BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17329_g1_i1 len=1211 path=[1906:0-1013 69:1014-1210]

Length=1211
                                                                      Score     E

gb|ABD33126.2|  RNA-directed DNA polymerase (Reverse transcriptase)     221   2e-61   Medicago truncatula
ref|XP_007210228.1|  hypothetical protein PRUPE_ppa015539mg             217   1e-59   
ref|XP_007203344.1|  hypothetical protein PRUPE_ppa020282mg             213   6e-57   
ref|XP_010667704.1|  PREDICTED: uncharacterized protein LOC104884717    210   9e-56   
ref|XP_008232623.1|  PREDICTED: putative ribonuclease H protein A...    204   1e-54   
ref|XP_009144596.1|  PREDICTED: putative ribonuclease H protein A...    195   4e-54   
ref|XP_008237273.1|  PREDICTED: uncharacterized protein LOC103336015    202   6e-53   
gb|ABN08038.1|  RNA-directed DNA polymerase (Reverse transcriptase)     195   1e-52   Medicago truncatula
gb|ABO80476.1|  RNA-directed DNA polymerase , related                   191   2e-52   Medicago truncatula
ref|XP_008242862.1|  PREDICTED: uncharacterized protein LOC103341160    195   1e-51   
ref|XP_007207773.1|  hypothetical protein PRUPE_ppa026368mg             196   2e-51   
emb|CAN76892.1|  hypothetical protein VITISV_005356                     197   2e-51   Vitis vinifera
ref|XP_010667378.1|  PREDICTED: uncharacterized protein LOC104884431    197   2e-51   
emb|CCA66044.1|  hypothetical protein                                   197   3e-51   
ref|XP_006493121.1|  PREDICTED: putative ribonuclease H protein A...    195   4e-51   
ref|XP_002454941.1|  hypothetical protein SORBIDRAFT_03g001780          192   4e-51   Sorghum bicolor [broomcorn]
ref|XP_010490159.1|  PREDICTED: uncharacterized protein LOC104767890    196   8e-51   
ref|XP_010693052.1|  PREDICTED: uncharacterized protein LOC104906048    194   1e-50   
ref|XP_007212800.1|  hypothetical protein PRUPE_ppa020180mg             192   5e-50   
ref|XP_002468588.1|  hypothetical protein SORBIDRAFT_01g048580          187   5e-50   Sorghum bicolor [broomcorn]
ref|XP_010666976.1|  PREDICTED: uncharacterized protein LOC104884079    192   6e-50   
ref|XP_010696021.1|  PREDICTED: uncharacterized protein LOC104908596    189   1e-49   
gb|AAB82639.1|  putative non-LTR retroelement reverse transcriptase     191   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513002.1|  PREDICTED: uncharacterized protein LOC104788940    191   2e-49   
ref|XP_010686122.1|  PREDICTED: uncharacterized protein LOC104900404    190   5e-49   
ref|XP_009119675.1|  PREDICTED: putative ribonuclease H protein A...    189   5e-49   
ref|XP_009108257.1|  PREDICTED: putative ribonuclease H protein A...    187   5e-49   
ref|XP_010682933.1|  PREDICTED: uncharacterized protein LOC104897695    189   8e-49   
ref|XP_008391838.1|  PREDICTED: uncharacterized protein LOC103454030    189   1e-48   
ref|XP_010684019.1|  PREDICTED: uncharacterized protein LOC104898622    187   2e-48   
ref|XP_010054717.1|  PREDICTED: uncharacterized protein LOC104443052    186   3e-48   
ref|XP_008227636.1|  PREDICTED: uncharacterized protein LOC103327128    183   7e-48   
ref|XP_009102116.1|  PREDICTED: uncharacterized protein LOC103828254    186   8e-48   
emb|CCA66050.1|  hypothetical protein                                   186   8e-48   
ref|XP_010693383.1|  PREDICTED: uncharacterized protein LOC104906342    186   1e-47   
ref|XP_006485451.1|  PREDICTED: uncharacterized protein LOC102622884    184   3e-47   
ref|XP_010688582.1|  PREDICTED: uncharacterized protein LOC104902493    185   3e-47   
ref|XP_009138589.1|  PREDICTED: putative ribonuclease H protein A...    181   4e-47   
ref|XP_010692477.1|  PREDICTED: uncharacterized protein LOC104905588    184   5e-47   
emb|CCA66054.1|  hypothetical protein                                   184   6e-47   
ref|XP_008340459.1|  PREDICTED: putative ribonuclease H protein A...    179   8e-47   
ref|XP_006493122.1|  PREDICTED: putative ribonuclease H protein A...    180   1e-46   
ref|XP_006464882.1|  PREDICTED: putative ribonuclease H protein A...    180   1e-46   
ref|XP_006478212.1|  PREDICTED: putative ribonuclease H protein A...    174   2e-46   
emb|CAN63032.1|  hypothetical protein VITISV_024672                     182   2e-46   Vitis vinifera
ref|XP_010463143.1|  PREDICTED: uncharacterized protein LOC104743796    179   3e-46   
ref|XP_006483194.1|  PREDICTED: putative ribonuclease H protein A...    178   5e-46   
ref|XP_010687489.1|  PREDICTED: uncharacterized protein LOC104901596    181   6e-46   
ref|XP_007203701.1|  hypothetical protein PRUPE_ppa020995mg             181   6e-46   
ref|XP_010666711.1|  PREDICTED: uncharacterized protein LOC104883845    179   6e-46   
ref|XP_008367240.1|  PREDICTED: putative ribonuclease H protein A...    178   8e-46   
gb|EPS63383.1|  hypothetical protein M569_11401                         181   9e-46   
ref|XP_010690177.1|  PREDICTED: uncharacterized protein LOC104903764    180   1e-45   
ref|XP_008393387.1|  PREDICTED: uncharacterized protein LOC103455579    178   1e-45   
emb|CCA66040.1|  hypothetical protein                                   180   1e-45   
ref|XP_006478211.1|  PREDICTED: putative ribonuclease H protein A...    174   1e-45   
ref|XP_008245529.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    180   2e-45   
ref|XP_010686872.1|  PREDICTED: uncharacterized protein LOC104901027    179   2e-45   
ref|XP_007227312.1|  hypothetical protein PRUPE_ppa016553mg             178   3e-45   
ref|XP_003612608.1|  Replication protein A 70 kDa DNA-binding sub...    179   3e-45   
ref|XP_008355389.1|  PREDICTED: putative ribonuclease H protein A...    177   3e-45   
ref|XP_009115971.1|  PREDICTED: putative ribonuclease H protein A...    175   4e-45   
ref|XP_007203452.1|  hypothetical protein PRUPE_ppa022115mg             179   5e-45   
ref|XP_004305156.1|  PREDICTED: putative ribonuclease H protein A...    176   5e-45   
ref|XP_008338205.1|  PREDICTED: putative ribonuclease H protein A...    177   6e-45   
ref|XP_010058710.1|  PREDICTED: uncharacterized protein LOC104446568    178   7e-45   
ref|XP_010474601.1|  PREDICTED: uncharacterized protein LOC104754160    178   8e-45   
ref|XP_010688579.1|  PREDICTED: uncharacterized protein LOC104902491    177   9e-45   
ref|XP_006491472.1|  PREDICTED: uncharacterized protein LOC102626455    177   1e-44   
ref|XP_008367519.1|  PREDICTED: putative ribonuclease H protein A...    175   1e-44   
gb|AAF69169.1|AC007915_21  F27F5.21                                     176   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472251.1|  PREDICTED: uncharacterized protein LOC104751896    176   2e-44   
ref|XP_010451797.1|  PREDICTED: uncharacterized protein LOC104733977    177   2e-44   
ref|XP_008244613.1|  PREDICTED: putative ribonuclease H protein A...    175   2e-44   
ref|XP_008345114.1|  PREDICTED: putative ribonuclease H protein A...    176   2e-44   
ref|XP_010694802.1|  PREDICTED: uncharacterized protein LOC104907559    176   3e-44   
gb|EPS61425.1|  hypothetical protein M569_13371                         176   4e-44   
ref|XP_009103788.1|  PREDICTED: uncharacterized protein LOC103829849    176   4e-44   
ref|XP_008351907.1|  PREDICTED: uncharacterized protein LOC103415345    176   4e-44   
ref|XP_009118154.1|  PREDICTED: putative ribonuclease H protein A...    170   9e-44   
ref|XP_008226782.1|  PREDICTED: putative ribonuclease H protein A...    173   1e-43   
ref|XP_010446251.1|  PREDICTED: uncharacterized protein LOC104729051    172   1e-43   
ref|XP_010468426.1|  PREDICTED: uncharacterized protein LOC104748491    171   2e-43   
ref|XP_008351857.1|  PREDICTED: putative ribonuclease H protein A...    165   2e-43   
ref|XP_010039097.1|  PREDICTED: uncharacterized protein LOC104427753    174   2e-43   
ref|XP_010495306.1|  PREDICTED: uncharacterized protein LOC104772378    172   2e-43   
ref|XP_004295829.1|  PREDICTED: uncharacterized protein LOC101302635    172   3e-43   
ref|XP_008233458.1|  PREDICTED: putative ribonuclease H protein A...    171   3e-43   
gb|AAG13524.1|AC068924_29  putative non-LTR retroelement reverse ...    173   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010666306.1|  PREDICTED: uncharacterized protein LOC104883473    173   3e-43   
ref|XP_010472440.1|  PREDICTED: uncharacterized protein LOC104752070    172   3e-43   
ref|XP_010495441.1|  PREDICTED: uncharacterized protein LOC104772536    172   3e-43   
ref|XP_008366311.1|  PREDICTED: putative ribonuclease H protein A...    171   3e-43   
gb|AAP54617.2|  retrotransposon protein, putative, unclassified         173   4e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008338539.1|  PREDICTED: uncharacterized protein LOC103401606    169   4e-43   
ref|XP_009361334.1|  PREDICTED: uncharacterized protein LOC103951630    172   4e-43   
gb|AAG51783.1|AC079679_3  reverse transcriptase, putative; 16838-...    172   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007220081.1|  hypothetical protein PRUPE_ppa024663mg             169   5e-43   
ref|XP_009140188.1|  PREDICTED: uncharacterized protein LOC103864181    170   5e-43   
ref|XP_004298552.1|  PREDICTED: putative ribonuclease H protein A...    163   8e-43   
ref|XP_009102110.1|  PREDICTED: putative ribonuclease H protein A...    168   1e-42   
gb|AFP55557.1|  non-ltr retroelement reverse transcriptase              172   1e-42   
gb|EEE50824.1|  hypothetical protein OsJ_31232                          171   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009115737.1|  PREDICTED: uncharacterized protein LOC103840975    169   2e-42   
gb|EPS72636.1|  hypothetical protein M569_02121                         171   2e-42   
ref|XP_009149314.1|  PREDICTED: uncharacterized protein LOC103872634    170   2e-42   
ref|XP_010682492.1|  PREDICTED: uncharacterized protein LOC104897331    171   2e-42   
ref|XP_010484944.1|  PREDICTED: uncharacterized protein LOC104763239    168   2e-42   
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413    171   2e-42   
ref|XP_008338514.1|  PREDICTED: uncharacterized protein LOC103401576    169   2e-42   
ref|XP_010039376.1|  PREDICTED: uncharacterized protein LOC104428079    170   3e-42   
ref|XP_010418809.1|  PREDICTED: uncharacterized protein LOC104704411    168   3e-42   
gb|ABA98491.1|  retrotransposon protein, putative, unclassified         171   3e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010513715.1|  PREDICTED: uncharacterized protein LOC104789767    162   3e-42   
gb|AAP53315.2|  retrotransposon protein, putative, unclassified         170   3e-42   Oryza sativa Japonica Group [Japonica rice]
gb|AAM18736.1|AC092548_14  putative reverse transcriptase               170   4e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010026656.1|  PREDICTED: uncharacterized protein LOC104417027    170   4e-42   
gb|EEE50691.1|  hypothetical protein OsJ_30951                          167   4e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009102306.1|  PREDICTED: putative ribonuclease H protein A...    166   6e-42   
ref|XP_009140270.1|  PREDICTED: putative ribonuclease H protein A...    168   6e-42   
ref|XP_008392963.1|  PREDICTED: uncharacterized protein LOC103455142    169   6e-42   
dbj|BAM28750.1|  reverse transcriptase-like protein                     159   7e-42   
ref|XP_010054376.1|  PREDICTED: uncharacterized protein LOC104442671    169   7e-42   
ref|XP_006494333.1|  PREDICTED: putative ribonuclease H protein A...    161   7e-42   
ref|XP_010495217.1|  PREDICTED: uncharacterized protein LOC104772285    169   8e-42   
gb|EEC72938.1|  hypothetical protein OsI_06800                          165   8e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_010451822.1|  PREDICTED: uncharacterized protein LOC104734004    168   8e-42   
ref|XP_009114092.1|  PREDICTED: uncharacterized protein LOC103839337    166   8e-42   
gb|AFP55574.1|  non-ltr retroelement reverse transcriptase              169   9e-42   
ref|XP_010451645.1|  PREDICTED: uncharacterized protein LOC104733795    168   1e-41   
ref|XP_009115910.1|  PREDICTED: putative ribonuclease H protein A...    167   1e-41   
ref|XP_010506884.1|  PREDICTED: uncharacterized protein LOC104783422    168   1e-41   
ref|XP_010412448.1|  PREDICTED: uncharacterized protein LOC104698743    168   1e-41   
ref|XP_008372180.1|  PREDICTED: putative ribonuclease H protein A...    159   1e-41   
ref|XP_008372934.1|  PREDICTED: putative ribonuclease H protein A...    167   1e-41   
gb|EEC66671.1|  hypothetical protein OsI_32959                          165   1e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_010424753.1|  PREDICTED: uncharacterized protein LOC104709909    165   2e-41   
ref|XP_010507233.1|  PREDICTED: uncharacterized protein LOC104783828    166   2e-41   
gb|AAD24831.1|  putative non-LTR retroelement reverse transcriptase     168   2e-41   Arabidopsis thaliana [mouse-ear cress]
emb|CCA66036.1|  hypothetical protein                                   168   2e-41   
ref|XP_010513536.1|  PREDICTED: uncharacterized protein LOC104789557    166   2e-41   
ref|XP_004298219.1|  PREDICTED: uncharacterized protein LOC101304768    168   2e-41   
ref|XP_009114416.1|  PREDICTED: uncharacterized protein LOC103839673    167   3e-41   
ref|XP_009102759.1|  PREDICTED: uncharacterized protein LOC103828873    167   3e-41   
ref|XP_010696345.1|  PREDICTED: uncharacterized protein LOC104908875    164   3e-41   
gb|AAD20714.1|  putative non-LTR retroelement reverse transcriptase     167   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462630.1|  PREDICTED: uncharacterized protein LOC104743220    165   3e-41   
emb|CAE01608.2|  OSJNBa0052O21.12                                       161   3e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010468701.1|  PREDICTED: uncharacterized protein LOC104748809    164   4e-41   
ref|XP_004954924.1|  PREDICTED: uncharacterized protein LOC101756955    166   4e-41   
ref|XP_009139334.1|  PREDICTED: putative ribonuclease H protein A...    163   5e-41   
ref|XP_009137133.1|  PREDICTED: uncharacterized protein LOC103861184    166   6e-41   
ref|XP_010480729.1|  PREDICTED: uncharacterized protein LOC104759515    166   7e-41   
ref|XP_007226707.1|  hypothetical protein PRUPE_ppa020120mg             166   7e-41   
ref|XP_010418618.1|  PREDICTED: uncharacterized protein LOC104704191    166   7e-41   
gb|EAZ29765.1|  hypothetical protein OsJ_13823                          161   8e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010419439.1|  PREDICTED: uncharacterized protein LOC104705159    166   9e-41   
ref|XP_010513742.1|  PREDICTED: uncharacterized protein LOC104789794    166   1e-40   
gb|EEE55133.1|  hypothetical protein OsJ_02920                          165   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010670096.1|  PREDICTED: uncharacterized protein LOC104887198    165   1e-40   
ref|XP_009103791.1|  PREDICTED: uncharacterized protein LOC103829852    165   1e-40   
ref|XP_009105597.1|  PREDICTED: uncharacterized protein LOC103831468    163   2e-40   
ref|XP_004289367.1|  PREDICTED: putative ribonuclease H protein A...    165   2e-40   
gb|ABB46931.2|  retrotransposon protein, putative, unclassified         165   2e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009107553.1|  PREDICTED: uncharacterized protein LOC103833206    163   2e-40   
gb|AAM01179.2|AC113336_31  Putative retroelement                        165   2e-40   Oryza sativa Japonica Group [Japonica rice]
gb|AAG03119.1|AC004133_13  F5A9.24                                      165   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123326.1|  PREDICTED: uncharacterized protein LOC103848097    165   2e-40   
ref|XP_010495286.1|  PREDICTED: uncharacterized protein LOC104772356    164   2e-40   
ref|XP_010474031.1|  PREDICTED: uncharacterized protein LOC104753480    165   2e-40   
ref|XP_009108660.1|  PREDICTED: putative ribonuclease H protein A...    161   2e-40   
ref|XP_009139326.1|  PREDICTED: uncharacterized protein LOC103863321    164   2e-40   
dbj|BAM28751.1|  reverse transcriptase-like protein                     155   2e-40   
ref|XP_009142123.1|  PREDICTED: putative ribonuclease H protein A...    162   3e-40   
pir||T00833  RNA-directed DNA polymerase homolog T13L16.7 - Arabi...    164   3e-40
ref|XP_008387184.1|  PREDICTED: putative ribonuclease H protein A...    163   3e-40   
gb|AAF97969.1|AC000103_19  F21J9.30                                     164   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116203.1|  PREDICTED: putative ribonuclease H protein A...    162   3e-40   
ref|XP_009140393.1|  PREDICTED: uncharacterized protein LOC103864388    164   3e-40   
ref|XP_010476358.1|  PREDICTED: uncharacterized protein LOC104755638    164   4e-40   
ref|XP_009115748.1|  PREDICTED: uncharacterized protein LOC103840987    162   4e-40   
ref|XP_010430691.1|  PREDICTED: uncharacterized protein LOC104714925    164   4e-40   
gb|EPS73861.1|  hypothetical protein M569_00896                         164   5e-40   
ref|XP_009126341.1|  PREDICTED: uncharacterized protein LOC103851249    163   5e-40   
ref|XP_010507122.1|  PREDICTED: uncharacterized protein LOC104783698    163   7e-40   
ref|XP_008351830.1|  PREDICTED: putative ribonuclease H protein A...    162   1e-39   
ref|XP_009770639.1|  PREDICTED: uncharacterized protein LOC104221303    158   1e-39   
ref|XP_010513760.1|  PREDICTED: uncharacterized protein LOC104789816    162   1e-39   
ref|XP_010445303.1|  PREDICTED: uncharacterized protein LOC104727950    161   2e-39   
ref|XP_009150816.1|  PREDICTED: uncharacterized protein LOC103874152    162   2e-39   
ref|XP_007210987.1|  hypothetical protein PRUPE_ppa021345mg             160   2e-39   
gb|EEC81552.1|  hypothetical protein OsI_24974                          161   2e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_010468497.1|  PREDICTED: uncharacterized protein LOC104748579    161   2e-39   
ref|XP_010495131.1|  PREDICTED: uncharacterized protein LOC104772187    162   2e-39   
gb|AAK52166.1|AC084831_20  putative reverse transcriptase               161   2e-39   Oryza sativa [red rice]
gb|ABF97084.1|  retrotransposon protein, putative, unclassified         161   2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008364002.1|  PREDICTED: putative ribonuclease H protein A...    159   4e-39   
ref|XP_010481092.1|  PREDICTED: uncharacterized protein LOC104759918    158   4e-39   
ref|XP_010424608.1|  PREDICTED: uncharacterized protein LOC104709742    159   5e-39   
ref|XP_009115101.1|  PREDICTED: uncharacterized protein LOC103840357    159   5e-39   
ref|XP_010463404.1|  PREDICTED: uncharacterized protein LOC104744076    158   5e-39   
ref|XP_010513001.1|  PREDICTED: uncharacterized protein LOC104788939    160   7e-39   
ref|XP_009108843.1|  PREDICTED: uncharacterized protein LOC103834526    159   8e-39   
gb|EEC76774.1|  hypothetical protein OsI_14862                          160   8e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_004296207.1|  PREDICTED: uncharacterized protein LOC101297422    159   9e-39   
ref|XP_010468192.1|  PREDICTED: uncharacterized protein LOC104748214    158   9e-39   
ref|XP_009138123.1|  PREDICTED: putative ribonuclease H protein A...    158   9e-39   
ref|XP_009113016.1|  PREDICTED: uncharacterized protein LOC103838337    160   9e-39   
ref|XP_010513448.1|  PREDICTED: uncharacterized protein LOC104789452    159   1e-38   
ref|XP_004310201.1|  PREDICTED: uncharacterized protein LOC101298860    159   1e-38   
ref|XP_010478571.1|  PREDICTED: uncharacterized protein LOC104757...    156   1e-38   
ref|XP_010478572.1|  PREDICTED: uncharacterized protein LOC104757...    156   1e-38   
ref|XP_009145555.1|  PREDICTED: putative ribonuclease H protein A...    158   1e-38   
ref|XP_008382376.1|  PREDICTED: uncharacterized protein LOC103445169    159   1e-38   
gb|AAY22445.1|  bZIP-like protein                                       149   1e-38   Gossypium hirsutum [American cotton]
ref|XP_004305133.1|  PREDICTED: putative ribonuclease H protein A...    155   2e-38   
ref|XP_004959141.1|  PREDICTED: putative ribonuclease H protein A...    158   2e-38   
ref|XP_010485231.1|  PREDICTED: uncharacterized protein LOC104763574    159   2e-38   
gb|KFK27800.1|  hypothetical protein AALP_AA8G430800                    159   2e-38   
emb|CAB75484.1|  putative protein                                       157   2e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27798.1|  hypothetical protein AALP_AA8G430800                    158   2e-38   
gb|KFK27799.1|  hypothetical protein AALP_AA8G430800                    158   2e-38   
gb|AAC33961.1|  contains similarity to reverse trancriptase (Pfam...    159   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123205.1|  PREDICTED: putative ribonuclease H protein A...    154   3e-38   
ref|XP_010451785.1|  PREDICTED: uncharacterized protein LOC104733961    158   3e-38   
ref|XP_010518579.1|  PREDICTED: uncharacterized protein LOC104793852    157   3e-38   
ref|XP_008365211.1|  PREDICTED: putative ribonuclease H protein A...    153   4e-38   
gb|AAD32950.1|  putative non-LTR retroelement reverse transcriptase     156   4e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAB84340.1|  putative non-LTR retroelement reverse transcriptase     157   4e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451493.1|  PREDICTED: uncharacterized protein LOC104733622    157   4e-38   
ref|XP_010451584.1|  PREDICTED: uncharacterized protein LOC104733725    157   5e-38   
ref|XP_009127418.1|  PREDICTED: uncharacterized protein LOC103852254    157   5e-38   
gb|AAO00713.1|  retrotransposon protein, putative, unclassified         157   7e-38   Oryza sativa Japonica Group [Japonica rice]
gb|AAP54692.2|  retrotransposon protein, putative, unclassified         157   7e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009151565.1|  PREDICTED: putative ribonuclease H protein A...    152   7e-38   
ref|XP_009124968.1|  PREDICTED: uncharacterized protein LOC103850017    157   8e-38   
ref|XP_010468536.1|  PREDICTED: uncharacterized protein LOC104748626    156   8e-38   
ref|XP_010667928.1|  PREDICTED: uncharacterized protein LOC104884923    155   8e-38   
ref|XP_009108635.1|  PREDICTED: putative ribonuclease H protein A...    155   8e-38   
ref|XP_009118503.1|  PREDICTED: uncharacterized protein LOC103843513    154   9e-38   
ref|XP_009140200.1|  PREDICTED: putative ribonuclease H protein A...    156   1e-37   
ref|XP_010495271.1|  PREDICTED: uncharacterized protein LOC104772340    155   1e-37   
ref|XP_010456858.1|  PREDICTED: uncharacterized protein LOC104738371    147   1e-37   
ref|XP_010419021.1|  PREDICTED: uncharacterized protein LOC104704671    156   2e-37   
ref|XP_009124289.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    156   2e-37   
ref|XP_010445598.1|  PREDICTED: uncharacterized protein LOC104728296    155   2e-37   
ref|XP_008234850.1|  PREDICTED: putative ribonuclease H protein A...    155   3e-37   
ref|XP_008367994.1|  PREDICTED: uncharacterized protein LOC103431605    156   3e-37   
ref|XP_007224046.1|  hypothetical protein PRUPE_ppa015219mg             155   3e-37   
emb|CAB40051.1|  putative protein                                       155   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217321.1|  hypothetical protein PRUPE_ppa019733mg             155   4e-37   
ref|XP_010480950.1|  PREDICTED: uncharacterized protein LOC104759762    155   4e-37   
ref|XP_009140970.1|  PREDICTED: uncharacterized protein LOC103864947    155   5e-37   
ref|XP_009375083.1|  PREDICTED: uncharacterized protein LOC103963932    155   5e-37   
ref|XP_009125370.1|  PREDICTED: putative ribonuclease H protein A...    154   5e-37   
ref|XP_009140406.1|  PREDICTED: putative ribonuclease H protein A...    152   5e-37   
ref|XP_009113011.1|  PREDICTED: putative ribonuclease H protein A...    152   6e-37   
ref|XP_009146506.1|  PREDICTED: uncharacterized protein LOC103870148    154   6e-37   
ref|XP_010689711.1|  PREDICTED: uncharacterized protein LOC104903385    154   7e-37   
ref|XP_004301440.1|  PREDICTED: putative ribonuclease H protein A...    152   7e-37   
ref|XP_010238942.1|  PREDICTED: uncharacterized protein LOC100831270    154   8e-37   
ref|XP_009112590.1|  PREDICTED: uncharacterized protein LOC103837948    154   8e-37   
ref|XP_009129017.1|  PREDICTED: uncharacterized protein LOC103853864    154   8e-37   
ref|XP_010673168.1|  PREDICTED: uncharacterized protein LOC104889608    154   9e-37   
ref|XP_010445339.1|  PREDICTED: uncharacterized protein LOC104727990    153   9e-37   
gb|EEC79647.1|  hypothetical protein OsI_20882                          154   1e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_009129032.1|  PREDICTED: uncharacterized protein LOC103853884    153   1e-36   
ref|XP_010468391.1|  PREDICTED: uncharacterized protein LOC104748447    152   1e-36   
emb|CAB39638.1|  RNA-directed DNA polymerase-like protein               153   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107610.1|  PREDICTED: putative ribonuclease H protein A...    152   1e-36   
ref|XP_009132673.1|  PREDICTED: putative ribonuclease H protein A...    152   1e-36   
gb|EEE68778.1|  hypothetical protein OsJ_27492                          153   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009138115.1|  PREDICTED: putative ribonuclease H protein A...    152   2e-36   
gb|AAD29058.1|  putative non-LTR retroelement reverse transcriptase     153   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb|ABA97040.1|  retrotransposon protein, putative, unclassified         153   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009139360.1|  PREDICTED: uncharacterized protein LOC103863362    152   2e-36   
ref|XP_009102729.1|  PREDICTED: uncharacterized protein LOC103828837    152   3e-36   
ref|XP_009130050.1|  PREDICTED: putative ribonuclease H protein A...    152   3e-36   
gb|EMS67609.1|  Alanyl-tRNA synthetase                                  153   3e-36   
gb|EEC83100.1|  hypothetical protein OsI_28249                          152   3e-36   
ref|XP_009138624.1|  PREDICTED: uncharacterized protein LOC103862701    152   3e-36   
gb|EEE52912.1|  hypothetical protein OsJ_35521                          151   4e-36   
gb|ABA96650.1|  retrotransposon protein, putative, unclassified         152   4e-36   
ref|XP_009123659.1|  PREDICTED: uncharacterized protein LOC103848514    150   4e-36   
gb|EEC84753.1|  hypothetical protein OsI_31756                          152   4e-36   
ref|XP_009102787.1|  PREDICTED: uncharacterized protein LOC103828902    151   5e-36   
ref|XP_009113843.1|  PREDICTED: putative ribonuclease H protein A...    150   5e-36   
ref|XP_010474595.1|  PREDICTED: uncharacterized protein LOC104754152    148   6e-36   
ref|XP_009150035.1|  PREDICTED: uncharacterized protein LOC103873375    151   7e-36   
ref|XP_010480989.1|  PREDICTED: uncharacterized protein LOC104759803    150   7e-36   
ref|XP_010105295.1|  hypothetical protein L484_002345                   151   7e-36   
ref|XP_010430664.1|  PREDICTED: uncharacterized protein LOC104714891    151   8e-36   
ref|XP_007207799.1|  hypothetical protein PRUPE_ppa024472mg             150   9e-36   
ref|XP_010684764.1|  PREDICTED: uncharacterized protein LOC104899297    150   9e-36   
ref|XP_009122881.1|  PREDICTED: putative ribonuclease H protein A...    149   1e-35   
ref|XP_010481048.1|  PREDICTED: uncharacterized protein LOC104759863    146   1e-35   
ref|XP_010518602.1|  PREDICTED: uncharacterized protein LOC104793875    145   1e-35   
ref|XP_009148188.1|  PREDICTED: uncharacterized protein LOC103871664    149   1e-35   
ref|XP_008367096.1|  PREDICTED: putative ribonuclease H protein A...    149   1e-35   
ref|XP_010424232.1|  PREDICTED: uncharacterized protein LOC104709291    143   1e-35   
ref|XP_009121250.1|  PREDICTED: uncharacterized protein LOC103846083    148   2e-35   
ref|XP_007212995.1|  hypothetical protein PRUPE_ppa022768mg             149   3e-35   
ref|XP_010507264.1|  PREDICTED: uncharacterized protein LOC104783860    146   3e-35   
ref|XP_010666820.1|  PREDICTED: uncharacterized protein LOC104883940    149   3e-35   
ref|XP_009102231.1|  PREDICTED: uncharacterized protein LOC103828378    149   3e-35   
ref|XP_009127063.1|  PREDICTED: uncharacterized protein LOC103851935    148   3e-35   
gb|ABN08570.1|  WW/Rsp5/WWP                                             141   4e-35   
ref|XP_009123679.1|  PREDICTED: putative ribonuclease H protein A...    149   4e-35   
ref|XP_009110782.1|  PREDICTED: uncharacterized protein LOC103836292    147   4e-35   
emb|CDP14470.1|  unnamed protein product                                146   4e-35   
ref|XP_007224193.1|  hypothetical protein PRUPE_ppa017155mg             148   5e-35   
ref|XP_008393538.1|  PREDICTED: uncharacterized protein LOC103455726    149   6e-35   
ref|XP_010681977.1|  PREDICTED: uncharacterized protein LOC104896888    148   7e-35   
ref|XP_007226166.1|  hypothetical protein PRUPE_ppa015256mg             145   8e-35   
gb|EEE61581.1|  hypothetical protein OsJ_15963                          148   8e-35   
ref|XP_010495329.1|  PREDICTED: uncharacterized protein LOC104772406    148   8e-35   
ref|XP_009103763.1|  PREDICTED: uncharacterized protein LOC103829818    148   8e-35   
ref|XP_010507236.1|  PREDICTED: uncharacterized protein LOC104783832    147   1e-34   
ref|XP_010468816.1|  PREDICTED: uncharacterized protein LOC104748941    147   1e-34   
emb|CAE04866.2|  OSJNBa0086O06.14                                       147   1e-34   
ref|XP_009139523.1|  PREDICTED: putative ribonuclease H protein A...    146   1e-34   
ref|XP_008341112.1|  PREDICTED: uncharacterized protein LOC103404034    147   1e-34   
pir||S65812  RNA-directed DNA polymerase (EC 2.7.7.49) (clone DW1...    147   2e-34
ref|XP_009353199.1|  PREDICTED: uncharacterized protein LOC103944460    147   3e-34   
ref|XP_009118875.1|  PREDICTED: uncharacterized protein LOC103843847    146   3e-34   
ref|XP_009135908.1|  PREDICTED: uncharacterized protein LOC103860050    146   3e-34   
gb|AAD24601.1|  putative non-LTR retroelement reverse transcriptase     146   4e-34   
gb|EEC78920.1|  hypothetical protein OsI_19335                          143   4e-34   
ref|XP_008393342.1|  PREDICTED: putative ribonuclease H protein A...    144   4e-34   
ref|XP_010495785.1|  PREDICTED: uncharacterized protein LOC104772929    145   5e-34   
ref|XP_007225095.1|  hypothetical protein PRUPE_ppa016563mg             145   5e-34   
gb|EEC73664.1|  hypothetical protein OsI_08202                          144   6e-34   
gb|EAZ45614.1|  hypothetical protein OsJ_30281                          145   7e-34   
ref|XP_008364539.1|  PREDICTED: putative ribonuclease H protein A...    143   7e-34   
ref|XP_004306191.1|  PREDICTED: putative ribonuclease H protein A...    144   7e-34   
ref|XP_008356436.1|  PREDICTED: putative ribonuclease H protein A...    144   9e-34   
ref|XP_009146764.1|  PREDICTED: uncharacterized protein LOC103870391    144   1e-33   
ref|XP_009107566.1|  PREDICTED: uncharacterized protein LOC103833219    144   1e-33   
gb|AAD21778.1|  putative non-LTR retroelement reverse transcriptase     145   1e-33   
ref|XP_010513204.1|  PREDICTED: uncharacterized protein LOC104789164    144   2e-33   
ref|XP_010688970.1|  PREDICTED: uncharacterized protein LOC104902764    144   2e-33   
ref|XP_009126346.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    144   2e-33   
ref|XP_008382787.1|  PREDICTED: putative ribonuclease H protein A...    142   2e-33   
ref|XP_010445465.1|  PREDICTED: uncharacterized protein LOC104728135    143   2e-33   
gb|EEE69154.1|  hypothetical protein OsJ_28290                          141   2e-33   
ref|XP_010502011.1|  PREDICTED: uncharacterized protein LOC104779357    143   2e-33   
ref|XP_010419203.1|  PREDICTED: uncharacterized protein LOC104704888    142   2e-33   
ref|XP_003576322.2|  PREDICTED: uncharacterized protein LOC100821137    143   3e-33   
ref|XP_004292011.1|  PREDICTED: uncharacterized protein LOC101291306    142   3e-33   
ref|XP_009141426.1|  PREDICTED: putative ribonuclease H protein A...    141   4e-33   
gb|EAZ03196.1|  hypothetical protein OsI_25347                          142   4e-33   
ref|NP_001173091.1|  Os02g0636500                                       140   6e-33   
ref|XP_009118883.1|  PREDICTED: uncharacterized protein LOC103843855    142   6e-33   
gb|AAD15377.1|  putative non-LTR retroelement reverse transcriptase     142   7e-33   
ref|XP_010319942.1|  PREDICTED: uncharacterized protein LOC104647070    138   7e-33   
ref|XP_006487889.1|  PREDICTED: uncharacterized protein LOC102617714    142   7e-33   
ref|XP_009147172.1|  PREDICTED: uncharacterized protein LOC103870758    142   8e-33   
gb|EEE57442.1|  hypothetical protein OsJ_07651                          141   8e-33   
ref|XP_004301927.1|  PREDICTED: putative ribonuclease H protein A...    141   9e-33   
ref|XP_009124128.1|  PREDICTED: uncharacterized protein LOC103849058    141   9e-33   
gb|AAG51754.1|AC068667_33  reverse transcriptase, putative; 10003...    142   1e-32   
gb|EEC80601.1|  hypothetical protein OsI_22949                          137   1e-32   
ref|XP_004305827.1|  PREDICTED: putative ribonuclease H protein A...    140   2e-32   
gb|EMS68524.1|  Cyclopropane-fatty-acyl-phospholipid synthase           141   2e-32   
ref|XP_010046217.1|  PREDICTED: uncharacterized protein LOC104435101    139   2e-32   
ref|XP_006494016.1|  PREDICTED: uncharacterized protein LOC102608298    141   2e-32   
gb|EMT20966.1|  Pleiotropic drug resistance protein 4                   141   2e-32   
ref|XP_008345353.1|  PREDICTED: putative ribonuclease H protein A...    140   2e-32   
ref|XP_010512944.1|  PREDICTED: uncharacterized protein LOC104788863    140   3e-32   
ref|XP_008232502.1|  PREDICTED: putative ribonuclease H protein A...    137   3e-32   
ref|XP_008359713.1|  PREDICTED: uncharacterized protein LOC103423419    134   3e-32   
ref|XP_009145592.1|  PREDICTED: putative ribonuclease H protein A...    137   3e-32   
ref|XP_008348723.1|  PREDICTED: uncharacterized protein LOC103411886    139   3e-32   
ref|XP_007198897.1|  hypothetical protein PRUPE_ppa015748mg             140   3e-32   
ref|XP_010445461.1|  PREDICTED: uncharacterized protein LOC104728130    139   3e-32   
ref|XP_010456830.1|  PREDICTED: uncharacterized protein LOC104738339    136   3e-32   
ref|XP_008372905.1|  PREDICTED: uncharacterized protein LOC103436258    139   5e-32   
emb|CAN77449.1|  hypothetical protein VITISV_016970                     136   6e-32   
ref|XP_009124577.1|  PREDICTED: uncharacterized protein LOC103849567    139   7e-32   
ref|XP_010506904.1|  PREDICTED: uncharacterized protein LOC104783445    138   8e-32   
ref|XP_008352230.1|  PREDICTED: putative ribonuclease H protein A...    138   8e-32   
ref|XP_010666352.1|  PREDICTED: uncharacterized protein LOC104883509    139   8e-32   
ref|XP_007219602.1|  hypothetical protein PRUPE_ppa023113mg             138   1e-31   
ref|XP_010039996.1|  PREDICTED: uncharacterized protein LOC104428743    138   1e-31   
gb|EAZ20803.1|  hypothetical protein OsJ_36426                          137   1e-31   
ref|XP_008385035.1|  PREDICTED: putative ribonuclease H protein A...    138   1e-31   
ref|XP_010501979.1|  PREDICTED: uncharacterized protein LOC104779321    137   1e-31   
ref|XP_009103405.1|  PREDICTED: uncharacterized protein LOC103829494    137   1e-31   
ref|XP_008237106.1|  PREDICTED: uncharacterized protein LOC103335848    137   1e-31   
ref|XP_010644016.1|  PREDICTED: uncharacterized protein LOC104877459    137   2e-31   
ref|XP_009349611.1|  PREDICTED: uncharacterized protein LOC103941142    138   2e-31   
ref|XP_009146521.1|  PREDICTED: putative ribonuclease H protein A...    135   2e-31   
gb|AAF18538.1|AC006551_24  Very similar to retrotransposon revers...    137   2e-31   
ref|XP_010469706.1|  PREDICTED: uncharacterized protein LOC104749719    137   3e-31   
ref|XP_004297906.1|  PREDICTED: putative ribonuclease H protein A...    132   3e-31   
gb|EPS65500.1|  hypothetical protein M569_09277                         130   3e-31   
ref|XP_010495658.1|  PREDICTED: uncharacterized protein LOC104772781    134   4e-31   
ref|XP_010474119.1|  PREDICTED: uncharacterized protein LOC104753583    136   6e-31   
ref|XP_009117147.1|  PREDICTED: putative ribonuclease H protein A...    130   6e-31   
ref|XP_010030283.1|  PREDICTED: putative leucine-rich repeat rece...    135   6e-31   
gb|EEC75230.1|  hypothetical protein OsI_11503                          135   8e-31   
ref|XP_008366302.1|  PREDICTED: uncharacterized protein LOC103429949    135   1e-30   
ref|XP_009107743.1|  PREDICTED: uncharacterized protein LOC103833410    135   1e-30   
gb|EEC83784.1|  hypothetical protein OsI_29682                          134   1e-30   
gb|EEC75227.1|  hypothetical protein OsI_11496                          135   1e-30   
ref|XP_008390254.1|  PREDICTED: putative ribonuclease H protein A...    134   2e-30   
ref|XP_008360834.1|  PREDICTED: putative ribonuclease H protein A...    127   2e-30   
ref|XP_010495450.1|  PREDICTED: uncharacterized protein LOC104772548    132   2e-30   
gb|AAK39575.1|AC025296_10  putative reverse transcriptase               134   2e-30   
ref|XP_009151737.1|  PREDICTED: putative ribonuclease H protein A...    131   2e-30   
gb|ABF95850.1|  retrotransposon protein, putative, unclassified         134   3e-30   
ref|NP_001066197.2|  Os12g0156200                                       134   4e-30   
ref|XP_008340956.1|  PREDICTED: uncharacterized protein LOC103403885    134   4e-30   
gb|AAQ19327.1|  bZIP-like protein                                       134   4e-30   
ref|XP_009107571.1|  PREDICTED: putative ribonuclease H protein A...    132   4e-30   
ref|XP_009145278.1|  PREDICTED: uncharacterized protein LOC103868985    132   5e-30   
ref|XP_008234111.1|  PREDICTED: putative ribonuclease H protein A...    128   5e-30   
ref|XP_009108245.1|  PREDICTED: putative ribonuclease H protein A...    130   5e-30   
gb|AAC28197.1|  contains similarity to reverse transcriptases           132   8e-30   
ref|XP_010678308.1|  PREDICTED: uncharacterized protein LOC104893877    130   9e-30   
ref|XP_008355518.1|  PREDICTED: putative ribonuclease H protein A...    132   9e-30   
ref|XP_009113628.1|  PREDICTED: uncharacterized protein LOC103838928    132   1e-29   
ref|XP_008222895.1|  PREDICTED: putative ribonuclease H protein A...    130   1e-29   
ref|XP_010468796.1|  PREDICTED: uncharacterized protein LOC104748915    132   1e-29   
ref|XP_009367701.1|  PREDICTED: uncharacterized protein LOC103957282    132   1e-29   
ref|XP_009149643.1|  PREDICTED: putative ribonuclease H protein A...    131   1e-29   
ref|XP_007207581.1|  hypothetical protein PRUPE_ppa018489mg             132   1e-29   
ref|XP_010236480.1|  PREDICTED: uncharacterized protein LOC104584065    132   1e-29   
ref|XP_010689378.1|  PREDICTED: uncharacterized protein LOC104903087    131   2e-29   
ref|XP_010490312.1|  PREDICTED: uncharacterized protein LOC104768075    131   2e-29   
ref|XP_010478573.1|  PREDICTED: uncharacterized protein LOC104757...    129   2e-29   
ref|XP_010501859.1|  PREDICTED: uncharacterized protein LOC104779176    126   3e-29   
gb|EAZ04413.1|  hypothetical protein OsI_26557                          127   3e-29   
ref|XP_010495331.1|  PREDICTED: uncharacterized protein LOC104772408    130   3e-29   
ref|XP_010669434.1|  PREDICTED: uncharacterized protein LOC104886665    131   3e-29   
ref|XP_004292002.1|  PREDICTED: uncharacterized protein LOC101312896    131   4e-29   
ref|XP_006655090.1|  PREDICTED: uncharacterized protein LOC102699406    130   5e-29   
emb|CDX84367.1|  BnaC03g51330D                                          129   5e-29   
ref|XP_010674775.1|  PREDICTED: uncharacterized protein LOC104890856    122   5e-29   
gb|EEC67895.1|  hypothetical protein OsI_35569                          129   5e-29   
ref|XP_004308581.1|  PREDICTED: uncharacterized protein LOC101295867    124   5e-29   
gb|EEE51862.1|  hypothetical protein OsJ_33393                          129   6e-29   
ref|XP_010474428.1|  PREDICTED: uncharacterized protein LOC104753953    129   6e-29   
ref|XP_009114067.1|  PREDICTED: putative ribonuclease H protein A...    127   8e-29   
gb|EEC84982.1|  hypothetical protein OsI_32248                          129   8e-29   
ref|XP_008387639.1|  PREDICTED: uncharacterized protein LOC103450094    130   9e-29   
ref|XP_010691921.1|  PREDICTED: uncharacterized protein LOC104905169    123   1e-28   
ref|XP_007200138.1|  hypothetical protein PRUPE_ppa017266mg             126   1e-28   
ref|XP_010030523.1|  PREDICTED: uncharacterized protein LOC104420366    122   1e-28   
ref|XP_010686132.1|  PREDICTED: uncharacterized protein LOC104900412    129   1e-28   
gb|AAS55787.1|  hypothetical protein                                    129   2e-28   
ref|XP_008374008.1|  PREDICTED: putative ribonuclease H protein A...    127   2e-28   
ref|XP_010424493.1|  PREDICTED: uncharacterized protein LOC104709611    128   2e-28   
ref|XP_008385416.1|  PREDICTED: putative ribonuclease H protein A...    127   2e-28   
ref|XP_010490174.1|  PREDICTED: uncharacterized protein LOC104767908    122   2e-28   
ref|XP_010233096.1|  PREDICTED: uncharacterized protein LOC104583080    127   3e-28   
ref|XP_009105552.1|  PREDICTED: putative ribonuclease H protein A...    125   4e-28   
ref|XP_009107709.1|  PREDICTED: putative ribonuclease H protein A...    124   4e-28   
gb|EEC68887.1|  hypothetical protein OsI_37529                          127   6e-28   
ref|XP_010495406.1|  PREDICTED: uncharacterized protein LOC104772500    127   6e-28   
gb|AAT58873.1|  hypothetical protein                                    127   7e-28   
ref|XP_010690686.1|  PREDICTED: uncharacterized protein LOC104904188    118   8e-28   
ref|XP_010495244.1|  PREDICTED: uncharacterized protein LOC104772312    127   8e-28   
gb|EEE59033.1|  hypothetical protein OsJ_10782                          126   9e-28   
ref|XP_010041058.1|  PREDICTED: uncharacterized protein LOC104429964    126   1e-27   
ref|XP_009119800.1|  PREDICTED: putative ribonuclease H protein A...    125   1e-27   
ref|XP_007216630.1|  hypothetical protein PRUPE_ppb024105mg             121   1e-27   
emb|CDX80327.1|  BnaC09g34150D                                          124   1e-27   
gb|EEC69287.1|  hypothetical protein OsI_38339                          122   2e-27   
gb|EEE51789.1|  hypothetical protein OsJ_33245                          125   2e-27   
ref|XP_010451225.1|  PREDICTED: uncharacterized protein LOC104733339    125   2e-27   
gb|AAX95129.1|  retrotransposon protein, putative, unclassified         125   3e-27   
emb|CDX68427.1|  BnaC01g25050D                                          124   3e-27   
gb|ABA91837.2|  retrotransposon protein, putative, unclassified         125   3e-27   
ref|XP_010451528.1|  PREDICTED: uncharacterized protein LOC104733662    124   3e-27   
ref|XP_008382176.1|  PREDICTED: uncharacterized protein LOC103444987    119   3e-27   
ref|XP_009121338.1|  PREDICTED: uncharacterized protein LOC103846184    124   4e-27   
emb|CAE02147.1|  OSJNBa0081G05.2                                        125   4e-27   
ref|XP_010040020.1|  PREDICTED: uncharacterized protein LOC104428773    116   4e-27   
ref|XP_008385551.1|  PREDICTED: putative ribonuclease H protein A...    123   5e-27   
gb|EEC70889.1|  hypothetical protein OsI_02427                          124   5e-27   
ref|XP_006467327.1|  PREDICTED: uncharacterized protein LOC102625297    120   6e-27   
ref|XP_010446169.1|  PREDICTED: uncharacterized protein LOC104728960    122   6e-27   
gb|EEE54811.1|  hypothetical protein OsJ_02230                          124   6e-27   
gb|EAZ40370.1|  hypothetical protein OsJ_24816                          122   6e-27   
ref|XP_008391252.1|  PREDICTED: putative ribonuclease H protein A...    122   7e-27   
ref|XP_009587735.1|  PREDICTED: uncharacterized protein LOC104085422    119   7e-27   
ref|XP_009114817.1|  PREDICTED: putative ribonuclease H protein A...    120   9e-27   
ref|XP_008387750.1|  PREDICTED: putative ribonuclease H protein A...    122   1e-26   
ref|XP_007203072.1|  hypothetical protein PRUPE_ppa023514mg             122   1e-26   
ref|XP_008338355.1|  PREDICTED: uncharacterized protein LOC103401418    123   1e-26   
ref|XP_009108046.1|  PREDICTED: putative ribonuclease H protein A...    119   1e-26   
ref|XP_010058272.1|  PREDICTED: putative disease resistance prote...    123   1e-26   
ref|XP_007212615.1|  hypothetical protein PRUPE_ppa017091mg             122   1e-26   
ref|XP_009113857.1|  PREDICTED: putative ribonuclease H protein A...    121   1e-26   
gb|EPS64876.1|  hypothetical protein M569_09903                         122   1e-26   
ref|XP_009111228.1|  PREDICTED: uncharacterized protein LOC103836687    122   2e-26   
ref|XP_007224497.1|  hypothetical protein PRUPE_ppa023013mg             121   2e-26   
ref|XP_010481146.1|  PREDICTED: uncharacterized protein LOC104759984    121   2e-26   
ref|XP_009113844.1|  PREDICTED: putative ribonuclease H protein A...    119   2e-26   



