKIKALGRESERNRRCIISGGAGRVL-SNCFSELAAESLENPRAGVMDEILAALAAFLPL  202

Query  173  EAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  352
            +  S +  + P  +  +VS+L +  ++ R+N AAL+   L+ +  P+    ++  D + E
Sbjct  203  DEGSYLQLASPKPLDSIVSVLKSADLEGRLN-AALVLKELASSSPPDRIEVVARTDGLIE  261

Query  353  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERA  532
             +V ++  P+S        V A + +  +++   + V  G V  L++ L D +K   E+A
Sbjct  262  ALVKLIEKPISPRATNASMVTAFYLVASSERIAARFVEMGIVSLLLEILVDSEKSMCEKA  321

Query  533  LATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa--seqaqr  706
            L  ++ +     G    +AH+L VP+LVK   +++   TE+A  AL  +C      +   
Sbjct  322  LGVLDGVLSCSRGREMASAHSLAVPVLVKKTSRVADMETEFAVSALWKLCKNDDEGERVV  381

Query  707  eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
            EA  AG   +LLLL+Q  C    K K   LLKLL
Sbjct  382  EALQAGAFQKLLLLLQVGCKGTTKEKVSDLLKLL  415



>ref|XP_009760074.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Nicotiana 
sylvestris]
Length=403

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 133/281 (47%), Gaps = 16/281 (6%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNS----PELSHESLAILSMFPLP  172
            L+ LR +A E+D N+  + +  A E L  I+ SN ++           E+L+IL    L 
Sbjct  114  LKSLRSIASENDANKRCMESAGAAEFLASIIISNRNNEGFGSLKGTKDEALSILYHLKLS  173

Query  173  EA--ESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEI  346
            E    ++I+  +   +  L  ++ + S + R  +  L++    G  S E+   +S   E 
Sbjct  174  EHGLRTLIMGGNGEFIESLTRIMQHGSYESRAYAVLLLKK---GFNSFEI---LSLKQEF  227

Query  347  FEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD-FDKCDA  523
            F  +V +L+  +S  +A K  ++ L  +C   + R KA  A AV  L++ L D  DK   
Sbjct  228  FTQVVQVLSDEIS-QKASKASLQILVNVCQWGRNRVKAAEADAVRVLVNLLLDSMDKSAC  286

Query  524  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  703
            E  L  ++ LC+   G A    HA  + ++ K IL++S  A+E A   L SI   S    
Sbjct  287  ELMLMLLDQLCQSAEGRAELLKHAAGLAIVSKKILRVSKLASERAIKILHSISKFSATPS  346

Query  704  reaaaa--GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
                    GV+ +L L++Q DC  + K +A+ +LKL    W
Sbjct  347  VLQEMLNLGVVAKLCLVLQVDCGSKTKDRAREILKLHAKAW  387



>ref|XP_003558390.1| PREDICTED: U-box domain-containing protein 21-like [Brachypodium 
distachyon]
Length=433

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 142/281 (51%), Gaps = 19/281 (7%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNA-REVLLCILFSNMDSNSPELSHESL--AILSMFPLP  172
            A+ R+R LA +S++NR  +++  A R +   +     D  +P  + E +  A++ M PL 
Sbjct  138  AIARVRALARDSERNRRCLVSVGAGRVLASALASLAADGETPAAALEDVLAALVCMTPLD  197

Query  173  EAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFE  352
            +  + I+++ P  +G LV++  N S+  R+N+  +I+ ++S     +L   +   +E+ +
Sbjct  198  DEAARILAT-PTSLGSLVAIAENGSLAGRLNAVLVIKEIVSCI---QLTGNV--VEELVD  251

Query  353  GIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGA-VEALIDRLQDFDKCDAER  529
             +  ++  P+   +A K  + A + L  + +           V  L++ L   DK  AE+
Sbjct  252  ALAKVIKAPIC-PQATKAAMVATYHLASSSERAAAHAAGAGLVPVLVESLVGADKSAAEK  310

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqre  709
            ALA ++ +     G  +  AHALTVP+LVK + ++S  ATE A  A+  +   +++++  
Sbjct  311  ALAVLDAVLASEEGRTSARAHALTVPVLVKKMFRVSDLATELAVSAMWRLGRGAKESEEG  370