>gb|ABD33126.2| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago 
truncatula]
Length=653

 Score =   221 bits (562),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 134/345 (39%), Positives = 189/345 (55%), Gaps = 36/345 (10%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I    R  +LHGV+V + AP +SH+LFADD FLF RAN  E+  +K ILD Y  AS QL+
Sbjct  247   IKQAERNNILHGVKVCKRAPTVSHLLFADDSFLFFRANENETRALKDILDTYANASDQLI  306

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N  KS   F        +N     S       G    KYLGLPS++G++KK+I  ++KDR
Sbjct  307   NMQKSEIYFSRNVPVTKKNT---LSNMLWVSEGIGIRKYLGLPSMIGRSKKSIFNYIKDR  363

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             I + + G ++  LS+AG EVL+K+V QA+PSY M +F L  ++  +IE +LN FWW  K 
Sbjct  364   IWNRISGLSSKMLSQAGKEVLIKSVAQAIPSYCMSVFLLPHSIADDIEKMLNSFWWGMKN  423

Query  542   ARRLGIRWKAWKALCTKIKRW--LGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRY  706
               R GIRW +W+ L  + K W  +G   + G +    G Q W  LT PD++V R+FK++Y
Sbjct  424   EGRGGIRWMSWERLTMR-KEWGGMGFRHIHGFDLAMSGKQCWNFLTNPDAMVSRIFKAKY  482

Query  707   YPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             + N + + A +GHNP ++WRSI      +K  Y+  IGD  +T                 
Sbjct  483   FTNENFLGASLGHNPSYVWRSIWSSRIFLKTGYQWRIGDGSTT-----------------  525

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                      A VS L++    SW+   I + FN RD + IL IP+
Sbjct  526   ---------ATVSHLIDAQTRSWNEPLIRNNFNLRDVDEILKIPL  561



>ref|XP_007210228.1| hypothetical protein PRUPE_ppa015539mg [Prunus persica]
 gb|EMJ11427.1| hypothetical protein PRUPE_ppa015539mg [Prunus persica]
Length=787

 Score =   217 bits (553),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 130/361 (36%), Positives = 196/361 (54%), Gaps = 15/361 (4%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             RR +LHGV + RGA  +SH+ FADD FLFLRAN ++   M  I   Y   SGQ ++ +KS
Sbjct  255   RRNLLHGVNLCRGATSVSHLFFADDSFLFLRANQQDCEQMSIIFQKYEMVSGQKIHLEKS  314

Query  197   LSVF*YQY-RSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
                F     R+   N +     R+     D    YLGLP+ VG++++     +K+RI   
Sbjct  315   CVSFSNNMDRTDQDNLAAVLGVRRV----DQHDVYLGLPTHVGRSRRQCFNSLKERIWKK  370

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             ++GW    LS AG E+LLK V QA+P Y M  F +   LC EI+ ++ H+WW  +  +R 
Sbjct  371   IQGWKAKLLSFAGKEILLKVVAQAVPIYMMNCFLIPKCLCDEIQQVMAHYWWGEQDGQR-  429

Query  554   GIRWKAWKALC-TKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSD  721
              I W +W  LC  K +  LG   +Y         Q WRL+  P+SLV R+ K+RY+ N  
Sbjct  430   KIHWLSWNKLCLPKQEGGLGFRNLYAFNMALLAKQLWRLIQTPNSLVARILKARYFKNCS  489

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
             ++ A +GH+P +IW+S+ +    +++  R  IG+  S  I  D WL  +E   VS+   E
Sbjct  490   ILEAQIGHSPSYIWQSLCKARVLIEKGSRWRIGNGHSVRIWGDRWLPNSESFQVSSPQAE  549

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV----PPKVRVFAWKLAMSYS  1066
                EA V+SL+N V   W  + +   F+A + NCI NIP+    PP + ++ ++    Y+
Sbjct  550   GFDEAKVNSLINPVTVQWKENLLQAWFSAEEVNCIRNIPLSFRHPPDILIWHFERDGQYT  609

Query  1067  L  1069
             +
Sbjct  610   V  610



>ref|XP_007203344.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
 gb|EMJ04543.1| hypothetical protein PRUPE_ppa020282mg [Prunus persica]
Length=1496

 Score =   213 bits (543),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 128/361 (35%), Positives = 195/361 (54%), Gaps = 15/361 (4%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             RR +LHGV + RGAP +SH+ FADD FLFLRA+ ++   +  I   Y   SGQ ++ +KS
Sbjct  1023  RRNLLHGVNLCRGAPSVSHLFFADDSFLFLRADQQDCEQLSIIFQKYEMVSGQKIHLEKS  1082

Query  197   LSVF*YQY-RSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
                F     R+   N +     R+     D    YLGLP+ VG++++     +K+RI   
Sbjct  1083  CVSFSINMDRTDQDNLAAVLGVRRV----DQHDVYLGLPTHVGRSRRQCFNSLKERIWKK  1138

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             ++GW    LS AG E+LLK V QA+P Y M  F +   LC EI+ ++  +WW  +  +R 
Sbjct  1139  IQGWKAKLLSFAGKEILLKVVAQAVPIYMMNCFLIPKCLCNEIQQVMARYWWVEQDGQR-  1197

Query  554   GIRWKAWKALC-TKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSD  721
              I W +W  LC  K +  LG   +Y         Q WRL+  P+SLV  + K+RY+ N  
Sbjct  1198  KIHWLSWNKLCLPKQEGGLGFRNLYAFNMALLAKQLWRLIQTPNSLVACILKARYFKNCS  1257

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
             ++ A +GH+P +IW+S+ +    +++  R  IG+  S  I  D WL  +E   VS+   E
Sbjct  1258  ILEAQIGHSPSYIWQSLCKARVLIEKGSRWRIGNGHSVRIWGDRWLPNSESFQVSSPQVE  1317

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV----PPKVRVFAWKLAMSYS  1066
                EA V+SL+N V   W  D +   F+A + NCI NIP+    PP + ++ ++    Y+
Sbjct  1318  GFEEAKVNSLINPVTLQWKEDLLQAWFSAEEVNCIRNIPLSFRHPPDILIWHFERDGQYT  1377

Query  1067  L  1069
             +
Sbjct  1378  V  1378



>ref|XP_010667704.1| PREDICTED: uncharacterized protein LOC104884717 [Beta vulgaris 
subsp. vulgaris]
Length=1578

 Score =   210 bits (534),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 196/343 (57%), Gaps = 9/343 (3%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
              R  L G++VA  AP + H+LFADDC +F RA+  ++  ++  L +Y  +SGQ VN+DK+
Sbjct  915   ERNSLKGIKVAPSAPSVDHLLFADDCIVFFRASMRDAEAIQEALTIYELSSGQKVNFDKT  974

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
                F    R   Q+  +  +        D   +YLGLP++VG++KK I   VK+++   +
Sbjct  975   NISF---SRGVPQDRRNAVAVHLRVREVDIHDRYLGLPTVVGRSKKVITRGVKEKLWKKL  1031

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
             +GW    LS+AG EV++K V Q+LP+YAM +F    +LC EI  +++ FWW  K   R  
Sbjct  1032  QGWKGMVLSKAGREVMIKVVAQSLPTYAMSVFKFPSSLCDEIRSLISQFWWGQKRGER-K  1090

Query  557   IRWKAWKALC-TKIKRWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRYYPNSDL  724
             I W AWK LC  K++  LG  D+K       G Q WRL  +  SL+E+++++RYYPNS+ 
Sbjct  1091  IHWVAWKKLCRPKVEGGLGFRDMKLFNWALLGKQAWRLTLQNGSLIEQIWRARYYPNSNF  1150

Query  725   MNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
             M++ +G  P + WR I E    +++  R  +GD  S  I KD W+  ++   + +    +
Sbjct  1151  MDSNLGATPSYTWRGIWEAKWVLRRGVRWRVGDGESIRIWKDAWIPGSQSRKIISPRGNA  1210

Query  902   VREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKV  1030
               +A V +L++ +  SW  D + D+F   +A  +L+IP+  ++
Sbjct  1211  NVDAEVGALIDPITKSWKEDLVADLFLPFEAARVLSIPISHRL  1253



>ref|XP_008232623.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
 ref|XP_008238689.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=965

 Score =   204 bits (519),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 133/342 (39%), Positives = 181/342 (53%), Gaps = 18/342 (5%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R   LHGV +A  AP I+H+ FADD  LF  A T E+  +K I  +Y  ASGQ VN  KS
Sbjct  260   RDSRLHGVSIAPSAPSINHLFFADDSLLFCNAGTTEALELKRIFGVYELASGQKVNLGKS  319

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
                F     S  +   D   Q           +YLGLP++VGK+KK +   VKDR+ + V
Sbjct  320   ALCF---SPSTPRVLQDDIRQLLNVTLVPCHERYLGLPTIVGKDKKKLFRTVKDRVWNKV  376

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
              GW    LS+AG EVL+K+V QA+PSY+M +F L + LCREIE I+  FWW+    R  G
Sbjct  377   NGWQGKLLSKAGKEVLIKSVCQAIPSYSMSVFRLPVGLCREIESIIAKFWWSKNDGR--G  434

Query  557   IRWKAWKALCT-KIKRWLGVYDLKGDEPG---TQTWRLLTRPDSLVERVFKSRYYPNSDL  724
             I WK W  +C  K    LG  +L          Q WRLL  P SL+ R+ K+RY+PNSD 
Sbjct  435   IHWKKWSFMCQHKSDGGLGFRELTSFNQALLCKQGWRLLEFPHSLIARMLKARYFPNSDF  494

Query  725   MNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
             + A  G  P F W+S++   + ++   R  IGD R   I  D W+     PY      +S
Sbjct  495   LAASSGSLPSFTWQSLLWGRDLLRLGLRWRIGDGRLVNIYGDPWV-----PYDRFFTIQS  549

Query  902   VREAPVSSLMNGVGTS---WDRDCIIDVFNARDANCILNIPV  1018
             +   P +S +  + T+   WD   +   F+  +A  IL+IP+
Sbjct  550   IPTLPATSRVCDLFTASGGWDVGKVFATFSFPEAEAILSIPL  591



>ref|XP_009144596.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=390

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 117/345 (34%), Positives = 177/345 (51%), Gaps = 11/345 (3%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I    R   L G++VAR  P +SH+LFADD   F +AN EE   +  IL  Y   SGQ +
Sbjct  3     IKKAERMKQLTGMKVARACPAVSHLLFADDSLFFCKANKEECHTILRILKDYEAVSGQQI  62

Query  182   NYDKSLSVF*YQYR-SG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             N+ KS   F ++   S  Q   D    R  GG     G YLGLP  +G +K  + GFV+D
Sbjct  63    NFQKSSIQFGHKIEESSRQELRDILGIRNLGG----MGSYLGLPESLGGSKVQVFGFVQD  118

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             R+ + V+GWN  F ++ G EV++K+V+ ALP++ M ++ L     +++   +  FWW+  
Sbjct  119   RLNNRVKGWNFRFFTKGGKEVIIKSVITALPNHVMSVYRLPKATVKKLTSAVAQFWWSPG  178

Query  539   VARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRY  706
              + R G+ WK+W  LC  K    LG  DL        G Q WRL+ +P+SL  RVFK RY
Sbjct  179   ESTR-GMHWKSWDKLCEHKDNGGLGFKDLNDFNTAMLGKQLWRLIEKPNSLFSRVFKGRY  237

Query  707   YPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             Y N+  +N +  ++P + WRSI    + V +     +G   S ++  D W+        +
Sbjct  238   YRNASPLNPIRSYSPSYGWRSITSARSLVCKGLIKRVGTGSSISVWNDPWIPSTRPRPAN  297

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              + H S  +  V SL++    +W+   +  +    DA  I  IP+
Sbjct  298   KNFHNSYPDLTVDSLIHQESRTWNLQALRTLVEPEDAKLIEGIPL  342



>ref|XP_008237273.1| PREDICTED: uncharacterized protein LOC103336015 [Prunus mume]
Length=1765

 Score =   202 bits (514),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 133/342 (39%), Positives = 181/342 (53%), Gaps = 18/342 (5%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R   LHGV +A  AP I+H+ FADD  LF  A T E+  +K I  +Y  ASGQ VN  KS
Sbjct  1060  RDSRLHGVSIAPSAPSINHLFFADDSLLFCNAGTTEALELKRIFGVYELASGQKVNLGKS  1119

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
                F     S  +   D   Q           +YLGLP++VGK+KK +   VKDR+ + V
Sbjct  1120  ALCF---SPSTPRVLQDDIRQLLNVTLVPCHERYLGLPTIVGKDKKKLFRTVKDRVWNKV  1176

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
              GW    LS+AG EVL+K+V QA+PSY+M +F L + LCREIE I+  FWW+    R  G
Sbjct  1177  NGWQGKLLSKAGKEVLIKSVCQAIPSYSMSVFRLPVGLCREIESIIAKFWWSKNDGR--G  1234

Query  557   IRWKAWKALCT-KIKRWLGVYDLKGDEPG---TQTWRLLTRPDSLVERVFKSRYYPNSDL  724
             I WK W  +C  K    LG  +L          Q WRLL  P SL+ R+ K+RY+PNSD 
Sbjct  1235  IHWKKWSFMCQHKSDGGLGFRELTSFNQALLCKQGWRLLEFPHSLIARMLKARYFPNSDF  1294

Query  725   MNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
             + A  G  P F W+S++   + ++   R  IGD R   I  D W+     PY      +S
Sbjct  1295  LAASSGSLPSFTWQSLLWGRDLLRLGLRWRIGDGRLVNIYGDPWV-----PYDRFFTIQS  1349

Query  902   VREAPVSSLMNGVGTS---WDRDCIIDVFNARDANCILNIPV  1018
             +   P +S +  + T+   WD   +   F+  +A  IL+IP+
Sbjct  1350  IPTLPATSRVCDLFTASGGWDVGKVFATFSFPEAEAILSIPL  1391



>gb|ABN08038.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago 
truncatula]
Length=573

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 177/348 (51%), Gaps = 45/348 (13%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I N   RG +HGV++ R  P ISH+LFADD FLF +A   E+  +K I+   T + G   
Sbjct  215   IKNHEFRGKIHGVRICRTTPSISHLLFADDNFLFCKATESEAQYVKDIISSITASLGVHN  274

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N                                  +GKYLGLPS+VG+NK AI  ++KDR
Sbjct  275   NIG--------------------------------SGKYLGLPSMVGRNKNAIFSYLKDR  302

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             I    + W+   LSRA  EVL+K+V QA+PSY M  F +  +LC E+E ++N F+W  K 
Sbjct  303   IWKKCQSWSVRSLSRADKEVLIKSVAQAIPSYCMGAFLIPASLCEELERMMNSFYWGSKK  362

Query  542   ARRLGIRWKAWKALCTKIKRWLGVYDLKGDEP------GTQTWRLLTRPDSLVERVFKSR  703
               R GI W  W  L   + + LG    +  E       G Q W+LL+   SL  R+ K++
Sbjct  363   NGRRGINWMRWDFL--TLHKSLGGLGFRNLEAFNLSMLGKQGWKLLSDSSSLFTRILKAK  420

Query  704   YYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL--VMAEDP  874
             Y+P  D ++A +GHNP + WRS+    + +   +R  IGD     +    W+  +++  P
Sbjct  421   YFPRRDFLDATLGHNPSYTWRSLWSTQSLLTLGHRWKIGDGSKINVWSMPWIRNLLSLKP  480

Query  875   YVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
               S  LH+   +  V+SL++    SWD   +  +FN  +A  IL+ P+
Sbjct  481   STSPPLHQ--HDLTVNSLLSADFNSWDTTLVQSLFNDAEAAAILSTPL  526



>gb|ABO80476.1| RNA-directed DNA polymerase , related [Medicago truncatula]
Length=405

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 124/349 (36%), Positives = 181/349 (52%), Gaps = 36/349 (10%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I   + RG +HGV+V RGAP +SH+LFAD+CFLF RAN  E+  +  IL  Y  ASGQ +
Sbjct  43    IHKEVNRGDIHGVKVCRGAPVVSHLLFADNCFLFCRANVVEAQRLLTILKTYEAASGQEI  102

Query  182   NYDKSLSVF*YQYRSG*--QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVK  355
             N  KS  VF  +  SG   ++ S     R   G    TGKYLGLPS++ ++K ++  F+K
Sbjct  103   NLSKS-EVFFSRNMSGAAQEDLSRIIGVRHVMG----TGKYLGLPSMIDRDKWSVFSFIK  157

Query  356   DRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTG  535
             D I   +  W    LS+AG EV++K+VLQ++PSY M I+ L  ++  +IE ++N FWW G
Sbjct  158   DSIWKRINVWRGRALSKAGKEVMIKSVLQSIPSYIMSIYLLPSSVIDDIEKMVNAFWWGG  217

Query  536   KVARRLGIRWKAWKAL-CTKIKRWLGVYDLKG---DEPGTQTWRLLTRPDSLVERVFKSR  703
             +   R GI+W AW+ + C K    +G  + K         Q W LL+ P+SLV RVFKSR
Sbjct  218   RSNNR-GIKWMAWEHMACPKEFGGMGFRNFKAFNIAMVAKQGWSLLSTPESLVARVFKSR  276

Query  704   YYPNSDLMNAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             Y+P S  + A                          +G+ +  ++  D W+   +   + 
Sbjct  277   YFPRSSFLGA------------------------KLVGNGQQVSVMNDPWVRGVQGSCIQ  312

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKV  1030
             +   + V    VS L+      WD D I  +F       IL+ P+  +V
Sbjct  313   SPQSQGVHILSVSDLIADEDRVWDVDKIESLFPDDMVQAILDTPLFAEV  361



>ref|XP_008242862.1| PREDICTED: uncharacterized protein LOC103341160 [Prunus mume]
Length=872

 Score =   195 bits (496),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 186/344 (54%), Gaps = 14/344 (4%)
 Frame = +2

Query  14    MRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDK  193
             ++ G+++G++V+R AP +SH+ FADD   F++A  E  + +KG+LD Y  ASGQL+NY+K
Sbjct  235   VQDGVINGIRVSRRAPILSHLFFADDSLFFIKAEEENCSRLKGLLDDYCLASGQLINYEK  294

Query  194   SLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
             S  +F     +  ++     S        D +G YLG+P   G++KK +L ++++R+   
Sbjct  295   SSLMF---SANTPEDVKTNISSIMGIRGFDNSGIYLGIPMTWGRSKKVVLAYIRERVAKK  351

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             + GW    LS AG EVL+K +  A+P+Y MM F     +C EI   +  FWW GK     
Sbjct  352   IMGWKQGTLSMAGKEVLIKAIATAVPAYPMMCFKFPKVVCNEISSNIAKFWW-GKSEGGN  410

Query  554   GIRWKAWKALC-TKIKRWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRYYPNSD  721
             GI WK+WKALC  K    LG  DL          Q+WR+++ P++L  R+ K+RYYP+ +
Sbjct  411   GIHWKSWKALCLAKGDGGLGFRDLTEFNLALLAKQSWRIISTPNALWVRILKARYYPDCE  470

Query  722   LMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
               +AV GH P +IW SI+E  +A+    R  I +   T I  D W+    D  + T +  
Sbjct  471   FKDAVLGHRPSWIWTSILEGRDALMGRARVQIINGADTNIWGDNWI---PDNGIITPITH  527

Query  899   SVREAP--VSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPP  1024
                 AP  VS ++N    +W  D +    +      IL IP+ P
Sbjct  528   VPPNAPQMVSDIINLHNRTWSLDRVSSYLSWETQKQILAIPIGP  571



>ref|XP_007207773.1| hypothetical protein PRUPE_ppa026368mg, partial [Prunus persica]
 gb|EMJ08972.1| hypothetical protein PRUPE_ppa026368mg, partial [Prunus persica]
Length=1060

 Score =   196 bits (499),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 125/349 (36%), Positives = 185/349 (53%), Gaps = 31/349 (9%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             RRG L GVQVARGAP ++H+LFADD  LF++A  ++   ++ +   Y   +GQ +NY KS
Sbjct  363   RRGDLVGVQVARGAPSVTHLLFADDSILFMKATNKDCMALETLFQTYEEVTGQQINYSKS  422

Query  197   -LSVF*YQYRS------G*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVK  355
              LS+     R+      G  N    R              YLGLP++ GK +K +   +K
Sbjct  423   ALSLSPNATRADFDMIEGVLNVPVVRCHEN----------YLGLPTIAGKGRKQLFQHLK  472

Query  356   DRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTG  535
             D++   + GW    LSRAG E+L+K VLQA+P+Y+M  F +   LC+E+  I+  FWW  
Sbjct  473   DKLWKHISGWKEKLLSRAGKEILIKAVLQAIPTYSMSCFRIPKGLCKELNGIMARFWW-A  531

Query  536   KVARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSR  703
             K   + GI W  W+ LC +K    LG  DL+         Q WR+L  P+SLV R+F++R
Sbjct  532   KAKDKRGIHWVKWELLCKSKFAGGLGFRDLEAFNQALLAKQCWRILRTPESLVARIFRAR  591

Query  704   YYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYV  880
             Y+P+   + A VG NP FIWRS+      + +  R  +G   S  +  D WL     P  
Sbjct  592   YHPSVPFLEAEVGTNPSFIWRSLQWGKELLNKGLRWRVGSGVSIQVYTDKWL-----PAP  646

Query  881   STHLHESVREAPVSSLMNGVGTS---WDRDCIIDVFNARDANCILNIPV  1018
             S     S  + P+S+ +  + TS   W+   + D+F  ++ + IL IP+
Sbjct  647   SCFKIMSPPQLPLSTRVCDLFTSSGQWNVPLLKDIFWDQEVDAILQIPL  695



>emb|CAN76892.1| hypothetical protein VITISV_005356 [Vitis vinifera]
Length=1793

 Score =   197 bits (502),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 123/346 (36%), Positives = 180/346 (52%), Gaps = 15/346 (4%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R G+LHG  VARGAP +SH+ FAD+ +LF +A   ES ++K IL  Y   SGQ +N +K 
Sbjct  1215  RCGVLHGCSVARGAPXVSHLFFADBSYLFFKATESESRSLKQILLRYQNLSGQEINLNKX  1274

Query  197   LSVF*YQYRSG*QN--CSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILS  370
                F        +   CS  + + QA       G YLG+P++VGKNK+ +  FV+ ++ +
Sbjct  1275  ALTFSRNTDDVVKRGICSILQVEEQA-----DPGIYLGMPAVVGKNKRQLFEFVRRKVWN  1329

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
              ++ WN   LSRAG E+ LK V Q++P+Y M +  L   LCR+IE ++N F+W      R
Sbjct  1330  RIQNWNGRRLSRAGKEICLKTVAQSIPTYVMQLLLLPKDLCRDIESMMNXFFWDSNPQXR  1389

Query  551   LGIRWKAWKALCTKIKR----WLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNS  718
               IRW +W  +C + K     +  + D        Q  R L   DSLV  +F++RY+ NS
Sbjct  1390  -SIRWMSWXKMCKQKKDGGLGFRKLEDFNLALLAKQGXRFLQNLDSLVTIIFQARYFRNS  1448

Query  719   DLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLH  895
               +NA +G NP ++WRSI+   + +K     SI       +  D WL  + +  + T   
Sbjct  1449  SFLNAELGSNPSYMWRSILAAQDLLKMGCYWSIASGTKVQVWGDSWLPNSSNRLIITPHV  1508

Query  896   ESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR  1033
                    V  L+      W  D I D F  RDA+ IL+IP+P   R
Sbjct  1509  ADFDGIKVDELI--TKGLWHEDFIRDKFMGRDADLILSIPLPMSSR  1552



>ref|XP_010667378.1| PREDICTED: uncharacterized protein LOC104884431 [Beta vulgaris 
subsp. vulgaris]
Length=1243

 Score =   197 bits (500),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 122/347 (35%), Positives = 183/347 (53%), Gaps = 13/347 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I  + +  ++HG + +R  P I H+LFADD  LF RA  +E   +   L+ Y  ASGQ +
Sbjct  548   IQRKTQEKLIHGAKASRSGPEIFHLLFADDSLLFTRATRQECFEIVDTLNRYELASGQKI  607

Query  182   NYDKSLSVF*YQYRSG*Q-NCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             NY+KS   F        +         RQ     +   KYLG+PS+ G++KK +   + D
Sbjct  608   NYEKSEVSFSKGVSIAQKVELMGILKMRQV----EKHEKYLGIPSITGRSKKLMFDSLLD  663

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             RI   ++GW    LSRAG EVLLK V+QA+P+Y M ++ +  T+ ++I+  +  FWW   
Sbjct  664   RIWKKLQGWKEKLLSRAGKEVLLKAVIQAVPTYLMGVYKIPATIIQKIQAAMARFWWGSS  723

Query  539   VARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRY  706
              A+R  I WK W+A+CT K    +G  DL        G Q WRL+  P SL+ RV K++Y
Sbjct  724   DAKR-KIHWKNWEAMCTLKCLGGMGFKDLTVFNDALLGRQAWRLINAPHSLLGRVMKAKY  782

Query  707   YPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             YP+ D ++A +G++  + WRSI      VK+     +GD  +  I +  WL      +++
Sbjct  783   YPSCDFIDASLGYSNSYSWRSIWSAKALVKEGLVWRVGDGENINIWEAPWLADENSRHIT  842

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPP  1024
             +     +    VS L++     W  D I + FN RD  CIL IP+ P
Sbjct  843   SPRRNDL--MVVSQLIDPHTKEWRYDVIDEYFNERDRKCILAIPLNP  887



>emb|CCA66044.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score =   197 bits (500),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 123/345 (36%), Positives = 189/345 (55%), Gaps = 13/345 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I  +++   LHG + +R  P ISH+ FAD   LF RA+ +E A +  IL+LY  ASGQ +
Sbjct  659   IQKKVQEKQLHGAKASRSGPVISHLFFADVSLLFTRASRQECAIIVEILNLYEQASGQKI  718

Query  182   NYDKSLSVF*YQYR-SG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             NYDKS   F      +  +  S+    +Q     +   KYLG+PS+ G+++ AI   + D
Sbjct  719   NYDKSEVSFSKGVSIAQKEELSNILQMKQV----ERHMKYLGIPSITGRSRTAIFDSLMD  774

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             RI   ++GW    LSRAG E+LLK+V+QA+P+Y M ++ L  ++ ++I   +  FWW   
Sbjct  775   RIWKKLQGWKEKLLSRAGKEILLKSVIQAIPTYLMGVYKLPCSIIQKIHSAMARFWWGSS  834

Query  539   VARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRY  706
               +R  I WK W +LCT K    +G  DL+       G Q WRL+  P SL+ RV K++Y
Sbjct  835   DTQR-RIHWKNWDSLCTLKCFGGMGFRDLRVFNDALLGRQAWRLVREPHSLLARVMKAKY  893

Query  707   YPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             Y N D ++A +G +  + WRSI      +K+     IG+  +  I +D W++     +++
Sbjct  894   YSNHDFLDAPLGVSTSYSWRSIWSSKALLKEGMVWRIGNGTNVRIWEDPWVLDELGRFIT  953

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +  H ++    VS L++     W    I  VFN RD  CIL+IP+
Sbjct  954   SEKHGNLNM--VSELIDFDRMEWKVSLIETVFNERDIKCILSIPL  996



>ref|XP_006493121.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Citrus sinensis]
Length=968

 Score =   195 bits (495),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 120/340 (35%), Positives = 176/340 (52%), Gaps = 18/340 (5%)
 Frame = +2

Query  26    MLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSV  205
             ++HG++ + G   I+H+LFADD  +F RA  E+  N+K + D Y  ASGQ+ N++KS   
Sbjct  278   LIHGLKFS-GNLSITHLLFADDSLVFTRATKEDCTNLKQLFDCYAAASGQIFNFEKSSMF  336

Query  206   F*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGW  385
             F    + G         Q Q     +   KYLGLPS+VG+ K +    +K RI++ +  W
Sbjct  337   FSENAKQGQITTIKDIFQLQVVSRHE---KYLGLPSMVGRKKTSFFNEIKLRIINKISNW  393

Query  386   NT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRW  565
                F S  G E+L+K V QA+P+YAM +F L + LC +++  +  FWW GK   +  I W
Sbjct  394   QANFFSSGGKEILIKAVAQAVPAYAMSVFKLPLGLCEDMQKAIAGFWW-GKKREKRSIHW  452

Query  566   KAWKALCTKIKR-WLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA  733
               W+ LC   KR  LG  DL          Q+WR++  P+SLV RV K +Y+ +S  M A
Sbjct  453   SKWERLCQAKKRGGLGFRDLSSFNQALVAKQSWRIIQAPESLVARVMKEKYFRHSCFMEA  512

Query  734   -VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVRE  910
              +G NP +IWRSI+     +++  R  IGD +   + +  WL     P   T    S   
Sbjct  513   QIGSNPSYIWRSILWGREVIRKGLRWRIGDGKLVKVYQSGWL-----PRPETFKPISPPS  567

Query  911   APVS---SLMNGVGTSWDRDCIIDVFNARDANCILNIPVP  1021
              P+    S++      W  D I   F+  DA  IL IP+P
Sbjct  568   LPLDTTVSVLIDEDQCWRDDVIRQHFHQEDAAQILKIPLP  607



>ref|XP_002454941.1| hypothetical protein SORBIDRAFT_03g001780 [Sorghum bicolor]
 gb|EES00061.1| hypothetical protein SORBIDRAFT_03g001780 [Sorghum bicolor]
Length=631

 Score =   192 bits (488),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 119/343 (35%), Positives = 191/343 (56%), Gaps = 18/343 (5%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             ++G + G+++ RGAP ++H+ FADD  + +RA   ++  ++ ILD+Y  ASGQ++N +KS
Sbjct  241   QKGKIEGIKICRGAPKVNHLFFADDSLILMRARASDALELRRILDVYEKASGQVINKEKS  300

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
               +F     +G  + S  RS         +T KYLGLP  +GK++K    ++K +I S +
Sbjct  301   SMMF--SPNTGQHDRSLMRSNLSITDEA-STEKYLGLPVNIGKSRKKPFEYIKKKIWSRI  357

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
             +GW    LS+AG E+L+K V Q++P+YAM  F L+  LC E+  I+  +WW+ +  +   
Sbjct  358   QGWQEKLLSKAGKEILIKAVAQSIPTYAMSCFDLTKGLCDELSSIIGRYWWSQQ-DKANK  416

Query  557   IRWKAWKALC-TKIKRWLGVYDLKGDEPGT---QTWRLLTRPDSLVERVFKSRYYPNSDL  724
             I W +W+ L  +K K  LG  DL          Q WRLLT PDSL  +V K+RY+P+SD+
Sbjct  417   IHWISWEKLTQSKEKGGLGFRDLHLFNLAMLSRQAWRLLTNPDSLCGQVLKARYFPHSDI  476

Query  725   MNAVGHNPL-FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
             ++      + + WRSI++    +K+     IG+ ++  I +  W+     P   T    +
Sbjct  477   LHCSPRPRISYTWRSILKGVALLKEGIIWRIGNGKNVKIWEHPWI-----PKGITRKPIT  531

Query  902   VREAP----VSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              R A     V+ L+N V   WD   + D+F  +DA  IL IP+
Sbjct  532   PRGASLLTRVNELINPVTGEWDEQLVNDLFWPQDAEEILQIPI  574



>ref|XP_010490159.1| PREDICTED: uncharacterized protein LOC104767890 [Camelina sativa]
Length=1712

 Score =   196 bits (497),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 181/345 (52%), Gaps = 20/345 (6%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             RG + G++VAR AP +SH+LF DD   + + N +E  ++  ILD Y  ASGQ +NY KS 
Sbjct  991   RGKITGLKVARSAPSVSHLLFTDDSIFYCKENDDELQHLISILDEYNIASGQRINYQKSS  1050

Query  200   SVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
               F    R   Q   D         +    G YLGLP   G +K  IL ++K+R+   V 
Sbjct  1051  IYF---GRRITQERRDLIKALTGIAAEGGQGFYLGLPEAFGGSKVTILRYLKERLQHKVS  1107

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
             GW T FLS  G E+LLK++  ALPS+ +  F L  T+ +++  ++  FWW  K   + G+
Sbjct  1108  GWQTNFLSFGGKEILLKSIAMALPSHTISCFKLPKTVSQQLASVMADFWWRNKQNSK-GM  1166

Query  560   RWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLM  727
              W+AW+ L   K +  LG  +++       G Q WR+L  P+SL+ RVFKSRY+  S  +
Sbjct  1167  HWRAWEHLSKPKSEGGLGFKEIEAYNIALFGKQLWRMLMNPNSLIARVFKSRYFSKSSPL  1226

Query  728   NA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTH-----  889
             +A +G  P F WRSI E    +KQ  R  IG+  S  + +D WL     P +S H     
Sbjct  1227  SAKLGSRPSFAWRSIHEAQELLKQGVRAIIGNGESVNLWQDPWL--GSKPALSLHNVCII  1284

Query  890   ---LHESVRE-APVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
                LH+SV +   V  +M     +W +D +  +F   D N I N+
Sbjct  1285  PSDLHKSVSKLMKVKDIMEDSRRAWRQDLLDTLFTMEDRNSIGNL  1329



>ref|XP_010693052.1| PREDICTED: uncharacterized protein LOC104906048 [Beta vulgaris 
subsp. vulgaris]
Length=1259

 Score =   194 bits (494),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 187/345 (54%), Gaps = 13/345 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I  +++   LHG + +R  P ISH+ FADD  LF RA+ +E   +  IL+ Y  ASGQ +
Sbjct  563   IQKKVQGKQLHGAKASRSGPVISHLFFADDSLLFTRASRQECTIIVDILNRYEKASGQKI  622

Query  182   NYDKSLSVF*YQYRSG*-QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             NY+KS   F     +   ++ ++    RQ     D   KYLG+PS+ G+++ AI   + D
Sbjct  623   NYEKSEVSFSKGVSTAQKEDLTNILHMRQV----DRHVKYLGIPSITGRSRTAIFDSLMD  678

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             RI   ++GW    LSRAG E+LLK+V+QA+P+Y M ++ L  ++ ++I   +  FWW   
Sbjct  679   RIWKKLQGWKEKLLSRAGKEILLKSVIQAIPTYLMGVYKLPCSIIQKIHSAMARFWWGSS  738

Query  539   VARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRY  706
                R  I WK+W +LCT K    +G  DL+       G Q WRL+  P SL+ RV K++Y
Sbjct  739   DTHR-KIHWKSWDSLCTLKCFGGMGFRDLRVFNDALLGRQAWRLVREPHSLLARVMKAKY  797

Query  707   YPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             Y N D ++A +G +  + W SI      +K+     IG+  +  I +D WL+     +++
Sbjct  798   YSNFDFLDAPLGVSTSYTWSSIWSSKALLKEGMVWRIGNGTNVRIWEDPWLLDELGRFIT  857

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +  H  +    VS L++     W    I  +FN RD  CIL+IP+
Sbjct  858   SEKHGDL--TMVSELIDFDRMEWKVSLIEALFNDRDIKCILSIPL  900



>ref|XP_007212800.1| hypothetical protein PRUPE_ppa020180mg [Prunus persica]
 gb|EMJ13999.1| hypothetical protein PRUPE_ppa020180mg [Prunus persica]
Length=1072

 Score =   192 bits (488),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 124/349 (36%), Positives = 183/349 (52%), Gaps = 31/349 (9%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             RRG L GVQVARGAP ++H+LFADD  LF++A  +    ++ +   Y   +GQ +NY KS
Sbjct  613   RRGDLVGVQVARGAPSVTHLLFADDSILFMKATNKACMALETLFQTYEEVTGQQINYSKS  672

Query  197   -LSVF*YQYRS------G*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVK  355
              LS+     R+      G  N    R              YLGLP++ GK +K +   +K
Sbjct  673   ALSLSPNATRADFDMIEGGLNVPVVRCHEN----------YLGLPTIAGKGRKQLFQHLK  722

Query  356   DRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTG  535
             D++   + GW    LSRAG E+L+K VLQA+P+Y+M  F +   LC+E+  I+  FWW  
Sbjct  723   DKLWKHISGWKEKLLSRAGKEILIKAVLQAIPTYSMSCFQIPKGLCKELNGIMARFWW-A  781

Query  536   KVARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSR  703
             K   + GI W  W+ LC +K    LG  DL+         Q WR+L  P+SLV R+F++R
Sbjct  782   KAKDKRGIHWVKWELLCKSKFAGGLGFRDLEAFNQALLAKQCWRILRTPESLVARIFRAR  841

Query  704   YYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYV  880
             Y+P+   + A VG NP FIW S+      + +  R  +G   S  +  D WL     P  
Sbjct  842   YHPSVPFLEAEVGTNPSFIWGSLQWGKELLNKGVRWRVGSGVSIQVYTDKWL-----PAP  896

Query  881   STHLHESVREAPVSSLMNGVGTS---WDRDCIIDVFNARDANCILNIPV  1018
             S     S  + P+S+ +  + TS   W+   + D+F  ++ + IL IP+
Sbjct  897   SCFKIMSPPQLPLSTRVCDLFTSSGQWNVPLLKDIFWDQEVDAILQIPL  945



>ref|XP_002468588.1| hypothetical protein SORBIDRAFT_01g048580 [Sorghum bicolor]
 gb|EER95586.1| hypothetical protein SORBIDRAFT_01g048580 [Sorghum bicolor]
Length=517

 Score =   187 bits (475),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 115/345 (33%), Positives = 184/345 (53%), Gaps = 26/345 (8%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G + G+++ RGAP ++H+ FADD  + +RA  E++  +K IL++Y  ASGQ++N DKS  
Sbjct  86    GKIEGIKICRGAPRVNHLFFADDSLMLMRARKEDAHELKHILEIYERASGQVINKDKSSI  145

Query  203   VF*YQYRSG*QNCSD---*RSQRQAGGSGDT-TGKYLGLPSLVGKNKKAILGFVKDRILS  370
             +F         N SD    + +++     +  + KYLG P   GK++K    ++K RI +
Sbjct  146   MF-------SPNTSDYFKGKMRKELSIMQEARSEKYLGGPISTGKSRKKAFEYIKQRIWA  198

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
              ++GW    LS+AG E+L+K V QA+P+YAM  F+L+ + C ++  ++  +WW+ +  + 
Sbjct  199   RIQGWQEKLLSKAGKEILIKAVAQAIPTYAMSYFNLTKSFCDDLSSMVGRYWWSEQ-DKT  257

Query  551   LGIRWKAWKALCTKIKR----WLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNS  718
               I W +W+ L    KR    +  +Y         Q WR+L  PD+L  RV K+RY+PNS
Sbjct  258   NKIHWLSWEKLTLSKKRGGLGFRDLYHFNLAMLARQAWRILIEPDTLCGRVLKARYFPNS  317

Query  719   DLMNAVGH-NPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLH  895
             +++        L+ WRSI++  N +K+     IG   +  I  D W+     P  +T   
Sbjct  318   NILQCKARAGILYTWRSIIDGINLLKEGIIWRIGSGSNVNIWTDPWI-----PRGTTRKP  372

Query  896   ESVRE----APVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              + R       VS L+N    +WD + I DVF   DA  IL IP 
Sbjct  373   ITPRGRYLITKVSDLINPSTGTWDENLISDVFWPEDAEAILMIPT  417



>ref|XP_010666976.1| PREDICTED: uncharacterized protein LOC104884079 [Beta vulgaris 
subsp. vulgaris]
Length=1268

 Score =   192 bits (489),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 123/350 (35%), Positives = 183/350 (52%), Gaps = 23/350 (7%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I  +++   LHG + +R  P ISH+LFADD  LF RA  +E   +  IL+ Y  A GQ +
Sbjct  573   IQKKVQEKRLHGAKASRSEPEISHLLFADDSLLFTRATRQECFEIVDILNRYELAFGQKI  632

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQA------GGSGDTTGKYLGLPSLVGKNKKAIL  343
             NY+KS   F    R           Q++A          +   KYLG+P + G++KK I 
Sbjct  633   NYEKSEVSFSKGVRV---------EQKEALMGILKMRQVEKHEKYLGIPFVAGRSKKLIF  683

Query  344   GFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHF  523
               + DRI   ++GW    LSRAG EVLLK V+QA+P+Y M  + L   + ++I+  +  F
Sbjct  684   ASLLDRIWKKLQGWKEKLLSRAGKEVLLKAVIQAIPTYLMGGYKLPTMIIQKIQAAMARF  743

Query  524   WWTGKVARRLGIRWKAWKALCT-KIKRWLGVYDL---KGDEPGTQTWRLLTRPDSLVERV  691
             WW     +R  I WK W+A+CT K    +G  DL        G Q WRL+  P SL+ RV
Sbjct  744   WWGSSDTKR-KIHWKNWEAMCTLKCLGGMGFKDLGVFNDALLGRQAWRLIHAPQSLLSRV  802

Query  692   FKSRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAE  868
              K++YYP+ + ++A +G++  + WRSI      VK+     +G+ +S  I +  W+V   
Sbjct  803   LKAKYYPSCEFLDASLGYSCSYSWRSIWSAKALVKEGLVWRVGNGQSINIWEAPWVVDEN  862

Query  869   DPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
               Y+++  +  +    V  L++     W  D I  VFN RD  CIL IP+
Sbjct  863   GRYITSPRNNDI--TMVQHLIDPNNIEWRLDVIDAVFNERDKKCILAIPL  910



>ref|XP_010696021.1| PREDICTED: uncharacterized protein LOC104908596 [Beta vulgaris 
subsp. vulgaris]
Length=710

 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 117/351 (33%), Positives = 185/351 (53%), Gaps = 17/351 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I  ++   +LHG + +R  P ISH+LF DD  LF RA  +E   +  IL+ Y  ASGQ +
Sbjct  83    IQQKVDARLLHGAKASRNGPEISHLLFVDDSLLFTRATRQECLTIVDILNQYEQASGQKI  142

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQR---QAGGSGDTTGKYLGLPSLVGKNKKAILGFV  352
             NYDKS   F     SG   C + + +          +   KY G+P++ G++KK +   +
Sbjct  143   NYDKSEVSF-----SG-GVCRERQEELINLLQMKKVEKHQKYPGIPTICGRSKKMLFRGL  196

Query  353   KDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWT  532
              DR+   +RGW    LSRAG EVL+K V+QA+P+Y M ++   + +  E +  +  FWW 
Sbjct  197   LDRMWKKLRGWKEKLLSRAGKEVLIKAVIQAIPTYLMGVYKFPVAIIHEFKSAMARFWWG  256

Query  533   GKVARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKS  700
             G    R  + W +W  LC  K    LG  DL+       G Q WRL+   +SL+ RVF +
Sbjct  257   GSGDER-KMHWLSWDKLCKPKCLGGLGFKDLEVFNDALLGRQVWRLVQHKNSLLSRVFSA  315

Query  701   RYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPY  877
             +YYP+ +++ A +GH+  F WRSI    + VK+     +G+ ++  I +D W+   +  +
Sbjct  316   KYYPHGNVLEARLGHSNSFSWRSIWSAKSLVKEVLMCRVGNGQNIDIWQDPWVGDDKGRF  375

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKV  1030
             + +   E+++   V  L++     W  D I   FN RD +CI +IP+  + 
Sbjct  376   IESDRCENLK--VVGDLIDYARMEWRCDVIEQNFNERDQHCIFSIPLSSRC  424



>gb|AAB82639.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1374

 Score =   191 bits (485),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/288 (40%), Positives = 164/288 (57%), Gaps = 15/288 (5%)
 Frame = +2

Query  17   RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
            ++  + G++VARGAPPISH+LFADD   + + N E    +  I++ Y+ ASGQ VNY KS
Sbjct  660  QKNQITGLKVARGAPPISHLLFADDSMFYCKVNDEALGQIIRIIEEYSLASGQRVNYLKS  719

Query  197  LSVF*YQYRSG*QNCSD*RS---QRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRIL  367
             S++  ++ S  + C   R    +R+ G      G YLGLP     +K A L ++KDR+ 
Sbjct  720  -SIYFGKHISEERRCLVKRKLGIEREGG-----EGVYLGLPESFQGSKVATLSYLKDRLG  773

Query  368  SWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVAR  547
              V GW + FLS  G E+LLK V  ALP+Y M  F +  T+C++IE ++  FWW  K   
Sbjct  774  KKVLGWQSNFLSPGGKEILLKAVAMALPTYTMSCFKIPKTICQQIESVMAEFWWKNKKEG  833

Query  548  RLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPN  715
            R G+ WKAW  L   K    LG  +++       G Q WR++T  DSL+ +VFKSRY+  
Sbjct  834  R-GLHWKAWCHLSRPKAVGGLGFKEIEAFNIALLGKQLWRMITEKDSLMAKVFKSRYFSK  892

Query  716  SDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL  856
            SD +NA +G  P F W+SI E    +KQ  R  IG+  +  +  D W+
Sbjct  893  SDPLNAPLGSRPSFAWKSIYEAQVLIKQGIRAVIGNGETINVWTDPWI  940



>ref|XP_010513002.1| PREDICTED: uncharacterized protein LOC104788940 [Camelina sativa]
Length=1347

 Score =   191 bits (485),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 120/351 (34%), Positives = 176/351 (50%), Gaps = 14/351 (4%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R G + G+Q++ G P +SH+LFADD   FL+AN   S N+  I   Y  ASGQ++N++KS
Sbjct  633   REGRIQGIQISNGGPRVSHLLFADDSLFFLKANYRNSVNLLQIFKDYGDASGQIINFEKS  692

Query  197   LSVF*YQ-YRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
                F  + Y+          S    GG G    KYLGLP   G+ KK +L ++   +   
Sbjct  693   SITFGSRVYQQTRDRIKHILSIPNVGGGG----KYLGLPKQFGRRKKEMLQYIHTHVKQK  748

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
               GW T FL+ AG E L+K+V  A+P Y+M  F L   LC E++ ++  FWW G    + 
Sbjct  749   TDGWQTRFLNTAGKETLIKSVAFAMPVYSMNCFELPKKLCSELDSLIARFWW-GSTQEKK  807

Query  554   GIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
              I W AWK L T K +  LG  D           Q W++L RPD+L+ R+ K+RY+ ++ 
Sbjct  808   KISWVAWKKLVTSKNEGGLGFRDFHLFNQALLANQAWKILQRPDNLIYRLLKARYFRDTS  867

Query  722   LMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
               +A  G  P + W S+      +K   + SIGD R T +G D WL     P     +  
Sbjct  868   FFSASWGTKPSYSWNSLRFGRELLKSGIQYSIGDGRLTKLGVDPWLP-TNPPRPPLLIRA  926

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP--PKVRVFAW  1045
                E PVS++++ V   WD   +    + RD + I    +P  P +  + W
Sbjct  927   EDAEMPVSTIIDPVSFHWDELQVQRFIDPRDHHLIYKTYLPQIPALDSYIW  977



>ref|XP_010686122.1| PREDICTED: uncharacterized protein LOC104900404 [Beta vulgaris 
subsp. vulgaris]
Length=1546

 Score =   190 bits (483),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 122/353 (35%), Positives = 181/353 (51%), Gaps = 23/353 (7%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I  ++    LHG + +R  P ISH+LFADD  LF RA  +E   +  IL+ Y  ASGQ +
Sbjct  850   IQQKVLSKELHGAKASRSGPEISHLLFADDSLLFTRATRQECLKIVDILNKYEAASGQKI  909

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RS------QRQAGGSGDTTGKYLGLPSLVGKNKKAIL  343
             NY+KS   F     S   NC    S       RQ     D   KYLG+P+L G++KK + 
Sbjct  910   NYEKSEVSF-----SKGVNCVQRESLSGILQMRQV----DRHQKYLGIPTLWGRSKKGMF  960

Query  344   GFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHF  523
               + DR+   +RGW    LSRAG EVL+K V+Q+LP+Y M ++   + + +EI   +  F
Sbjct  961   RDLLDRVWKKLRGWKEKLLSRAGKEVLIKAVIQSLPTYLMGVYKFPVVIIQEIHSAMARF  1020

Query  524   WWTGKVARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERV  691
             WW GK   R  + W +W+ +   K    +G  DL        G Q WRLL   +SL+ RV
Sbjct  1021  WWGGKGMER-KMHWVSWEKMSKPKCLGGMGFKDLSVFNDALLGRQVWRLLHYKNSLLSRV  1079

Query  692   FKSRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAE  868
               ++YYP+ D++ A +G +  F WRSI    + V++     +G  R+  I  D W+    
Sbjct  1080  LSAKYYPDGDVLQARLGFSNSFSWRSIWSAKSLVQEGLMWRVGGGRNINIWSDPWVGDER  1139

Query  869   DPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPK  1027
               ++ ++  E +    VS L++     W  + I   F  RD  CIL+IP+  +
Sbjct  1140  GRFILSNRAEGLN--TVSDLIDDTTKEWKFEAIEQHFGERDQQCILSIPLSSR  1190



>ref|XP_009119675.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1046

 Score =   189 bits (480),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 182/351 (52%), Gaps = 26/351 (7%)
 Frame = +2

Query  8     NRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNY  187
              +MR+  + G++VAR APP++ +LFADD  ++     EE   +  IL  Y+ ASGQ +NY
Sbjct  324   EQMRK--ISGLRVARRAPPVTQLLFADDSMMYCTGTEEELEQISQILQTYSMASGQRINY  381

Query  188   DKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVK  355
              KS   F        +N    R +      G  T    G YLGLP     +K +IL ++K
Sbjct  382   QKSSVYFG-------KNIPRGRREEILQKLGIETIGGDGLYLGLPETFSGSKVSILSYLK  434

Query  356   DRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTG  535
             + +   V GW T FLS  G EVLLK V  ALP+Y M  F L  T  ++I  +++ FWW  
Sbjct  435   ENLSQRVHGWQTKFLSPGGKEVLLKAVAMALPTYTMACFLLPKTTIKQIMALISEFWWRN  494

Query  536   KVARRLGIRWKAWKALCT-KIKRWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSR  703
                 R G+RWK+W++LC  K    LG  DL+       G Q WR++  P SL+ ++FKSR
Sbjct  495   GNESR-GMRWKSWESLCKPKTCGGLGFKDLEAYNLALLGKQLWRMIKNPTSLMAKIFKSR  553

Query  704   YYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL------VM  862
             Y+ NSD +NA +G  P + WRSI      ++Q  R  IG+ + T + ++ WL      ++
Sbjct  554   YFKNSDPLNATLGSRPSYAWRSIHAAQKLIQQGARVVIGNGKDTKLWQERWLGATPATMI  613

Query  863   AEDPYVSTHLHESVRE-APVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
                 +V    H  + E   VS L++  G  W+ + +  +F     N IL I
Sbjct  614   QSMKWVENQGHGRLSEDMRVSELLSSSGREWNYEKLDGMFTEEIRNKILEI  664



>ref|XP_009108257.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=710

 Score =   187 bits (474),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 113/345 (33%), Positives = 177/345 (51%), Gaps = 11/345 (3%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I    R  +L GV+VAR  PPISH+LFADD   F + N EE   +  IL  Y   SGQ +
Sbjct  10    IKKAERDKLLTGVKVARACPPISHLLFADDSLFFCKVNNEECQTILRILKDYELVSGQQI  69

Query  182   NYDKSLSVF*YQYRSG*-QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             N+DKS   F ++   G  Q   D    +  GG     G YLG+P  +G +K  + GFV++
Sbjct  70    NFDKSSIQFGHKVEDGLRQELRDVLGIQNLGG----MGSYLGIPESLGGSKVQVFGFVQE  125

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             R+ + V GW   F ++ G EV++K+V+ ALP++ M  + +  T+ +++   +  FWW+  
Sbjct  126   RLNNRVNGWTFKFFTKGGKEVIIKSVVTALPNHVMGCYRIPKTVMKKLTSAVARFWWSPG  185

Query  539   VARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRY  706
              + R G+ WK+W  LC  K +  LG  DL        G Q WRL+ +PD+L  RVFK RY
Sbjct  186   GSTR-GMHWKSWDKLCLPKTEGGLGFKDLTDFNTAMLGKQLWRLIQKPDTLFARVFKGRY  244

Query  707   YPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             + N+  +  +  +   + WRSI+   + V +     +G   S ++  D WL        +
Sbjct  245   FRNASPLEPIRSYASSYGWRSIISARSLVSKGLIKRVGSGSSISVWNDPWLPSTRPRPAN  304

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              + H    +  V SL++    +W+   I  + +  D   I +IP+
Sbjct  305   KNQHNLYPDLTVDSLIDETSRTWNSQVIRTLVDPNDIQLIESIPL  349



>ref|XP_010682933.1| PREDICTED: uncharacterized protein LOC104897695 [Beta vulgaris 
subsp. vulgaris]
Length=1326

 Score =   189 bits (481),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 122/350 (35%), Positives = 182/350 (52%), Gaps = 22/350 (6%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G++HG +V R AP ISH+ FADD  LF RA  +E + +  IL  Y  ASGQ +N+DKS  
Sbjct  628   GLIHGARVCRSAPRISHLFFADDSILFTRAALQECSVVADILSTYERASGQKINFDKSEV  687

Query  203   VF*YQYRSG*QNCSD*RSQ--RQAGGSGDTT--GKYLGLPSLVGKNKKAILGFVKDRILS  370
              F        +N  D R    R   G  +     KYLGLP+++G++KK +   +K+R+  
Sbjct  688   SFS-------KNVDDSRKNDIRSLFGVREVERHEKYLGLPTVIGRSKKMVFTVLKERVWK  740

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
              ++GW    LSRAG EVLLK V+Q++P+Y M +F++   +  EI  +   FWW  +   R
Sbjct  741   KLQGWKEKLLSRAGKEVLLKAVIQSIPTYMMSLFAIPDCILSEINAMCARFWWGSRGTER  800

Query  551   LGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNS  718
               + W +W+ +C  K    +G  DLK         Q WRLL    S+   VF +RYYP S
Sbjct  801   R-MHWLSWEKMCLPKAYGGMGFRDLKVFNQALLAKQGWRLLCHNGSMAHAVFNARYYPRS  859

Query  719   DLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLH  895
             + +NA  G +P ++WRSI    + + +  +  +GD  S  + ++ WL       V T   
Sbjct  860   NFLNARRGFDPSYVWRSIWGAKSLLLEGLKWRVGDGSSIGVWEESWLPGESAAVVPTPNM  919

Query  896   ESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV----PPKVR  1033
             ES  +  VS L++  G  WD   + + F   D   I  IP+    PP ++
Sbjct  920   ESPADLRVSDLLDASG-RWDELVLRNHFTEEDILLIREIPLSSRKPPDLQ  968



>ref|XP_008391838.1| PREDICTED: uncharacterized protein LOC103454030 [Malus domestica]
Length=1374

 Score =   189 bits (480),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 119/348 (34%), Positives = 178/348 (51%), Gaps = 27/348 (8%)
 Frame = +2

Query  14    MRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDK  193
             M RG+LHG +      P++H+ FADD  LF  A  EE+  +  IL+ Y   SGQ +N  K
Sbjct  590   MERGILHGYKFTTNGIPLTHLFFADDSVLFGNATVEEAQGVADILNTYASGSGQEINLSK  649

Query  194   SLSVF*YQYRSG*QNCSD*RSQRQAGGS-----GDTTGKYLGLPSLVGKNKKAILGFVKD  358
             S   F           +  R++++ G +      D  GKYLGL +  G +KKA+   ++D
Sbjct  650   SSIFF--------GTSTSKRTKKRIGNTLGIPYKDGFGKYLGLQADFGHSKKAVFAEIRD  701

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             +I + + GW+  FLS+AG EV++K V  ALP+YAM  F L I +CR++E  +  +WW G 
Sbjct  702   KIEARLAGWSEQFLSQAGKEVMIKAVAMALPNYAMSCFKLPIGVCRDVEKAVRSYWWRGN  761

Query  539   VARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEPGTQT---WRLLTRPDSLVERVFKSRY  706
               +R G  W +W  L   K    +G  D++           WRL+  P SL+  V K +Y
Sbjct  762   TQKR-GCHWTSWDRLMKQKSAGGMGFKDIQCFNLAFLAKIGWRLIQNPTSLLATVLKDKY  820

Query  707   YPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             YP     +A  G N  + W+ I E +  ++   R  +GD  S  I KD WL     P  +
Sbjct  821   YPGKCFKDAGKGRNTSWGWKGIFEGHMVLQHGVRWRVGDGESINIQKDPWL-----PTPT  875

Query  884   THLH---ESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             T L    +S+ E  V  L++ +  SW  + I+  FN  +A  IL+IP+
Sbjct  876   TFLAKPLDSLEETKVRDLIDPISKSWKEEVILAGFNRDEARKILSIPL  923



>ref|XP_010684019.1| PREDICTED: uncharacterized protein LOC104898622 [Beta vulgaris 
subsp. vulgaris]
Length=1162

 Score =   187 bits (476),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 115/350 (33%), Positives = 184/350 (53%), Gaps = 23/350 (7%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I  +++   +HG + +R  P ISH+ FADD  LF RA  +E   +  IL+LY  ASGQ +
Sbjct  580   IQKKVQDKQIHGAKASRSGPDISHLFFADDKLLFTRATRQECTVIVDILNLYELASGQKI  639

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGS------GDTTGKYLGLPSLVGKNKKAIL  343
             NY+KS   F     S         +QR+   S       D   KYLG+PS+  ++KKAI 
Sbjct  640   NYEKSEVSFSKGVSS---------TQREELTSILNMRQVDKHEKYLGIPSISSRSKKAIF  690

Query  344   GFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHF  523
               + DRI   ++GW    LSRAG E+LLK+V+Q +P+Y M ++ +   + ++I+  +  F
Sbjct  691   DSLTDRIWKKLQGWKEKLLSRAGKEILLKSVIQVIPTYLMGVYKIPCMIIQKIQSAMARF  750

Query  524   WWTGKVARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERV  691
             WW    ++R  + WK+W +LC+ K    +G  DLK       G Q WRL+  P+ L  RV
Sbjct  751   WWGSSNSQR-KVHWKSWDSLCSPKCLGGMGFKDLKVFNDALLGRQAWRLIREPNLLFGRV  809

Query  692   FKSRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAE  868
              K++Y+P+ D ++A +G++  + WRSI      VK+     +G+     +  D W+    
Sbjct  810   MKAKYFPHCDFLDAPLGYSSSYSWRSIWSSKALVKEGVIWRVGNGTQIKLWDDPWVADEN  869

Query  869   DPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
               ++++  + +   + VS L++     W  +     FN RD  CIL  P+
Sbjct  870   GRFLTSEKNPNF--SLVSDLIDLENMEWRTEIFDSSFNERDIRCILGTPL  917



>ref|XP_010054717.1| PREDICTED: uncharacterized protein LOC104443052 [Eucalyptus grandis]
Length=916

 Score =   186 bits (472),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 122/345 (35%), Positives = 179/345 (52%), Gaps = 17/345 (5%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G + G+++ R  P +SH++FADD   FL     E  N+  IL+ Y  A+GQ +N +KS  
Sbjct  243   GTIKGIKLNRNCPTLSHLMFADDSIFFLHGTILECQNLAMILNQYCLAAGQEINLNKSGI  302

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRG  382
              F    +   Q+  D  ++       D TGKYLG+PS  G++KK +  ++  RI   +  
Sbjct  303   FF---SKGCPQSLKDNMARELRVPIIDKTGKYLGIPSDWGESKKQMFAWILGRISKKLES  359

Query  383   WNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIR  562
             W    LS+AG EVLLK V+QALP YAM +F LS+++C+ IE  +  FWW     ++ G+ 
Sbjct  360   WKEKLLSKAGKEVLLKTVIQALPQYAMSVFKLSVSICKAIEQKIASFWWKTN-EKKEGMH  418

Query  563   WKAWKALCTKIKR-WLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
             WK W  L  +  R  +G  DL        G Q WRL  +P SL   +FK  YYP +DL +
Sbjct  419   WKRWDTLKIRKDRGGMGFRDLLSFNRAMLGKQAWRLAQQPSSLWGSLFKGLYYPYTDLWH  478

Query  731   AV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV--MAEDPYVSTHLHES  901
             A  G  P + WRS+V   +++       +GD     I +D WL   + E P    H++E 
Sbjct  479   ATRGIRPSWGWRSLVLGRDSIAPKIMWKVGDGTKIKIREDKWLHRGVIEGP---VHVNEP  535

Query  902   VREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVRV  1036
                + VS ++N V   WD   I   F+ + A  IL IP+ P+   
Sbjct  536   ---SLVSEIINKVQGRWDELKIAAHFDEKLAEEILTIPIKPQTET  577



>ref|XP_008227636.1| PREDICTED: uncharacterized protein LOC103327128 [Prunus mume]
Length=713

 Score =   183 bits (465),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 121/308 (39%), Positives = 161/308 (52%), Gaps = 15/308 (5%)
 Frame = +2

Query  17   RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
            R   LHGV +A  AP I+H+ FADD  LF  A T E+  +K I  +Y  ASGQ VN  KS
Sbjct  416  RDSRLHGVSIALSAPSINHLFFADDSLLFCNAGTTEALELKRIFGVYEAASGQKVNLGKS  475

Query  197  LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
               F     S  +   D   Q           +YLGLP++V K+KK +   VKDR+ + V
Sbjct  476  ALCF---SPSTPRVLQDDIRQLLNVTLVPCHERYLGLPTIVRKDKKKLFRTVKDRVWNKV  532

Query  377  RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
             GW    LS+AG EVL+K+V QA+PSY M +F L + LCREIE I+  FWW+    R  G
Sbjct  533  NGWQGKLLSKAGKEVLIKSVCQAIPSYFMSVFRLPVGLCREIESIIAKFWWSKNDGR--G  590

Query  557  IRWKAWKALCT-KIKRWLGVYDLKGDEPG---TQTWRLLTRPDSLVERVFKSRYYPNSDL  724
            I WK  + +C  K    LG  +L          Q WRLL  P SL+ R+ K+RY+P SD 
Sbjct  591  IHWKTLRFMCQHKSDGGLGFKELTSFNQALLCKQGWRLLEFPYSLISRMLKARYFPQSDF  650

Query  725  MNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
            + A  G  P F W+S++   + ++   R  IGD R   I  D W+     PY      +S
Sbjct  651  LAASSGSLPSFTWQSLLWGRDLLRLGLRWRIGDGRLVNIYGDPWV-----PYDRFFTVQS  705

Query  902  VREAPVSS  925
            +   P +S
Sbjct  706  IPTLPATS  713



>ref|XP_009102116.1| PREDICTED: uncharacterized protein LOC103828254 [Brassica rapa]
Length=1131

 Score =   186 bits (472),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 114/345 (33%), Positives = 173/345 (50%), Gaps = 11/345 (3%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I    R   L G++VAR  P +SH+LFADD   F +AN EE   +  IL  Y   SGQ +
Sbjct  482   IKKAERMKQLTGMKVARACPAVSHLLFADDSLFFCKANKEECHTILRILKDYEAVSGQQI  541

Query  182   NYDKSLSVF*YQYR-SG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             N+ KS   F ++   S  Q   D    +  GG     G YLGLP  +G +K  + GFV+D
Sbjct  542   NFQKSSIQFGHKIEESSRQELRDILGIQNLGG----MGSYLGLPESLGGSKVQVFGFVQD  597

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             R+ + V GW   F ++ G EV++K+V+ ALP++ M ++ L     +++   +  FWW   
Sbjct  598   RLNNRVNGWTFRFFTKGGKEVIIKSVITALPNHVMSVYRLPKATVKKLTSAVAQFWWNPG  657

Query  539   VARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRY  706
              + R G+ WK+W  LC  K    LG  DL        G Q WRL+ +P+SL  RVFK RY
Sbjct  658   GSTR-GMHWKSWDKLCEHKDNGGLGFKDLNDFNTAMLGKQLWRLIEKPNSLFSRVFKGRY  716

Query  707   YPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             Y N+  +  +  ++P + WRSI    + V +     +G   S ++  D W+        +
Sbjct  717   YRNASPLEPIRSYSPSYGWRSITSARSLVCKGLIKRVGTGSSISVWNDPWIPSTRPRPAN  776

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              + H S  +  V SL++    +W+   +  +    DA  I  IP+
Sbjct  777   KNFHNSYPDLTVDSLIHQESRTWNLQALRTLVEPDDAKLIEGIPL  821



>emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1357

 Score =   186 bits (473),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 125/357 (35%), Positives = 181/357 (51%), Gaps = 25/357 (7%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             +HG + +R  P ISH+LFADD  LF RA  +E   +  IL+ Y  ASGQ +NY+KS   F
Sbjct  671   IHGAKASRNGPEISHLLFADDSLLFTRATRQECLTIVDILNKYEAASGQKINYEKSEVSF  730

Query  209   *YQYRSG*QNCSD*RS------QRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILS  370
                  S   +C            RQ     D   KYLG+P+L G++KK +   + DR+  
Sbjct  731   -----SRGVSCEKKEELITLLHMRQV----DRHQKYLGIPALCGRSKKVLFRELLDRMWK  781

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
              +RGW    LSRAG EVL+K V+QALP+Y M ++ L + + +EI   +  FWW GK   R
Sbjct  782   KLRGWKEKLLSRAGKEVLIKAVIQALPTYLMGVYKLPVAVIQEIHSAMARFWWGGKGDER  841

Query  551   LGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNS  718
               + W +W+ +C  K    +G  DL        G Q WRLL   +SL+ RV  ++YYP+ 
Sbjct  842   -KMHWLSWEKMCKPKCMGGMGFKDLAVFNDALLGKQVWRLLHNKESLLSRVMSAKYYPHG  900

Query  719   DLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLH  895
             D+  A +G++  + WRSI    + V +     +GD     I    W+   E  ++ +   
Sbjct  901   DVRYARLGYSHSYSWRSIWGAKSLVLEGLIWRVGDGTKIDIWSAPWVGDEEGRFIKSARV  960

Query  896   ESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVRVFAWKLAMSYS  1066
             E +    V  LM+     W+ + I   FN RD  CIL IP+    R    +L  +YS
Sbjct  961   EGLE--VVGDLMDVERKEWNVELIERHFNERDQQCILAIPL--STRCLQDELTWAYS  1013



>ref|XP_010693383.1| PREDICTED: uncharacterized protein LOC104906342 [Beta vulgaris 
subsp. vulgaris]
Length=1157

 Score =   186 bits (471),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 118/359 (33%), Positives = 185/359 (52%), Gaps = 15/359 (4%)
 Frame = +2

Query  8     NRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNY  187
             N ++   +HG + +R  P ISH+LFADD  LF RA  +E   +  + + Y  ASGQ +NY
Sbjct  464   NAVQEKRIHGAKASRSGPVISHLLFADDSLLFARATRQECLAVVDLFNKYEEASGQKINY  523

Query  188   DKSLSVF*YQYR-SG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRI  364
             +KS   F    R    +      + RQ     D  GKYLG+ ++ G++KKAI   + DRI
Sbjct  524   EKSEVSFSKGVRFEQKEELLGLLNMRQV----DRHGKYLGITTVAGQSKKAIFTAILDRI  579

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
                +RGW    LSRAG EVLLK+V+QA+P+Y M I+   +++   I   +  F+W G+  
Sbjct  580   WKKLRGWKEKLLSRAGKEVLLKSVIQAIPTYLMGIYKFPVSVTSTISSAMAQFFW-GQSG  638

Query  545   RRLGIRWKAWKALCT-KIKRWLGVYDLK---GDEPGTQTWRLLTRPDSLVERVFKSRYYP  712
                 I WK WKA+C  K    LG  DL+       G Q WR++    +L+ +V K++YY 
Sbjct  639   GGRRIHWKNWKAMCELKCLGGLGFKDLEIFNDALLGRQAWRIMNGEHTLLGKVMKAKYYR  698

Query  713   NSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTH  889
             +   ++A +G+ P + WR I      VK+     +G+ +   I +D W+      ++ + 
Sbjct  699   HCSFLDAPLGYAPSYSWRGIWSSKALVKEGMLWRVGNGQDINIWRDPWIADETGRFIQSD  758

Query  890   LHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR--VFAWKLAMS  1060
               E V  + VS L++     W+ + +  +F  RD  CIL IP+  + +  +  W    S
Sbjct  759   EAEEV--SKVSELIHSDTGEWNLELLARLFTERDQECILAIPLSERSQRDIITWAFTKS  815



>ref|XP_006485451.1| PREDICTED: uncharacterized protein LOC102622884 [Citrus sinensis]
Length=1160

 Score =   184 bits (468),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 118/351 (34%), Positives = 182/351 (52%), Gaps = 32/351 (9%)
 Frame = +2

Query  26    MLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSV  205
             ++HG+   +    ISH+LFADD  +F RA+  +   +K ILD Y+ ASGQ+ N++KS S+
Sbjct  434   LIHGLSFGKELK-ISHLLFADDSLIFCRASVADCQKLKMILDCYSLASGQIFNFEKS-SL  491

Query  206   F*YQYRSG*QNCSD*RSQRQAGGSGD--------TTGKYLGLPSLVGKNKKAILGFVKDR  361
             F           S    Q QA   G+            YLGLP++VG+ +      +K +
Sbjct  492   F----------LSGNVQQAQASAIGNIFHLNIVSKYENYLGLPAMVGRKRSGFFNDIKLK  541

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +L+ +  W   F S  G EVL+K  +QA+P++AM +F + + +C +I+ I+ +FWW    
Sbjct  542   VLNKISSWQHKFFSCGGKEVLIKAAVQAIPAFAMSVFKIPLGICEDIQRIVGNFWWGSSR  601

Query  542   ARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYY  709
              RR  I W  W+ +   K K  +G  D           Q WR+   PDSLV RV ++RY+
Sbjct  602   ERR-SIHWSKWEKMSQAKCKGGMGFRDFASFNQALLAKQGWRIQQCPDSLVARVLQARYF  660

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
              +S+ +NA +G NP +IWRSI+     +    R  IG+ +   I K  W+     P+   
Sbjct  661   HSSNFLNAKIGSNPSYIWRSILWGRQIICGGSRWRIGNGQDVHIHKANWI---PKPFTFK  717

Query  887   HLHESV--REAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR  1033
              + +     EA VS L+NG    WD + I   F+  DA+ I  IP+P ++R
Sbjct  718   PVIKPTMPSEALVSELING-ENCWDEELIYKHFDKMDADVITQIPLPRRLR  767



>ref|XP_010688582.1| PREDICTED: uncharacterized protein LOC104902493 [Beta vulgaris 
subsp. vulgaris]
Length=1771

 Score =   185 bits (470),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 123/358 (34%), Positives = 183/358 (51%), Gaps = 16/358 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             +D   R   +HGV++ RGAP ISH+ FADD  LF RAN  E + +  I+ LY  ASGQ V
Sbjct  864   LDKAARERAIHGVRICRGAPRISHLFFADDSILFARANLRECSQIADIIKLYERASGQKV  923

Query  182   NYDKSLSVF*YQYR-SG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             N  K+   F  +   +  +   D    R+     D   KYLGLP+++G++KKA+   +K+
Sbjct  924   NLSKTDVAFSKKVSVARREEIVDTLGVREV----DRHEKYLGLPTIIGRSKKAVFACLKE  979

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW-TG  535
             RI   + GW    LSR G EVL+K V QA+P+Y M IF L   L  EI  +   FWW + 
Sbjct  980   RIWKKLTGWKEKLLSRPGKEVLIKAVAQAIPTYMMSIFRLPDGLIDEIHALFAKFWWGSN  1039

Query  536   KVARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSR  703
              V +++   W  W++LC  K    +G  DLK         Q WRL   P SL+ +VFK+R
Sbjct  1040  DVEKKM--HWHNWESLCLPKAMGGMGFRDLKCFNQAMLAKQCWRLFENPHSLLYKVFKAR  1097

Query  704   YYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYV  880
             Y+ + + + A  G +P + WRSI    + + +  R  +G+  S  +  + WL   +   V
Sbjct  1098  YFKHDEFLTAHRGFDPSYSWRSIWGAKSLLLEGLRWRVGNGVSIKVWDEAWLADDDANKV  1157

Query  881   STHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP---PKVRVFAW  1045
              T    +     VS L++     W+   + +     DA+ +LNIP+    P+   F W
Sbjct  1158  PTPTAAAEPHILVSELIDHELGWWNEAKVREQMVEADADRVLNIPLSKFWPRDDKFWW  1215



>ref|XP_009138589.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=739

 Score =   181 bits (460),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 116/292 (40%), Positives = 163/292 (56%), Gaps = 23/292 (8%)
 Frame = +2

Query  17   RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
            +R  + G++VARGAP ISH+L+ADD   + + +T E  N+  +L  Y+ ASGQ +N+ KS
Sbjct  11   QRREITGLKVARGAPAISHLLYADDSLFYCKGSTVELDNLLNLLSNYSLASGQRINHQKS  70

Query  197  LSVF*YQYRSG*QNCSD*RSQ-------RQAGGSGDTTGKYLGLPSLVGKNKKAILGFVK  355
               F      G     + R Q        Q GG G     YLGLP   G +K +IL ++K
Sbjct  71   CIYF------GKNIPQERRDQIKAKMGIEQEGGEGT----YLGLPEAFGGSKVSILSYLK  120

Query  356  DRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTG  535
            DR+   V+GW T FLS AG EV+LK V  ALP+Y M  F L  T+C++I  I++  WW  
Sbjct  121  DRMRERVQGWQTRFLSPAGKEVMLKAVALALPTYTMACFLLPKTVCKKIVSIMSEVWWKN  180

Query  536  KVARRLGIRWKAWKALCTKIKR-WLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSR  703
            K   R GI WK+W  +C + +   LG  D++       G Q WR+L+  DSL+ RVFKSR
Sbjct  181  KQESR-GIYWKSWDQMCKRKENGGLGFKDIEAFNLALLGKQLWRMLSVKDSLLTRVFKSR  239

Query  704  YYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL  856
            Y+  SD ++A +G  P + WRSI      ++Q  R  IG    T + +D W+
Sbjct  240  YFAKSDPLSAGLGSRPSYAWRSIHAAQKLIQQGARVLIGSGEDTKVFQDSWI  291



>ref|XP_010692477.1| PREDICTED: uncharacterized protein LOC104905588 [Beta vulgaris 
subsp. vulgaris]
Length=1260

 Score =   184 bits (467),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 183/345 (53%), Gaps = 13/345 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I  +++   LHG + +R  P ISH+ FADD  LF RAN +E   +  IL+ Y  ASGQ +
Sbjct  564   IQRKVQDKQLHGAKASRSGPEISHLFFADDSLLFTRANRQECTIIVDILNQYELASGQKI  623

Query  182   NYDKS-LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             NY+KS +S       S     ++  + RQ     D   KYLG+PS+ G++KKAI   + D
Sbjct  624   NYEKSEVSYSRGVSVSQKDELTNILNMRQV----DRHEKYLGIPSISGRSKKAIFDSLID  679

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             RI   ++GW    LSRAG EVLLK+V+QA+P+Y M ++   + + ++I+  +  FWW   
Sbjct  680   RIWKKLQGWKEKLLSRAGKEVLLKSVIQAIPTYLMGVYKFPVFIIQKIQSAMARFWWGSS  739

Query  539   VARRLGIRWKAWKALCT-KIKRWLGVYDL---KGDEPGTQTWRLLTRPDSLVERVFKSRY  706
               +R  I WK W ++C  K    +G  DL        G Q WRL   P SL+ RV K++Y
Sbjct  740   DTQR-KIHWKNWDSMCNLKCFGGMGFKDLTIFNDALLGRQAWRLTREPQSLLGRVMKAKY  798

Query  707   YPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             +PN D +NA +GH+  + W SI      +K+     +G+     +  D W++     +++
Sbjct  799   FPNCDFLNAPLGHSSSYSWSSIWSSKALLKEGVIWRVGNGSQINMWSDPWVLDEGGRFLT  858

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +  H S+R   VS L++     W    +    N RD  CIL  P+
Sbjct  859   STPHASIRW--VSELIDFDRMEWKTSLLESFLNERDLRCILASPL  901



>emb|CCA66054.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1355

 Score =   184 bits (467),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 121/345 (35%), Positives = 183/345 (53%), Gaps = 13/345 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I  +++   LHG + +R  P ISH+ FADD  LF RAN +E   +  IL+ Y  ASGQ +
Sbjct  659   IQRKVQDKQLHGAKASRSGPEISHLFFADDSLLFTRANRQECTIIVDILNQYELASGQKI  718

Query  182   NYDKS-LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             NY+KS +S       S     ++  + RQ     D   KYLG+PS+ G++KKAI   + D
Sbjct  719   NYEKSEVSYSRGVSVSQKDELTNILNMRQV----DRHEKYLGIPSISGRSKKAIFDSLID  774

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             RI   ++GW    LSRAG EVLLK+V+QA+P+Y M ++   + + ++I+  +  FWW   
Sbjct  775   RIWKKLQGWKEKLLSRAGKEVLLKSVIQAIPTYLMGVYKFPVFIIQKIQSAMARFWWGSS  834

Query  539   VARRLGIRWKAWKALCT-KIKRWLGVYDL---KGDEPGTQTWRLLTRPDSLVERVFKSRY  706
               +R  I WK W ++C  K    +G  DL        G Q WRL   P SL+ RV K++Y
Sbjct  835   DTQR-KIHWKNWDSMCNLKCFGGMGFKDLTIFNDALLGRQAWRLTREPQSLLGRVMKAKY  893

Query  707   YPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             +PN D +NA +GH+  + W SI      +K+     +G+     +  D W++     +++
Sbjct  894   FPNCDFLNAPLGHSSSYSWSSIWSSKALLKEGVIWRVGNGSQINMWSDPWVLDEGGRFLT  953

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +  H S+R   VS L++     W    +    N RD  CIL  P+
Sbjct  954   STPHASIRW--VSELIDFDRMEWKTSLLESFLNERDLRCILASPL  996



>ref|XP_008340459.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=536

 Score =   179 bits (453),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 115/350 (33%), Positives = 176/350 (50%), Gaps = 21/350 (6%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I  R RRG+++G+ +   AP ISH+LFADD  LF +A   +   ++ +L +Y  ASGQ V
Sbjct  60    IALRERRGLINGISICPEAPSISHLLFADDSLLFCQATESDCRQIREVLKVYERASGQKV  119

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSG----DTTGKYLGLPSLVGKNKKAILGF  349
             N +KS + F    +   Q        + A   G    D   KYLG+P+ VG+NK    G 
Sbjct  120   NLEKSEACFSRNVKRPAQ-------MKLAEIFGVNRVDRHDKYLGMPTFVGRNKSLCFGN  172

Query  350   VKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW  529
             +KDR+   ++ W    LS AG EVL+K V QA+P+Y+M  F L    C E+  ++  +WW
Sbjct  173   LKDRLWKRLKSWQGKLLSAAGKEVLVKAVAQAIPNYSMSCFLLPKLFCDELNKMVASYWW  232

Query  530   TGKVARRLGIRWKAWKALCT-KIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFK  697
             +G    +  + W +W+ LC  K++  LG   +Y         Q WRLL  P SLV  V K
Sbjct  233   SGDEGEK-KMHWCSWERLCNPKMEGGLGFRFLYAFNLGMLAKQGWRLLANPQSLVATVLK  291

Query  698   SRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAE--  868
              +Y+P S  M A +     ++W+SI    N +    R  +    S  I +D W+ +    
Sbjct  292   EKYFPTSSFMEAPLKPGASYVWKSIYIARNVLSLGLRWQVDTGHSIRIWEDPWIPIPLRF  351

Query  869   DPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              PY    +  ++    V+ L++ V   W  D +  +F+A + N I  IP+
Sbjct  352   RPYSPKPMGCTL--TMVNELIDHVAKCWKIDVLQSLFSAEEVNLIRKIPL  399



>ref|XP_006493122.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Citrus sinensis]
Length=765

 Score =   180 bits (456),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 164/326 (50%), Gaps = 18/326 (6%)
 Frame = +2

Query  71    HILF-ADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*YQYRSG*QNCSD  247
             HIL   DD  +F RA  E+  N+K + D Y  ASGQ+ N++KS   F    + G      
Sbjct  88    HILNDGDDSLVFTRATKEDCTNLKQLFDCYAAASGQIFNFEKSSMFFSENAKQGQITTIK  147

Query  248   *RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT*FLSRAGHEVLL  427
                Q Q     +   KYLGLPS+VG+ K +    +K RI++ +  W   F S  G E+L+
Sbjct  148   DIFQLQVVSRHE---KYLGLPSMVGRKKTSFFNEIKLRIINKISNWQANFFSSGGKEILI  204