Query  710  aaaa--------GVMTQLLLLVQSDCTERAKRKAQMLLKLL  808
             A          G   +LLLL+Q  C +  K K   LLK+L
Sbjct  371  EATKCLVEALRVGAFQKLLLLLQVGCRDATKEKTTELLKML  411



>ref|XP_011021423.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Populus euphratica]
Length=415

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 85/280 (30%), Positives = 138/280 (49%), Gaps = 22/280 (8%)
 Frame = +2

Query  32   ESDKNRSVILANNAREVLLCILFSNMDSNSPEL------------SHESLAILSMFPLPE  175
            ES++NRS +      + L  IL ++ DS S E+            S E+L IL    + +
Sbjct  124  ESERNRSCLEEAGVVDFLASILKTD-DSTSVEIDSDDNESEFTRASDEALNILYHLKISQ  182

Query  176  AE--SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
             +  ++I++     +  L+ +L + S   R  +  L++SV        L   IS   E+F
Sbjct  183  RQLKNLIINDGDRFLESLLQILKHSSYQSRAYATMLLKSVFEVADPTHL---ISIRPEMF  239

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDF-DKCDAE  526
              IV +L+  +S  +A K  +K L  +C   + R KAV  GAV  LI+ L D  DK   E
Sbjct  240  VEIVRVLDDQIS-QQASKAALKLLMEICPWGRNRIKAVEGGAVSVLIELLLDTSDKRACE  298

Query  527  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC--saseqa  700
              LA +ELLC    G A    H   + ++ K IL++SH A++ A   L SIC  SA+   
Sbjct  299  LILAVLELLCGCADGRAELLKHGAGLAVVSKKILRVSHVASDKAVRILCSICRFSATSTV  358

Query  701  qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
             +E    G + +L L++Q + + ++K +A+ +LK+    W
Sbjct  359  LQEMLQVGAVAKLCLILQVNSSLKSKERAREILKVHSKVW  398



>ref|XP_002873519.1| hypothetical protein ARALYDRAFT_487992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49778.1| hypothetical protein ARALYDRAFT_487992 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 74/145 (51%), Gaps = 8/145 (6%)
 Frame = +2

Query  401  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  580
            K   K L ALCLA+  RH AV AGA  A+I+     +    ERALA +EL+C    G A 
Sbjct  159  KYVTKILLALCLAEGNRHVAVEAGAARAVIETAAGLEISAVERALAALELMCTTAEGAAE  218

Query  581  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq-------reaaaaGVMTQL  739
               HA+TVP +V ++ +++ R  EYA  ++LSI                 A A  V   +
Sbjct  219  VRGHAMTVPAMVAVMARLAGRGREYAI-SILSIVYGKAGGGGDSGEEIAVAPAEEVARAV  277

Query  740  LLLVQSDCTERAKRKAQMLLKLLRD  814
             L ++ +CT R +RK   LLK L +
Sbjct  278  ALALEGECTARGRRKGAQLLKTLEE  302



>ref|XP_010106989.1| E3 ubiquitin-protein ligase [Morus notabilis]
 gb|EXC12987.1| E3 ubiquitin-protein ligase [Morus notabilis]
Length=419

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 86/293 (29%), Positives = 137/293 (47%), Gaps = 25/293 (9%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSN---SP--------------ELS  133
            LRRLR +A ES+ N+  + +  A E L+ ++ ++ + N   SP                S
Sbjct  115  LRRLRSIAAESETNKRCLESAGAVEFLVSLIANDNNENAVSSPLSSSENDESFDFARSAS  174

Query  134  HESLAILSMFPLPEAE-SVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSP  310
             E+L IL    L E     ++  +   V  L  ++   S D R  S  L++S+       
Sbjct  175  DEALTILHNLHLSETVLKKLIDRNGEFVDSLTRVMRQGSYDSRAYSIMLLKSMFDVADPM  234

Query  311  ELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALI  490
             +   IS   E +  +V IL   +S  +A K  ++ L  LC   + R KAV AGAV  LI
Sbjct  235  RM---ISLRTEFYAELVQILRDQIS-PQASKAALQLLVQLCPWGRNRIKAVEAGAVAVLI  290