Query  428   KNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKAWKALCTKIKR-W  604
             K V QA+P+YAM +F L + LC +++  +  FWW GK   +  I W  W+ LC   KR  
Sbjct  205   KAVAQAVPAYAMSVFKLPLGLCEDMQKAIAGFWW-GKKREKRSIHWSKWERLCQAKKRGG  263

Query  605   LGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-VGHNPLFIWRSIV  772
             LG  DL          Q+WR++  P+SLV RV K +Y+ +S  M A +G NP +IWRSI+
Sbjct  264   LGFRDLSSFNQALVAKQSWRIIQAPESLVARVMKEKYFRHSCFMEAQIGSNPSYIWRSIL  323

Query  773   EVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREAPVS---SLMNGVG  943
                  +++  R  IGD +   + +  WL     P   T    S    P+    S++    
Sbjct  324   WGREVIRKGLRWRIGDGKLVKVYQSGWL-----PRPETFKPISPPSLPLDTTVSVLIDED  378

Query  944   TSWDRDCIIDVFNARDANCILNIPVP  1021
               W  D I   F+  DA  IL IP+P
Sbjct  379   QCWRDDVIRQHFHQEDAAQILKIPLP  404



>ref|XP_006464882.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=769

 Score =   180 bits (456),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 164/326 (50%), Gaps = 18/326 (6%)
 Frame = +2

Query  71    HILF-ADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*YQYRSG*QNCSD  247
             HIL   DD  +F RA  E+  N+K + D Y  ASGQ+ N++KS   F    + G      
Sbjct  88    HILNDGDDSLVFTRATKEDCTNLKQLFDCYAAASGQIFNFEKSSMFFSENAKQGQITTIK  147

Query  248   *RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT*FLSRAGHEVLL  427
                Q Q     +   KYLGLPS+VG+ K +    +K RI++ +  W   F S  G E+L+
Sbjct  148   DIFQLQVVSRHE---KYLGLPSMVGRKKTSFFNEIKLRIINKISNWQANFFSSGGKEILI  204

Query  428   KNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKAWKALCTKIKR-W  604
             K V QA+P+YAM +F L + LC +++  +  FWW GK   +  I W  W+ LC   KR  
Sbjct  205   KAVAQAVPAYAMSVFKLPLGLCEDMQKAIAGFWW-GKKREKRSIHWSKWERLCQAKKRGG  263

Query  605   LGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-VGHNPLFIWRSIV  772
             LG  DL          Q+WR++  P+SLV RV K +Y+ +S  M A +G NP +IWRSI+
Sbjct  264   LGFRDLSSFNQALVAKQSWRIIQAPESLVARVMKEKYFRHSCFMEAQIGSNPSYIWRSIL  323

Query  773   EVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREAPVS---SLMNGVG  943
                  +++  R  IGD +   + +  WL     P   T    S    P+    S++    
Sbjct  324   WGREVIRKGLRWRIGDGKLVKVYQSGWL-----PRPETFKPISPPSLPLDTTVSVLIDED  378

Query  944   TSWDRDCIIDVFNARDANCILNIPVP  1021
               W  D I   F+  DA  IL IP+P
Sbjct  379   QCWRDDVIRQHFHQEDAAQILKIPLP  404



>ref|XP_006478212.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X2 [Citrus sinensis]
Length=387

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/351 (32%), Positives = 180/351 (51%), Gaps = 18/351 (5%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             + ++HG++ +R +  I+H+LFADD  +F +A+  E   +KGI   Y+ ASGQ+ NYDKS 
Sbjct  7     QSLIHGLRFSR-SLSITHLLFADDSLVFSKASLTECRKLKGIFYGYSAASGQVFNYDKSS  65

Query  200   SVF*YQYRSG*QNCSD*RSQRQAGGSGDTTG--KYLGLPSLVGKNKKAILGFVKDRILSW  373
               F     S   N S     +   G    +   KYLGLPS+VG+ K +    +K R+L+ 
Sbjct  66    MFF-----SSNTNQSQVEEIKNIFGLNIVSKHEKYLGLPSMVGRKKISFFNEIKLRVLNK  120

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             +  W T   S  G EVL+K V QA+P++AM +F +   LC +I+  +  FWW     RR 
Sbjct  121   LSSWQTRSFSSGGKEVLIKAVAQAVPAFAMSVFKIPQGLCDDIQRAVARFWWGSSETRR-  179

Query  554   GIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
              I W  W+ LC+ K +  LG  +           Q WR+L   DSL+ ++ K++Y+ ++D
Sbjct  180   SIHWARWEKLCSAKTRGGLGFREFSSFNQALIAKQGWRVLHNLDSLMAKILKAKYFKHTD  239

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
              M A +G NP F+WRSI+     + +  R  +G+    ++    W+   E  + ST +  
Sbjct  240   FMEAKLGSNPSFVWRSILWGRQLLHEGLRWRVGNGHKISVFSRNWMKKGE-FHNSTSIAR  298

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP--PKVRVFAW  1045
                +A V+  ++     W ++ +   F       IL IP+P  P+  V  W
Sbjct  299   LSNDAVVADFIDE-KNQWKQEMVAQHFPKEITERILKIPLPKTPQEDVMIW  348



>emb|CAN63032.1| hypothetical protein VITISV_024672 [Vitis vinifera]
Length=1413

 Score =   182 bits (463),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 117/333 (35%), Positives = 167/333 (50%), Gaps = 42/333 (13%)
 Frame = +2

Query  44    VARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*YQYR  223
             VARGAP +SH+ FADD +LF +A   ES ++K IL  Y   SGQ +N +KS   F     
Sbjct  902   VARGAPTVSHLFFADDSYLFFKATESESRSLKQILLRYQNLSGQEINLNKSALTFIRNTD  961

Query  224   SG*QN--CSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT*F  397
                +   CS  + + QA       G YLG+P++VGKNK+ +  FV+ ++ + ++ WN   
Sbjct  962   DVVKRGICSILQVKEQAD-----PGIYLGMPAVVGKNKQQLFEFVRRKVWNRIQNWNGRH  1016

Query  398   LSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKAWK  577
             LSRA  E+ LK V Q++P+Y M +  L   LCR+IE ++N F+W     RR         
Sbjct  1017  LSRARKEICLKTVAQSIPTYVMQLLLLPKDLCRDIESMMNGFFWDSNPQRR---------  1067

Query  578   ALCTKIKRWLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-VGHNPLF  754
                                    +WR L   DSLV R+F++RY+ NS  +NA +G NP +
Sbjct  1068  -----------------------SWRFLRNLDSLVTRIFQARYFINSSFLNAELGSNPSY  1104

Query  755   IWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREAPVSSLMN  934
             +WRSI+   + +K+ Y  SI       +  D WL    +  + T       E  V  L+ 
Sbjct  1105  MWRSILAAQDLLKRGYYWSIASGTKVQVWGDSWLPDNSNRLIITPPIAGFDEIKVDELI-  1163

Query  935   GVGTSWDRDCIIDVFNARDANCILNIPVPPKVR  1033
                  W  D I D F ARDA+ IL IP+P   R
Sbjct  1164  -TEGLWREDFIRDKFMARDADLILYIPLPMSSR  1195



>ref|XP_010463143.1| PREDICTED: uncharacterized protein LOC104743796 [Camelina sativa]
Length=761

 Score =   179 bits (454),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 113/345 (33%), Positives = 175/345 (51%), Gaps = 14/345 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I   ++   +HG + +R  P ISH+LFADD  LF +A+ EE   +  +L +Y  ASGQ V
Sbjct  85    ISTSVKANHIHGFRASRNGPAISHMLFADDSLLFCKADEEECNKLLDLLKIYASASGQHV  144

Query  182   NYDKSLSVF*YQ-YRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             N+ KS  +F    + +  QN  +     + GG     GKYLGLP  +G++K  +  ++  
Sbjct  145   NFQKSAILFGKNIHPNTQQNIKNLTGIIKVGG----FGKYLGLPEAIGRDKSNVFTYISQ  200

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             R+ + +  W + FLS  G EVL+K V  A+P+Y M  F L   +   +   +  FWW+G 
Sbjct  201   RLQNKLNSWYSKFLSPGGKEVLIKVVATAIPTYTMSCFLLPKKITAHLSGQIRKFWWSG-  259

Query  539   VARRLGIRWKAWKALCTKIKRW--LGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSR  703
             V  +  I W AW  L T++K++  LG  DL          Q WR+L  P SL+ RV +++
Sbjct  260   VKDKYKIPWVAWSKL-TRLKQYGGLGFKDLHQFNVALLAKQAWRMLKEPQSLLSRVLQAK  318

Query  704   YYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYV  880
             Y+  S LM A +GH P   WRSI +    +K+  +  IGD  +  I  D W+     P  
Sbjct  319   YFSKSKLMEANLGHRPSHAWRSIHQGIQLIKKGLKWRIGDGNTVRIWSDQWIDNPPRPAR  378

Query  881   STHL-HESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
              +H  H+++    V  LM    + W  + + ++ +  D   I  I
Sbjct  379   RSHQHHQNLNSLKVVDLMKPNTSQWSSERLHELIHPEDIKYIQRI  423



>ref|XP_006483194.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=765

 Score =   178 bits (452),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 181/348 (52%), Gaps = 18/348 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             ++   R   + G++ A+    I+H+LFADD  +F +A+  +   +KGI D Y  ASGQ+ 
Sbjct  63    LNQAEREQKIRGLKFAQDIT-ITHLLFADDSLVFSKASVADCKYLKGIFDCYAKASGQIF  121

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N++KS S+F +  ++  +  S  +S  Q         KYLGLP ++G+NK +    VK +
Sbjct  122   NFEKS-SMF-FSGKASSEQISAIKSIFQLKVVPKYE-KYLGLPPMLGRNKMSFFKEVKLK  178

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             + S +  W+    S  G E+L+K V QA+P+YAM +F L   LC +I+  +  FWW G  
Sbjct  179   VTSKISSWHHKLFSAGGKEILIKAVAQAVPAYAMSVFKLPKGLCEDIQKEIARFWW-GTK  237

Query  542   ARRLGIRWKAWKALCTKIKR-WLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYY  709
               + GI W  W ++    +R  LG  DL          Q WRL+  P+SL+ RV K+RYY
Sbjct  238   KDKHGIHWARWDSMSKAKRRGGLGFRDLPSFNQALVAKQGWRLVRYPNSLMARVMKARYY  297

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
              NS   NA VG NP FIWRSI+  +  +K+  R  IGD +   + KD W+     P  +T
Sbjct  298   KNSTFWNAKVGSNPSFIWRSILWGSQVIKKGVRWRIGDGKKVLVYKDKWI-----PRPAT  352

Query  887   HLHESVREAPVSSLMNGVGTS---WDRDCIIDVFNARDANCILNIPVP  1021
                 S +  P  +++  +  S   W  D +   F   D   IL I +P
Sbjct  353   FQPISPKTLPHETVVADLIDSENKWRVDRLEQHFMKEDIEAILKILLP  400



>ref|XP_010687489.1| PREDICTED: uncharacterized protein LOC104901596 [Beta vulgaris 
subsp. vulgaris]
Length=1102

 Score =   181 bits (458),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 116/335 (35%), Positives = 168/335 (50%), Gaps = 9/335 (3%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             +HG Q+ RGAP ISH+ FADD  LF +A+ +E + +  I+  Y  ASGQ VN  K+  VF
Sbjct  386   IHGAQICRGAPRISHLFFADDSILFTKASVQECSVVADIISKYERASGQQVNLSKTEVVF  445

Query  209   *YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWN  388
                  SG   C                 KYLGLP+++G++KK     +K+RI   ++GW 
Sbjct  446   SRNVDSG---CRSEIVNVLGVTEVAKQEKYLGLPTIIGRSKKVTFVCIKERIWKKLQGWK  502

Query  389   T*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWK  568
                LS  G EVL+K V+QA+P+Y M +F L   L  EI  ++  FWW  K   R  + W 
Sbjct  503   EKLLSHPGKEVLIKAVVQAIPTYMMSVFCLPSGLVDEIHSLIARFWWGSKEGER-KMHWY  561

Query  569   AWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-  733
              W+ LC  K    LG  DL          Q WRL     SL+  V K+RY+   + ++A 
Sbjct  562   KWETLCMPKSMGGLGFRDLHCFNQALLAKQAWRLTKNSYSLLALVLKARYHKKVEFVDAR  621

Query  734   VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREA  913
              G+NP F WRSI    + + +  +  +G  RS  + +D WL+     +  T    S  E 
Sbjct  622   RGYNPSFTWRSIWGSKSLLLEGLKWCVGSGRSIRVWEDAWLLGEGAHFTPTPSMNSDMEL  681

Query  914   PVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              VS+L++     W+ D +   F   + + IL IP+
Sbjct  682   RVSALLDYDEGGWNVDMVQQTFVEEEWDMILKIPL  716



>ref|XP_007203701.1| hypothetical protein PRUPE_ppa020995mg, partial [Prunus persica]
 gb|EMJ04900.1| hypothetical protein PRUPE_ppa020995mg, partial [Prunus persica]
Length=1367

 Score =   181 bits (459),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 117/366 (32%), Positives = 181/366 (49%), Gaps = 40/366 (11%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             RR +LHGV + RGAP +SH+ F DD FLFLRAN ++   +  I   Y    GQ ++ +KS
Sbjct  909   RRNLLHGVNLCRGAPSVSHLFFTDDRFLFLRANQQDCEQLSIIFQKYEMVLGQKIHLEKS  968

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGG-----SGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
                F         N  D   Q            D    YLGLP+ VG++++     +K+R
Sbjct  969   CVSF--------SNNMDRTDQDNLAAVLEVKRVDQHDVYLGLPTHVGRSRRQCFNSLKER  1020

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             I   ++GW    LS AG E+LLK V Q +P Y M  F +   LC EI+ ++  +WW  + 
Sbjct  1021  IWKKIQGWKAKLLSFAGKEILLKVVAQVVPIYMMNCFLIPKCLCDEIQQVMARYWWGEQD  1080

Query  542   ARRLGIRWKAWKALC-TKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYY  709
              +R  I W +W  LC  K +  LG   +Y         Q WRL+  P+SLV R+ K+RY+
Sbjct  1081  GQR-KIHWLSWNKLCLPKQEGGLGFRNLYAFNMALLAKQLWRLIQTPNSLVARILKARYF  1139

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTI-GKDMWLVMAEDPYVS  883
              N  ++ A +GH+P +IW+S+ +    +++  +  IG+  S  I G  + L +++ P   
Sbjct  1140  KNCSILEAQIGHSPSYIWQSLCKARVLIEKESQWRIGNGHSVRIWGDSLTLNLSKFP---  1196

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV----PPKVRVFAWKL  1051
                H   R          V   W  D +   F+  + NCI NIP+    PP + ++ ++ 
Sbjct  1197  ---HHKQR----------VTMQWKEDLLQAWFSTEEVNCIRNIPLSFRHPPDILIWHFER  1243

Query  1052  AMSYSL  1069
                Y++
Sbjct  1244  DGQYTV  1249



>ref|XP_010666711.1| PREDICTED: uncharacterized protein LOC104883845 [Beta vulgaris 
subsp. vulgaris]
Length=849

 Score =   179 bits (453),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 115/350 (33%), Positives = 176/350 (50%), Gaps = 23/350 (7%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I +++ + +LHG + +   P +SH+LFADD  LF RA  +E   +  IL+ Y  ASGQ +
Sbjct  216   IQHKIDQKILHGAKASWNDPVVSHLLFADDSLLFTRATRQECLIIVDILNQYEKASGQKI  275

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQ------AGGSGDTTGKYLGLPSLVGKNKKAIL  343
             NYDKS   F    R         R +++           +   KYLG+P+  G +KK + 
Sbjct  276   NYDKSEVSFSKGVR---------RERKEELINLLQMKHVEKHQKYLGIPTATGSSKKLLF  326

Query  344   GFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHF  523
               + DR+   +RGW    LSRAG EVL+K V+QA+P+Y M ++     +  EI   +  F
Sbjct  327   RSILDRMWKKLRGWKEQLLSRAGKEVLIKAVIQAIPTYLMGVYKFPAAIIHEISSAMARF  386

Query  524   WWTGKVARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERV  691
             WW GK   R  + W +W+ LC  K    +G  DL        G Q WRL+   +SL+ RV
Sbjct  387   WWGGKGEAR-KMHWISWEKLCKPKCLGGMGFKDLAVFNDALLGRQVWRLIHFKNSLLSRV  445

Query  692   FKSRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAE  868
              K++YYP  +++NA +G +  + WRSI    + V++     +G      I  D W+    
Sbjct  446   MKAKYYPRCEMLNARLGFSNSYSWRSIWGAKSLVREGLMWRVGSGNDINIWSDPWVADER  505

Query  869   DPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
               ++ +    S+    V+ L+N     W  D +   F  RD +CIL IP+
Sbjct  506   GRFIESEEAGSLNR--VAELINPDTMEWRSDLLNQYFTDRDRDCILAIPL  553



>ref|XP_008367240.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=806

 Score =   178 bits (451),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 116/352 (33%), Positives = 175/352 (50%), Gaps = 27/352 (8%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I   M  G+LHG +      P++H+ FADD  LF  A  EE+  +  IL+ Y   SGQ +
Sbjct  127   IKKGMEXGVLHGYRFTPNGSPLTHLFFADDSVLFGNATVEEAQGVVDILNTYAXGSGQEI  186

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGS-----GDTTGKYLGLPSLVGKNKKAILG  346
             N  KS   F           +  R +++ G +      D  GKYLGL +  G +KKA+  
Sbjct  187   NLSKSSIFF--------GTSTSKRIKKRIGNTLGIPHKDGFGKYLGLQADFGLSKKAVFX  238

Query  347   FVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFW  526
              ++D++ + + GW+  FLS+AG EVL+K V   LP++AM  F L I +CR++E  +  +W
Sbjct  239   EIRDKMEARLAGWSEQFLSQAGKEVLIKAVAMXLPNFAMSCFKLPIGVCRDMEKAVRSYW  298

Query  527   WTGKVARRLGIRWKAW-KALCTKIKRWLGVYDLKGDEPGTQT---WRLLTRPDSLVERVF  694
             W G   +R G  W +W K +  K    LG  D++           WRL+  P SL+  V 
Sbjct  299   WRGNSQKR-GCHWASWDKLMKQKSAGGLGFKDIQCFNLAFLAKIGWRLIQNPTSLLANVL  357

Query  695   KSRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAED  871
             + +YYP     +A  G N  + W+ I E    ++   R  +GD  S  I KD WL     
Sbjct  358   RDKYYPGKCFKDAGKGRNTSWGWKGIFESRTVLQHGVRWRVGDGESINIRKDPWL-----  412

Query  872   PYVSTHLH---ESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             P  +T L    +++ E  V  L++ +  SW    I + FN  +A  IL+IP+
Sbjct  413   PTPTTFLAKPLDNLEEIKVRDLIDPISKSWKEGVITEGFNREEARTILSIPL  464



>gb|EPS63383.1| hypothetical protein M569_11401 [Genlisea aurea]
Length=1469

 Score =   181 bits (458),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 120/345 (35%), Positives = 174/345 (50%), Gaps = 34/345 (10%)
 Frame = +2

Query  35    GVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS-LSVF*  211
             G+Q++   P ISH+LFADD  +F  A       ++ +L  Y   SGQL+N +KS LSV  
Sbjct  1042  GIQLSPTVPKISHLLFADDTLIFSAATLTAMEGIRSVLTRYAAISGQLINLEKSALSVP-  1100

Query  212   YQYRSG*QNCSD*RSQRQAGGSG----DTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
                            Q  +   G    D+ GKYLGLPS++G +KKA    +KDRI   + 
Sbjct  1101  -------SEADPHYRQLLSTAVGVPLTDSLGKYLGLPSMIGISKKAAFRSLKDRIQGRIL  1153

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
              W+T FLS+AG  VL+K+VLQ++PSY M  F +  TL RE+  + + FWW+ +   ++ +
Sbjct  1154  HWHTKFLSKAGKMVLIKSVLQSIPSYTMQCFKIPTTLIRELNSLFSQFWWSDRGHSKMHL  1213

Query  560   RWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLM  727
                AW  LC   ++  LG  +L          Q WR+ T+ D L+ RV + +YY N+  +
Sbjct  1214  L--AWDKLCEAPVQGGLGFRNLTTFNQALLAKQCWRIFTKDDLLLSRVLQGKYYKNTSFL  1271

Query  728   NA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-------VMAEDPYVS  883
              A +G NP F WRS++   N +    R   GD     +    WL        M  +P +S
Sbjct  1272  EARLGRNPSFTWRSLLTAKNLLLSGLRWRPGDGVHINVWNSPWLPRAGSFKPMFRNPALS  1331

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              HL        VS L++     W+R  I  VF   DA  IL+IP+
Sbjct  1332  PHLR-------VSDLISPDTCDWNRSYIQQVFLPADAATILSIPL  1369



>ref|XP_010690177.1| PREDICTED: uncharacterized protein LOC104903764 [Beta vulgaris 
subsp. vulgaris]
Length=1254

 Score =   180 bits (456),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 115/348 (33%), Positives = 171/348 (49%), Gaps = 17/348 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             ID   R   +HGV V RGAP +SH+ FADD  LF +A  +E + +  I+  Y  ASGQ V
Sbjct  621   IDKAARERAIHGVMVCRGAPRVSHLFFADDSILFAKATLQECSRVADIISTYERASGQKV  680

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSG----DTTGKYLGLPSLVGKNKKAILGF  349
             N  K+   F         N    R +      G    D   KYLGLP+++G++KKA+   
Sbjct  681   NLSKTEVAFS-------TNVPAERRKDIVETLGVREVDRHEKYLGLPTIIGRSKKAVFAC  733

Query  350   VKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW  529
             +K+RI   ++GW    LSR G E+++K V QA+P+Y M IF +   L  EI  +   FWW
Sbjct  734   LKERIWKKLQGWKEKLLSRPGKEIMIKAVAQAIPTYMMSIFKIPDGLIDEIHSLFARFWW  793

Query  530   TGKVARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFK  697
              G       + W  W+ LC  K    LG  DLK         Q WRL+    +L+ ++ K
Sbjct  794   -GSTGSHRKLHWHKWEDLCLPKAMGGLGFRDLKSFNAALLAKQGWRLIHGTGTLLHKILK  852

Query  698   SRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDP  874
             +RY+ N   + A  G NP + WRS+  V + + +  +  +G+     + +D WL      
Sbjct  853   ARYFKNCSFLEAPCGFNPSYSWRSLWGVKDLLMEGTKWRVGNGTQIRVWEDAWLPGHGSH  912

Query  875   YVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              V T +  S  +  VS+L+      W+ + +   F A D   I +IP+
Sbjct  913   LVPTPMAHSTADLLVSNLICFESGKWNVEKLNVTFGAHDRRLIRDIPL  960



>ref|XP_008393387.1| PREDICTED: uncharacterized protein LOC103455579 [Malus domestica]
Length=876

 Score =   178 bits (451),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 127/377 (34%), Positives = 185/377 (49%), Gaps = 39/377 (10%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             + N    G L G+ V   A P+SH+ FADD  LF RA   E+  +KG+L  Y   SGQ +
Sbjct  216   LHNAEEMGRLRGMSVTEEADPLSHVFFADDSVLFCRATEGEAHTIKGLLQQYAVGSGQFI  275

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSG----DTTGKYLGLPSLVGKNKKAILGF  349
             N DKS   F          CS    ++ +   G    +  GKYLG+ +  G +KK +   
Sbjct  276   NLDKSSVHFS-------MGCSKALKEQLSQILGIKHQEGFGKYLGIQADFGASKKKVFEE  328

Query  350   VKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW  529
             V++R+   + GW   FLS AG EVL+K+V  ALP Y M  F L I L +EIE ++  FWW
Sbjct  329   VRNRLDERINGWAEQFLSMAGKEVLIKSVAAALPIYTMSCFQLPIHLAKEIEQVIARFWW  388

Query  530   TGKVARRLGIRWKAW-KALCTKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFK  697
               +  ++ GI W  W K    K+   LG   + D          WRL++ P S++ RV +
Sbjct  389   RDQRTKK-GIHWMTWNKVAKKKVYGGLGFREIIDFNLAMLAKVGWRLISNPGSILARVLQ  447

Query  698   SRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDP  874
             ++YYP+S  ++A VG    + W+ I++    +K   R  +GD     IGKD WL +    
Sbjct  448   AKYYPSSSFLDAPVGTGTSWGWKGILQGRKILKAGVRWRVGDGTCIQIGKDPWLPIPR-T  506

Query  875   YVSTHLHESVREAP--VSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVRVFAWK  1048
             +  T  HE   E P  V+ L++  G  W R+ I   F+  +A  IL++P+          
Sbjct  507   FRPTSRHE---EMPIFVADLVDMEGM-WKREVIELCFSEDEAKTILSMPI----------  552

Query  1049  LAMSYSLVLCP*RHVWY  1099
                  S   CP R VW+
Sbjct  553   -----SRFGCPDRVVWH  564



>emb|CCA66040.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1362

 Score =   180 bits (456),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 175/341 (51%), Gaps = 21/341 (6%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             +HG Q+ RGAP +SH+ FADD  LF +A+ +E + +  I+  Y  ASGQ VN  K+  VF
Sbjct  667   IHGAQICRGAPVVSHLFFADDSILFTKASVQECSMVADIISKYERASGQQVNLSKTEVVF  726

Query  209   *YQYRSG*QNCSD*RSQRQA------GGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILS  370
                      + S  R +R A          D   KYLGLP+++G++KK     +K+RI  
Sbjct  727   ---------SRSVDRERRSAIVNVLGVKEVDRQEKYLGLPTIIGRSKKVTFACIKERIWK  777

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
              ++GW    LSR G EVL+K+V QA+P+Y M +FSL   L  EI  +L  FWW      R
Sbjct  778   KLQGWKEKLLSRPGKEVLIKSVAQAIPTYMMSVFSLPSGLIDEIHSLLARFWWGSSDTNR  837

Query  551   LGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNS  718
               + W +W  LC  K    LG  DL          Q WRL T   +L+ R+ ++RY+ +S
Sbjct  838   -KMHWHSWDTLCYPKSMGGLGFRDLHCFNQSLLAKQAWRLCTGDQTLLYRLLQARYFKSS  896

Query  719   DLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLH  895
             +L+ A  G+NP F WRSI    + + +  +  +G      + +D W++      V T   
Sbjct  897   ELLEARRGYNPSFTWRSIWGSKSLLLEGLKWCVGSGERIRVWEDAWILGEGAHMVPTPQA  956

Query  896   ESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +S  +  V  L++    +W+ + +   F   +   +L+IP+
Sbjct  957   DSNLDLKVCDLIDVARGAWNIESVQQTFVEEEWELVLSIPL  997



>ref|XP_006478211.1| PREDICTED: putative ribonuclease H protein At1g65750-like isoform 
X1 [Citrus sinensis]
Length=478

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 113/351 (32%), Positives = 179/351 (51%), Gaps = 18/351 (5%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             + ++HG++ +R    I+H+LFADD  +F +A+  E   +KGI   Y+ ASGQ+ NYDKS 
Sbjct  98    QSLIHGLRFSRSLS-ITHLLFADDSLVFSKASLTECRKLKGIFYGYSAASGQVFNYDKSS  156

Query  200   SVF*YQYRSG*QNCSD*RSQRQAGGSGDTTG--KYLGLPSLVGKNKKAILGFVKDRILSW  373
               F     S   N S     +   G    +   KYLGLPS+VG+ K +    +K R+L+ 
Sbjct  157   MFF-----SSNTNQSQVEEIKNIFGLNIVSKHEKYLGLPSMVGRKKISFFNEIKLRVLNK  211

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             +  W T   S  G EVL+K V QA+P++AM +F +   LC +I+  +  FWW     RR 
Sbjct  212   LSSWQTRSFSSGGKEVLIKAVAQAVPAFAMSVFKIPQGLCDDIQRAVARFWWGSSETRR-  270

Query  554   GIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
              I W  W+ LC+ K +  LG  +           Q WR+L   DSL+ ++ K++Y+ ++D
Sbjct  271   SIHWARWEKLCSAKTRGGLGFREFSSFNQALIAKQGWRVLHNLDSLMAKILKAKYFKHTD  330

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
              M A +G NP F+WRSI+     + +  R  +G+    ++    W+   E  + ST +  
Sbjct  331   FMEAKLGSNPSFVWRSILWGRQLLHEGLRWRVGNGHKISVFSRNWMKKGEF-HNSTSIAR  389

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP--PKVRVFAW  1045
                +A V+  ++     W ++ +   F       IL IP+P  P+  V  W
Sbjct  390   LSNDAVVADFIDE-KNQWKQEMVAQHFPKEITERILKIPLPKTPQEDVMIW  439



>ref|XP_008245529.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103343662 
[Prunus mume]
Length=1725

 Score =   180 bits (456),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 117/345 (34%), Positives = 180/345 (52%), Gaps = 10/345 (3%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I+  +  G + G++  RG P +SH+ FADD  +FL+A       +  ILD Y  ASGQLV
Sbjct  679   INQAVTHGFIQGMKFGRGGPVLSHLFFADDSLMFLKATENNCRVIVRILDAYCTASGQLV  738

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N++KS   F     +  +     R+      S D  GKYLGLP++ G++KK  L FVKD+
Sbjct  739   NFEKSNMFF--SPNTPLEVKDRLRAILNVTISEDP-GKYLGLPTIWGRSKKMALAFVKDK  795

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             IL  ++GW    LS+AG EVL+K+V QA+PSY M +F      C+EI+ IL +FWW G+ 
Sbjct  796   ILGKIQGWKHGLLSQAGREVLIKSVAQAVPSYPMSVFLFPNGFCQEIDSILANFWW-GQS  854

Query  542   ARRLGIRWKAWKAL-CTKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYY  709
              +   I W +WK L   K +  +G  +LK         Q WR++T P +   ++ KS+Y+
Sbjct  855   QQSNKIHWISWKDLGMPKNEGGMGFRNLKDFNVALLAKQGWRMVTEPQAFWAQLLKSKYF  914

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV-MAEDPYVS  883
             PN D + A  G    + W S++   N +    R  + D     +  D W+    E     
Sbjct  915   PNCDFLRAGKGAKSSWAWSSLLVGRNIIMNGARWQVLDGSRVHLWTDKWIPGCTEHALQP  974

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +HL +   EA V ++++     W+ + I  +F+   A  I  +P+
Sbjct  975   SHLSQVDLEAKVETIIDCHSREWNLEAIGGMFSPNAAKIIKAMPL  1019



>ref|XP_010686872.1| PREDICTED: uncharacterized protein LOC104901027 [Beta vulgaris 
subsp. vulgaris]
Length=1273

 Score =   179 bits (454),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 122/359 (34%), Positives = 179/359 (50%), Gaps = 18/359 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I    +   +HG ++ RGAP +SH+ FADD  LF +A+ +E + +  I+  Y  ASGQ V
Sbjct  569   ISKAAQENRIHGARICRGAPLVSHLFFADDSILFTKASVQECSVVADIISKYERASGQKV  628

Query  182   NYDKSLSVF*YQYRSG*QN--CSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVK  355
             N  K+  VF        +N   S    Q  A        KYLGLP+++G++KK     +K
Sbjct  629   NLSKTEVVFSKGVDEERRNDIVSILGVQEVA-----RQEKYLGLPTVIGRSKKVTFACIK  683

Query  356   DRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW-T  532
             +RI   ++GW    LSR G EVLLK+V QA+P+Y M +F L   L  EI  +   FWW +
Sbjct  684   ERIWKKLQGWKEKLLSRPGKEVLLKSVAQAIPTYMMSVFCLPSGLIDEIHAMFARFWWGS  743

Query  533   GKVARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKS  700
               V R+L   W  W +LC  K    LG  DL          Q WRL     S + +V K+
Sbjct  744   NGVERKL--HWHKWDSLCLPKSMGGLGFRDLHCFNMALLAKQAWRLSQDGHSFLHQVLKA  801

Query  701   RYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPY  877
             RYY   + ++A  G+ P F WRSI      + +  +  +G+  S  +G+D W++     +
Sbjct  802   RYYKRVEFLDARRGYTPSFTWRSIWGSKALLLEGLKWRVGNGESIRVGEDAWIMGEGSHF  861

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP---PKVRVFAW  1045
             V T    S  E  VS+L++     W+ + +  +F   +   ILNIP+    P  R F W
Sbjct  862   VPTPQANSDMELKVSALLDYHTRGWNTELVHQIFQEAEWPLILNIPLSRFWPNDRRFWW  920



>ref|XP_007227312.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
 gb|EMJ28511.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
Length=992

 Score =   178 bits (451),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 116/344 (34%), Positives = 164/344 (48%), Gaps = 9/344 (3%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I  + R G L GV + RGAP ISH+ FADD FLF  AN  +   +K ILD Y  A GQ V
Sbjct  300   IAQKEREGFLKGVSICRGAPAISHLFFADDSFLFAWANMADCMALKDILDTYERALGQQV  359

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N+ KS   F      G Q      +Q       D   +YLGLP ++ K K A    +K+R
Sbjct  360   NFQKSAVCFSKNVHRGDQLM---LAQFMGIPCVDHHSQYLGLPMVLDKKKGASFNHLKER  416

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +   ++ W    LS AG E+L+K V QA+P Y M  F L   +C ++  ++  FWW    
Sbjct  417   LWKKLQTWKGKLLSGAGKEILIKVVAQAIPIYTMSCFLLPKYVCEDLNKLVAQFWWNSST  476

Query  542   ARRLGIRWKAWKALCT-KIKRWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRYY  709
               +  I W AW  LC  K +  LG  +L          Q WRLL  PDSLV +V K++Y+
Sbjct  477   ENK-KIHWMAWDRLCAPKEEGGLGFRNLHAFNLALLAKQGWRLLQNPDSLVTKVLKAKYF  535

Query  710   PN-SDLMNAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
             P  S L   V      +W+S+ +    + Q  R  +G   +  I +D WL       + +
Sbjct  536   PTRSFLETTVSPYASVVWKSLCDARTVIIQGSRWQVGSGDTIGIWEDRWLPQPNSFQIFS  595

Query  887   HLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                E      VS L++G    W+   + +VF   +   I +IP+
Sbjct  596   PRPEHSAITKVSDLIHGDSREWNAPLLQNVFFPEEVMLIRSIPL  639



>ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula]
Length=1723

 Score =   179 bits (455),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 185/373 (50%), Gaps = 54/373 (14%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G + G ++ + AP ISH+LFADDCFLF +A + ++  MK IL++Y  +SGQ +N+ KS  
Sbjct  1086  GTISGAKICKNAPIISHLLFADDCFLFFKAKSGQAQGMKNILEMYESSSGQSINFQKSEV  1145

Query  203   VF*YQYRSG*Q-NCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
              +        + + S     +Q  G    TGKYLG+PS+VG+++ +   FVK+R+   + 
Sbjct  1146  FYSRNVDDAVKASISQILGVQQVMG----TGKYLGVPSMVGRSRISTFKFVKERVWKKIN  1201

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
              W++  LS+AG E L+K+VLQ++P Y M IF++  ++  +IE +L+     G      G+
Sbjct  1202  SWSSKCLSQAGRETLIKSVLQSIPFYIMSIFAIPKSIIVDIEKMLSIHKKEG------GL  1255

Query  560   RWKAWKALCTKIKRWLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-V  736
              +K  +A    +              G Q W+ +T P ++V R+FK++Y+   D +++ +
Sbjct  1256  GFKNLRAFNEGML-------------GKQAWKFMTEPHNIVTRLFKAKYFNKCDFLDSKI  1302

Query  737   GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREAP  916
             GHNP ++WR+I      V + Y+ SIG      +    WLV          L E  +E  
Sbjct  1303  GHNPSYVWRNIWGAKRVVSEGYKWSIGSGTDICVWDQRWLVDGGVLQKPESLPEEFKELT  1362

Query  917   VSSLMNGVGTSWDRDCIIDVFNARDANCILNIP---------------------------  1015
             V+ L       W+   + ++ +  D N ILN P                           
Sbjct  1363  VADLFISQTRFWNVGLLRNLVSNEDTNRILNTPIFEPNHLSQHVDLSTHRCDGNWVLLWN  1422

Query  1016  --VPPKVRVFAWK  1048
               VPPKV+ F W+
Sbjct  1423  LKVPPKVKTFLWR  1435



>ref|XP_008355389.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=883

 Score =   177 bits (449),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 116/352 (33%), Positives = 175/352 (50%), Gaps = 27/352 (8%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I   M  G+LHG +      P++H+ FADD  LF  A  EE+  +  IL+ Y   SGQ +
Sbjct  155   IKKGMECGVLHGYRFTPNGSPLTHLFFADDSVLFGNATVEEAQGVVDILNTYAXGSGQEI  214

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGS-----GDTTGKYLGLPSLVGKNKKAILG  346
             N  KS   F           +  R +++ G +      D  GKYLGL +  G +KKA+  
Sbjct  215   NLSKSSIFF--------GTSTSKRIKKRIGNTLGIPHKDGFGKYLGLQADFGLSKKAVFX  266

Query  347   FVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFW  526
              ++D++ + + GW+  FLS+AG EVL+K V   LP++AM  F L I +CR++E  +  +W
Sbjct  267   EIRDKMEARLAGWSEQFLSQAGKEVLIKAVAMXLPNFAMSCFKLPIGVCRDMEKAVRSYW  326

Query  527   WTGKVARRLGIRWKAW-KALCTKIKRWLGVYDLKGDEPGTQT---WRLLTRPDSLVERVF  694
             W G   +R G  W +W K +  K    LG  D++           WRL+  P SL+  V 
Sbjct  327   WRGNSQKR-GCHWASWDKLMKQKSAGGLGFKDIQCFNLAFLAKIGWRLIQNPTSLLANVL  385

Query  695   KSRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAED  871
             + +YYP     +A  G N  + W+ I E    ++   R  +GD  S  I KD WL     
Sbjct  386   RDKYYPGKCFKDAGKGRNTSWGWKGIFESRTVLQHGVRWRVGDGESINIRKDPWL-----  440

Query  872   PYVSTHLH---ESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             P  +T L    +++ E  V  L++ +  SW    I + FN  +A  IL+IP+
Sbjct  441   PTPTTFLAKPLDNLEEIKVRDLIDPISKSWKEGVITEGFNREEARTILSIPL  492



>ref|XP_009115971.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=614

 Score =   175 bits (443),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 108/333 (32%), Positives = 169/333 (51%), Gaps = 11/333 (3%)
 Frame = +2

Query  38    VQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*YQ  217
             ++VAR  P ISH+LFADD   F +A  EE   +  IL  Y   SGQL+N+DKS   F + 
Sbjct  1     MKVARACPSISHLLFADDSLFFCKALKEECHTILRILKEYEVVSGQLINFDKSSIQFGHN  60

Query  218   YR-SG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT*  394
                S  Q+  D    +  GG     G YLGLP  +G +K  +  FV+DR+ + V GW   
Sbjct  61    IEESTRQDLRDILGIQNLGG----MGSYLGLPENLGGSKIQVFSFVQDRLNNRVNGWTFK  116

Query  395   FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKAW  574
             F ++ G EV++K+V+ ALP++ M ++ L     +++   +  FWW+    R  G+ WK+W
Sbjct  117   FFTKGGKEVIIKSVVTALPNHVMSVYRLPKATTKKLTTAVAQFWWSPG-GRTRGMHWKSW  175

Query  575   KALC-TKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMNAV-G  739
               +C  K    LG   + D      G Q WRL+  P++L  RVFK RYY N+  +  +  
Sbjct  176   DKVCLDKEAGGLGFKDITDFNTAMLGKQLWRLIENPNTLFSRVFKGRYYRNASPLEPIRS  235

Query  740   HNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREAPV  919
             ++P + WRSIV   + V +     +G   S ++  D WL        + + H       V
Sbjct  236   YSPSYGWRSIVSARSLVSKGLIKRVGSGSSISVWNDPWLPTTRPRPANKNQHIFDPNLTV  295

Query  920   SSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              SL++    +W+   +  + + +D   I +IP+
Sbjct  296   DSLIDSTSRTWNSHALRAMIDPQDVKIIESIPL  328



>ref|XP_007203452.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
 gb|EMJ04651.1| hypothetical protein PRUPE_ppa022115mg [Prunus persica]
Length=1755

 Score =   179 bits (453),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 118/350 (34%), Positives = 172/350 (49%), Gaps = 22/350 (6%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R+G L G+ + RGAP +SH+ FADD F+F +A       +K I ++Y  ASGQ +N  KS
Sbjct  1078  RQGQLQGIVICRGAPTVSHLFFADDSFVFAKATDNNCGVLKHIFEVYEHASGQQINCQKS  1137

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSG----DTTGKYLGLPSLVGKNKKAILGFVKDRI  364
                F        Q+       R A   G    D+   YLGLP ++G+NK     ++K+R+
Sbjct  1138  CVAFSANIHMDTQS-------RLASVLGVPRVDSHATYLGLPMMLGRNKTVCFRYLKERV  1190

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
                ++GW    LS AG EVLLK V Q++P Y M  F L   LC EIE ++  FWW G+  
Sbjct  1191  WKKLQGWREQTLSIAGKEVLLKVVAQSIPLYVMSCFLLPQGLCHEIEQMMARFWW-GQQG  1249

Query  545   RRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYP  712
                 I W  W+ LC  K +  +G   L+         Q WRL+  P SL  R+ K++Y+P
Sbjct  1250  ENRKIHWMRWERLCKAKTEGGMGFRCLQAFNMAMLAKQGWRLVHNPHSLASRLLKAKYFP  1309

Query  713   NSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTH  889
              ++   A +G  P  +W+SI      ++   R  IGD +S  I  D W+       V T 
Sbjct  1310  QTNFWEATLGSRPSCVWKSIWTARKVLEMGSRFQIGDGKSVRIWGDKWVPRPATFAVITS  1369

Query  890   LHESVREAPVSSLMNGVGT-SWDRDCIIDVFNARDANCILNIPV----PP  1024
               + +    VS L+   G+  WD   + ++F   D   I+ IP+    PP
Sbjct  1370  PLDGMENTKVSELICNEGSPQWDLQKLNNLFLPVDVVDIVRIPLSIRAPP  1419



>ref|XP_004305156.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=813

 Score =   176 bits (446),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 119/353 (34%), Positives = 174/353 (49%), Gaps = 20/353 (6%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             ++ +  +G+L G+ +   AP I H+LFADD  LF  AN  E  ++K +L  Y  ASGQLV
Sbjct  156   LNQKASQGLLKGISICDSAPVIHHLLFADDSLLFGVANHAECGHIKAVLADYEKASGQLV  215

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTG--KYLGLPSLVGKNKKAILGFVK  355
             N+ KS  VF     S     S   S     G G      KYLGLP+ VGK+K     F+K
Sbjct  216   NFGKSNIVF-----SKGTPVSLQSSIAGELGVGVVVKHEKYLGLPTYVGKSKTETFAFIK  270

Query  356   DRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTG  535
             +R+   + GW    LS AG  +L++ V QALPSY+M  F L  +    +      FW   
Sbjct  271   ERLSKKLEGWQGKLLSGAGKGILIRVVAQALPSYSMSCFLLPKSFYAALHQKCARFWLGS  330

Query  536   KVARRLGIRWKAWKALCTKIKR-WLGVYDLKGDEPGT---QTWRLLTRPDSLVERVFKSR  703
             K   R  I W +W+ LC   +R  +G  DL          Q WR+L  PDSLV R+F++R
Sbjct  331   KQEDR-KIHWLSWEKLCRPKERGGMGFRDLYAHNIAMLAKQGWRILQFPDSLVARLFRAR  389

Query  704   YYPNSDLMNAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL--VMAEDPY  877
             Y+P+S   +A   +    W+ I E  + + +  R  +GD     I +D WL    +  P 
Sbjct  390   YFPSSSFWSATATDGSACWKGIAEARSVLARGMRWQVGDGTRVCIWEDPWLPRPFSFKPL  449

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVRV  1036
                + H  +    +S  +      W+R+ +  +F+A DA  IL+IP+  + R 
Sbjct  450   YRVNTHIVLVSELISDFV------WNRNLVNILFDASDAELILSIPISSRGRA  496



>ref|XP_008338205.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=950

 Score =   177 bits (448),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 126/377 (33%), Positives = 184/377 (49%), Gaps = 39/377 (10%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             + N    G L G+ V   A P+SH+ FADD  LF RA   E+  +KG+L  Y   SGQ +
Sbjct  300   LHNXEEMGRLRGMSVTEEADPLSHVFFADDXVLFCRATEGEAHTIKGLLQQYAVGSGQFI  359

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSG----DTTGKYLGLPSLVGKNKKAILGF  349
             N DKS   F          CS    ++ +   G    +  GKYLG+ +  G +KK +   
Sbjct  360   NLDKSSVHFSM-------GCSKALKEQLSQILGIKHQEGFGKYLGIQADFGASKKKVFEE  412

Query  350   VKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW  529
             V++R+   + GW   FLS AG EVL+K+V  ALP Y M  F L I L +EIE ++  FWW
Sbjct  413   VRNRLDERINGWAEQFLSMAGKEVLIKSVAAALPIYTMSCFQLPIHLAKEIEQVIARFWW  472

Query  530   TGKVARRLGIRWKAW-KALCTKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFK  697
               +  ++ GI W  W K    K+   LG   + D          WRL++ P S++ RV +
Sbjct  473   RDQRTKK-GIHWMTWNKVAKKKVYGGLGFREIIDFNLAMLAKVGWRLISNPGSILARVLQ  531

Query  698   SRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDP  874
             ++YYP+S  ++A VG    + W+ I++    +K   R  +GD      GKD WL +    
Sbjct  532   AKYYPSSSFLDAPVGTGTSWGWKGILQGRKILKAGVRWRVGDGTCIQXGKDPWLPIPRT-  590

Query  875   YVSTHLHESVREAP--VSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVRVFAWK  1048
             +  T  HE   E P  V+ L++  G  W R+ I   F+  +A  IL++P+          
Sbjct  591   FRPTSRHE---EMPIFVADLVDMEGM-WKREVIELCFSEDEAKTILSMPI----------  636

Query  1049  LAMSYSLVLCP*RHVWY  1099
                  S   CP R VW+
Sbjct  637   -----SRFGCPDRVVWH  648



>ref|XP_010058710.1| PREDICTED: uncharacterized protein LOC104446568 [Eucalyptus grandis]
Length=1356

 Score =   178 bits (451),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 115/348 (33%), Positives = 177/348 (51%), Gaps = 13/348 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             +   M  G + G+Q  R  P +SH+ FADD   FLRA   E  N+  +L+ Y  A+GQL+
Sbjct  682   LTQAMAMGHIKGIQFNRDCPKLSHLFFADDSVFFLRATISECQNLANLLNQYCFATGQLI  741

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N +KS   F        Q+     +Q          GKYLG+PS  G++K+ +  ++  R
Sbjct  742   NRNKSGVFFSKHCPISLQHN---LAQELRVPIISKYGKYLGIPSDWGRSKREMFSWILAR  798

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             + + + GW   FLS++G E+LLK+V+QAL  YAM +F L ++LCR IE  ++ FWW+ K 
Sbjct  799   VNAKLAGWQEQFLSKSGKEILLKSVIQALLQYAMSLFKLPLSLCRLIERKISAFWWS-KH  857

Query  542   ARRLGIRWKAWKAL-CTKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYY  709
                 GI WK W  L  +K+   +G  DL        G Q WRLL +P ++  ++FK  Y+
Sbjct  858   NSHSGIHWKNWSELKLSKVSGGMGFRDLINFNTAMLGKQAWRLLQQPQAIWSQLFKGLYF  917

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
               S    A  GH P + W+S+++   A+    R  +GD     I +D WL +        
Sbjct  918   RYSSFQTAPSGHRPSWGWQSLLKGREAITPKLRWLVGDGSQIHIREDNWLPIGP----IG  973

Query  887   HLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKV  1030
              L E      V++L++   + W    +   FN + +  ILN P+ P +
Sbjct  974   GLPEEGEPELVANLIDLQHSEWKSSLVTAFFNVQVSAAILNTPINPSL  1021



>ref|XP_010474601.1| PREDICTED: uncharacterized protein LOC104754160 [Camelina sativa]
Length=1368

 Score =   178 bits (451),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 125/363 (34%), Positives = 182/363 (50%), Gaps = 24/363 (7%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G + G+QVARG+PPI+++LFADD   + + +  E   +  I++ Y+ ASGQ VNY+KS  
Sbjct  654   GKITGLQVARGSPPITNLLFADDSMFYCKKSDSEINQVISIIEEYSLASGQRVNYEKSSV  713

Query  203   VF*YQYRSG*Q-NCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
              F        + N        Q GG G     YLGLP     +K   L ++K+R+   V 
Sbjct  714   YFGKLIPDEERGNIKHNLGINQEGGEG----IYLGLPESFKGSKVNTLSYLKERMHQKVN  769

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
             GW + FLS  G EVLLK V  ALP++ M  F L   +C+++  +++ FWW  K   R G+
Sbjct  770   GWQSLFLSPGGKEVLLKAVAMALPTHTMSCFKLPTAICKQLTSVMSDFWWQNKQDSR-GM  828

Query  560   RWKAWKALCT-KIKRWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRYYPNSDLM  727
              W AW+ L   K    LG  D++       G Q WR++T  DSL+ RV+KSRY+ +SD +
Sbjct  829   HWTAWEKLSKPKAVGGLGFRDIEDFNLALLGKQLWRMITHKDSLLARVYKSRYFKHSDPL  888

Query  728   NA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV---------MAEDPY  877
             +A +G+ P F WRSI      +KQ  R  IG+  S  I +  W+          M   P 
Sbjct  889   SASLGNRPSFAWRSIHASQKIIKQGARAVIGNGASVNIWQHQWVEEKPSRGISRMKVIPP  948

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI-PVPPKVR-VFAWKL  1051
                 +  SV    V  L+   G  W+   +  +F   D  CI  + P     + V+AW  
Sbjct  949   QFQRIASSVNS--VQDLLLPSGKDWNETLLELLFEDADRVCIRGLRPGSATTKDVYAWDY  1006

Query  1052  AMS  1060
             + S
Sbjct  1007  SRS  1009



>ref|XP_010688579.1| PREDICTED: uncharacterized protein LOC104902491 [Beta vulgaris 
subsp. vulgaris]
Length=1325

 Score =   177 bits (450),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 120/353 (34%), Positives = 174/353 (49%), Gaps = 12/353 (3%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             +HG Q+ RGAP ISH+ FADD  LF  A+  E + +  I+  Y  ASGQ VN  K+  VF
Sbjct  630   IHGAQICRGAPRISHLFFADDSILFTNASVHECSVVADIISKYERASGQQVNLSKTEVVF  689

Query  209   *YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWN  388
                   G +N              +   KYLGLP+++G++KK     +K+RI   ++GW 
Sbjct  690   SRNVGRGVRNEI---VNVLGVNEVEKQEKYLGLPTIIGRSKKVTFACIKERIWKKLQGWK  746

Query  389   T*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWK  568
                LSR G EVL+K V+QA+P+Y M +F L   L  EI  ++  FWW  K   R  + W 
Sbjct  747   EKLLSRPGKEVLIKAVVQAIPTYMMSVFCLPSGLIDEIHSLIARFWWGSKEGER-KMHWH  805

Query  569   AWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-  733
              W+ALC  K    LG  DL          Q WRL     SL+  + K+RYY   + ++A 
Sbjct  806   KWEALCMPKSMGGLGFRDLHCFNQALLAKQAWRLCNNSYSLLSLLLKARYYKKVEFIDAR  865

Query  734   VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREA  913
              G+NP F WRSI    + + +  +  +G  RS  +  D WL+        T   +S  E 
Sbjct  866   RGYNPSFTWRSIWGSKSLLLEGLKWCVGSGRSIRVWDDAWLMGEGAHLTPTPRLDSDMEL  925

Query  914   PVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP---PKVRVFAWKLAMSY  1063
              VS+L++  G  W+ + +   F   + + IL IP+    P   ++ W     Y
Sbjct  926   RVSALLDYEGGGWNVELVRQTFVEEEWDMILKIPLSRFWPDDHLYWWPTQNGY  978



>ref|XP_006491472.1| PREDICTED: uncharacterized protein LOC102626455 [Citrus sinensis]
Length=1452

 Score =   177 bits (450),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 181/348 (52%), Gaps = 18/348 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             ++   R   + G++ A+    I+H+LFADD  +F +A+  +   +KGI D Y  ASGQ+ 
Sbjct  750   LNQAEREQKIRGLKFAQDIT-ITHLLFADDSLVFSKASVADCKYLKGIFDCYAKASGQIF  808

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N++KS S+F +  ++  +  S  +S  Q         KYLGLP ++G+NK +    VK +
Sbjct  809   NFEKS-SMF-FSGKASSEQISAIKSIFQLKVVPKYE-KYLGLPPMLGRNKMSFFKEVKLK  865

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             + S +  W+    S  G E+L+K V QA+P+YAM +F L   LC +I+  +  FWW G  
Sbjct  866   VTSKISSWHHKLFSAGGKEILIKAVAQAVPAYAMSVFKLPKGLCEDIQKEIARFWW-GTK  924

Query  542   ARRLGIRWKAWKALCTKIKR-WLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYY  709
               + GI W  W ++    +R  LG  DL          Q WRL+  P+SL+ RV K+RYY
Sbjct  925   KDKHGIHWARWDSMSKAKRRGGLGFRDLPSFNQALVAKQGWRLVRYPNSLMARVMKARYY  984

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
              NS   NA VG NP FIWRSI+  +  +K+  R  IGD +   + KD W+     P  +T
Sbjct  985   KNSTFWNAKVGSNPSFIWRSILWGSQVIKKGVRWRIGDGKKVLVYKDKWI-----PRPAT  1039

Query  887   HLHESVREAPVSSLMNGVGTS---WDRDCIIDVFNARDANCILNIPVP  1021
                 S +  P  +++  +  S   W  D +   F   D   IL I +P
Sbjct  1040  FQPISPKTLPHETVVADLIDSENKWRVDRLEQHFMKEDIEAILKILLP  1087



>ref|XP_008367519.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=822

 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 119/343 (35%), Positives = 175/343 (51%), Gaps = 23/343 (7%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G LHGV+V     PI+H+LFADD  LF  A  EE+  ++ IL+ Y   SGQ +N  KS S
Sbjct  162   GXLHGVKVTPKGMPITHLLFADDSVLFCEATVEEARGVREILNSYAVGSGQEINMLKS-S  220

Query  203   VF*YQYRSG*QNCSD*RS----QRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILS  370
             +F Y  +   ++  D       Q +AG      GKYLGL    G +KK +   V++RI S
Sbjct  221   IF-YGSKVKKRDKKDIERTLNIQSKAG-----FGKYLGLQXDFGHSKKVVFNDVRERIES  274

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
              + GW   FLS AG E+L+K V  A+P++AM  F L I +CR+IE  +  +WW G   RR
Sbjct  275   RMTGWAEQFLSPAGKEILIKXVATAMPNHAMSCFKLPIGVCRDIEKAIRXYWWRGSEXRR  334

Query  551   LGIRWKAWKALCTKIKRWLGVYDLKGDEP------GTQTWRLLTRPDSLVERVFKSRYYP  712
              G+   +W  L    K+ LG    K  +       G   WRL+  PDSL+  V + +YYP
Sbjct  335   -GVHXTSWDRLIQ--KKCLGGLGFKDFQCFNLAFLGKIGWRLIIFPDSLLASVMRDKYYP  391

Query  713   NSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTH  889
                   A +G    + W+ I+E    +++     +GD  +  I +D W  M     +   
Sbjct  392   EKSFREATIGRGSSWGWKGILEARKVLEKGLIWRVGDGETIKIREDPWFPMXSTFRIRPA  451

Query  890   LHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             ++  +    VS L+N    +W  D I   F++ +AN IL+IP+
Sbjct  452   VN--LGALYVSBLINQESKTWKADLISACFSSEEANTILSIPI  492



>gb|AAF69169.1|AC007915_21 F27F5.21 [Arabidopsis thaliana]
Length=1023

 Score =   176 bits (447),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 115/376 (31%), Positives = 190/376 (51%), Gaps = 38/376 (10%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             +  ++ G++VA  +P +SH+LFA+D   F +AN E+   + GIL  Y   SGQ++N+ KS
Sbjct  510   QEKLITGIKVATASPSVSHLLFANDSLFFCKANKEQCGVILGILKQYEAVSGQMINFSKS  569

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
                F   ++ G    ++ +S       G   G YLGLP  +G +K  I  FV+DR+ + +
Sbjct  570   SIQF--GHKVGDDIKAEIKSALGIHSIGGM-GSYLGLPESLGGSKTRIFSFVRDRLQTRI  626

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
              GW+  FLS+ G EV++K+V+  LP+Y M  F L  T+  ++   +  FWW+     R G
Sbjct  627   NGWSAKFLSKGGKEVMIKSVVAVLPTYVMSCFRLPKTITSKLTSAVAKFWWSSDGESR-G  685

Query  557   IRWKAWKALC-TKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDL  724
             + W AW  LC +K    LG   V D        Q WRL+T PDSL  +VFK RY+  S+ 
Sbjct  686   MHWMAWNKLCSSKADGGLGFRSVNDFNSALLAKQLWRLITVPDSLFAKVFKGRYFRKSNP  745

Query  725   MNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-VMAEDPYVS--THL  892
             ++ +  ++P + WRSI+   + VK+     +G   S ++ +D W+      P +S  + +
Sbjct  746   LDKLKSYSPSYGWRSIISARSLVKKGLINRVGSGASISVWEDPWIPAQFPRPAISNGSVI  805

Query  893   HESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCIL----------------------  1006
               S++   V++L++     W+ D + ++F   D   I                       
Sbjct  806   DPSLK---VNNLIDSRSNFWNIDFLNEIFVPEDVLLISAMHLGSSTKEDSLDIKTLKAHI  862

Query  1007  -NIPVPPKVRVFAWKL  1051
               +  PPK+R F W++
Sbjct  863   WKVQCPPKLRHFLWQV  878



>ref|XP_010472251.1| PREDICTED: uncharacterized protein LOC104751896 [Camelina sativa]
Length=1160

 Score =   176 bits (447),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 171/353 (48%), Gaps = 27/353 (8%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             +  R  +  L G Q     P + H+LFADD     +AN EE   +   L LY  ASGQ++
Sbjct  493   MQRRHEQQRLTGFQFNESCPSVQHLLFADDSLFICKANKEECEEVLNCLSLYGKASGQVI  552

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQ-------RQAGGSGDTTGKYLGLPSLVGKNKKAI  340
             N+ KS   F      G +   D +         R  GGSG     YLGLP     +K+A+
Sbjct  553   NFAKSTVTF------GGKASYDTKELVKTTLGIRNEGGSGS----YLGLPECFSGSKQAL  602

Query  341   LGFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNH  520
             L F+ +++   + GW    LS  G EVLLK++  ALP YAM  F LS  LCR++   +  
Sbjct  603   LAFIGEKLQGRLHGWFAKSLSLGGKEVLLKSIAMALPVYAMSCFRLSKNLCRKLTSAMTE  662

Query  521   FWWTGKVARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVER  688
             FWW+    +R  I W AW  LC  K +  LG  DL          Q+WR+L  P SLV R
Sbjct  663   FWWSHCEGQR-NIAWVAWAKLCKAKSEGGLGFKDLSDFNQALLAKQSWRMLNNPTSLVAR  721

Query  689   VFKSRYYPNSDLMN-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMA  865
              FKSRY+    +++   G  P + WRSI++  + +K+     IGD  +T + ++ W +  
Sbjct  722   FFKSRYFRYKSILDCGTGSRPSYAWRSILQGRDLLKKGLLKVIGDGSNTLVWQEKW-IQE  780

Query  866   EDPYVS--THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             E P       +   VR   VS L +     WD   I ++F   DAN IL + +
Sbjct  781   EHPRAPYRAQIFFDVR-LKVSDLRDPSTGHWDVSKIENLFPPGDANRILAMKL  832



>ref|XP_010451797.1| PREDICTED: uncharacterized protein LOC104733977 [Camelina sativa]
Length=1377

 Score =   177 bits (448),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 123/340 (36%), Positives = 168/340 (49%), Gaps = 19/340 (6%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             L G       P I H+LFADD     RA  EE   +   L LY  ASGQ++N+ KS   F
Sbjct  671   LTGFSFNETCPTIQHLLFADDSLFICRATKEECEELMRCLKLYGKASGQVINFTKSAITF  730

Query  209   *YQYRSG*Q-NCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGW  385
               +     +       +  + GGSG     YLGLP     +K+A+LGF+ +++ + ++GW
Sbjct  731   GKKTSDAVKLMVKQTLNIHEEGGSGS----YLGLPECFSGSKQALLGFIGEKLQNRLQGW  786

Query  386   NT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRW  565
             +   LS  G EVLLK V  ALP YAM  F LS  LCR++   +  FWW+    +R  I W
Sbjct  787   HAKSLSLGGKEVLLKAVGMALPVYAMSCFRLSKNLCRKLTSAMCKFWWSNCQGKR-KIAW  845

Query  566   KAWKALC-TKIKRWLGVYDLKGDEP----GTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
              AWK LC +K +  LG  DL GD        Q WR+L  P SLV R +KSRY+  +  + 
Sbjct  846   IAWKKLCKSKSEGGLGFKDL-GDFNQALLAKQAWRILNNPGSLVSRFYKSRYFKRTSFLE  904

Query  731   A-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL--VMAEDPY-VSTHLHE  898
                G  P + WRSI+     +K     SIGD   T + K+ WL  +    PY + T    
Sbjct  905   CGTGSRPSYAWRSILHGRELLKSGLMKSIGDGCDTFVWKNKWLFDIHPRAPYRLQTFFEV  964

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              +R   V  L      SWD   +  +F   DA  IL++P+
Sbjct  965   DLR---VKDLRVPDQMSWDIGKVKALFPPEDAKQILSMPL  1001



>ref|XP_008244613.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=930

 Score =   175 bits (444),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 123/367 (34%), Positives = 179/367 (49%), Gaps = 16/367 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             + + +  G + G+++AR  P ISH+ FADD   F++A  +    +K  LD Y  ASGQ +
Sbjct  202   LSSAVHNGEIKGIRIARRCPMISHLFFADDALFFVKAEAQNCMKLKEKLDKYCLASGQCI  261

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N  KS S+F +   +      D  +     G  D  G YLGLP++ G++K A LG++K+R
Sbjct  262   NSQKS-SLF-FSPNTPANTRHDICTLMNINGV-DNPGIYLGLPTIWGRSKNAALGYIKER  318

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             I   + GW    LS AG EV LK V  A+P++ M  F      C +I   L  FWW G  
Sbjct  319   IRKKIDGWKLNSLSLAGKEVPLKVVATAVPAFPMTCFRFPEGTCNQINSDLASFWW-GNN  377

Query  542   ARRLGIRWKAWKALCTKIK-RWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRYY  709
                 GI WK+WK LC   K   LG  DL          Q+WR++  P++   ++ K+RY+
Sbjct  378   EESAGIHWKSWKKLCLAKKVGGLGFRDLSNFNLALIAKQSWRIILNPEAAWVKILKARYF  437

Query  710   PNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
             P +D +NA  G  P + W S +E   A+ +  R  I    +T I  D+W+   E   V T
Sbjct  438   PTTDFLNATKGSRPSWAWVSFLEGRKAMMKEARFQIFSGANTNIWNDVWIPSCESGPVKT  497

Query  887   HLHESVREAP--VSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP----PKVRVFAWK  1048
              L     +AP  V  LM+    +W  D I    N      I  IP+     P   V+ W 
Sbjct  498   -LQPIPPQAPQLVQELMDKQNHTWKLDSISTFINNDILQSIRCIPIGHSSRPDRLVWPWN  556

Query  1049  LAMSYSL  1069
              + SY++
Sbjct  557   SSGSYTV  563



>ref|XP_008345114.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1067

 Score =   176 bits (445),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 119/343 (35%), Positives = 175/343 (51%), Gaps = 23/343 (7%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G LHGV+V     PI+H+LFADD  LF  A  EE+  ++ IL+ Y   SGQ +N  KS S
Sbjct  162   GXLHGVKVTPKGMPITHLLFADDSVLFCEATVEEARGVREILNSYAVGSGQEINMLKS-S  220

Query  203   VF*YQYRSG*QNCSD*RS----QRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILS  370
             +F Y  +   ++  D       Q +AG      GKYLGL    G +KK +   V++RI S
Sbjct  221   IF-YGSKVKKRDKKDIERTLNIQSKAG-----FGKYLGLQXDFGHSKKVVFNDVRERIES  274

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
              + GW   FLS AG E+L+K V  A+P++AM  F L I +CR+IE  +  +WW G   RR
Sbjct  275   RMTGWAEQFLSPAGKEILIKXVATAMPNHAMSCFKLPIGVCRDIEKAIRXYWWRGSEXRR  334

Query  551   LGIRWKAWKALCTKIKRWLGVYDLKGDEP------GTQTWRLLTRPDSLVERVFKSRYYP  712
              G+   +W  L    K+ LG    K  +       G   WRL+  PDSL+  V + +YYP
Sbjct  335   -GVHXTSWDRLIQ--KKCLGGLGFKDFQCFNLAFLGKIGWRLIIFPDSLLASVMRDKYYP  391

Query  713   NSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTH  889
                   A +G    + W+ I+E    +++     +GD  +  I +D W  M     +   
Sbjct  392   EKSFREATIGRGSSWGWKGILEARKVLEKGLIWRVGDGETIKIREDPWFPMXSTFRIRPA  451

Query  890   LHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             ++  +    VS L+N    +W  D I   F++ +AN IL+IP+
Sbjct  452   VN--LGALYVSBLINQESKTWKADLISACFSSEEANTILSIPI  492



>ref|XP_010694802.1| PREDICTED: uncharacterized protein LOC104907559 [Beta vulgaris 
subsp. vulgaris]
Length=1336

 Score =   176 bits (446),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 117/343 (34%), Positives = 178/343 (52%), Gaps = 14/343 (4%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G +HG +V R  P ISH+ FADD  LF RA  +E + +  IL  Y  ASGQ +N+DKS  
Sbjct  639   GRIHGARVCRSGPRISHLFFADDSILFSRATLQECSVVAEILSTYERASGQKINFDKSEV  698

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDTTG--KYLGLPSLVGKNKKAILGFVKDRILSWV  376
              F     S   + +   + R   G  +     KYLGLP+++G++KK I   +K+R+   +
Sbjct  699   SF-----SKHVDTNRRVAIRSLFGVREVEKHEKYLGLPTVIGRSKKVIFSVLKERVWKKL  753

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
             +GW    LSRAG EVLLK ++Q++P+Y M +F++   +  EI  + + FWW  +   R  
Sbjct  754   QGWKEKLLSRAGKEVLLKAIIQSIPTYMMSLFAVPDCILNEINAMCSRFWWGARGTER-K  812

Query  557   IRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDL  724
             + W +W+ LC  K    +G  DLK         Q WRLL   +SL   V K+RY+P +  
Sbjct  813   MHWVSWEKLCLPKSYGGMGFRDLKVFNQALLAKQGWRLLCDTNSLAHLVMKARYFPRTLF  872

Query  725   MNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
              +A  G +P ++WRSI      + +  +  +GD  S  + +D WL       V T   ES
Sbjct  873   TSARRGFDPSYVWRSIWGAKALLLEGLKWRVGDGNSINVWEDSWLPGDSCSVVPTPNIES  932

Query  902   VREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKV  1030
               +  VS L++  GT W+   +   F + DA  I  I +  ++
Sbjct  933   PADLQVSDLIDRGGT-WNELALSTHFTSNDAALIRTIHISRRM  974



>gb|EPS61425.1| hypothetical protein M569_13371 [Genlisea aurea]
Length=1255

 Score =   176 bits (445),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 116/336 (35%), Positives = 175/336 (52%), Gaps = 16/336 (5%)
 Frame = +2

Query  35    GVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*Y  214
             G Q++   P ISH+LFADD  +F  A       + G+L  Y   SGQ++N +KS+ V   
Sbjct  562   GFQLSPTTPKISHLLFADDTLIFSSATLAAMRGIDGVLSSYAAVSGQMINLEKSVLVIPS  621

Query  215   QYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT*  394
             +  +     +   S+       +T G+YLGLPS+VG +KKA    +KDRI S +  W+T 
Sbjct  622   EPDA---QYTHLLSEAVGVPLTETLGRYLGLPSMVGLSKKAAFRNLKDRIHSRILHWHTK  678

Query  395   FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKAW  574
             FLS+AG  VL+K+VLQA+P+Y+M  F L  +L  E+  +L+ FWW  +   ++ +   AW
Sbjct  679   FLSKAGKMVLIKSVLQAIPAYSMQCFKLPASLIAELNGLLSSFWWDDRGKPKMHLL--AW  736

Query  575   KALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-VG  739
               LC   +   LG  +L          Q WR+L +PDSL+ ++ K +YY N+  + A +G
Sbjct  737   DKLCRATVHGGLGFRNLAIFNKALLAKQCWRILMKPDSLLAQLLKGKYYRNTSFLCASLG  796

Query  740   HNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV---MAEDPYVSTHLHESVRE  910
              +P F WRS++     +    R   GD     I    WL      +  Y    L  ++R 
Sbjct  797   RSPSFTWRSLLTARELLVSGLRWCPGDGSQINIWSSPWLPRMGFFKPIYKRPELPPTLR-  855

Query  911   APVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
               VS L+N     W+R  I  +F   DA+ IL+IP+
Sbjct  856   --VSDLINPGTRDWNRSLIRHLFLPIDASSILSIPL  889



>ref|XP_009103788.1| PREDICTED: uncharacterized protein LOC103829849 [Brassica rapa]
Length=1405

 Score =   176 bits (446),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 109/337 (32%), Positives = 172/337 (51%), Gaps = 13/337 (4%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G +HG+Q +   P I H+LFADDC L  +A++E++  +  IL +Y  A+GQL+N  KS  
Sbjct  689   GSIHGIQFSEEGPMIHHMLFADDCLLICKASSEQANKLIEILQIYESATGQLINVAKSAI  748

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRG  382
              F  + +    N      Q         TG YLGLP     +K  IL ++ DR+   + G
Sbjct  749   TFGVKVKD---NIKAEIKQITCIEKEGGTGSYLGLPECFSGSKTEILAYIYDRLRDRLSG  805

Query  383   WNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIR  562
             W    LS  G E+L+K V  A+P YAM  F L+ T C  +   +  FWW     +R  + 
Sbjct  806   WFAKLLSLGGKEILIKAVAMAMPVYAMSCFKLTKTSCDNLSKAMADFWWNSLEHKR-KMH  864

Query  563   WKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
             W +W  LC  K +  LG  D++         Q WR+L  PDSL+ RVFKSRY+ ++D ++
Sbjct  865   WLSWTKLCLAKEQGGLGFKDIQSFNQALLAKQAWRILNHPDSLLARVFKSRYFKSTDFLS  924

Query  731   AV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAE--DPYVSTHLHES  901
             A  G  P + WRSI    + ++Q  R  IG+  + ++  D W+   E   P +     + 
Sbjct  925   AKNGPRPSYAWRSIQFGKDLLRQGLRKHIGNGETVSVWVDRWIEGNERRAPLMKNIFVDL  984

Query  902   VREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
             + +  VS L++     W+ + + ++F   D + I+++
Sbjct  985   LLK--VSDLIDLQNNCWNMEKLQELFYQEDIDRIMSM  1019



>ref|XP_008351907.1| PREDICTED: uncharacterized protein LOC103415345 [Malus domestica]
Length=1736

 Score =   176 bits (446),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 126/377 (33%), Positives = 182/377 (48%), Gaps = 39/377 (10%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             + N    G L G+ V   A P+SH+ FADD  LF RA   E+  +KG+L  Y   SGQ +
Sbjct  1049  LHNXEEMGRLRGMSVTEXADPLSHVFFADDXVLFCRATXGEAHTIKGLLQQYAVGSGQFI  1108

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSG----DTTGKYLGLPSLVGKNKKAILGF  349
             N DKS   F          CS    ++ +   G    +  GKYLG+    G +KK +   
Sbjct  1109  NLDKSSVHFS-------MGCSKALKEQLSQILGIKHQEGFGKYLGIQXDFGASKKKVFEE  1161

Query  350   VKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW  529
             V++R+   + GW   FLS AG EVL+K+V  ALP Y M  F L I L +EIE ++  FWW
Sbjct  1162  VRNRLDERINGWAEQFLSMAGKEVLIKSVAAALPXYTMSCFQLPIHLAKEIEQVIARFWW  1221

Query  530   TGKVARRLGIRWKAW-KALCTKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFK  697
               +  ++ GI W  W K    K+   LG   + D          WRL++   S + RV +
Sbjct  1222  RDQRTKK-GIHWMTWNKVAXKKVYGGLGFREIIDFNLAMLAKVGWRLISNXGSJLARVLQ  1280

Query  698   SRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDP  874
             ++YYP+S  ++A VG    + W+ I++    +K   R  +GD     IGKD WL +    
Sbjct  1281  AKYYPSSSFLDAPVGXGTSWGWKGILQGRKILKAGVRWRVGDXTCIQIGKDPWLPIPR-T  1339

Query  875   YVSTHLHESVREAP--VSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVRVFAWK  1048
             +  T  HE   E P  V+ L++  G  W R+ I   F+  +A  IL++P+          
Sbjct  1340  FRPTSRHE---EMPIFVADLVDMEGM-WKREVIELCFSEDEAKTILSMPI----------  1385

Query  1049  LAMSYSLVLCP*RHVWY  1099
                  S   CP R VW+
Sbjct  1386  -----SRFGCPDRVVWH  1397



>ref|XP_009118154.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=538

 Score =   170 bits (431),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 106/322 (33%), Positives = 160/322 (50%), Gaps = 9/322 (3%)
 Frame = +2

Query  17   RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
              G L G+QVARG P ISH+LFADD   FL+AN      ++ +L+ Y  ASGQ +N +KS
Sbjct  90   EEGSLQGLQVARGCPRISHLLFADDTMFFLQANKNNCKALQSLLNRYELASGQTINKEKS  149

Query  197  LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
               F  +  +  ++      Q Q  G     GKYLGLP   G+ K+ +   + DRI    
Sbjct  150  AITFSRKAPAELKDMVKQELQIQKEGG---VGKYLGLPEQFGRRKRDLFATILDRIQQKA  206

Query  377  RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
            RGW+T FLS AG  V++++VL  +PSY+M  F L ++LC+ I+ I+  FWW      +  
Sbjct  207  RGWSTKFLSSAGKLVMIQSVLSPIPSYSMTCFKLPVSLCKRIQSIVTRFWWESNENEK-K  265

Query  557  IRWKAWKALCT-KIKRWLGVYDLKGDEPGTQT---WRLLTRPDSLVERVFKSRYYPNSDL  724
            + W AW  +   K    LG  D +           WR+  +PDSL+ +    +Y P   +
Sbjct  266  MAWVAWDRIAKPKSCGGLGFRDFQKFNDSLLAKIGWRMYQKPDSLLCKTLLGKYCPEGTI  325

Query  725  MNAVGHNPL-FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
            +NA   + +   WR I+   + + +     +GD R+  + +D WL   +         E 
Sbjct  326  LNATASSTMSHGWRGILIGRDLLLENMGWVVGDGRAINVWRDPWLATTKRESPIGPPTEQ  385

Query  902  VREAPVSSLMNGVGTSWDRDCI  967
              E  V+ LM   G  W+R+ I
Sbjct  386  AAELTVADLMVSGGNQWNRERI  407



>ref|XP_008226782.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=963

 Score =   173 bits (439),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 161/295 (55%), Gaps = 17/295 (6%)
 Frame = +2

Query  14   MRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDK  193
            +R G + G+++AR +P +SH+ FADD   FL+A+         +LD+Y  ASGQ VN++K
Sbjct  240  IRDGNIQGIKLARRSPTLSHLFFADDSLFFLKADVLNFQRFMQVLDMYCLASGQCVNFEK  299

Query  194  SLSVF*YQYRSG*QNCSD*RSQ--RQAGGSG-DTTGKYLGLPSLVGKNKKAILGFVKDRI  364
            S  VF           S  R Q     G +G D  G YLGLP++ G++K+A L ++KDR+
Sbjct  300  SNMVF------SPNTPSSLRVQLCEMFGFNGVDNAGTYLGLPTIWGRSKRAALDYIKDRV  353

Query  365  LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW-TGKV  541
               + GW    LS AG E+LLK V  A+P+Y M  F    ++C +I   +  FWW  G+ 
Sbjct  354  RRKIEGWKQSSLSLAGKEILLKAVATAIPAYPMSCFKFPASVCSDINGEMTRFWWKNGEE  413

Query  542  ARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYY  709
              +  I WKAW++LC +K +  LG              Q+WR+L  P++   R+ K+RYY
Sbjct  414  GSK--IHWKAWESLCKSKDEGGLGFRHFSSFNIALLAKQSWRILQNPNASWVRILKARYY  471

Query  710  PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAED  871
            P+ D + A  G    + W S++E  +A+ +  R  I D ++T I KD+WL    D
Sbjct  472  PDCDFLKAKKGSRASWAWSSLLEGRDALIKDSRCQIFDGKNTNIWKDIWLPPPHD  526



>ref|XP_010446251.1| PREDICTED: uncharacterized protein LOC104729051 [Camelina sativa]
Length=786

 Score =   172 bits (435),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 115/365 (32%), Positives = 182/365 (50%), Gaps = 32/365 (9%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R  ++ G++VA   PPI+H+LFADD   F +A+ ++   +  IL  Y   SGQ +N++KS
Sbjct  65    RNKLISGIKVAHKCPPITHLLFADDSLFFCKADKDQCGVILEILKTYEAVSGQQINFEKS  124

Query  197   LSVF*YQYRSG*QNCSD*RSQRQA-------GGSGDTTGKYLGLPSLVGKNKKAILGFVK  355
                F ++         + R + Q        GG     G YLG+P  +G +K  +  FV+
Sbjct  125   SVQFGHKVEE------EVRREMQGVLGISNLGG----MGSYLGIPESLGGSKTKVFSFVR  174

Query  356   DRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTG  535
             DR+ S   GW    LS+ G EV++K+V  A+P++ M  F L  ++  ++   +  FWW+ 
Sbjct  175   DRLQSRTNGWTAKQLSKGGKEVMIKSVATAVPTFVMSCFRLPKSVTSKLTSAVAKFWWSS  234

Query  536   KVARRLGIRWKAWKALCTKIKRWLGVYDLKG-DEPGT-----QTWRLLTRPDSLVERVFK  697
                +  G+ W AW+ LC    + LG    K  D+  T     Q WRL+  PDSL   VFK
Sbjct  235   --GQSGGMHWLAWEKLCG--SKQLGGLGFKNVDDFNTALLVKQLWRLIESPDSLFAWVFK  290

Query  698   SRYYPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDP  874
              RYY NS+ M+ +  ++P + WRSIV   + V +     +G+  S +I  D W V A+ P
Sbjct  291   GRYYRNSNPMDPIRSYSPSYGWRSIVSARSLVNKGLIKRVGNGESISIWTDPW-VPAQSP  349

Query  875   YVSTHLHESVREA-PVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV--PPKVRVFAW  1045
               +     S+  +  +S L++    SW  D ++  F+  DA  I  +P+   P+     W
Sbjct  350   RPAMSKGPSLDSSLKISHLIDHQTNSWCIDLLLQHFSPEDAALIGALPLGSTPREDSLGW  409

Query  1046  KLAMS  1060
                 S
Sbjct  410   HFTKS  414



>ref|XP_010468426.1| PREDICTED: uncharacterized protein LOC104748491 [Camelina sativa]
Length=770

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 172/343 (50%), Gaps = 19/343 (6%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             +G L G       P + H+LFADD  L  RA  EE   +   L LY  ASGQL+N+ KS 
Sbjct  126   QGRLTGFSFNNLYPVVQHLLFADDSLLISRATKEECEEIIRCLQLYGKASGQLINFSKSA  185

Query  200   SVF*YQYRSG*-QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
               F  +      Q      +  + GGSG     YLGLP     +K+A+LGF+ D++ + +
Sbjct  186   VTFGKKTTDEVKQIVKQTLNILEEGGSGT----YLGLPECFRGSKQALLGFIGDKLQNRL  241

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
             +GW    LS  G EVLLK V+ ALP +AM    LS  LCR +   +   WW+    +R  
Sbjct  242   QGWFANSLSLGGKEVLLKAVVMALPVFAMSYVRLSKNLCRMLTSAMCELWWSNCQGKR-K  300

Query  557   IRWKAWKALC-TKIKRWLGVYDLKGDEP----GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
             I W AWK LC +K +  LG  DL GD        Q WR+L  PDSL+ R +KSRY+  S 
Sbjct  301   IAWVAWKKLCKSKSEGGLGFKDL-GDFNQALLAKQAWRILNTPDSLLARFYKSRYFRKST  359

Query  722   LMN-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV--MAEDPY-VSTH  889
             +++      P + WRSI+     +KQ    +IGD   T++  D W+       PY   T 
Sbjct  360   ILDCGKCTRPSYAWRSIIHGRELLKQGLLKNIGDGHDTSVWLDKWIFDKHPRAPYRFQTI  419

Query  890   LHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                ++R   VS L       WDR+ +  +F   DA+ IL +P+
Sbjct  420   FQVNLR---VSDLRVTNQPQWDREKVQYLFPPGDASQILAMPL  459



>ref|XP_008351857.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=319

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 147/285 (52%), Gaps = 17/285 (6%)
 Frame = +2

Query  20   RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
            +G   GV++ + A  + H+LFADD F+FLR+  +E   +KG+L  Y  AS Q VN  KS 
Sbjct  42   KGAFQGVKICKEASSVHHLLFADDSFIFLRSMLQECLQVKGLLRYYEQASRQAVNLTKSS  101

Query  200  SVF*YQYRSG*QNCSD*RSQRQAGGSG----DTTGKYLGLPSLVGKNKKAILGFVKDRIL  367
              F         N +   +Q  A   G    D   +YLGLP LV ++KKA   ++KDR+ 
Sbjct  102  VAFS-------SNLTVFNAQLLADCLGMERVDFHERYLGLPVLVDRSKKATFAYIKDRLW  154

Query  368  SWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVAR  547
              + GW    LS AG E+L+K V QA+P Y M  F L  T C E   ++  FWW   + +
Sbjct  155  KKLNGWRGLLLSSAGKEILIKLVAQAIPLYTMQTFLLPKTFCDEPNQMVAQFWWGSAMGK  214

Query  548  RLGIRWKAWKALCT-KIKRWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRYYPN  715
            R  I W +WK LC  K +  LG  DL          Q WRLL  P+SLV  +FK++Y+P 
Sbjct  215  R-RIHWMSWKKLCNPKSEGGLGFKDLYAFNLALLAKQGWRLLQYPNSLVAWIFKAKYFPY  273

Query  716  SDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKD  847
            +D + A V  N    W+S+      +++  R  +GD  S  +  D
Sbjct  274  TDFLQAHVSPNSSHCWKSVAASRLIIQKGARWRVGDGLSINVWGD  318



>ref|XP_010039097.1| PREDICTED: uncharacterized protein LOC104427753 [Eucalyptus grandis]
Length=1506

 Score =   174 bits (440),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 115/353 (33%), Positives = 183/353 (52%), Gaps = 27/353 (8%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I   +  G L G++  R  P +SH+ FADD   FL+A   E+ N+  IL+ Y  A+GQ++
Sbjct  791   ITQAVEMGQLQGIKFNRACPTLSHLFFADDSVFFLKATISEAQNLANILNQYCLATGQII  850

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAG----GSGDTTGKYLGLPSLVGKNKKAILGF  349
             N +KS   F        +NC     Q  A        +  GKYLG+PS  G++K+ +  +
Sbjct  851   NRNKSGLYFS-------KNCPLSLQQNIASEFRMPMMNRYGKYLGIPSDWGRSKREMFSW  903

Query  350   VKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW  529
             +  +  + + GW    LS++G E+LLK+V+QALP YAM IF L ++LCR IE  ++ FWW
Sbjct  904   ILAKANAKLDGWKERLLSKSGKEILLKSVVQALPQYAMSIFKLPLSLCRLIEKKISVFWW  963

Query  530   TGKVARRLGIRWKAWKAL-CTKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFK  697
             +    +  GI W+ W +L  +K    +G  DL        G Q W L  +P++L  ++FK
Sbjct  964   SNNNGKT-GIHWQNWTSLKLSKDSGGMGFRDLVSFNKAMLGKQAWHLFQQPNALWSQLFK  1022

Query  698   SRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDP  874
               Y+ NS    A  G+  L+ W+SI++   A+    R  +GD     I +D WL M    
Sbjct  1023  GLYFRNSSFQCAQAGNRTLWGWQSILKGREAILPRLRWLVGDGSKIKIREDNWLPMGT--  1080

Query  875   YVSTHLHESVREAP---VSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPP  1024
                  L  +V +     V+ L++    +W+   I ++F+++ +  IL IP+ P
Sbjct  1081  -----LGGTVAQGEPVLVADLIDNSHHTWNSTLISNLFDSQVSEEILKIPINP  1128



>ref|XP_010495306.1| PREDICTED: uncharacterized protein LOC104772378 [Camelina sativa]
Length=885

 Score =   172 bits (435),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 115/359 (32%), Positives = 178/359 (50%), Gaps = 27/359 (8%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             + G++VA   P I+H+LFADD   F +A+ E+   +  IL  Y   SGQ +N+ KS   F
Sbjct  234   ITGIKVANKCPQITHLLFADDSLFFYKADKEQCGVVLAILKQYEAVSGQQINFAKSSIQF  293

Query  209   *YQYRSG*QNCSD*RSQRQAGGSGDTT-----GKYLGLPSLVGKNKKAILGFVKDRILSW  373
                      +  D R Q +  G    T     G YLG+P  +G +K  +  +V+DR+ S 
Sbjct  294   --------GHTVDERVQTELHGVLGITNLGGMGSYLGIPESLGGSKTKVFSYVRDRLQSR  345