Query  491  DRLQD-FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGA  667
            + L D  ++   E  L  ++L+C    G A    HA  + ++ K +L++SH  +E A   
Sbjct  291  ELLLDSVERRPCEMILTGLDLMCGCAEGRAELIRHAAGLAVVSKRVLRVSHIGSEKAMRI  350

Query  668  LLSIC--saseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            L S+   SA+     E    GV+ +L L++Q DC  + K KA+ +L+L    W
Sbjct  351  LFSVARFSATPAVLAEMLQLGVVAKLCLVLQVDCGGKTKEKAREILRLHARTW  403



>emb|CDP20283.1| unnamed protein product [Coffea canephora]
Length=448

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/273 (25%), Positives = 131/273 (48%), Gaps = 17/273 (6%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSH----ESLAILSMFPL  169
            AL+ LR +    D  +  ++ N    +L  +L        P  +H    E++ IL     
Sbjct  167  ALKELRQVVSAHDSAKKTVVDNGGVALLSSLL-------GPFTTHAVGSEAIGILVNLDF  219

Query  170  PEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
              +++      P +V  +V +L+  S+D ++N   LIE ++ G    +  ++I ++  + 
Sbjct  220  -SSDAKTNLRQPAKVSLMVDILNEGSIDTKINCTKLIEILIDGE---DFESEIVSSLSLL  275

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAER  529
             G++ ++     +   +  G++ L  +C  +  R+  V+ GAV  L++ L   +    E 
Sbjct  276  VGVLRLVK-DKRHPNGVLAGLRLLKMICSHESVRNSVVSIGAVPQLVELLPTLNPECLEL  334

Query  530  ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qr  706
            AL  +E LC +P G  A       +P +VK+++K+S   T +A   L ++C  + +    
Sbjct  335  ALYVLEALCTLPEGGLALKNCPSAIPAIVKLLMKVSESCTHFALSILWAVCKLAPEECAA  394

Query  707  eaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKL  805
             A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  395  LAVDAGLAAKLLLVIQSGCNPVLKQRSAELLKL  427



>ref|XP_007145787.1| hypothetical protein PHAVU_007G267700g [Phaseolus vulgaris]
 gb|ESW17781.1| hypothetical protein PHAVU_007G267700g [Phaseolus vulgaris]
Length=411

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 85/285 (30%), Positives = 142/285 (50%), Gaps = 18/285 (6%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDS---NSPEL------SHESLAILS  157
            LR L+ +A ES  N+  I +  A + L  ++ + ++S   +  EL      + E+L++L 
Sbjct  114  LRTLKSIASESQTNKRSIESAGAVKFLASVITNTINSCLDDDVELELKASVADEALSLLH  173

Query  158  MFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISN-  334
               L E     + S P     L  ++     + R  +  L++S LS    P    Q+ N 
Sbjct  174  NIQLSEPGLKTLLSHPEFTHSLTKVMQKGIYESRAYAVFLLKS-LSEVADP---VQLINL  229

Query  335  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD-FD  511
              E+F  +V +L   +S  +A K  ++ L  +C   + R KAV AGAV  +++ L +  +
Sbjct  230  KPELFIELVQVLKDQIS-QKASKATLQTLIQVCPWARNRVKAVEAGAVPVIVELLLECRE  288

Query  512  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC--s  685
            +   E  L  +E+LC+   G A   AHA  V ++ K IL++S  A + AA  LL++C  S
Sbjct  289  RKPCEMMLVLLEILCQSADGRAELLAHAAGVAIVAKKILRVSTTANDRAAKILLAVCRFS  348

Query  686  aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            A+    +E    GV+ +L L++Q D   +AK KA+ +LKL    W
Sbjct  349  ATPSVVQEMVQLGVVAKLCLVLQVDSGNKAKEKAREILKLHAKAW  393



>ref|XP_006362850.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Solanum tuberosum]
Length=404

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 82/284 (29%), Positives = 140/284 (49%), Gaps = 21/284 (7%)
 Frame = +2

Query  5    LRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAES  184
            LRR++ +A  S+ N+  + +    + L  I+    + +  E S E+L IL  F L  +++
Sbjct  115  LRRIKSIARVSESNKMCLESAGVVDFLTSIMMKKKEES--EASDEALNIL--FHLNPSDT  170