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
               GW+   LS+ G EV++K+V  A+P++ M  + L  T+  ++   +  FWW+    +  
Sbjct  346   TTGWSVKLLSKGGKEVMVKSVATAVPTFVMSCYRLPKTITSKLTSAVAKFWWSSN-GQSG  404

Query  554   GIRWKAWKAL-CTKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSD  721
             G+ W AW+ L C+K    LG   V D        Q WRL+  PDSL  RVFKSRYY NSD
Sbjct  405   GMHWIAWERLCCSKQMGGLGFRNVDDFNTALLAKQLWRLIEFPDSLFARVFKSRYYRNSD  464

Query  722   LMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-VMAEDPYVSTHLH  895
              ++ +  ++P + WRSIV   + V +     +G   + ++  D W+      P +S    
Sbjct  465   PLDPIRSYSPSYGWRSIVSARSLVNKGLIKRVGSGDTISVWTDPWVPAQFPRPALSNGPF  524

Query  896   E--SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP--PKVRVFAWKLAMS  1060
             +  S+R   ++  M+    SW+RD +++ F+  D   I  IP    P    F W    S
Sbjct  525   KDPSIR---LTQFMDSQSNSWNRDRLVEHFDPGDVALIEAIPFSSLPLKDSFGWHFTKS  580



>ref|XP_004295829.1| PREDICTED: uncharacterized protein LOC101302635 [Fragaria vesca 
subsp. vesca]
Length=913

 Score =   172 bits (436),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 120/340 (35%), Positives = 171/340 (50%), Gaps = 13/340 (4%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             + GM+HGV+ A  AP ISH+LFADD  LF RA   E+ ++K  L LY  A+GQ +N+ KS
Sbjct  219   QEGMIHGVKAAVDAPIISHMLFADDSLLFGRAEIHEAIHVKQCLLLYESAAGQKINFQKS  278

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSG-DTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
                F      G  + +     +  G    D   KYLGLP++ G+NKK +   + +R+   
Sbjct  279   AIAF----GPGLDDQTKLEITQMLGVPMVDCHEKYLGLPTIAGRNKKGMFKRINERLDFH  334

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             ++GW +  LS+AG  VL+K V QA+P+Y+M +F L   +C + +  +  FWW GK   + 
Sbjct  335   LQGWQSKLLSKAGKFVLVKAVAQAIPTYSMSVFKLPKGVCCKFQSKVAKFWW-GKKGNKR  393

Query  554   GIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
             GI W  W  LC  K +  LG  DL+G          WR++  PDS++ RV  ++Y  N D
Sbjct  394   GIHWCKWDLLCRNKKEGGLGFRDLEGFNQALLAKTVWRIVLHPDSIINRVLHAKYVRNGD  453

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
                A V   P F+W+ +V   + +    R  IG      I  D WL       V T    
Sbjct  454   WAAAGVRVKPSFVWQGLVWGKDLLCVGIRWRIGSGDLVKIWGDKWLATPWSFKVVTPCFM  513

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                 A VS LM+  G  WD + I   F   D   IL +P+
Sbjct  514   D-PNARVSQLMSQPGM-WDMNFIKQHFLPVDVEKILTVPL  551



>ref|XP_008233458.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=811

 Score =   171 bits (433),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 116/363 (32%), Positives = 178/363 (49%), Gaps = 20/363 (6%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             RG + GV++AR  P +SH+ FA+D   FLRA     +N+K +LDLY  ASGQ +N+ KS 
Sbjct  85    RGNIMGVKIARRCPTLSHLFFANDSLFFLRAEARNFSNLKRVLDLYCVASGQCINFQKSS  144

Query  200   SVF*YQYRSG*QN--CSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
               F        +   CS            D  G YLGLP++ G++KK+ L + ++R+   
Sbjct  145   IFFSPNTTESVRTLLCSILNID-----GLDNPGIYLGLPTIWGRSKKSALSYNRERVKKM  199

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             + GW    LS AG EVL+K+V  A+P+Y M  F      C EI   L +FWW G      
Sbjct  200   IAGWKQNTLSMAGKEVLIKSVATAIPAYPMTCFRFPEGTCNEINSDLANFWW-GNSTEGN  258

Query  554   GIRWKAWKAL-CTKIKRWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRYYPNSD  721
             G+ WK+WK L  +K    LG  DL          Q WR++  P S+  ++ ++RY+P+ +
Sbjct  259   GLHWKSWKKLGVSKKSGGLGFRDLSSFNLALLAKQAWRIVQNPQSIWAQILQARYFPHCN  318

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
              + A  G    + W S++E  +A+    +  I +  +T I KD W+  +    +      
Sbjct  319   FLQAKKGSRSSWAWASLIEGRDALLMEAKFQIFNGATTNIWKDNWISASNSGVIKPTCPV  378

Query  899   SVREAP--VSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP----PKVRVFAWKLAMS  1060
              +  AP  V  +M+    SW+ D I D  +    N I + P+     P   V+ W    S
Sbjct  379   PI-TAPQLVCEIMDKPNHSWNLDLIADCLDRETINLIRSTPISLSPRPDRLVWPWNPNGS  437

Query  1061  YSL  1069
             +S+
Sbjct  438   FSV  440



>gb|AAG13524.1|AC068924_29 putative non-LTR retroelement reverse transcriptase [Oryza sativa 
Japonica Group]
Length=1382

 Score =   173 bits (439),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 117/337 (35%), Positives = 165/337 (49%), Gaps = 10/337 (3%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G L G++  R  PPISH+LFADD   F +A++     +K  L  Y  ASGQ +N  KS S
Sbjct  677   GELQGIKNGRHGPPISHLLFADDSIFFAKADSRNVQALKNTLRSYCSASGQKINLHKS-S  735

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRG  382
             +F +  R         +S  Q          YLG+P+ +G        F+ +RI   V G
Sbjct  736   IF-FGKRCPDAVKISVKSCLQVDNEV-LQDSYLGMPTEIGLATTNFFKFLPERIWKRVNG  793

Query  383   WNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIR  562
             W    LSRAG E +LK V QA+P+Y M  F + +++C +++  +   WW  +  ++  + 
Sbjct  794   WTDRPLSRAGMETMLKAVAQAIPNYVMSCFRIPVSICEKMKTCIADHWWGFEDGKK-KMH  852

Query  563   WKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
             WK+W  L T K    +G  +         G Q WRLLT PDSL  RV K RY+PNS    
Sbjct  853   WKSWSWLSTPKFLGGMGFREFTTFNQAMLGRQCWRLLTDPDSLCSRVLKGRYFPNSSFWE  912

Query  731   AVG-HNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVR  907
             A    +P F WRS++     + +  R  +GD ++  I  D W +    P + T L     
Sbjct  913   AAQPKSPSFTWRSLLFGRELLAKGVRWGVGDGKTIKIFSDNW-IPGFRPQLVTTLSPFPT  971

Query  908   EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +A VS LMN     WD D I  +F    A  IL IP+
Sbjct  972   DATVSCLMNEDARCWDGDLIRSLFPVDIAKEILQIPI  1008



>ref|XP_010666306.1| PREDICTED: uncharacterized protein LOC104883473 [Beta vulgaris 
subsp. vulgaris]
Length=1322

 Score =   173 bits (438),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 110/335 (33%), Positives = 172/335 (51%), Gaps = 9/335 (3%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             +HG ++ RGAP +SH+ FADD  LF +A+ +E + +  I+  Y  ASGQ VN  K+  VF
Sbjct  627   IHGARICRGAPMVSHLFFADDSILFTKASVQECSVVADIISKYERASGQKVNLSKTEVVF  686

Query  209   *YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWN  388
                  S   +  D   +       +   KYLGLP+++G++KK     +K+RI   ++GW 
Sbjct  687   SRNVES---DRRDAIVRVLGVNEVERQEKYLGLPTVIGRSKKVTFACIKERIWKKLQGWK  743

Query  389   T*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWK  568
                LSR G E+L+K+V QA+P+Y M +F L   L  EI  +L  FWW      R  + W 
Sbjct  744   EKLLSRPGKEILIKSVAQAIPTYMMSVFCLPSGLIDEIHAMLARFWWGSNGGER-KMHWH  802

Query  569   AWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-  733
             +W A+C  K    LG  DL          Q WRL  R  +L+ +V ++RYY N + + A 
Sbjct  803   SWDAMCLPKSMGGLGFRDLHCFNQALLAKQAWRLCQRDATLLSQVLQARYYKNVEFLEAR  862

Query  734   VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREA  913
              G+NP F WRS+    + + +  +  +G      +  + W++     +V T  H+S  E 
Sbjct  863   RGYNPSFTWRSVWSSKSLLLEGLKWCVGSGSRINVWTEAWILGEGSHHVPTPRHDSNMEL  922

Query  914   PVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              V  L++     W+ + +  VF   +   IL+IP+
Sbjct  923   RVCDLIDVNRGGWNVEVVQQVFVEEEWRSILDIPL  957



>ref|XP_010472440.1| PREDICTED: uncharacterized protein LOC104752070 [Camelina sativa]
Length=1126

 Score =   172 bits (437),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 123/360 (34%), Positives = 176/360 (49%), Gaps = 27/360 (8%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             L G +     P I ++LFADD     ++  EE   +   L  Y  ASGQ++N  KS   F
Sbjct  524   LTGFRFNESCPVIQNLLFADDSLFVCQSTKEECEELMLCLQSYGKASGQMINLSKSAVTF  583

Query  209   *YQYRSG*QNC-SD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGW  385
               +     +N      S  + GG    TG YLGLP     +K+A+LGF+ D++ + ++GW
Sbjct  584   GKRISEETKNVVKQTLSIYEEGG----TGTYLGLPECFSGSKQALLGFIGDKLQNRLQGW  639

Query  386   NT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRW  565
                 LS  G EVLLK V  ALP YAM  F LS  LCR++   +  FWW+    RR  I W
Sbjct  640   FAKSLSLGGKEVLLKAVAMALPVYAMSCFRLSKNLCRKLTSAMCEFWWSNCQGRR-KIAW  698

Query  566   KAWKALC-TKIKRWLGVYDLKGDEP----GTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
              AWK LC +K +  LG  DL GD        Q WR+L  PDSLV R +KSRY+  + ++ 
Sbjct  699   VAWKKLCKSKSEGGLGFKDL-GDFNQALLAKQAWRILNNPDSLVTRFYKSRYFRKTSIIE  757

Query  731   A-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV--MAEDPYVSTHLHES  901
                G  P + WRSI+   + +K     SIGD   T + +D W++      P+ S    + 
Sbjct  758   CGAGSRPSYAWRSILHGRDLLKAGLMKSIGDGCDTLVWRDKWIMDKHPRAPFRSQIFFDF  817

Query  902   VREAPVSSLMNGVGTSWDRDCIID-VFNARDANCI-LN--------IPVPPKVRVFAWKL  1051
                  V  L      +WD++  +  ++  R  + I LN        +   PK+R F W++
Sbjct  818   --NMKVVDLRTPGAATWDKEKTLSTLYEPRSDDLIKLNELKASVWKVETVPKIRTFLWRM  875



>ref|XP_010495441.1| PREDICTED: uncharacterized protein LOC104772536 [Camelina sativa]
Length=911

 Score =   172 bits (435),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 112/362 (31%), Positives = 177/362 (49%), Gaps = 33/362 (9%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             + G++VA   PPI+H+LFADD   F + + ++   +  IL  Y   SGQ VN  KS   F
Sbjct  214   ITGIKVANKCPPITHLLFADDSLFFCKVDKDQCLAILEILRQYERVSGQQVNLAKSSIQF  273

Query  209   *YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRILSWV  376
              +   +  Q           G  G T     G YLG+P  +G +K  +  +V+DR+ S  
Sbjct  274   GHTVEAAVQT-------ELQGVLGITNRGGMGSYLGIPESLGGSKTKVFSYVRDRLQSRT  326

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
              GW+   LS+ G EV++K+V  A+ ++ M  + L  T+  ++   + +FWW+    +  G
Sbjct  327   TGWSARLLSKGGKEVMVKSVATAVLTFVMSCYRLPKTITTKLTSAVANFWWSTN-GQSGG  385

Query  557   IRWKAWKALCTKIKR----WLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDL  724
             + W AW+ LC   +     +  V D        Q WRL+  PDSL  RVFKSRYY NSD 
Sbjct  386   MHWIAWERLCCSKQLGGLGFKSVDDFNTALLAKQLWRLIEYPDSLFARVFKSRYYRNSDP  445

Query  725   MNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-------VMAEDPYV  880
             M+ +  ++P + WRSIV   + V +     +G   S +I  D W+        ++  P+ 
Sbjct  446   MDPIRSYSPSYGWRSIVSARSLVNKGLITRVGSGTSISIWSDPWVPAQFARPALSNGPFK  505

Query  881   STHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR--VFAWKLA  1054
               +L       P+S L++    SW +D ++  F++ D   I  IP+  ++R   F W   
Sbjct  506   DPNL-------PISHLIDRSANSWRKDLLMHHFDSEDVALIEAIPLGRQLRDDYFGWHFT  558

Query  1055  MS  1060
              S
Sbjct  559   KS  560



>ref|XP_008366311.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=812

 Score =   171 bits (432),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 117/351 (33%), Positives = 173/351 (49%), Gaps = 25/351 (7%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             +  R  +G LHG++V      ISH+ FADD  +F +A   E   +  +L  Y  ASGQ++
Sbjct  227   LRKREEQGYLHGIRVTPDGMQISHLFFADDAVIFCKATEVEVRGILEVLQCYAAASGQII  286

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGS------GDTTGKYLGLPSLVGKNKKAIL  343
             N +K    F  Q       C   R QR+   S       +T G+YLGL +  G +KKA+ 
Sbjct  287   NREKCSLYFGNQ-------CP--RQQRRLIESCTNFVGKETFGRYLGLSADFGASKKAVF  337

Query  344   GFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHF  523
               V++ +   + GW   FLS AG EV++K V  ALP+YAM  F L + LC+E+E  + +F
Sbjct  338   EGVREALDGRINGWAEQFLSPAGKEVMIKAVAIALPNYAMSCFKLPVNLCKEMESNIANF  397

Query  524   WWTGKVARRLGIRWKAWKALCTKIK-RWLGVYDLKGDEPGTQT---WRLLTRPDSLVERV  691
             WW G   +  G+ W +W+ +  + K   LG  DL            WR+LT P SL+ ++
Sbjct  398   WWRGSREKN-GMHWISWEKMKRRKKVGGLGFRDLLSFNLAYLAKIGWRILTNPLSLLSKI  456

Query  692   FKSRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAE  868
              K +Y+P    M A VG    + W+ I++    +++  R  +GD  S  +  D WL    
Sbjct  457   LKXKYFPECSFMEAKVGKRSTWGWKGIMQGKKILERGRRWRVGDGSSIRVKYDPWLPRPH  516

Query  869   D-PYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                 +S HL   V    V  L+N V  SW  D +   F   ++N IL IP 
Sbjct  517   TFRVISKHLDMPVM---VKDLINPVTGSWMVDLVKGCFEEEESNIILGIPT  564



>gb|AAP54617.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
 gb|EAZ16681.1| hypothetical protein OsJ_32156 [Oryza sativa Japonica Group]
Length=1339

 Score =   173 bits (438),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 164/342 (48%), Gaps = 20/342 (6%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G L G++  R  PPISH+LFADD   F +A++     +K  L  Y  ASGQ +N  KS  
Sbjct  634   GELQGIKNGRHGPPISHLLFADDSIFFAKADSRNVQALKNTLRSYCSASGQKINLHKSSI  693

Query  203   VF*YQYRSG*QNCSD*-----RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRIL  367
              F        + C D      +S  Q          YLG+P+ +G        F+ +RI 
Sbjct  694   FFG-------KRCPDAVKISVKSCLQVDNEV-LQDSYLGMPTEIGLATTNFFKFLPERIW  745

Query  368   SWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVAR  547
               V GW    LSRAG E +LK V QA+P+Y M  F + +++C +++  +   WW  +  +
Sbjct  746   KRVNGWTDRPLSRAGMETMLKAVAQAIPNYVMSCFRIPVSICEKMKTCIADHWWGFEDGK  805

Query  548   RLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPN  715
             +  + WK+W  L T K    +G  +         G Q WRLLT PDSL  RV K RY+PN
Sbjct  806   K-KMHWKSWSWLSTPKFLGGMGFREFTTFNQAMLGRQCWRLLTDPDSLCSRVLKGRYFPN  864

Query  716   SDLMNAVG-HNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHL  892
             S    A    +P F WRS++     + +  R  +GD ++  I  D W +    P + T L
Sbjct  865   SSFWEAAQPKSPSFTWRSLLFGRELLAKGVRWGVGDGKTIKIFSDNW-IPGFRPQLVTTL  923

Query  893   HESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                  +A VS LMN     WD D I  +F    A  IL IP+
Sbjct  924   SPFPTDATVSCLMNEDARCWDGDLIRSLFPVDIAKEILQIPI  965



>ref|XP_008338539.1| PREDICTED: uncharacterized protein LOC103401606 [Malus domestica]
Length=565

 Score =   169 bits (427),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 107/292 (37%), Positives = 153/292 (52%), Gaps = 21/292 (7%)
 Frame = +2

Query  14   MRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDK  193
            M RG LHG +V+    PISH+ F +D  LF  A+ EE+  +  +L  Y   SGQ VN  K
Sbjct  1    MERGALHGFRVSANGNPISHLFFTNDSVLFGHASVEEAKGILEVLRTYARGSGQAVNLSK  60

Query  194  SLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTT-----GKYLGLPSLVGKNKKAILGFVKD  358
            SL  F  +  S        R +R+ G +         G+YLGL +  G +K+ +   V+D
Sbjct  61   SLIFFGSKTSS--------RVRRKIGQTMRIQCKTGFGRYLGLQADFGHSKRVVFEEVRD  112

Query  359  RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
            R+ SW+ GW   FLS+A  EVL+K V  ALP+YAM  F L I +CR++E  + +FWW G 
Sbjct  113  RLESWLAGWAKQFLSQARKEVLIKAVAMALPNYAMSCFKLPIGVCRDLEKAIRNFWWKGS  172

Query  539  VARRLGIRWKAWKALCTKIKRW--LGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSR  703
              R+ G+ W +W+ L  K K++  LG  D++       G   WRL+  P SL+  V + +
Sbjct  173  EQRK-GVHWISWERL-MKQKQFGGLGFRDIQCFNLAFLGKIGWRLIQIPRSLLATVLEEK  230

Query  704  YYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL  856
            YYP     +A  G N  + W+ I E  N + Q  R  +GD     I +D W 
Sbjct  231  YYPGKSFTDAGKGKNTSWEWKGIFEARNVLLQGLRWRVGDGACINIREDPWF  282



>ref|XP_009361334.1| PREDICTED: uncharacterized protein LOC103951630 [Pyrus x bretschneideri]
Length=1297

 Score =   172 bits (437),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 116/352 (33%), Positives = 181/352 (51%), Gaps = 14/352 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I   + R ML G+Q   G P ISH+ FADD  +F+RA+ +   ++K IL  Y  ASGQLV
Sbjct  575   IQQAVERRMLMGIQPNYGCPIISHLFFADDTLIFMRADKKNCNSLKKILADYCSASGQLV  634

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGS-GDTTGKYLGLPSLVGKNKKAILGFVKD  358
             NY KS   F     +    C         G    +  GKYLGLPS  G++KK  L FVK+
Sbjct  635   NYQKSCLFF----GANVPRCLSIELGHFVGIPLAEEPGKYLGLPSFWGRSKKQGLAFVKE  690

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             RIL+ V+GW    LS+AG E+++K V+QA+P+Y M +F    TLC + + ++  FWW GK
Sbjct  691   RILAKVQGWKQYTLSQAGKEIMIKAVIQAIPAYPMHLFKFPTTLCSDFDALIAEFWW-GK  749

Query  539   VARRLGIRWKAWKAL-CTKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRY  706
                + GI W +   L   K +  +G  + +         Q WRL+  P+SL  ++ K+RY
Sbjct  750   SGGQKGIHWVSRGILGYPKQEEGMGFRNFQAFNDALLAKQCWRLIHDPNSLWAQLLKARY  809

Query  707   YPNSDLM-NAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL--VMAEDPY  877
             +P+   + +++G    + W S++     + +     I + RS  +  D W+  + A  P 
Sbjct  810   FPHCSFLDDSLGGRASWGWSSLLVGREILLRGAHWQIMNGRSIRLWHDRWVPSIPAGKPT  869

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR  1033
                 +  S R   V++L+N V  +W+ + I    +  D   IL+  +   +R
Sbjct  870   AVGGVRVS-RNMRVNTLINDVSGTWNIEAIRPFISLEDFEAILDTSIGDGLR  920



>gb|AAG51783.1|AC079679_3 reverse transcriptase, putative; 16838-20266 [Arabidopsis thaliana]
Length=1142

 Score =   172 bits (436),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 109/343 (32%), Positives = 177/343 (52%), Gaps = 17/343 (5%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R+ ++ G++VA  +P +SH+LFADD   F +AN E+   +  IL  Y   SGQ +N+ KS
Sbjct  444   RQNLITGIKVATPSPAVSHLLFADDSLFFCKANKEQCGIILEILKQYESVSGQQINFSKS  503

Query  197   LSVF*YQYRSG*QNCSD*R---SQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRIL  367
                F ++     +  +D +        GG     G YLGLP  +G +K  +  FV+DR+ 
Sbjct  504   SIQFGHKVEDSIK--ADIKLILGIHNLGG----MGSYLGLPESLGGSKTKVFSFVRDRLQ  557

Query  368   SWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVAR  547
             S + GW+  FLS+ G EV++K+V   LP Y M  F L   +  ++   +  FWW+     
Sbjct  558   SRINGWSAKFLSKGGKEVMIKSVAATLPRYVMSCFRLPKAITSKLTSAVAKFWWSSNGDS  617

Query  548   RLGIRWKAWKALC-TKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPN  715
             R G+ W AW  LC +K    LG   V D        Q WRL+T PDSL  +VFK RY+  
Sbjct  618   R-GMHWMAWDKLCSSKSDGGLGFRNVDDFNSALLAKQLWRLITAPDSLFAKVFKGRYFRK  676

Query  716   SDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHL  892
             S+ ++++  ++P + WRS++   + V +     +G   S ++  D W + A+ P  + + 
Sbjct  677   SNPLDSIKSYSPSYGWRSMISARSLVYKGLIKRVGSGASISVWNDPW-IPAQFPRPAKYG  735

Query  893   HESVREA-PVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                V  +  V SL++     W+ D + ++F+  D   I  +P+
Sbjct  736   GSIVDPSLKVKSLIDSRSNFWNIDLLKELFDPEDVPLISALPI  778



>ref|XP_007220081.1| hypothetical protein PRUPE_ppa024663mg [Prunus persica]
 gb|EMJ21280.1| hypothetical protein PRUPE_ppa024663mg [Prunus persica]
Length=681

 Score =   169 bits (429),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 121/367 (33%), Positives = 181/367 (49%), Gaps = 16/367 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             + + +  G + GV++AR  P ISH+ FAD+   F++A  +    +K  LD Y  ASGQ +
Sbjct  36    LSSAVHNGEIKGVRIARRCPMISHLFFADNALFFVKAEAQNYMKLKEKLDKYCLASGQCI  95

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             +  KS S+F +   +  +   D  +     G  D  G YLGLP++ G++K A LG++K+R
Sbjct  96    SSQKS-SIF-FSSNTLVETRRDICALLNINGV-DNPGTYLGLPTIWGRSKNAALGYIKER  152

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             IL  + GW    LS AG EVLLK V  A+P++ M  F      C +I   L  FWW G  
Sbjct  153   ILKKMDGWKLNTLSLAGKEVLLKAVTTAVPAFPMACFRFPEGTCNQINSALASFWW-GNN  211

Query  542   ARRLGIRWKAWKALCTKIK-RWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRYY  709
                 GI WK+WK LC   K   LG  DL          Q+WR++  P++   ++ K+RY+
Sbjct  212   EENAGIHWKSWKKLCLAKKVGGLGFRDLSNFNLALLAKQSWRIILNPEAAWVKILKARYF  271

Query  710   PNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
             P +D ++A  G  P + W S++E   A+ +  R  I    +     D+W+   E   V T
Sbjct  272   PTTDFLHATKGSRPSWAWVSLLEGITAMMKEARFQIFIGANMNKWNDVWIPSCEPGPVQT  331

Query  887   HLHESVREAP--VSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP----PKVRVFAWK  1048
              L     +AP  V  LM+    +W  D I    N      I  IP+     P   V+ W 
Sbjct  332   -LLPIPHQAPQLVQELMDKRNHTWKLDSISTFINNDFLQSIGCIPIGHSSRPDRLVWPWN  390

Query  1049  LAMSYSL  1069
              + SY++
Sbjct  391   SSGSYTV  397



>ref|XP_009140188.1| PREDICTED: uncharacterized protein LOC103864181 [Brassica rapa]
Length=829

 Score =   170 bits (431),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 179/365 (49%), Gaps = 21/365 (6%)
 Frame = +2

Query  8     NRMRR-GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVN  184
             NR  R G L G+Q +   P I H+LFADD     +A+  ++  +K ILD+Y  A+GQ +N
Sbjct  106   NRAERDGNLQGLQFSEHGPSIHHLLFADDSLFMCKADVSQARVLKRILDIYDNATGQTIN  165

Query  185   YDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDT-TGKYLGLPSLVGKNKKAILGFVKDR  361
               KS   F      G    S    Q+  G   +  T KYLGLP     +K  +LG++K+R
Sbjct  166   VQKSAISFGRDIDIG----SKALIQKVLGIVNEGGTSKYLGLPECFSGSKVELLGYLKER  221

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
                 +  W    LS+ G E+LLK+   ALP +AM +F L   +C ++   +  FWW G  
Sbjct  222   TNGRLNSWYMRKLSQGGKEILLKSTASALPLFAMSVFKLPKKVCSKLSSAMADFWW-GAD  280

Query  542   ARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYY  709
             +    I W +W  LC +K    LG  DL+         Q W++L+ P+SLV R  KSRY+
Sbjct  281   SHLKKIHWLSWDKLCLSKEYGGLGFRDLEAFNQALLAKQAWKILSSPESLVARFLKSRYF  340

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPY---  877
             PN + + A +G  P + WRS++     + +  +  +GD  S  +  D W+    D Y   
Sbjct  341   PNGEFLEASLGKRPSYAWRSLLFGRELLNKGIKKRVGDGNSIFVWSDRWIEDDSDGYGLR  400

Query  878   ---VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCIL-NIPVPPKVRVFAW  1045
                +   L ++     VS+L++     W+R  + D+F   D   +L N PV  K   ++W
Sbjct  401   ALWIKNLLFDA--NLKVSNLIDFSARRWNRVALEDLFVPSDIRILLQNQPVVSKQDFWSW  458

Query  1046  KLAMS  1060
             K   S
Sbjct  459   KFKRS  463



>ref|XP_004298552.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=322

 Score =   163 bits (413),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 94/255 (37%), Positives = 141/255 (55%), Gaps = 12/255 (5%)
 Frame = +2

Query  26   MLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSV  205
            +LHGV +ARGAP ++H+ FADD  LF  A+ ++   +K I  +Y   SGQ ++ +KS   
Sbjct  47   LLHGVSIARGAPSVTHLFFADDSLLFCDASVQDCLKLKEIFAVYERVSGQKISVEKSTVS  106

Query  206  F*YQY-RSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRG  382
            F  +  R   + CS     +          +YLGLP + G+NKK +   V DR+   ++G
Sbjct  107  FSPRTTRVVKEACSTALDMKIV----PCHERYLGLPIVTGRNKKKVFKGVADRVWQKIQG  162

Query  383  WNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIR  562
            W    LS+ G EVL+K V Q++P+Y M +F L   +C+EI   L  +WW     +  GI 
Sbjct  163  WEGKLLSKGGKEVLIKAVAQSIPTYTMSVFQLPAGICKEINKHLARYWWGNFGGK--GIH  220

Query  563  WKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
            W+ W ALC  K +  LG  + +       G   WRL+   +SLV ++ K++YYPNS  + 
Sbjct  221  WRRWDALCVPKGEGGLGFREFQCFNQALVGKIGWRLIQDEESLVGQMLKAKYYPNSSFLE  280

Query  731  AV-GHNPLFIWRSIV  772
            AV G NP  IWR+++
Sbjct  281  AVIGRNPSSIWRAVM  295



>ref|XP_009102110.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=712

 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 113/346 (33%), Positives = 169/346 (49%), Gaps = 13/346 (4%)
 Frame = +2

Query  14    MRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDK  193
             MR   L GV++A  AP ++H+LFADD   F  AN + +  +K I   Y   SGQ +N  K
Sbjct  1     MRDRSLLGVKIAIQAPAVNHLLFADDSLFFSLANPKAAKKLKDIFSKYESVSGQAINLSK  60

Query  194   SLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
             S   F    + G +  +  R+       G   GKYLGLP   G  K  +  ++ D++   
Sbjct  61    STITF--GSKVGAEVKTRMRNVLGIHNEGGI-GKYLGLPEQFGSKKGEMFAYIVDKVKKV  117

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW-TGKVARR  550
             V GW    L+  G EVLLK++  A+P ++M IF L   +C EI  IL  FWW TG+    
Sbjct  118   VHGWKQKHLTHGGKEVLLKSIALAMPIFSMNIFRLPKEVCEEINAILARFWWGTGESK--  175

Query  551   LGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNS  718
              G+ W AWK +C  K +  LG  DL+       G Q WR++  P+ L+ RV ++RY+P  
Sbjct  176   -GLHWYAWKRVCIPKREGGLGFRDLESFNQALLGKQVWRIMQNPNCLMARVLRARYFPEG  234

Query  719   DLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLH  895
             D++ A +     + W+SI+   + + +  R  IG+  ST +  D WL +   P       
Sbjct  235   DILKATLKKKSSYAWKSILHGKDLIVKGMRYIIGNGESTKMWTDSWLSL-HPPRPPRSRG  293

Query  896   ESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR  1033
             E    + VS  +   G  W+ D + +     D   IL + +  K R
Sbjct  294   EVNTNSKVSDYVLNNGRGWNLDKLREDVIQEDIEKILELKISSKAR  339



>gb|AFP55557.1| non-ltr retroelement reverse transcriptase [Rosa rugosa]
Length=1747

 Score =   172 bits (435),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 149/286 (52%), Gaps = 12/286 (4%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R   +HGV +ARGAP +SH+ +ADD  LF  A   +   +K I   Y  ASGQ +N DKS
Sbjct  948   REQQIHGVAIARGAPSVSHLFYADDSLLFCDATVTDCMALKNIFSTYEAASGQKINKDKS  1007

Query  197   LSVF*YQYRSG*QN-CSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
                F  +  +  +  CS                +YLGLP++ GK+KK +   + DR+ + 
Sbjct  1008  AICFSPKSPAAIKEACSAILDMPVV----PCHERYLGLPTVSGKDKKKLFQSLPDRVWNR  1063

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             V GW    LS+AG EVL+K V QA+P+Y M +F L       I   +  FWW  +  +  
Sbjct  1064  VHGWEGKLLSKAGKEVLIKTVAQAIPNYTMSVFQLPAGTSDAINKCVARFWWGKEGGK--  1121

Query  554   GIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
             GI W+ W  LC +K    LG  DL        G Q WRL+  PDSLV R+ K++Y+P  D
Sbjct  1122  GIHWRRWSDLCFSKKDGGLGFRDLSLFNQALLGKQGWRLMMYPDSLVARMLKAKYFPWDD  1181

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL  856
              M A +G +P ++WRS +     +++  R  IGD +   +  D W+
Sbjct  1182  FMEAELGSSPSYLWRSFLWGRELLRKGVRWRIGDGKEVRVFIDPWV  1227



>gb|EEE50824.1| hypothetical protein OsJ_31232 [Oryza sativa Japonica Group]
Length=1594

 Score =   171 bits (434),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 113/353 (32%), Positives = 175/353 (50%), Gaps = 19/353 (5%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
               G LHG+++ +GAP +SH+LFADD  +  RAN  E+  ++ IL +Y   SGQ++N DKS
Sbjct  889   EEGRLHGIRICQGAPSVSHLLFADDSLILCRANGGEAQQLQTILQIYEECSGQVINKDKS  948

Query  197   LSVF*YQYRSG*QNC--SD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILS  370
               +F     S  +    +    QR+      T  KYLGLP  VG+++  I  ++K+RI  
Sbjct  949   AVMFSPNTSSLEKGAVMAALNMQRET-----TNEKYLGLPVFVGRSRTKIFSYLKERIWQ  1003

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
              ++GW    LSRAG E+L+K V QA+P++AM  F L+  LC +I  ++  +WW+ +  + 
Sbjct  1004  RIQGWKEKLLSRAGKEILIKAVAQAIPTFAMGCFELTKDLCDQISKMIAKYWWSNQ-EKD  1062

Query  551   LGIRWKAWKALC-TKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNS  718
               + W +W  L   K    LG   +Y         Q WRL+  PDSL  RV +++Y+P  
Sbjct  1063  NKMHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVLRAKYFPLG  1122

Query  719   DLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVM--AEDPYVSTH  889
             D        N  + WRSI +    ++      +GD     I  D W+    +  P     
Sbjct  1123  DCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWRMGDGSKINIWADPWIPRGWSRKPMTPRG  1182

Query  890   LHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR-VFAW  1045
              +   +   V  L++    +WD D +   F   D   I +IPV  ++  V AW
Sbjct  1183  ANLVTK---VEELIDPYTGTWDEDLLSQTFWEEDVAAIKSIPVHVEMEDVLAW  1232



>ref|XP_009115737.1| PREDICTED: uncharacterized protein LOC103840975 [Brassica rapa]
Length=863

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/346 (32%), Positives = 172/346 (50%), Gaps = 9/346 (3%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I    R G + G+++ARG+PPISH+LFADD   F +A+  + A +  I++ Y  ASGQ +
Sbjct  155   IQGAEREGRITGLKIARGSPPISHLLFADDSLFFCKADILQCAELMKIINDYGKASGQQL  214

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N  KS  +F  +     +  +D +        G   G YLGLP  +  +K+    +++DR
Sbjct  215   NISKSSILFGTKVPQ--ETKADIKQALGITKEGGM-GVYLGLPEKICGSKRQAFAYIQDR  271

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             + S V  W+   LS+ G EVLLK+V QALP+Y M  F L   + R++   ++ FWW+ K 
Sbjct  272   LNSRVNSWSAKLLSKGGKEVLLKSVAQALPTYVMSCFLLPQDIIRKLTSSISRFWWSSKQ  331

Query  542   ARRLGIRWKAWKALCT-KIKRWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRYY  709
               R G+ W AW  +C  K K  LG  DLK         Q WR+L  P SL+ RV K RY+
Sbjct  332   NSR-GLHWIAWHKICKPKDKGGLGFRDLKNFNLALLAKQLWRILHHPTSLLARVLKGRYF  390

Query  710   PNSD-LMNAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
               +D ++ +  ++P ++WRS++     ++   R +I    +T +    WL          
Sbjct  391   RATDPILASKANSPSYVWRSLMAAKPLLQAGLRRTICSGANTKVCSANWLPTTPPRPPLC  450

Query  887   HLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPP  1024
                    +  V+ L      +W+ D +   F   D + I +I   P
Sbjct  451   IRPSFNPDLKVAELFMPHSRTWNLDSLRSFFATEDISLICSIKPRP  496



>gb|EPS72636.1| hypothetical protein M569_02121, partial [Genlisea aurea]
Length=1503

 Score =   171 bits (433),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 112/340 (33%), Positives = 173/340 (51%), Gaps = 25/340 (7%)
 Frame = +2

Query  35    GVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*Y  214
             G +V R  P ISH+ FADD  +F  A+    + +  IL  Y  ASGQ VN  KS  VF  
Sbjct  1005  GFRVTRRGPSISHLFFADDAMIFCEASCAALSRVSDILQDYERASGQKVNTHKSAMVFS-  1063

Query  215   QYRSG*QNCSD*RSQRQAGGSGDTTGK----YLGLPSLVGKNKKAILGFVKDRILSWVRG  382
                    N  D   +  + G G         YLGLPSL G +KK +   + +R+   + G
Sbjct  1064  ------PNTPDSEKEIWSRGLGFLVKSHHDIYLGLPSLTGSSKKRLFSGLLERVNRKIEG  1117

Query  383   WNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIR  562
             WN+ FLS+AG  VL+K VLQA+P+Y M  F+L  +   +++  ++ +WW  +  +  GI 
Sbjct  1118  WNSKFLSQAGKLVLIKAVLQAIPAYTMSCFALPKSFLGDLQSAISRYWWRNRNGK--GIH  1175

Query  563   WKAWKALCTKIKR----WLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
             WK+W  +    K     +  ++D      G Q WR+ + P S++ RVF+++Y+PN D+  
Sbjct  1176  WKSWDFISRSFKEGGLGFRDLHDFNLALLGKQVWRIASAPHSILSRVFRAKYFPNGDIWT  1235

Query  731   AVGHNPL----FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
             A    P     ++W  I++  + V +  R  IGD  S  I  D W +     +  T+L  
Sbjct  1236  A---RPCARGSYVWNGIMKSRDLVSKGIRHLIGDGSSVDIWHDPW-IPKPPTFKPTNLLG  1291

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
               R A V++L++     WD   I + F+  DAN I++IP+
Sbjct  1292  ERRRASVATLIDSRTKWWDVGRIREKFDPVDANHIISIPL  1331



>ref|XP_009149314.1| PREDICTED: uncharacterized protein LOC103872634 [Brassica rapa]
Length=954

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 114/345 (33%), Positives = 179/345 (52%), Gaps = 14/345 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             +++    G L G+ ++   P + H+LFADD  L  +AN  E   +   L  Y  ASGQ +
Sbjct  286   LNHAEESGRLTGIGLSANGPRVHHLLFADDSLLLCKANELEGTEIMNCLKEYGDASGQRI  345

Query  182   NYDKSLSVF*YQ-YRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             N+ KS  +F  Q   S   N        + GG G     YLGLP     +K+ +L F+++
Sbjct  346   NFQKSSVIFGSQVLDSTKANVKRVLGIDREGGEG----TYLGLPECFKGSKRELLSFIRE  401

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             ++ S + GW    LS  G EVLLK+V  +LP YAM +F L   +C +I   +  FWW G 
Sbjct  402   KLQSRLHGWFAKTLSLGGKEVLLKSVAMSLPVYAMSMFKLPKDVCAKITSAMTEFWWGGG  461

Query  539   VARRLGIRWKAWKALCTKIKR-WLGVYDL-KGDEP--GTQTWRLLTRPDSLVERVFKSRY  706
               +R  I W +WK LC + K   LG +D+ K ++   G Q WR+++ P+SLV RV KS+Y
Sbjct  462   NGKR-KIAWVSWKKLCKQKKEGGLGFHDIVKFNQSLLGKQAWRIMSNPNSLVARVLKSKY  520

Query  707   YPNSD-LMNAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             +PN D L +++G  P + WRSI+   + + +     IG+   + +    W++    P   
Sbjct  521   FPNVDFLQSSLGSRPSYAWRSILHGRDVLSKGLVRDIGNGERSNVWSVNWII-DPIPRTP  579

Query  884   THLHESVREAP--VSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
              +  +S+ +    VS L+  + +SWD   + + F   DA  IL +
Sbjct  580   NYRQDSIVDLTLRVSDLLLPLSSSWDAARVREAFTDHDAEIILRL  624



>ref|XP_010682492.1| PREDICTED: uncharacterized protein LOC104897331 [Beta vulgaris 
subsp. vulgaris]
Length=1212

 Score =   171 bits (432),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 112/345 (32%), Positives = 177/345 (51%), Gaps = 20/345 (6%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G +HG +V R AP ISH+ FADD  LF RA  +E + +  I+ +Y  ASGQ +N++KS  
Sbjct  514   GRIHGARVCRSAPRISHLFFADDSILFTRATLQECSVVADIISVYERASGQKINFNKSEV  573

Query  203   VF*YQYRSG*QNCSD*R--SQRQAGGSGDTT--GKYLGLPSLVGKNKKAILGFVKDRILS  370
              F        +N  D R    R   G  +     KYLGLP+L+G++KKA+   +K+R+  
Sbjct  574   SFS-------KNVDDSRRVEIRSMLGVREVVKHDKYLGLPTLIGRSKKAVFAVLKERVWK  626

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK-VAR  547
              ++GW    LS+AG EVL+K V+QA+P+Y M +F++   +  +I  +   FWW    +AR
Sbjct  627   KLQGWKEKLLSKAGKEVLIKAVIQAIPTYMMSLFAIPDGILEDINSMCARFWWRATGMAR  686

Query  548   RLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPN  715
             ++   W +W+  C  K    +G  DLK         Q WRL+    SL  ++ ++RY+ N
Sbjct  687   KM--HWISWEKFCLPKSYGGMGFRDLKTFNQALLAKQGWRLMCDDGSLAHQIMRARYFKN  744

Query  716   SDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHL  892
                ++A  G++P F+WRSI    + + +  +  +G+  S  +    WL       V T  
Sbjct  745   VPFLDARRGYDPSFVWRSIWGAKSLLMEGLKWRVGNGASIRVWDMAWLPGDSSSKVPTPN  804

Query  893   HESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPK  1027
              ES  +  V+ L++ V   WD   +       DA     IP+  +
Sbjct  805   VESREDLMVADLLS-VNGGWDVAALAHHLTEEDAMLAREIPLSER  848



>ref|XP_010484944.1| PREDICTED: uncharacterized protein LOC104763239 [Camelina sativa]
Length=797

 Score =   168 bits (426),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 113/364 (31%), Positives = 178/364 (49%), Gaps = 19/364 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I    R  ++ G++VA   PPISH+LFADD   F +A+ ++   +  IL  Y   SGQ +
Sbjct  353   IQKAERNKLITGIKVANKCPPISHLLFADDSLFFCKADRDQCRVILDILHQYESVSGQQI  412

Query  182   NYDKSLSVF*YQYRSG*Q-NCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             N+ KS   F ++     +    D       GG     G YLGLP  +G  K  +  FV++
Sbjct  413   NFSKSSVQFGHKIDDQTKAELQDVLGIPTLGG----MGSYLGLPESLGGAKTKVFSFVRE  468

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             R  S   GW   FLS+ G EV++K+V  A+P++ M  F L  T+  ++   + +FWW+  
Sbjct  469   RFQSRTNGWTANFLSKGGREVMIKSVATAVPTFVMSCFRLPKTITSKLTSAVANFWWSTN  528

Query  539   VARRLGIRWKAWKALCTKIKRWLG------VYDLKGDEPGTQTWRLLTRPDSLVERVFKS  700
               +  G+ W AW+ LC  + + LG      V D        Q WRL+  PDSL  RVFKS
Sbjct  529   -GQSGGMHWLAWEKLC--VSKQLGGLGFRNVDDFNSALLAKQLWRLIDVPDSLFARVFKS  585

Query  701   RYYPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-VMAEDP  874
             RYY N+  M+ +  ++P + WRSI    + V +     +G   + ++  D W+      P
Sbjct  586   RYYRNTHPMDPIRSYSPSYGWRSICSARSLVNKGLIKRVGSGDTISVWSDPWVPAQFPRP  645