Query  185  -----VIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
                 +   +D   +  L+  L+N  V  R N+ AL+ S L+     +L   I       
Sbjct  171  ELKKLINSQNDHHFLDSLLQFLNNGHVQSRTNAIALLRSTLNVADPSQL---IGIQPVYI  227

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA-E  526
            +GIV ILN  +S  +A K+ +K L  LC   + + KAV  GAV ALI+ L D ++    E
Sbjct  228  KGIVCILNDKIS-QQATKVALKLLVELCPWGRNKIKAVENGAVFALIELLLDTNERRVCE  286

Query  527  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATE------YAAGALLSICsa  688
              L  ++ LC    G +    H   + ++ K IL++SH A++      Y+    L+ C  
Sbjct  287  LILTALDHLCTCADGRSELLRHGGGIAIVSKKILRVSHLASDRGVRILYSISKFLATC-Y  345

Query  689  seqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
            S +  +E    GV+++L L++Q D + + K KA+ +L+L    W
Sbjct  346  STKVLQEMLQVGVVSKLCLVLQVDVSPKTKEKAKEILRLHSRVW  389



>ref|XP_007207456.1| hypothetical protein PRUPE_ppa005655mg [Prunus persica]
 gb|EMJ08655.1| hypothetical protein PRUPE_ppa005655mg [Prunus persica]
Length=449

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 121/233 (52%), Gaps = 10/233 (4%)
 Frame = +2

Query  122  PELSH----ESLAILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESV  289
            P  SH    E +AIL    L ++ES      P ++  +V +L+  S++ ++N   LI+ +
Sbjct  201  PFTSHVVGSEVIAILVNLTL-DSESRTSLMQPAKISLMVDILNEGSIETKINCTRLIKML  259

Query  290  LSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTA  469
            +      + R++I ++  +  G++ ++     ++  +  G+  L  +CL K+ R   V+ 
Sbjct  260  M---EEKDFRSEIISSHSLLVGLMRLVK-DKRHTVGILPGLSLLRTICLHKEVRGFMVSI  315

Query  470  GAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRAT  649
            GAV  L+D L   D    E AL  ++ L  +P G +A      T+P +V+++++IS   T
Sbjct  316  GAVPQLVDCLPSLDHECLELALFILDALSSLPEGISALKDCLNTIPNMVRLLMRISESCT  375

Query  650  EYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKL  805
            +YA   L S+C  + +     A  AG+  +LLL++QS C    K+++  LLKL
Sbjct  376  QYALSILWSVCKHAPEECSSIALDAGLAAKLLLVIQSACGPVLKQQSAELLKL  428



>ref|XP_002965206.1| hypothetical protein SELMODRAFT_439085 [Selaginella moellendorffii]
 gb|EFJ34044.1| hypothetical protein SELMODRAFT_439085 [Selaginella moellendorffii]
Length=567

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 69/125 (55%), Gaps = 13/125 (10%)
 Frame = +2

Query  344  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  523
            I    V +L  P + ++ +++ +K++  +CL+K  R  AV AGAVEAL+D L D    D 
Sbjct  319  ILGACVALLKDPSAEAKLVRLALKSMLGICLSKPNRIPAVKAGAVEALLDTLVDLHGVDG  378

Query  524  -------------ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAG  664
                         ERALAT+ELLC    G AA  +    +  LV ++L +S RATEYAAG
Sbjct  379  GEFCSKSGIVVNVERALATLELLCTSSEGRAAICSQPNFISELVGLVLGVSERATEYAAG  438

Query  665  ALLSI  679
             L ++
Sbjct  439  VLCAV  443



>ref|XP_006854618.1| hypothetical protein AMTR_s00030p00159240 [Amborella trichopoda]
 gb|ERN16085.1| hypothetical protein AMTR_s00030p00159240 [Amborella trichopoda]
Length=405

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 139/280 (50%), Gaps = 11/280 (4%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELS--HESLAILSMFPLPE  175
            +LR LR LA  S+ NR  I +  A  V+  ++    D     ++   E+L+I+ +  + E
Sbjct  113  SLRELRDLAIASEMNRRRIGSAGAIPVMAHLILGQKDRGDESMATIEEALSIIHVLQVLE  172