Query  875   YVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPP--KVRVFAWK  1048
              +S  L + +    ++ L++    +W  D + + F+  D + I  IP+    K   F W 
Sbjct  646   ALSKGLVKDL-SLQMNQLIDRQTNTWRMDMLNEHFDPLDVDLIGAIPLGSNQKDDPFGWH  704

Query  1049  LAMS  1060
             L  +
Sbjct  705   LTKT  708



>ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621413 [Citrus sinensis]
Length=2303

 Score =   171 bits (434),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 113/335 (34%), Positives = 169/335 (50%), Gaps = 23/335 (7%)
 Frame = +2

Query  65    ISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*YQYRSG*QNCS  244
             ISH+LFADD  +F  A+  E  ++KGI D Y  ASGQ+ N++KS   F      G +   
Sbjct  653   ISHLLFADDSLVFSTASVAECKHLKGIFDRYAKASGQIFNFEKSSMFF------GGKIPE  706

Query  245   D*RSQRQAGGSGDTTG---KYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT*FLSRAGH  415
             + ++  +   + +      KYLGLPS++G+ K +    VK R+LS +  W     S  G 
Sbjct  707   EQKAAIRNIFNLNVVSKYEKYLGLPSMIGRKKTSFFREVKLRVLSKINNWQHKMFSSGGK  766

Query  416   EVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKAWKAL-CTK  592
             E+L+K V QA+P+YAM +F L   LC EI+  +  FWW  K  +R GI W  W  L C K
Sbjct  767   EILIKAVAQAVPAYAMSVFKLPKGLCEEIQSEIAKFWWGSKKDKR-GIHWARWDKLSCAK  825

Query  593   IKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-VGHNPLFIW  760
              +  LG  D           Q WRL+  P+SLV +V ++RY+ +   ++A  G NP FIW
Sbjct  826   SRGGLGFRDFISFNQAMVAKQGWRLIQFPNSLVSKVLRARYFKSCSFLDAKPGSNPSFIW  885

Query  761   RSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREAPVSSLMNGV  940
             RSI+     +++  R  IG+  +  + KD W+     P   T    S    P+ + +  +
Sbjct  886   RSILWGRQVIQKGARWRIGNGSNILVYKDNWI-----PRPDTFKPISPPTLPIDTTVGEL  940

Query  941   ---GTSWDRDCIIDVFNARDANCILNIPVPPKVRV  1036
                  +W+   +   F   D   IL IP+P   +V
Sbjct  941   MDDENNWNVAKLNQHFMQEDTEAILKIPLPRSQKV  975



>ref|XP_008338514.1| PREDICTED: uncharacterized protein LOC103401576 [Malus domestica]
Length=866

 Score =   169 bits (428),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 112/330 (34%), Positives = 165/330 (50%), Gaps = 26/330 (8%)
 Frame = +2

Query  20   RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
              ++  V ++ G P ISH+LFADD   FL+A  +  +    IL  Y  ASGQ +NYDKS 
Sbjct  205  ENVIQSVSLSSGGPIISHLLFADDSLFFLKATPQTCSAFIHILHSYCEASGQXINYDKST  264

Query  200  SVF*YQYRSG*QNCSD*RSQRQAGGS------GDTTGKYLGLPSLVGKNKKAILGFVKDR  361
              F         + +     R+  G+          GKYLGLP+  G++K   L +VK R
Sbjct  265  MFF---------SANTPHPIREEIGTILNMSESXDPGKYLGLPTXXGRSKTEALAYVKSR  315

Query  362  ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
            I   ++ W    LS+AG EVL+K V  A+P+Y +  F   +TLCRE++ +  +FWW GK 
Sbjct  316  IQQKIQSWKINSLSQAGREVLIKVVAYAVPTYPINCFLFPLTLCRELDALXANFWW-GKK  374

Query  542  ARRLGIRWKAWKALC-TKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYY  709
                 I W++W+ +C  K    LG     D        Q W L   P+S   +V K RY+
Sbjct  375  EDESRIHWRSWETICLPKAVGGLGFRSFSDFNKALLAKQFWXLTQEPESFWAKVLKGRYF  434

Query  710  PNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
            PN D ++A  G    + W S++E    + Q  R  IG+  + +I KD W++ A+D  +  
Sbjct  435  PNVDALSATKGSRASWAWSSLLEGQAIIIQGARWQIGNGAAVSIWKDKWIMDADDGLL--  492

Query  887  HLHESVRE-AP--VSSLMNGVGTSWDRDCI  967
            H    V E AP  V  +++ V  +WD   I
Sbjct  493  HPXTPVPESAPVLVKDIIHHVSRTWDTSQI  522



>ref|XP_010039376.1| PREDICTED: uncharacterized protein LOC104428079 [Eucalyptus grandis]
Length=1343

 Score =   170 bits (431),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/352 (31%), Positives = 177/352 (50%), Gaps = 29/352 (8%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             + N +  G + G++  R  P ++H+LFADD   F+  +  E  ++  IL+ Y  A+GQ +
Sbjct  621   MHNALADGSIKGIKPNRYCPTLTHLLFADDAIFFMDGSVRECQSLAAILNQYCYATGQAI  680

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N +KS   F    +   Q+     +        D TGKYLGLPS  GK KK +  ++  R
Sbjct  681   NLNKSGMFF---SKGCPQDLKRNMTHEMRVPIMDRTGKYLGLPSDWGKTKKDMFAWILAR  737

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +   + GW   +LS+AG E+L+K V+QALP YAM IF + +++C+ IE  +  FWW    
Sbjct  738   VNMKLAGWKEKYLSKAGKEILVKTVVQALPQYAMSIFKIPVSICKAIEKRIAAFWWRQND  797

Query  542   ARRLGIRWKAWKALCTKIKR-WLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYY  709
             A++  + WK W+ L ++  R  LG  DL        G Q WRL   P +L  ++ K  Y+
Sbjct  798   AKK-SMHWKNWETLKSRKDRGGLGFKDLISFNVAMLGKQAWRLSQSPSALWSQLLKGLYF  856

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMA-------  865
             P  DL  A  G  P + W+S++   +A+    + ++GD +S  I +D WL          
Sbjct  857   PQGDLWKANRGPRPSWGWQSVLRGRDAILPDLKWTVGDGKSIHIRQDHWLSQGILGGPEN  916

Query  866   -EDPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
               DP++            V+ L++     W+   +  +F+ +  N IL +P+
Sbjct  917   RNDPHL------------VADLIDQERKEWNVPLLNQLFDQKIVNEILTLPI  956



>ref|XP_010418809.1| PREDICTED: uncharacterized protein LOC104704411 [Camelina sativa]
Length=792

 Score =   168 bits (425),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 112/357 (31%), Positives = 171/357 (48%), Gaps = 21/357 (6%)
 Frame = +2

Query  26    MLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSV  205
             ++ G++V+  +P ISH+LFADD   F RA  E+   +  IL  Y  ASGQ +N+ KS   
Sbjct  93    LITGIKVSTASPAISHLLFADDSLFFCRATKEQCEVVLRILRKYERASGQQINFQKSSVQ  152

Query  206   F*YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRILSW  373
             F +    G         +   G  G T     G YLG+P  +G  K  I  +V+DR+ S 
Sbjct  153   FGHTVDHG-------LREELKGVLGITNLGGMGSYLGIPESLGGAKTQIFSYVQDRLQSR  205

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
                W    LS+ G EV++K+V  A+P++ M  F L  T+ R++   ++++WW+     R 
Sbjct  206   ASSWPARLLSKGGKEVMIKSVATAVPTFVMSCFRLPKTITRKLTSAISNYWWSSSGQSR-  264

Query  554   GIRWKAWKALCTKIKR----WLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSD  721
             G+ W AW  LC         + G+ D        Q WRL++  DSL  RVFK RYY +SD
Sbjct  265   GLHWVAWDKLCQDKTEGGLGFRGLDDFNTALLAKQLWRLISVLDSLFARVFKGRYYRHSD  324

Query  722   LMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-VMAEDPYVSTHLH  895
              ++ +  ++P + WRSI+   + V +     +G   S ++  D W+   +  P + T L 
Sbjct  325   PLDPIKSYSPSYGWRSIISARSLVNKGLIKRVGSGVSISVWHDPWIPAQSPRPAIGTGL-  383

Query  896   ESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIP--VPPKVRVFAWKLAMS  1060
              S     V +L+N    SWD   +   F   D   I  +P  +P K     W    S
Sbjct  384   SSDHLLSVQNLINRSSNSWDMALLSATFVPEDVALISALPLRLPDKPDSLGWHFTKS  440



>gb|ABA98491.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1621

 Score =   171 bits (432),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 112/351 (32%), Positives = 175/351 (50%), Gaps = 19/351 (5%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G LHG+++ +GAP +SH+LFADD  +  RAN  E+  ++ IL +Y   SGQ++N DKS  
Sbjct  918   GRLHGIRICQGAPSVSHLLFADDSLILCRANGGEAQQLQTILQIYEECSGQVINKDKSAV  977

Query  203   VF*YQYRSG*QNC--SD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
             +F     S  +    +    QR+      T  +YLGLP  VG+++  I  ++K+RI   +
Sbjct  978   MFSPNTSSLEKRAVMAALNMQRET-----TNERYLGLPVFVGRSRTKIFSYLKERIWQRI  1032

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
             +GW    LSRAG E+L+K V QA+P++AM  F L+  LC +I  ++  +WW+ +  +   
Sbjct  1033  QGWKEKLLSRAGKEILIKAVAQAIPTFAMGCFELTKDLCDQISKMIAKYWWSNQ-EKDNK  1091

Query  557   IRWKAWKALC-TKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDL  724
             + W +W  L   K    LG   +Y         Q WRL+  PDSL  RV +++Y+P  D 
Sbjct  1092  MHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVLRAKYFPLGDC  1151

Query  725   MN-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVM--AEDPYVSTHLH  895
                    N  + WRSI +    ++      +GD     I  D W+    +  P      +
Sbjct  1152  FRPKQTSNVSYTWRSIQKGLRVLQNGMIWRVGDGSKINIWADPWIPRGWSRKPMTPRGAN  1211

Query  896   ESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR-VFAW  1045
                +   V  L++    +WD D +   F   D   I +IPV  ++  V AW
Sbjct  1212  LVTK---VEELIDPYTGTWDEDLLSQTFWEEDVAAIKSIPVHVEMEDVLAW  1259



>ref|XP_010513715.1| PREDICTED: uncharacterized protein LOC104789767 [Camelina sativa]
Length=355

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/302 (35%), Positives = 163/302 (54%), Gaps = 22/302 (7%)
 Frame = +2

Query  17   RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
            R  ++ G++V+  +P ISH+LFADD   F RA  E+   + GIL  Y  ASGQ +N+ KS
Sbjct  54   RLKVIIGIRVSTASPAISHLLFADDSLFFCRATKEQCEAVLGILGKYGRASGQQINFQKS  113

Query  197  LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRI  364
               F      G    +D R + + G  G T     G YLG+P  +G  K  I  FV+D++
Sbjct  114  SIQF------GHTVDNDLREELK-GVLGITNLGGMGSYLGIPESLGGAKTKIFSFVQDKL  166

Query  365  LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
             +   GW    LS+ G EV++K+V  A+P++ M  F L  T+ R++   +++FWW+  + 
Sbjct  167  QTRASGWPARLLSKGGKEVMIKSVATAVPTFVMSCFRLPKTVTRKLTSAISNFWWS-SLG  225

Query  545  RRLGIRWKAWKALCT-KIKRWLGVYDLKGDEPGT-----QTWRLLTRPDSLVERVFKSRY  706
            +  G+ W AW  LC+ K    LG   L  D+  T     Q WRL+T PDSL  RVFK RY
Sbjct  226  QSRGLHWVAWDKLCSGKDTGGLGFRSL--DDYNTALLAKQLWRLITVPDSLFARVFKGRY  283

Query  707  YPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-VMAEDPYV  880
            Y +SD ++ +  ++P + WRS++   + V +     +G   S ++  D W+   +  P +
Sbjct  284  YRHSDPLDPIKSYSPSYGWRSMIFARSLVNKGLIKRVGSGASISVWTDPWIPAQSPRPAL  343

Query  881  ST  886
            ST
Sbjct  344  ST  345



>gb|AAP53315.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1505

 Score =   170 bits (431),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 112/353 (32%), Positives = 174/353 (49%), Gaps = 19/353 (5%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
               G LHG+++ +GAP +SH+LFADD  +  RAN  E+  ++ IL +Y   SGQ++N DKS
Sbjct  857   EEGRLHGIRICQGAPSVSHLLFADDSLILCRANGGEAQQLQTILQIYEECSGQVINKDKS  916

Query  197   LSVF*YQYRSG*QNC--SD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILS  370
               +F     S  +    +    QR+      T  KYLGLP  VG+++  I  ++K+RI  
Sbjct  917   AVMFSPNTSSLEKGAVMAALNMQRET-----TNEKYLGLPVFVGRSRTKIFSYLKERIWQ  971

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
              ++GW    LSRAG E+L+K V Q +P++AM  F L+  LC +I  ++  +WW+ +  + 
Sbjct  972   RIQGWKEKLLSRAGKEILIKAVAQVIPTFAMGCFELTKDLCDQISKMIAKYWWSNQ-EKD  1030

Query  551   LGIRWKAWKALC-TKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNS  718
               + W +W  L   K    LG   +Y         Q WRL+  PDSL  RV +++Y+P  
Sbjct  1031  NKMHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVLRAKYFPLG  1090

Query  719   DLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVM--AEDPYVSTH  889
             D        N  + WRSI +    ++      +GD     I  D W+    +  P     
Sbjct  1091  DCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWRVGDGSKINIWADPWIPRGWSRKPMTPRG  1150

Query  890   LHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR-VFAW  1045
              +   +   V  L++    +WD D +   F   D   I +IPV  ++  V AW
Sbjct  1151  ANLVTK---VEELIDPYTGTWDEDLLSQTFWEEDVAAIKSIPVHVEMEDVLAW  1200



>gb|AAM18736.1|AC092548_14 putative reverse transcriptase [Oryza sativa Japonica Group]
Length=1509

 Score =   170 bits (431),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 112/353 (32%), Positives = 174/353 (49%), Gaps = 19/353 (5%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
               G LHG+++ +GAP +SH+LFADD  +  RAN  E+  ++ IL +Y   SGQ++N DKS
Sbjct  861   EEGRLHGIRICQGAPSVSHLLFADDSLILCRANGGEAQQLQTILQIYEECSGQVINKDKS  920

Query  197   LSVF*YQYRSG*QNC--SD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILS  370
               +F     S  +    +    QR+      T  KYLGLP  VG+++  I  ++K+RI  
Sbjct  921   AVMFSPNTSSLEKGAVMAALNMQRET-----TNEKYLGLPVFVGRSRTKIFSYLKERIWQ  975

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
              ++GW    LSRAG E+L+K V Q +P++AM  F L+  LC +I  ++  +WW+ +  + 
Sbjct  976   RIQGWKEKLLSRAGKEILIKAVAQVIPTFAMGCFELTKDLCDQISKMIAKYWWSNQ-EKD  1034

Query  551   LGIRWKAWKALC-TKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNS  718
               + W +W  L   K    LG   +Y         Q WRL+  PDSL  RV +++Y+P  
Sbjct  1035  NKMHWLSWNKLTLPKNMGGLGFRDIYIFNLAMLAKQGWRLIQDPDSLCSRVLRAKYFPLG  1094

Query  719   DLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVM--AEDPYVSTH  889
             D        N  + WRSI +    ++      +GD     I  D W+    +  P     
Sbjct  1095  DCFRPKQTSNVSYTWRSIQKGLRVLQNGMIWRVGDGSKINIWADPWIPRGWSRKPMTPRG  1154

Query  890   LHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR-VFAW  1045
              +   +   V  L++    +WD D +   F   D   I +IPV  ++  V AW
Sbjct  1155  ANLVTK---VEELIDPYTGTWDEDLLSQTFWEEDVAAIKSIPVHVEMEDVLAW  1204



>ref|XP_010026656.1| PREDICTED: uncharacterized protein LOC104417027 [Eucalyptus grandis]
Length=1695

 Score =   170 bits (431),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 177/352 (50%), Gaps = 25/352 (7%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I   +  G L G++ AR  P +SH+ FADD   FL     E  NM  IL+ Y  A+GQ +
Sbjct  979   ITQAVSSGYLKGIKFARSCPTLSHLFFADDSVFFLDGTITECQNMSNILNQYCIATGQTI  1038

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSG----DTTGKYLGLPSLVGKNKKAILGF  349
             N +KS  +   +Y      C     +  A           GKYLG+PS  G++K+ +  +
Sbjct  1039  NRNKS-GMICSKY------CPISLQEHLAREFRVPVLQRFGKYLGIPSDWGRSKRDMFSW  1091

Query  350   VKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW  529
             +  R+ S + GW    LS+ G EVLLK V+QA+P YAM +F L  ++C+ +E  +  FWW
Sbjct  1092  IVARVSSKMEGWKESLLSKGGKEVLLKAVVQAIPQYAMSVFQLPQSICKTLEQRIAQFWW  1151

Query  530   TGKVARRLGIRWKAWKAL-CTKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFK  697
                V+RR G+ W  W AL  +K    LG  DL        G Q W+L+  P SL  ++FK
Sbjct  1152  RNDVSRR-GVHWHPWNALKISKHSGGLGFRDLMVFNKALLGKQAWKLVQSPLSLWSQLFK  1210

Query  698   SRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDP  874
               Y+PN   + A +G+ P + WRS++    A+    R S+GD +  +I +D WL +   P
Sbjct  1211  GLYFPNGSFLRAEIGYRPSWGWRSLLAGREAILPNLRWSVGDGKRISIRQDQWLPIGSIP  1270

Query  875   YVSTHLHESVREAP--VSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPP  1024
                       R+ P  V+ L++ +  +W+   +   ++      ++ IP+ P
Sbjct  1271  ------GPLARDEPQIVADLIDPLLQTWNLPLLQRHYDDCIVREVIKIPIRP  1316



>gb|EEE50691.1| hypothetical protein OsJ_30951 [Oryza sativa Japonica Group]
Length=697

 Score =   167 bits (422),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 110/343 (32%), Positives = 174/343 (51%), Gaps = 27/343 (8%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             L G+++ RGAP ++H+ FADD  L L+A    +  MK I+  Y   SGQ+VN DKS+ +F
Sbjct  185   LCGLRICRGAPILTHLFFADDSLLLLKATESVANEMKQIILDYERCSGQIVNRDKSVVMF  244

Query  209   *YQYRSG*QNCSD*RSQRQAGGSGDTTG--------KYLGLPSLVGKNKKAILGFVKDRI  364
                        S    + +      T G        +YLGLP  +G++K     ++K++I
Sbjct  245   -----------SSNMDEEEKKVFSHTLGINCIAHNDRYLGLPVFIGRSKAKTFEYLKEKI  293

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
                ++GW   FLS+AG E+L+K V QA+P+YAM  F L+ +LC E+  ++  FWW     
Sbjct  294   WRCIQGWKEKFLSKAGKEILIKAVAQAIPTYAMSCFYLTKSLCDELTSMILRFWWAQHDN  353

Query  545   RRLGIRWKAW-KALCTKIKRWLGVYDLKGDEPGT---QTWRLLTRPDSLVERVFKSRYYP  712
              +  I W    K +  K +  LG  DL          Q WRL+  PDSL  R+ K++Y+P
Sbjct  354   DK-KIHWLGKDKIMKPKSQGGLGFRDLHSFNIAMLARQGWRLIQNPDSLCSRLLKAKYFP  412

Query  713   NSDLMNAVGHNPL-FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTH  889
             N ++++A     + + WRSI++    +++     +G+     I  D WL   +  +V+T 
Sbjct  413   NCNVLDAQSRKQMSYSWRSILKGIQLLRKGVIWRVGNGEHINIWSDPWLP-RDMRFVTTR  471

Query  890   LHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                S+    V  L++     WD + I  +FN  DA  I  IP+
Sbjct  472   RGASLI-TRVCELIDPTTGQWDIELIQQIFNENDAKIITRIPL  513



>ref|XP_009102306.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=703

 Score =   166 bits (421),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 105/352 (30%), Positives = 174/352 (49%), Gaps = 15/352 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             +++   +G + G++V+R +PP+SH+LFADD   F +A + E   +   L  Y  ASGQ +
Sbjct  85    LNHAENQGKITGIRVSRASPPVSHLLFADDSLFFCKAESRECDEVMKALGTYGKASGQCI  144

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N++KS  +F  +      +  D         +    G YLG+P  +  +K  +  F+K+R
Sbjct  145   NFEKSSLLFGKRIPG---HVKDGLKLSTGIANEGGMGSYLGIPEDISGSKVRLFAFLKER  201

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +   V GW   +L+R G EVL+K++L ALP+Y M    L +  C  +   +  FWW+   
Sbjct  202   LQHRVNGWTGRWLTRGGKEVLIKSILLALPTYVMSTLLLPLETCENLASAIAQFWWSSNP  261

Query  542   ARRLGIRWKAWKALCTKIKR----WLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYY  709
              RR GI W  W+ LC   +     +  +++      G Q WRL+  PDSL+ RV +  Y+
Sbjct  262   PRR-GIHWVKWEKLCKSREEGGIGFRMIHEFNLALLGKQLWRLVQFPDSLLARVLRGLYF  320

Query  710   P-NSDLMNAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-VMAEDPY--  877
               +S L     +NP + WRSI+     +    R  +       I +D+W+  +   P   
Sbjct  321   RYSSPLRLNDANNPSYGWRSIMAAKPLITLGIRQKVHSGNEIRIWEDLWIPTIPARPARP  380

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR  1033
             ++  LH  V   PVSSLM G    W+ + + +  N  D + I ++ +  + R
Sbjct  381   IAPVLHPMV---PVSSLMIGNPKRWNTEMLQNYVNQEDISLIQSLAISQEYR  429



>ref|XP_009140270.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=866

 Score =   168 bits (425),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 113/342 (33%), Positives = 170/342 (50%), Gaps = 19/342 (6%)
 Frame = +2

Query  14    MRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDK  193
             M+R  + G++++  +P ++H+LFADD   F  AN +    +K IL  Y   SGQ VN +K
Sbjct  160   MKRK-IQGIKISTHSPSVNHLLFADDSLFFSLANPKNGRAIKQILQQYEKVSGQAVNLNK  218

Query  194   SLSVF*YQYRSG*QNCSD*RS----QRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             S   F  + +   Q  +  R       + GG     GKYLG+P   G+ K  IL +V ++
Sbjct  219   SSITFGSRVKD--QVKTQMRHLLGIHNEGGG-----GKYLGIPEQFGRKKAEILKYVTEK  271

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             + +  +GW   FLS  G EVL+K+V  A   Y M  F L  ++C EI  IL  FWW GK 
Sbjct  272   VKTKTQGWQNKFLSPGGKEVLIKSVASATSVYPMNTFKLPKSVCEEINNILATFWW-GKD  330

Query  542   ARRLGIRWKAWKALCTKIKR-WLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYY  709
                 G+ W AW  +    K   +G  D++       G Q WR+LT+P+SL+ RV K RY+
Sbjct  331   DGSKGMHWFAWNRMSLPKKEGGMGFRDIEKFNDALLGKQAWRILTKPNSLMARVMKGRYF  390

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
             P++ ++NA       +IWRSI+   + + +  R  IG+  +     D WL     P    
Sbjct  391   PSTSILNARETRQNSYIWRSILHGKDLLTKGVRCVIGNGNTIDTWTDPWLP-TNPPRAPV  449

Query  887   HLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
              + +    + VS  M+     W+ + I +  N  DA  IL I
Sbjct  450   PIFDQHGNSKVSDFMHRGLKEWNEELIRNTMNQADAEEILAI  491



>ref|XP_008392963.1| PREDICTED: uncharacterized protein LOC103455142 [Malus domestica]
Length=1279

 Score =   169 bits (428),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 120/339 (35%), Positives = 167/339 (49%), Gaps = 13/339 (4%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             RG LHG  V+    PISH+ FADD  LF  A+ EE+  M  +L  Y   SGQ VN  KS 
Sbjct  581   RGALHGXXVSANGTPISHLFFADDSVLFGHASVEEARGMVEVLRTYARGSGQAVNLSKS-  639

Query  200   SVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
             S+F     S        R+      SG   G+YLGL S  G +KK +   V+DR+ S + 
Sbjct  640   SIFFGSKTSNRVRKXIGRTMGIQCKSG--FGRYLGLQSDFGHSKKVVFEEVRDRLESXLA  697

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
             GW   FLS+AG EVL+K V  A+P+YAM  F L I +CR++E  + +FWW G   R+  +
Sbjct  698   GWAEQFLSQAGKEVLVKAVAMAMPNYAMSCFKLPIGVCRDLEKAIRNFWWRGSEQRKX-V  756

Query  560   RWKAWKALCTKIKR--WLGVYDLKGDEPGTQT---WRLLTRPDSLVERVFKSRYYPNSDL  724
              W + + L  K KR    G  D++           WRL+  P SL+  V + +YYP    
Sbjct  757   HWISXERL-MKQKRVGGXGFRDIQCFNXAFLAKIGWRLIQNPGSLLATVLQEKYYPGKCF  815

Query  725   MNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
               A  G N  + W+ I +    +    R  +GD     I  D W        V     ES
Sbjct  816   XEAGKGRNTSWGWKGIFDARMVLLHGLRWRVGDGACINIRXDPWXPRPSTFKVKP--FES  873

Query  902   VREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +    V  L++   +SW+RD I++ F+  D   IL+IP+
Sbjct  874   LHATMVCELIDSETSSWNRDLILESFHQDDVRPILSIPL  912



>dbj|BAM28750.1| reverse transcriptase-like protein, partial [Camellia sinensis 
var. sinensis]
Length=255

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 94/248 (38%), Positives = 136/248 (55%), Gaps = 6/248 (2%)
 Frame = +2

Query  302   GLPSLVGKNKKAILGFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLS  481
             GLP  VG +K+A+LGFVK+R+ + + GW   FLS AG EVL+K+V QA+P+Y M  F L 
Sbjct  1     GLPYCVGHSKRAVLGFVKERVWTRLNGWKEKFLSVAGREVLIKSVAQAIPTYIMSCFRLP  60

Query  482   ITLCREIEVILNHFWWTGKVARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQT  649
               +C EIE ++ +FWW  K   R  I W +WK LC +K++  +G   L+         Q 
Sbjct  61    DGVCHEIESMVCNFWWXQKEETR-KIHWTSWKQLCKSKLQGGMGFRCLQXFNSALLAKQC  119

Query  650   WRLLTRPDSLVERVFKSRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDER  826
             WRL+ RP SLV RVFK+RY+P +  ++A VG NP F WRSIV   + +    R  +G+  
Sbjct  120   WRLVQRPQSLVARVFKARYFPQTSFLDALVGSNPSFTWRSIVGSRSLLNAGLRWRVGNGA  179

Query  827   STTIGKDMWLVMAEDPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCIL  1006
             S ++  D W+       V         +A VS L++    +W  + +   F   D   I 
Sbjct  180   SISVKYDKWVPRPHSFKVILPPSTLSDDARVSDLIDSEKGAWYDEMLTQNFLGMDVEAIR  239

Query  1007  NIPVPPKV  1030
              IP+ P +
Sbjct  240   CIPICPTL  247



>ref|XP_010054376.1| PREDICTED: uncharacterized protein LOC104442671 [Eucalyptus grandis]
Length=1509

 Score =   169 bits (428),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 174/347 (50%), Gaps = 33/347 (10%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G L G +V+R +P +SH+ FADD   FL A T E  N+  IL  Y  A+GQ +N +KS  
Sbjct  799   GHLQGFKVSRYSPTLSHLFFADDAIFFLTATTTECQNLASILSQYCLATGQSINRNKS-G  857

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSG------DTTGKYLGLPSLVGKNKKAILGFVKDRI  364
             +F  +Y      C   R  ++   S       D  GKYLG+PS  G +K  +  ++  R+
Sbjct  858   IFLGKY------CP--RCLKENLASELRIPVLDRMGKYLGIPSDWGSSKGEMFSWILGRV  909

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
              S + GW    +S+ G EVL+K V+QA+P Y M +F + I++C+ IE  +  FWW     
Sbjct  910   NSKMEGWKENLISKGGKEVLIKTVVQAIPQYVMSVFKIPISICKSIEKKIARFWWQND-C  968

Query  545   RRLGIRWKAWKAL-CTKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYP  712
             R+ GI WK W  L  TK    LG  DL        G Q WRL+ +P SL  ++FK+ Y+P
Sbjct  969   RKAGIHWKQWDVLKYTKALGGLGFRDLVAFNKAMLGKQAWRLIQQPSSLWSKLFKAIYFP  1028

Query  713   NSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV--MAEDPYVS  883
               D   A  G  P + W+S++     +    + S+GD ++  I +D WL   +   P   
Sbjct  1029  AQDFRYAHKGVRPSWGWQSLLSSREVILPNLQWSVGDGKNINIREDRWLPRGIVGGP---  1085

Query  884   THLHESVREAP--VSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                  + RE P  V+ L+      W+   + + ++ +    IL IPV
Sbjct  1086  -----ANREEPSLVAELLVQNSNHWNLATLNNFYDEQTTAEILRIPV  1127



>ref|XP_006494333.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=351

 Score =   161 bits (408),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 151/286 (53%), Gaps = 22/286 (8%)
 Frame = +2

Query  8    NRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNY  187
            N + +G+  G ++      ISH+LFADD  +F +A+ +   N+K I D Y  ASGQL N+
Sbjct  79   NHLIQGLKFGKELT-----ISHLLFADDSLVFTKASVDSCKNLKTIFDCYAAASGQLFNF  133

Query  188  DKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVK  355
            +KS  VF     SG  +  + R++              GKYLGLPS+VG+ K +    VK
Sbjct  134  EKSSLVF-----SG--SIPEDRAEAIKNIFQLNVVSWHGKYLGLPSMVGRTKTSFFNEVK  186

Query  356  DRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTG  535
             +++S +  W   F S  G EVL+K + QA+P+YAM IF L + LC +I+  +  FWW  
Sbjct  187  LKVVSKITSWQHRFFSSEGKEVLIKAMAQAIPAYAMSIFKLPLGLCDDIQNAMAKFWWRS  246

Query  536  KVARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSR  703
            K  +R GI W  W  +   K +  LG  ++          Q WRLL  P+  V RV K+R
Sbjct  247  KEDKR-GIHWARWGKMSHAKSREGLGFREMSSFNRALVAKQGWRLLQYPELFVTRVPKAR  305

Query  704  YYPNSDLMNAVGH-NPLFIWRSIVEVNNAVKQWYRGSIGDERSTTI  838
            YY  +D + A    NP +IWRSI+     +++  R  IG+   T +
Sbjct  306  YYKETDFLQARARSNPSYIWRSILWGRQVLQKGIRWRIGNGEDTNM  351



>ref|XP_010495217.1| PREDICTED: uncharacterized protein LOC104772285 [Camelina sativa]
Length=1122

 Score =   169 bits (427),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 110/363 (30%), Positives = 173/363 (48%), Gaps = 45/363 (12%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R  ++ G++VA   PPI+H+LFADD   F +   EE   +  +L  Y   SGQL+N +KS
Sbjct  458   REKLITGIKVANQCPPITHLLFADDSLFFCKVTKEECEAILTVLRSYEAVSGQLINLEKS  517

Query  197   LSVF*YQYRSG*QNCSD*RSQRQA-------GGSGDTTGKYLGLPSLVGKNKKAILGFVK  355
                F      G +   D +++ Q+       GG     G YLG+P  +G +K  +  FV+
Sbjct  518   SIQF------GHKVPEDTKAELQSILGISKLGG----MGSYLGIPESLGGSKTKVFSFVR  567

Query  356   DRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTG  535
             D++     GW+   LSR G EV++K+V  A+P++ M  F +  T+  ++   + +FWW+ 
Sbjct  568   DKLQGRTTGWSAKLLSRGGKEVMIKSVATAVPTFVMSCFRIPKTITSKLTSAIANFWWSS  627

Query  536   KVARRLGIRWKAWKALCTKIKRWLG-----VYDLKGDEPGTQTWRLLTRPDSLVERVFKS  700
                +  G+ W AW+ LC   K++ G     + D        Q WRL+  PDSL  RVFKS
Sbjct  628   N-GQSGGMHWLAWEKLCAS-KQFGGLGFRNIDDFNSALLAKQLWRLIEVPDSLFARVFKS  685

Query  701   RYYPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPY  877
             RYY NS  M+ +  ++P + WRSIV   +    W        R             +DP 
Sbjct  686   RYYRNSHPMDPIKSYSPSYGWRSIVSARSLTDPWVPAQF--PRPALCKGSF-----KDPS  738

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP--PKVRVFAWKL  1051
             +            ++ L++    +W  D + D+F+  D + I  IP+   P+   F W  
Sbjct  739   IQ-----------MNDLIDRSSNTWRMDRLADLFDPEDVSLISAIPLSLTPQYDSFGWHF  787

Query  1052  AMS  1060
               S
Sbjct  788   TKS  790



>gb|EEC72938.1| hypothetical protein OsI_06800 [Oryza sativa Indica Group]
Length=556

 Score =   165 bits (418),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 110/344 (32%), Positives = 175/344 (51%), Gaps = 16/344 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             ++ ++ +G ++ +Q+ R AP +SH+LFADD  LF +A  +++  MK +L+ Y   +GQL+
Sbjct  63    LEEKVDQGAMNPIQICRRAPAVSHLLFADDTLLFFKAANDQAVVMKEVLETYASCTGQLI  122

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N  K   +F     +  QN    + ++    S     KYLG P   G+  K     +++R
Sbjct  123   NPCKCSIMFGQSSPTAVQN----QIKQTLQISNSFEDKYLGFPMPEGRMTKGKFQSLQER  178

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +   +  W    LS  G E+L+K VLQA+P Y M +F L  ++  E+  ++ +FWW  + 
Sbjct  179   LWKRIMLWGEKLLSTGGKEILIKAVLQAMPVYVMGLFKLPESVYEELTKLVRNFWWGAEK  238

Query  542   ARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEPGT---QTWRLLTRPDSLVERVFKSRYY  709
              +R    WK+W  L   K+K  +G  D +         Q WRLL RPDSL  R+ K++YY
Sbjct  239   GKR-RTHWKSWDCLIARKLKGGMGFRDFRLFNQALLARQAWRLLDRPDSLCARILKAKYY  297

Query  710   PNSDLMN-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL--VMAEDPYV  880
             PN  L++ + G N    WR+I      +K+     IG+ +S  + +D W+    +  P  
Sbjct  298   PNGSLIDTSFGGNASPGWRAIEYGLELLKKGIIWRIGNGKSVRLWRDPWIPRSFSRRPIS  357

Query  881   STHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
             +     + R   VS L++    SWD D I   F   DA  ILNI
Sbjct  358   AKR---NCRLRWVSDLIDQ-SESWDTDKISQHFLPMDAEAILNI  397



>ref|XP_010451822.1| PREDICTED: uncharacterized protein LOC104734004 [Camelina sativa]
Length=1120

 Score =   168 bits (426),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 112/361 (31%), Positives = 176/361 (49%), Gaps = 33/361 (9%)
 Frame = +2

Query  26    MLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSV  205
             ++ G++VA   PPI+H+LFADD   F +   ++   +  IL  Y  ASGQ +N+ KS   
Sbjct  549   LITGIKVANKCPPITHLLFADDSLFFCKVAKDQCEAILRILRNYEAASGQQINFAKSSIQ  608

Query  206   F*Y----QYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
             F +    Q +   Q      +Q   GG     G YLGLP  +G +K  +  FV++R+   
Sbjct  609   FGHTVAEQTKLEIQGVLGITAQ---GG----MGSYLGLPESLGGSKTKVFSFVRERLQGR  661

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
               GW+   LS+ G EV++K++  A+P++ M  F L  T+  ++   + +FWW+    R  
Sbjct  662   TTGWSARLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAVANFWWSSD-GRTG  720

Query  554   GIRWKAWKAL-CTKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSD  721
             G+ W AW+ L C+K +  LG   V D        Q WRL+  PDSL  R+ K RYY NSD
Sbjct  721   GMHWLAWEKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFARILKGRYYRNSD  780

Query  722   LMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-------VMAEDPY  877
              M  +  ++P + WRSI+   + V++     +G   S +I  D W+        +++ P+
Sbjct  781   PMEPIRSYSPSYGWRSIISARSLVQKGLIKRVGSGESISIWTDPWIPAQSPRPALSKGPF  840

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP--PKVRVFAWKL  1051
                 L        +S L++    SW  D + D F+  D   I  +P+   PK     W  
Sbjct  841   KDPSLK-------ISHLIDSRTRSWRMDVLSDHFDPGDVALIGALPLGSCPKDDTLGWHF  893

Query  1052  A  1054
              
Sbjct  894   T  894



>ref|XP_009114092.1| PREDICTED: uncharacterized protein LOC103839337 [Brassica rapa]
Length=778

 Score =   166 bits (421),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 105/347 (30%), Positives = 176/347 (51%), Gaps = 15/347 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             + N  +   L G+++AR +PP+SH+LFADD   F +A+  E + +  I+D+Y  ASGQ +
Sbjct  81    LKNAEQEKKLTGLKIARASPPVSHLLFADDSLFFCKADQGECSELMKIIDVYINASGQQL  140

Query  182   NYDKSLSVF*YQYRSG*QN-CSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             N  KS  +F  +  +  +N      +  Q GG     G YLGLP  +  +KK +  +V++
Sbjct  141   NKSKSSVIFGSKVVASSKNDLKRSLAIYQEGG----MGMYLGLPEKICGSKKQVFSYVQE  196

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             R+      W+T  LS+ G E+ +K V QA+PS+ M  + L   + +++   ++ FWW+ K
Sbjct  197   RLNDRTNSWSTKLLSKGGKEIQIKAVAQAVPSFTMSCYLLPQGITKKLMSAVSRFWWSTK  256

Query  539   VARRLGIRWKAWKALCTKIKR-WLGVYDLKGDEPG---TQTWRLLTRPDSLVERVFKSRY  706
             +  + G+ W AW  +C       LG  D           Q WRLL  P SL+ RV K RY
Sbjct  257   INNK-GLHWVAWDKICVPTDEGGLGFRDFHAFNLALLTKQLWRLLQYPHSLLARVLKGRY  315

Query  707   YPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVM--AEDPY  877
             Y +++ MN     NP + WRS++     + +  R  IG+  +T + ++ WL    A  P 
Sbjct  316   YRHTNPMNVQKASNPSYGWRSLLASKEVLHKGLRKKIGNGHTTKVWEEPWLPTQPARAPL  375

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                ++ +   +  V  L++    SW+ + +  V +  D   I ++ V
Sbjct  376   SIGNVRD--EDFHVHHLIDAQNQSWNLEILNTVISTEDIPKITSLRV  420



>gb|AFP55574.1| non-ltr retroelement reverse transcriptase [Rosa rugosa]
Length=1656

 Score =   169 bits (428),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 120/344 (35%), Positives = 166/344 (48%), Gaps = 12/344 (3%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I+   +  +L  V +     P+SH+ FADD   FLRA  +    +  +L  Y  ASGQL+
Sbjct  1264  INKMCQDSLLTPVTIGPNNLPVSHLFFADDSLFFLRATLQNCETLSDLLHTYCIASGQLI  1323

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N +KS S+F +   +  +      S  Q     D  G YLGLP+   ++KK  LGF+KD 
Sbjct  1324  NVEKS-SIF-FSPNTPPEIAHLLSSIMQIPVVSDP-GTYLGLPTFWHRSKKKALGFIKDS  1380

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             IL  V+GW    LS+AG EVL+K V  A+P+Y M  F    TLC+E+  IL  FWW G V
Sbjct  1381  ILRKVKGWKQATLSQAGKEVLIKAVATAIPAYPMGCFKFPSTLCKELNGILADFWW-GNV  1439

Query  542   ARRLGIRWKAWKALCTKIKR----WLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYY  709
               R GI WK+W  L    K     +  + D        Q WRL   P +L  RV +  YY
Sbjct  1440  DTR-GIHWKSWDFLARPKKDGGMGFRNLEDFNNSLLAKQAWRLHQNPFALWARVLEQLYY  1498

Query  710   PNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
             P S  + A  G NP +IW S++   N + +    +IG+  S  I  D W+       VS 
Sbjct  1499  PRSSFLEAPKGPNPSWIWNSLLIGRNFIHKEALWNIGNGFSVNIVGDNWIPSIPPSTVSL  1558

Query  887   HLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              L+E    + V  L+N    SW+ D   +         I  IP+
Sbjct  1559  PLNED--NSRVCELINWDTKSWELDHFAETITPTQRLLISAIPI  1600



>ref|XP_010451645.1| PREDICTED: uncharacterized protein LOC104733795 [Camelina sativa]
Length=1000

 Score =   168 bits (425),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/343 (31%), Positives = 173/343 (50%), Gaps = 17/343 (5%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R  ++ G++VA   PPI+H+LFADD   F +AN E+   +  IL  Y  ASGQ +N+ KS
Sbjct  160   RDKLITGIKVANKCPPITHLLFADDNLFFCKANREQCRVILDILKQYESASGQQINFSKS  219

Query  197   LSVF*YQYRSG*QN-CSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
                F ++     ++   D       GG     G YLGLP  +G  K  +  FV++R+   
Sbjct  220   PVQFGHKIDDTLKSELHDVLGITTLGG----MGSYLGLPESLGGAKTKVFSFVRERLQGR  275

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
               GW    LS+ G EV++K+V  A+P++ M  F L  T+  ++  ++ +FWW+    +  
Sbjct  276   TNGWTANLLSKGGKEVMIKSVATAVPTFVMSCFRLPKTITSKLTSVVANFWWSTN-GQTG  334

Query  554   GIRWKAWKALCTKIKRWLG------VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPN  715
             G+ W AW+ LC  + + LG      V D        Q WRL+  PDSL  RVFKSRYY N
Sbjct  335   GMHWLAWEKLC--VSKQLGGLGFRNVDDFNSALLAKQLWRLIDAPDSLFARVFKSRYYRN  392

Query  716   SDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-VMAEDPYVSTH  889
             +  ++ +  ++P + WRSI    + V +     +G   + +I  D W+      P +S  
Sbjct  393   THPLDPIRSYSPSYGWRSICSARSLVNKGLIKRVGSGDTISIWSDPWVPAQFPRPALSKG  452

Query  890   LHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             L + +    ++ L++    +W  D + + F+  D   I  IP+
Sbjct  453   LVKDL-SLQMNQLIDCRTNTWCMDMLHEHFDPSDVALIQAIPL  494



>ref|XP_009115910.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=869

 Score =   167 bits (423),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 118/355 (33%), Positives = 178/355 (50%), Gaps = 19/355 (5%)
 Frame = +2

Query  2     IDNRMRRGM----LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGAS  169
             + + M R M    + GV+VA  APP++H+LFADD   F  AN   +  +K IL  Y  AS
Sbjct  151   LSHMMNRAMEDRSILGVKVALQAPPVNHLLFADDSLFFSLANPRAATKLKKILSEYEAAS  210

Query  170   GQLVNYDKSLSVF*YQYRSG*QN-CSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILG  346
             GQ VN  KS   F  +     ++   +      AGG     GKYLG+P   G++K  +  
Sbjct  211   GQSVNLSKSSITFGSKVSEIVKSRMRNILGIHNAGG----IGKYLGMPEQFGRSKSDMFA  266