Query  176  --AESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF  349
               +S++ S +   +  L  +L N S   R+ S +++++VL   +  E     S   E+F
Sbjct  173  DTVKSIVASDNGAFIDSLSWVLLNGSYRSRLYSVSILKTVL---KLVEPTIITSLKPELF  229

Query  350  EGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL-QDFDKCDAE  526
              +V ++N  +S S+A K  ++ L  +C   + R KA   GA+  +I  L +  ++ + E
Sbjct  230  RAMVRVMNNQVS-SQATKCVLQILMEVCSLGRNRVKACEEGAMPVIIQMLIESTERRERE  288

Query  527  RALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq--a  700
              L  ++LLC    G A    H   V ++ K I ++S  ATE A   L S+C  S     
Sbjct  289  LLLGVLDLLCGCAEGRAELLRHGAGVAVVSKKIFRVSTTATERAVKILWSLCKYSATHGV  348

Query  701  qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  820
              E    G +++L ++VQ+DC+ +AK KA+  L++    W
Sbjct  349  LMEMLNIGAVSKLCMVVQTDCSFKAKEKAKEALRMHAKTW  388



>ref|XP_002526642.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF35754.1| Spotted leaf protein, putative [Ricinus communis]
Length=404

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 138/248 (56%), Gaps = 19/248 (8%)
 Frame = +2

Query  125  ELSHESLA--------ILSMFPLPEAESVIVSSDPVRVGYLVSLLSNPSVDVRMNSAALI  280
            E+S ES+         +L + P  + ES+ +  +  ++    SLL + +  +++    LI
Sbjct  156  EISQESINFSEHALSCVLRLLPFAQYESLNMLKEESKLQSFKSLLEHGTSKMKVGLCHLI  215

Query  281  ESVLSGTRSPELRAQISNADEIFEGIVGIL--NCPLSYSRALKIGVKALFALCLAKQYRH  454
            E++ S + + EL + +     + +G+V ++  NC      A + G+KA+ ALC ++  R 
Sbjct  216  EAISSSSDTRELCSILGQNHGLLQGLVLLVQDNC-----EAPEAGIKAISALCSSESNRD  270

Query  455  KAVTAGAVEALIDRLQDFDKCDAE---RALATVELLCRIPSGCAAFAAHALTVPLLVKII  625
              V  G ++ L+  + + ++C      RA+AT+ELL  + +   A   +   +  LVK++
Sbjct  271  NMVQGGVLKGLLTYISNAERCHRNLISRAMATIELLLELDTAKEAVINNPDGIGALVKMV  330

Query  626  LKIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLK  802
             ++S H  +E A  +L+ +C  S QA+ EA +AGV+TQ+LLL+QS C+ R K +A+MLLK
Sbjct  331  FRVSDHEGSESAVRSLMILCGDSLQAREEAISAGVLTQVLLLLQSQCSGRTKTRARMLLK  390

Query  803  LLRDCWPE  826
            LLR  W E
Sbjct  391  LLRSKWNE  398



>ref|XP_002881419.1| hypothetical protein ARALYDRAFT_482563 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57678.1| hypothetical protein ARALYDRAFT_482563 [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 145/288 (50%), Gaps = 23/288 (8%)
 Frame = +2

Query  2    ALRRLRGLACESDKNRSVILANNAREVLLCILFSNMDSNSPELSHESLAILSMFPLPEAE  181
            +L+RLR +  E+  N+  + A    E L  I+ SN +S +  L+ E+L +L  + L  +E
Sbjct  116  SLKRLRQIVSENANNKRCLEAAGVPEFLAKIV-SN-ESENESLTDEALNLL--YHLETSE  171

Query  182  SVIVS-------SDPVRVGYLVSLLSNPSVDVRMNSAALIESVLSGTRSPELRAQISNAD  340
            +V+ +       +D V+   L  ++     + R+ +  L++++L      ++   ++   
Sbjct  172  TVLKNLLNNKKGNDIVK--SLTKIMQGGIYESRVYATLLLKNILEVADPMQI---MTLKP  226

Query  341  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  508
            E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L +     
Sbjct  227  EVFTEVVQILDDRIS-QKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMEESFTS  285

Query  509  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  685
            ++   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  286  ERRGPEMAMVVLDLLCQCAEGRADFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRF  345

Query  686  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  826
             A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  346  CATPALLHEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  393



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2133155381984