Query  347   FVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFW  526
             ++ DR+ S  +GW+  +LS  G EVLLK++  A+P ++M +F L   +C EI  +L  F 
Sbjct  267   YIVDRVKSVTQGWSKKYLSHGGKEVLLKSIALAMPIFSMNVFRLPKEVCEEINGVLAKFG  326

Query  527   WTGKVARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVF  694
             W G   ++ G+ W AWK +   K +  LG  DL+       G Q WR+L  PD L+ RV 
Sbjct  327   W-GNTDKK-GMHWYAWKRVSVPKREGGLGFRDLQNFNQALLGKQVWRILQHPDCLMARVI  384

Query  695   KSRYYPNSDLMNAVGHNPL-FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAED  871
             ++RY+ + ++++AV      + W+SI+     VKQ  R  IGD   T +  D WL +   
Sbjct  385   RARYFADGNILDAVQKRKASYAWKSILYGKELVKQGLRYVIGDGTLTNLWTDPWLPV--H  442

Query  872   PYVSTHLHESVR-EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR  1033
             P       + V     V  L+   G  W+   + DV    D + IL + +  K +
Sbjct  443   PPRPPRARDGVPLVGKVKDLIRSDGRGWNEQKLHDVVVEEDIDKILGVKIFSKAQ  497



>ref|XP_010506884.1| PREDICTED: uncharacterized protein LOC104783422 [Camelina sativa]
Length=1248

 Score =   168 bits (426),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 112/361 (31%), Positives = 176/361 (49%), Gaps = 33/361 (9%)
 Frame = +2

Query  26    MLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSV  205
             ++ G++VA   PPI+H+LFADD   F +   ++   +  IL  Y  ASGQ +N+ KS   
Sbjct  549   LITGIKVANKCPPITHLLFADDSLFFCKVAKDQCEAILRILRNYEAASGQQINFAKSSIQ  608

Query  206   F*Y----QYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
             F +    Q +   Q      +Q   GG     G YLGLP  +G +K  +  FV++R+   
Sbjct  609   FGHTVAEQTKLEIQGVLGITAQ---GG----MGSYLGLPESLGGSKTKVFSFVRERLQGR  661

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
               GW+   LS+ G EV++K++  A+P++ M  F L  T+  ++   + +FWW+    R  
Sbjct  662   TTGWSARLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAVANFWWSSD-GRTG  720

Query  554   GIRWKAWKAL-CTKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSD  721
             G+ W AW+ L C+K +  LG   V D        Q WRL+  PDSL  R+ K RYY NSD
Sbjct  721   GMHWLAWEKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFARILKGRYYRNSD  780

Query  722   LMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-------VMAEDPY  877
              M  +  ++P + WRSI+   + V++     +G   S +I  D W+        +++ P+
Sbjct  781   PMEPIRSYSPSYGWRSIISARSLVQKGLIKRVGSGESISIWTDPWIPAQSPRPALSKGPF  840

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP--PKVRVFAWKL  1051
                 L        +S L++    SW  D + D F+  D   I  +P+   PK     W  
Sbjct  841   KDPSLK-------ISHLIDSRTRSWRMDVLSDHFDPGDVALIGALPLGSCPKDDTLGWHF  893

Query  1052  A  1054
              
Sbjct  894   T  894



>ref|XP_010412448.1| PREDICTED: uncharacterized protein LOC104698743 [Camelina sativa]
Length=1329

 Score =   168 bits (426),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 112/361 (31%), Positives = 176/361 (49%), Gaps = 33/361 (9%)
 Frame = +2

Query  26    MLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSV  205
             ++ G++VA   PPI+H+LFADD   F +   ++   +  IL  Y  ASGQ +N+ KS   
Sbjct  630   LITGIKVANKCPPITHLLFADDSLFFCKVAKDQCEAILRILRNYEAASGQQINFAKSSIQ  689

Query  206   F*Y----QYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
             F +    Q +   Q      +Q   GG     G YLGLP  +G +K  +  FV++R+   
Sbjct  690   FGHTVAEQTKLEIQGVLGITAQ---GG----MGSYLGLPESLGGSKTKVFSFVRERLQGR  742

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
               GW+   LS+ G EV++K++  A+P++ M  F L  T+  ++   + +FWW+    R  
Sbjct  743   TTGWSARLLSKGGKEVMIKSIATAVPTFVMSCFRLPKTITSKLSSAVANFWWSSD-GRTG  801

Query  554   GIRWKAWKAL-CTKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSD  721
             G+ W AW+ L C+K +  LG   V D        Q WRL+  PDSL  R+ K RYY NSD
Sbjct  802   GMHWLAWEKLCCSKQQGGLGFRNVDDFNSALLAKQLWRLIEYPDSLFARILKGRYYRNSD  861

Query  722   LMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-------VMAEDPY  877
              M  +  ++P + WRSI+   + V++     +G   S +I  D W+        +++ P+
Sbjct  862   PMEPIRSYSPSYGWRSIISARSLVQKGLIKRVGSGESISIWTDPWIPAQSPRPALSKGPF  921

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP--PKVRVFAWKL  1051
                 L        +S L++    SW  D + D F+  D   I  +P+   PK     W  
Sbjct  922   KDPSLK-------ISHLIDSRTRSWRMDVLSDHFDPGDVALIGALPLGSCPKDDTLGWHF  974

Query  1052  A  1054
              
Sbjct  975   T  975



>ref|XP_008372180.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=305

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 147/291 (51%), Gaps = 19/291 (7%)
 Frame = +2

Query  14   MRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDK  193
            M RG+LHG +      P++H+ FADD  LF  A  EE+  +  IL+ Y   SGQ +N  K
Sbjct  1    MERGVLHGYRFTPNGSPLTHLFFADDSVLFGNATVEEAQGVVDILNTYANGSGQEINLSK  60

Query  194  SLSVF*YQYRSG*QNCSD*RSQRQAGGS-----GDTTGKYLGLPSLVGKNKKAILGFVKD  358
            S   F           +  R +++ G +      D  GKYLGL +  G +KKA+   ++D
Sbjct  61   SSIFF--------GTSTSKRIKKRIGNTLGIPHKDGFGKYLGLQADFGLSKKAVFXEIRD  112

Query  359  RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
            ++ + + GW+  FLS+AG EVL+K V   LP++AM  F L I +CR++E  +  +WW G 
Sbjct  113  KMEARLAGWSEQFLSQAGKEVLIKAVAMXLPNFAMSCFKLPIGVCRDMEKAVRSYWWRGN  172

Query  539  VARRLGIRWKAW-KALCTKIKRWLGVYDLKGDEPGTQT---WRLLTRPDSLVERVFKSRY  706
              +R G  W +W K +  K    LG  D++           WRL+  P SL+  V + +Y
Sbjct  173  SQKR-GCHWASWDKLMKQKSAGGLGFKDIQCFNLAFLAKIGWRLIQNPTSLLANVLRDKY  231

Query  707  YPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL  856
            YP     +A  G N  + W+ I E    ++   R  +GD     I KD WL
Sbjct  232  YPGKCFKDAGKGRNTSWGWKGIFESRTVLQHGVRWRVGDGEXINIRKDPWL  282



>ref|XP_008372934.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=961

 Score =   167 bits (423),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/349 (31%), Positives = 173/349 (50%), Gaps = 21/349 (6%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I   +  G LHG++V+    PISH+ FADD  LF  A+ E++  +  IL  Y   SGQ +
Sbjct  233   IRKGLENGSLHGIRVSPTGRPISHLFFADDSVLFCNASVEDAXGVGEILRAYASGSGQEI  292

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAG-----GSGDTTGKYLGLPSLVGKNKKAILG  346
             N  KS  +F  + +         R +++        S +  GKYLGL +  G +KKA+ G
Sbjct  293   NMTKSSIMFSPKTKK--------RVKKEIVHVLNIQSREGFGKYLGLQADFGLSKKAVFG  344

Query  347   FVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFW  526
              +++RI S + GW   FLS+AG E+L+K V  A+P+YAM  F L I +C++IE  + ++W
Sbjct  345   EIRERIESRMVGWAEQFLSQAGKEILIKAVAMAMPNYAMSCFKLPIGVCKDIEKAVRNYW  404

Query  527   WTGKVARRLGIRWKAWKALCTKIKR-WLGVYDLKGDEPGTQT---WRLLTRPDSLVERVF  694
             W G   R+ GI W AW+ + ++ +   LG  D++           WR+  +P+SL   V 
Sbjct  405   WRGSGDRK-GIHWVAWEKIRSQKRNGGLGFKDIQCFNLALLAKIGWRITLQPBSLJANVL  463

Query  695   KSRYYPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAED  871
             + +Y+P      A  G    + W+ I E    + +  R  +GD     I +D W    + 
Sbjct  464   REKYFPGKTFREASGGRGTSWGWKGIFEARKVLDKGIRWRVGDGNCINIREDPWF--PKP  521

Query  872   PYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                   + E ++   V  L++     W  D +   F  +D   IL+IP+
Sbjct  522   STFKARVXEGLQAIMVRDLIDPGSREWKTDMVKGGFLEKDVTSILSIPL  570



>gb|EEC66671.1| hypothetical protein OsI_32959 [Oryza sativa Indica Group]
Length=697

 Score =   165 bits (418),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/343 (32%), Positives = 174/343 (51%), Gaps = 27/343 (8%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             L G+++ RGAP ++H+ FADD  L L+A    +  MK I+  Y  +SGQ+VN DKS+ +F
Sbjct  185   LCGLRICRGAPILTHLFFADDSLLLLKATESVANEMKQIILDYERSSGQIVNRDKSVVMF  244

Query  209   *YQYRSG*QNCSD*RSQRQAGGSGDTTG--------KYLGLPSLVGKNKKAILGFVKDRI  364
                        S    + +      T G        +YLGLP  +G++K     ++K++I
Sbjct  245   -----------SSNMDEEEKKVFSHTLGINCIAHNDRYLGLPVFIGRSKAKTFEYLKEKI  293

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
                ++GW   FLS+AG E+L+K V QA+P+YAM  F L+ +LC E+  ++  FWW     
Sbjct  294   WRCIQGWKEKFLSKAGKEILIKAVAQAIPTYAMSCFYLTKSLCDELTSMILRFWWAQHDN  353

Query  545   RRLGIRWKAW-KALCTKIKRWLGVYDLKGDEPGT---QTWRLLTRPDSLVERVFKSRYYP  712
              +  I W    K +  K +  L   DL          Q WRL+  PDSL  R+ K++Y+P
Sbjct  354   DK-KIHWLGKDKIMKPKSQGGLAFRDLHSFNIAMLARQGWRLIQNPDSLCSRLLKAKYFP  412

Query  713   NSDLMNAVGHNPL-FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTH  889
             N ++++A     + + WRSI++    +++     +G+     I  D WL   +  +V+T 
Sbjct  413   NCNVLDAQSRKQMSYSWRSILKGIQLLRKGVIWRVGNGEHINIWSDPWLP-RDMRFVTTR  471

Query  890   LHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                S+    V  L++     WD + I  +FN  DA  I  IP+
Sbjct  472   RGASLI-TRVCELIDPTTGQWDIELIQQIFNENDAKIITRIPL  513



>ref|XP_010424753.1| PREDICTED: uncharacterized protein LOC104709909 [Camelina sativa]
Length=725

 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/344 (32%), Positives = 169/344 (49%), Gaps = 19/344 (6%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R  ++ G++V+   P ISH+LFADD   F RA  E+   + GIL  Y   SGQ +N+ KS
Sbjct  54    RSKLITGIKVSTACPTISHLLFADDSLFFCRATKEQCEVILGILREYERISGQRINFQKS  113

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRI  364
                F +   +G +       +   G  G TT      YLG+P  +G +K  I  FV+DR+
Sbjct  114   SVQFGHTVDAGVR-------EDLKGILGITTLGGMSSYLGIPESLGGSKTNIFSFVQDRL  166

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
                  GW    LSR G EV++K+V   +P++ M  F +  T+ R++   +++FWW     
Sbjct  167   QKRAGGWPARLLSRGGKEVMIKSVATVVPTFVMSCFRIPKTVTRKLTSAISNFWWCSSGE  226

Query  545   RRLGIRWKAWKALCT-KIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYP  712
              R G+ W AW  LC  K +  LG   + D        Q WRL++ PDSL  +VFK RYY 
Sbjct  227   TR-GLHWIAWDRLCADKTEGGLGFRCLDDFNTALLAKQLWRLISVPDSLFAKVFKGRYYR  285

Query  713   NSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTH  889
             +SD ++ +  + P + WRS++   + V +     +G   S ++  D W + A+ P  +  
Sbjct  286   HSDPLDPIKSYFPYYGWRSLISARSLVNKGLIKRVGTGASISVWSDPW-IPAQSPRPALC  344

Query  890   LHESVREA-PVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                 V     V + ++    SWD   +   F A D   I  +P+
Sbjct  345   SGSPVDPTLRVENFIDRTSRSWDLALLSASFEAEDVALISALPL  388



>ref|XP_010507233.1| PREDICTED: uncharacterized protein LOC104783828 [Camelina sativa]
Length=860

 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 112/360 (31%), Positives = 177/360 (49%), Gaps = 17/360 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I    R  ++ G++VA   PPISH+LFADD   F +A+ ++   +  IL  Y   SGQ +
Sbjct  374   IQKAERNKLITGIKVANKCPPISHLLFADDSLFFCKADRDQCRVILDILHQYESVSGQQI  433

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N+ KS   F ++     Q  ++ +        G   G YLGLP  +   K  +  FV++R
Sbjct  434   NFSKSSVQFGHKIDD--QTTAELQDVLGIPTLGGM-GSYLGLPESLDGAKTKVFSFVRER  490

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             I S   GW   FLS+ G EV++K+V  A+P++ M  F L  T+  ++   + +FWW+   
Sbjct  491   IQSRTNGWTANFLSKGGREVMIKSVATAVPTFVMSCFRLPKTITSKLTSAVANFWWSTNG  550

Query  542   ARRLGIRWKAWKALCTKIKRWLG------VYDLKGDEPGTQTWRLLTRPDSLVERVFKSR  703
               R G+ W  W+ LC  + + LG      V D        Q WRL+  PDSL  RVFKSR
Sbjct  551   QSR-GMHWLPWEKLC--VSKQLGGLGFRNVDDFNSALLAKQLWRLIDVPDSLFARVFKSR  607

Query  704   YYPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-VMAEDPY  877
             YY N+  M+ +  ++P + WRSI    + V +     +G   + ++  D W+      P 
Sbjct  608   YYRNTHHMDPIRSYSPSYGWRSICSACSLVNKGLIKRVGSGDTISVWSDPWVPAQFPRPA  667

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPP--KVRVFAWKL  1051
             +S  L + +    ++ L++    +W  D + + F+  D + I  IP+    K   F W L
Sbjct  668   LSKGLVKDL-SLQMNQLIDRQTNTWRMDMLNEHFDPLDVDLIGAIPLGSNQKDDPFGWHL  726



>gb|AAD24831.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1524

 Score =   168 bits (425),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 116/344 (34%), Positives = 175/344 (51%), Gaps = 13/344 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I+ R   G L GV++  GAP I+H+ FADD   F +AN      +K + D+Y   SGQ +
Sbjct  811   INGRASSGDLRGVRIGNGAPAITHLQFADDSLFFCQANVRNCQALKDVFDVYEYYSGQKI  870

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N  KS+  F  +     Q+      +    G G   GKYLGLP   G+ KK +  ++ DR
Sbjct  871   NVQKSMITFGSRVYGSTQSKLKQILEIPNQGGG---GKYLGLPEQFGRKKKEMFEYIIDR  927

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +      W+  FLS AG E++LK+V  A+P YAM  F L   +  EIE +L +FWW  K 
Sbjct  928   VKKRTSTWSARFLSPAGKEIMLKSVALAMPVYAMSCFKLPKGIVSEIESLLMNFWWE-KA  986

Query  542   ARRLGIRWKAWKAL-CTKIKRWLGVYDL-KGDEP--GTQTWRLLTRPDSLVERVFKSRYY  709
             + + GI W AWK L  +K +  LG  DL K ++     Q WRL+  P+SL  RV K+RY+
Sbjct  987   SNQRGIPWVAWKRLQYSKKEGGLGFRDLAKFNDALLAKQAWRLIQYPNSLFARVMKARYF  1046

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
              +  +++A V     + W S+++    +K+  R  IGD ++  IG D   ++   P    
Sbjct  1047  KDVSILDAKVRKQQSYGWASLLDGIALLKKGTRHLIGDGQNIRIGLDN--IVDSHPPRPL  1104

Query  887   HLHESVREAPVSSLMNGVGTS--WDRDCIIDVFNARDANCILNI  1012
             +  E+ +E  +++L    G+   WD   I    +  D   I  I
Sbjct  1105  NTEETYKEMTINNLFERKGSYYFWDDSKISQFVDQSDHGFIHRI  1148



>emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=1369

 Score =   168 bits (425),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/353 (33%), Positives = 179/353 (51%), Gaps = 9/353 (3%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
              + ++HGV++     PISH+ FADD  LF+RA  EE  N+  IL  Y  ASGQ +N +KS
Sbjct  669   EKKVIHGVKIGHRVSPISHLFFADDSLLFIRATEEEVENVMDILSTYEAASGQKLNMEKS  728

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
                +         N       + A  + +   KYLGLP+ +G +KK +   ++DR+   +
Sbjct  729   EMSYSRNLEPDKINT---LQMKLAFKTVEGHEKYLGLPTFIGSSKKRVFQAIQDRVWKKL  785

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
             +GW   +LS+AG EVL+K V QA+P+YAM  F +  ++   IE +  +F+W  K   R  
Sbjct  786   KGWKGKYLSQAGREVLIKAVAQAIPTYAMQCFVIPKSIIDGIEKMCRNFFWGQKEEERR-  844

Query  557   IRWKAWKAL-CTKIKRWLGV--YDLKGDE-PGTQTWRLLTRPDSLVERVFKSRYYPNSDL  724
             + W AW+ L   K +  LG+  +D+        Q WR+LT+PDSL+ RV K +Y+P S+ 
Sbjct  845   VAWVAWEKLFLPKKEGGLGIRNFDVFNRALLAKQAWRILTKPDSLMARVIKGKYFPRSNF  904

Query  725   MNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
             + A V  N  F  +SI+     +++     IGD R TTI  D W+   E   ++     S
Sbjct  905   LEARVSPNMSFTCKSILSARAVIQKGMCRVIGDGRDTTIWGDPWVPSLERYSIAATEGVS  964

Query  902   VREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVRVFAWKLAMS  1060
               + P           W+ + +  +F   ++  I  IPV  + +   W   MS
Sbjct  965   EDDGPQKVCELISNDRWNVELLNTLFQPWESTAIQRIPVALQKKPDQWMWMMS  1017



>ref|XP_010513536.1| PREDICTED: uncharacterized protein LOC104789557 [Camelina sativa]
Length=790

 Score =   166 bits (419),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 117/361 (32%), Positives = 181/361 (50%), Gaps = 29/361 (8%)
 Frame = +2

Query  26    MLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSV  205
             +L G++V+  +P ISH+LFADD   F  A  E+   + GIL  Y   SGQ +N+ KS   
Sbjct  93    LLIGIRVSTASPTISHLLFADDSLFFCLATKEQCEVVLGILGKYERVSGQQINFQKSSIQ  152

Query  206   F*YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRILSW  373
             F +          D R + + G  G T     G YLG+P  +G  K  I  FV+D++ + 
Sbjct  153   FGHTVDI------DLREELK-GVLGITNLGGMGSYLGIPESLGGAKTKIFSFVQDKLQAR  205

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
               GW    LS+ G +V++K+V  A+P++ M  F L  T+ R++   +++FWW+     R 
Sbjct  206   ASGWPARLLSKGGKKVMIKSVATAVPTFVMSCFRLPKTVTRKLTSAISNFWWSSSGQSR-  264

Query  554   GIRWKAWKALC-TKIKRWLGVYDLKGDEPGT-----QTWRLLTRPDSLVERVFKSRYYPN  715
             G+ W AW  LC  K    LG  +L  D+  T     Q WRL+T PDSL  RVFK RYY +
Sbjct  265   GLHWVAWDKLCFGKDTGGLGFRNL--DDYNTALLAKQLWRLITVPDSLFARVFKGRYYRH  322

Query  716   SDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-VMAEDPYVST-  886
             SD ++ +  ++P + WRS++   + V +     +G   S ++  D W+   +  P +ST 
Sbjct  323   SDRLDPIKSYSPSYGWRSMISACSLVNKGLITRVGSGASISVWADPWIPAQSPRPALSTG  382

Query  887   -HLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV--PPKVRVFAWKLAM  1057
                  S+R   V + ++    SWD   +   F   D   I  +P+  P  + +F W    
Sbjct  383   SSFDPSLR---VINFIDRSSNSWDMAQLTATFVPEDVTIISALPIRQPDTLDLFGWLFTK  439

Query  1058  S  1060
             S
Sbjct  440   S  440



>ref|XP_004298219.1| PREDICTED: uncharacterized protein LOC101304768 [Fragaria vesca 
subsp. vesca]
Length=1687

 Score =   168 bits (425),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 123/354 (35%), Positives = 177/354 (50%), Gaps = 31/354 (9%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
               N  R G++HG +V+ G+PPISHILFADD  LF RA  +E   +K  L LY  A+GQ V
Sbjct  659   FQNVEREGLVHGAKVSEGSPPISHILFADDSMLFGRAEMQELTLLKQCLLLYERAAGQKV  718

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTG--------KYLGLPSLVGKNKKA  337
             N+ KS   F                + Q        G        KYLGLP++ G+NKK 
Sbjct  719   NFQKSAVAF-----------GPGLLEEQKSLIATFLGVLVVPFHEKYLGLPTVAGRNKKE  767

Query  338   ILGFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILN  517
             +   + +R+   ++GW +  LS+AG  +L+K V QA+PSY M +F LS  +CR  +  + 
Sbjct  768   MFKRIHERLDQHLQGWQSRLLSKAGKTILIKAVAQAIPSYTMSVFKLSKGVCRIYQSKVA  827

Query  518   HFWWTGKVARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVE  685
             ++WW G   ++ GI W  W  LC  K+   LG  D++           WR++ +P SL  
Sbjct  828   NYWW-GSGGKKNGIHWCKWDLLCRNKMDGGLGFRDIECFNQALLAKTVWRIVMQPTSLAN  886

Query  686   RVFKSRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVM  862
             RV +++Y    D   A +G  P FIWRS+V     +    R  +G+  +  I +D WL  
Sbjct  887   RVLQAKYVHGGDWAAAPIGPKPSFIWRSLVWGKKLLCAGIRWRVGNGTAIRIWEDKWLPS  946

Query  863   AEDPYVST--HLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                  V T   +  + R   VS+LM    + WD   I   F   DA+ IL+IPV
Sbjct  947   PWSFRVVTPRFMDSNTR---VSTLMTSP-SMWDVIFIQTHFLPVDADKILSIPV  996



>ref|XP_009114416.1| PREDICTED: uncharacterized protein LOC103839673 [Brassica rapa]
Length=1267

 Score =   167 bits (423),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 98/273 (36%), Positives = 149/273 (55%), Gaps = 11/273 (4%)
 Frame = +2

Query  2    IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
            I    R   L G++VAR  P ISH+LFADD   F +A   E   +  IL  Y   SGQL+
Sbjct  600  IKKAERENQLTGMKVARACPSISHLLFADDSLFFCKAQEAECQTILRILQDYAAVSGQLI  659

Query  182  NYDKSLSVF*YQYR-SG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
            N+ KS   F ++   S  Q   D    +  GG     G YLGLP  +G +K  I GFV+D
Sbjct  660  NFQKSSIQFGHKIEDSRRQMMRDILGIQNVGG----MGTYLGLPENMGGSKIQIFGFVQD  715

Query  359  RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
            R+ S V GW   + ++ G EV++K+V+ A+P++ M  + L     ++I  ++  FWW+  
Sbjct  716  RVSSRVNGWTFRYFTKGGKEVVIKSVVTAMPNHVMSCYRLPKANTKKITSVVARFWWSPG  775

Query  539  VARRLGIRWKAWKALCT-KIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRY  706
             + R G+ WK+W  +C  K +  LG   + D      G Q WRL+ +P++L  RVFK RY
Sbjct  776  GSTR-GMHWKSWDKVCAPKDQGGLGFKDIMDFNTAMLGKQLWRLIEKPNTLFARVFKGRY  834

Query  707  YPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWY  802
            Y N+  ++ +  ++P + WRSI+   + V++ Y
Sbjct  835  YRNASPLDPIRSYSPSYGWRSIISARSLVERVY  867



>ref|XP_009102759.1| PREDICTED: uncharacterized protein LOC103828873 [Brassica rapa]
Length=1081

 Score =   167 bits (422),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 122/396 (31%), Positives = 193/396 (49%), Gaps = 38/396 (10%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I    R G + G+++AR +PPISH+LFADD   F +A+T++   +  I++ Y  ASGQ +
Sbjct  522   IQGAEREGRITGLKIARDSPPISHLLFADDSLFFCKADTQQCRELMKIIEEYGRASGQQL  581

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQ-RQAGG--SGDTTGKYLGLPSLVGKNKKAILGFV  352
             N  KS   F      G +   + +++ ++A G       G YLGLP  +  +K+    F+
Sbjct  582   NVAKSSIFF------GSKVPPELKTELKEALGITREGGMGVYLGLPEKICGSKRQAFAFI  635

Query  353   KDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWT  532
             ++R++S +  W+   LS+ G EVL+K+V QA+PSY M  F L   + +++   +  FWW+
Sbjct  636   QERLMSRLNSWSAKLLSKGGKEVLIKSVAQAMPSYVMSCFLLPQDIIKKLTSAIARFWWS  695

Query  533   GKVARRLGIRWKAWKALCTKIKR-WLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKS  700
              K   R G+ W AW  +C   ++  LG  DLK         Q WRL+  P SL+ +V K 
Sbjct  696   TKQNNR-GLHWVAWNKICLPTEKGGLGFRDLKNFNLALLAKQLWRLVQYPTSLLAKVLKE  754

Query  701   RYYPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPY  877
             RY+ NS+ ++      P ++WRSI+     +K   R SIG   +T +  + W+       
Sbjct  755   RYFRNSNPIDVEKASQPSYVWRSIMAAKPLLKSGLRKSIGSGYNTRVWDEPWI-------  807

Query  878   VSTHLHESVREAPVS-------SLMNGVGTSWDRDCIIDVFNARDANCI--LNIPVPPKV  1030
              ST        AP+         L++    SW+ + +  V    D   I  L I    KV
Sbjct  808   PSTPPRPPTGVAPIQKPNLLVYELIDRETKSWNVEALKAVIAPEDIPLISSLRISRSFKV  867

Query  1031  RVFAWKLAMS--YSL-----VLCP*RHVWYTAICVE  1117
               F W    S  YS+      +C   +   T +C+E
Sbjct  868   DSFCWIHTKSGAYSVKTGYDEICRSENEQNTELCIE  903



>ref|XP_010696345.1| PREDICTED: uncharacterized protein LOC104908875 [Beta vulgaris 
subsp. vulgaris]
Length=647

 Score =   164 bits (415),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/323 (33%), Positives = 162/323 (50%), Gaps = 9/323 (3%)
 Frame = +2

Query  65    ISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*YQYRSG*QNCS  244
             +SH+ FADD  LF +A+ +E + +  I+  Y  ASGQ VN  K+  VF     S  +N  
Sbjct  2     VSHLFFADDSILFAKASVQECSVVADIIYKYERASGQKVNLSKTEVVFSRNVESDRRNAI  61

Query  245   D*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT*FLSRAGHEVL  424
                         D   KYLGLP+++G++KK     +K+RI   ++GW    LSR G E+L
Sbjct  62    ---VNVLGVKEVDRQEKYLGLPTVIGRSKKVTFACIKERIWKKLQGWKEKLLSRPGKEIL  118

Query  425   LKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKAWKALC-TKIKR  601
             +K+V QA+P+Y M +F L   L  EI  ++  FWW G       + W +W+++C  K   
Sbjct  119   IKSVAQAIPTYMMSVFCLPSGLLDEIHSLIARFWW-GSNGGEKKMHWHSWESMCLPKSMG  177

Query  602   WLGVYDL---KGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-VGHNPLFIWRSI  769
              LG  DL     D    Q WRL     + + RV ++RYY N+D ++A  G+NP F  RSI
Sbjct  178   GLGFRDLHCFNQDSLAKQAWRLCQSHSTHLARVLQARYYKNTDFLDARRGYNPSFTRRSI  237

Query  770   VEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREAPVSSLMNGVGTS  949
                 + + +  +  +G      +  D W++      V T  H+S R+  V  L+      
Sbjct  238   WGAKSLLLEGLKWCVGSGSRIRVWDDAWILGNGSHCVPTPSHDSNRDLRVCDLIGASRGG  297

Query  950   WDRDCIIDVFNARDANCILNIPV  1018
             W+ + I  VF   + + IL IP+
Sbjct  298   WNVELIQQVFVEEEWSSILGIPL  320



>gb|AAD20714.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1750

 Score =   167 bits (424),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 116/344 (34%), Positives = 175/344 (51%), Gaps = 13/344 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I+ R   G L GV++  GAP I+H+ FADD   F +AN      +K + D+Y   SGQ +
Sbjct  1037  INGRASSGDLRGVRIGNGAPAITHLQFADDSLFFCQANVRNCQALKDVFDVYEYYSGQKI  1096

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N  KS+  F  +     Q+      +    G G   GKYLGLP   G+ KK +  ++ DR
Sbjct  1097  NVQKSMITFGSRVYGSTQSRLKQILEIPNQGGG---GKYLGLPEQFGRKKKEMFEYIIDR  1153

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +      W+  FLS AG E++LK+V  A+P YAM  F L   +  EIE +L +FWW  K 
Sbjct  1154  VKKRTSTWSARFLSPAGKEIMLKSVALAMPVYAMSCFKLPKGIVSEIESLLMNFWWE-KA  1212

Query  542   ARRLGIRWKAWKAL-CTKIKRWLGVYDL-KGDEP--GTQTWRLLTRPDSLVERVFKSRYY  709
             + + GI W AWK L  +K +  LG  DL K ++     Q WRL+  P+SL  RV K+RY+
Sbjct  1213  SNQRGIPWVAWKRLQYSKKEGGLGFRDLAKFNDALLAKQAWRLIQYPNSLFARVMKARYF  1272

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
              +  +++A V     + W S+++    +K+  R  IGD ++  IG D   ++   P    
Sbjct  1273  KDVSILDAKVRKQQSYGWASLLDGIALLKKGTRHLIGDGQNIRIGLDN--IVDSHPPRPL  1330

Query  887   HLHESVREAPVSSLMNGVGTS--WDRDCIIDVFNARDANCILNI  1012
             +  E+ +E  +++L    G+   WD   I    +  D   I  I
Sbjct  1331  NTEETYKEMTINNLFERKGSYYFWDDSKISQFVDQSDHGFIHRI  1374



>ref|XP_010462630.1| PREDICTED: uncharacterized protein LOC104743220 [Camelina sativa]
Length=746

 Score =   165 bits (417),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 116/345 (34%), Positives = 171/345 (50%), Gaps = 16/345 (5%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G L GV+VAR +P ++H+LFADD   F+R++ +   ++  IL  Y  ASGQ +N DKS  
Sbjct  70    GSLPGVKVARQSPLVNHLLFADDTMFFMRSDQKSCNSLTKILQKYERASGQRINVDKSSI  129

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDT-TGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
              F  +     +     + +R  G   +   GKYLGLP   G+ K  +   + D+I     
Sbjct  130   TFSAKTSREMKT----KVKRDLGIQKEGGNGKYLGLPENFGRRKSDVFESIVDKIRQRSH  185

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
              W++  LS AG +VLLK+VL ++PSYAM  F L  +LC+ I+ +L  FWW  K  ++  +
Sbjct  186   SWSSRTLSEAGKQVLLKSVLSSMPSYAMTCFKLPGSLCKRIQSVLTRFWWDDKPDKQ-KM  244

Query  560   RWKAWKALC-TKIKRWLGVYDLKGDEPGTQ---TWRLLTRPDSLVERVFKSRYYPNSDLM  727
              W AW  L   K    LG  D++           WRLL  P++L+ RV   +Y  +   M
Sbjct  245   SWVAWTKLTRPKNAGGLGFRDMERFNDALLAKIAWRLLKEPNTLLARVLLGKYCHSYSFM  304

Query  728   N-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAED--PYVSTHLHE  898
               ++  NP   WRSI+   N +KQ     IG+  S  I +D WL       PY     H+
Sbjct  305   ECSIPSNPSHGWRSIMAGRNVIKQGAGWLIGNGESVKIWRDPWLSTTTPLCPYGPIREHQ  364

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR  1033
                   VSSL++     W+   I +    +  +CI  IP+ P  R
Sbjct  365   EGET--VSSLLDPSTNQWNWSKIREEL-PQYVDCIKQIPLAPSRR  406



>emb|CAE01608.2| OSJNBa0052O21.12 [Oryza sativa Japonica Group]
Length=427

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 110/337 (33%), Positives = 161/337 (48%), Gaps = 10/337 (3%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G++ G++  R  PPISH+LFADD   F R++      +K  L  Y  ASGQ +N  KS  
Sbjct  86    GVIQGIRNGRLGPPISHLLFADDSIFFARSDLHSVQGLKDALQAYCKASGQKINLQKSSI  145

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRG  382
              F        +N      Q       DT   YLG+P+ +G+       F+ +R+   V G
Sbjct  146   FFGQNCLEDIKNSVKETLQVSVEILQDT---YLGMPTEIGRASTGSFHFLPERVWRRVNG  202

Query  383   WNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIR  562
             WN   +SRA  E +LK V QA+P+Y M  F L ++ C +++  +   WW  +  ++  + 
Sbjct  203   WNDRPMSRARKETMLKAVAQAIPTYVMSCFKLPVSTCEKMKSCILDHWWGFEDGKK-KMH  261

Query  563   WKAWKALCT-KIKRWLGVYDL---KGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
             W++W+ + T K    +G  DL          Q WR++T   SL  RV K RY+PNSDL N
Sbjct  262   WRSWEWMTTPKSLGGMGFRDLGLFNQAMLARQGWRIVTDLVSLCARVLKGRYFPNSDLWN  321

Query  731   AVGHNPL-FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVR  907
             A       F W SI+   + +++  R  IG+  S  I KD W +    P +   L     
Sbjct  322   APKPTATSFTWPSILFGRDLLRKGVRWGIGNGSSVKILKDHW-IPGIKPSMVRPLLPLPE  380

Query  908   EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +  V  L+N     WD D +   F+   A  IL IPV
Sbjct  381   DVTVDFLVNDAIGEWDEDKVFSFFDETTAQQILQIPV  417



>ref|XP_010468701.1| PREDICTED: uncharacterized protein LOC104748809 [Camelina sativa]
Length=691

 Score =   164 bits (414),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 113/347 (33%), Positives = 180/347 (52%), Gaps = 13/347 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I++++  G L G+++  G PPI+H+ FADD   F RAN      +K   D+Y   SGQ++
Sbjct  85    INSQVASGHLQGIKIGNGVPPITHLQFADDSLFFCRANKRNCQALKDAFDVYEYYSGQII  144

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N  KSL  F  +     QN      Q     +    GKYLGLP   G+ KK +  ++ +R
Sbjct  145   NTSKSLITFGSRVHGSRQNA---LQQILNISNKGGGGKYLGLPEQFGRKKKEMFEYIVER  201

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +      W+  FLS AG EVLLK+V  A+P YAM  F L + L  E+E IL +FWW    
Sbjct  202   VRQRTANWSGKFLSPAGKEVLLKSVAAAMPVYAMSCFKLPLGLISELESILMNFWWKKNA  261

Query  542   ARRLGIRWKAWKAL-CTKIKRWLGVYDL-KGDEP--GTQTWRLLTRPDSLVERVFKSRYY  709
             + R GI W AWK L  +K +  LG  +L K ++     Q WR++  P+SL  +V K+RY+
Sbjct  262   SSR-GISWIAWKRLQYSKKEGGLGFRNLAKFNDALLAKQAWRIIQYPNSLFAKVMKARYF  320

Query  710   PNSDLMNAVG-HNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
             P++ + +A    N  + W SI+   + +K+  R ++GD  +  +  D   V+A+ P    
Sbjct  321   PDNSVTDASAKKNQSYGWSSILVGLDLLKKGLRVAVGDGSTIRVNIDN--VIADHPPRPI  378

Query  887   HLHESVREAPVSSLMNGVGT--SWDRDCIIDVFNARDANCILNIPVP  1021
                +   +  +S+ +   G+  SW+     ++    D + ++ I +P
Sbjct  379   CSMDPHTQCTLSAFIQSHGSVKSWNNHTAANILEPTDFDALMQIYIP  425



>ref|XP_004954924.1| PREDICTED: uncharacterized protein LOC101756955 [Setaria italica]
Length=1203

 Score =   166 bits (421),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 110/339 (32%), Positives = 169/339 (50%), Gaps = 10/339 (3%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
              RG L GV+V R AP ISH+LFADD  + ++A+   +  +  IL+ Y  +SGQ ++  KS
Sbjct  526   ERGDLIGVKVCRDAPTISHLLFADDSLILMQADKNNADCLASILNRYCASSGQKISEAKS  585

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
              S++        Q       Q     +     KYLGLP+LVG ++      + DR+ + +
Sbjct  586   -SIYFSANTEADQKTE--VCQILNIMTESLNDKYLGLPALVGLDRSNCFRHLIDRVNTRI  642

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
              GW    LS  G E+L+K++ QA+P YAMM+F +  ++C+ I   ++ +WW      R  
Sbjct  643   NGWKEKTLSLGGKEILIKSIAQAVPVYAMMVFQIPKSICKGITNAISQYWWGDDDEHRR-  701

Query  557   IRWKAWKALC-TKIKRWLGVYDLKG---DEPGTQTWRLLTRPDSLVERVFKSRYYPNSDL  724
             + W+ W  +C  K K  +G  DL+         Q WRLL  P+SL  RV ++RYYPN  L
Sbjct  702   MHWQEWWKMCLPKDKGGMGFRDLQSFNLAMLAKQAWRLLCEPESLCARVLRARYYPNGKL  761

Query  725   MNAVGHN-PLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
             + A   N   F W+SI+      K  Y   +GD     I +D W+  + +  + T    +
Sbjct  762   LQARNKNGSSFTWQSILAGLECFKHGYIWRVGDGTQINIWEDNWIPGSHNLKIQTARGNN  821

Query  902   VREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +  + V  L+N +   WD D +  +F   D   I  IP 
Sbjct  822   LV-STVDELINPITMQWDVDLLKAIFWPTDVYRIRQIPT  859



>ref|XP_009139334.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=614

 Score =   163 bits (413),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 109/345 (32%), Positives = 176/345 (51%), Gaps = 16/345 (5%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             +G LHG+++   +PP+ H+LFADD  L  RA+  ES  +   L  Y  ASGQ++N  KS 
Sbjct  156   QGRLHGIKLTEKSPPVHHLLFADDSLLMCRADLLESEEILKCLRNYGLASGQVINTSKSS  215

Query  200   SVF*YQY-RSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
              +F  +   +  +   +     + GG G+    YLGLP +   +K+ +L F+K+++   +
Sbjct  216   IIFGSKIPETRKEEIKNLLGIHKEGGDGN----YLGLPEVFKGSKRDLLNFIKEKLEGRL  271

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
             +GW +  LS    EVL+K+V  ALP YAM +F L   LC  I   +  +WW+    +R  
Sbjct  272   QGWYSKTLSMGAKEVLIKSVALALPIYAMSVFLLPKDLCARITSAIAEYWWSSGDKKR-N  330

Query  557   IRWKAWKALCT-KIKRWLGVYDLKGDEPG---TQTWRLLTRPDSLVERVFKSRYYPNSDL  724
             I W AW+ LC  K    +G +D+          Q WR+ ++P+SLV RV + RY+  S  
Sbjct  331   IPWVAWQKLCKPKNMGGMGFHDIGRFNQALLCKQAWRIWSQPESLVARVLRGRYFNRSSF  390

Query  725   MN-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
             +    G  P F WRSI++    +KQ     IG+   + +  + W++    P    +  +S
Sbjct  391   LECGTGTRPSFAWRSILQGRELLKQGLIRHIGNGEQSNVWVENWII-DTVPRPPMYRADS  449

Query  902   VRE--APVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKV  1030
             V +    VS L+      W+R+ ++  F   DA  +L +   PK+
Sbjct  450   VIDLTLKVSDLLVPGSDRWNRNLVLQTFTDEDAARVLCL--KPKI  492



>ref|XP_009137133.1| PREDICTED: uncharacterized protein LOC103861184 [Brassica rapa]
Length=957

 Score =   166 bits (419),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 111/339 (33%), Positives = 169/339 (50%), Gaps = 12/339 (4%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             +G++ G+++A   P + H+LFADD F   RA+  E A     L LY  +SGQ++N+ KS 
Sbjct  250   QGLVSGMKLAPTCPAVQHLLFADDSFFLCRASLAECAEFLRRLKLYGDSSGQVINFQKSA  309

Query  200   SVF*YQYRSG*QNC-SD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
               F        +   S+  +    GG G    KYLGLP     +K+ +L ++ +++   +
Sbjct  310   ITFGAGIDPVMKRLLSEFLNIENEGGDG----KYLGLPECFSGSKRKLLAYIGEKLGKRL  365

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
             +GW    LS  G EVLLK++  ALP YAM  F L+   C++I   +  FWW     +R  
Sbjct  366   QGWFAKKLSLGGKEVLLKSIAMALPVYAMSCFRLTKHHCQKIMSAMASFWWDECDEKR-K  424

Query  557   IRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDL  724
             I W +W  LC +K    LG  D++         Q WRLL  P+SL+ R++K RYY N+  
Sbjct  425   IHWVSWPKLCISKENGGLGFRDIEDFNQALLAKQAWRLLNEPNSLLARIYKGRYYANTGF  484

Query  725   MNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
             M    G+ P + WRSI      + +    SIGD +ST +    W +M E P    +    
Sbjct  485   MECGKGYRPSYAWRSIFFGRELLSKGLIRSIGDGQSTLVWSQKW-IMDEVPRRPINKEMM  543

Query  902   VREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +      S +      WD D + ++F   + N IL++PV
Sbjct  544   IDVNLKVSDLKLNENQWDGDKLQEIFPINEVNRILHMPV  582



>ref|XP_010480729.1| PREDICTED: uncharacterized protein LOC104759515 [Camelina sativa]
Length=1240

 Score =   166 bits (420),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 113/363 (31%), Positives = 182/363 (50%), Gaps = 27/363 (7%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R  ++ G++V+   P +SH+LFADD   F RA  E+   + GIL  Y  ASGQ +N+ KS
Sbjct  407   RSKLITGIKVSTACPAVSHLLFADDSLFFCRATKEQCEAVLGILRQYERASGQQINFQKS  466

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRI  364
                F      G    +D R + + G  G T       YLG+P  +G +K  +  FV+DR+
Sbjct  467   SVQF------GHTVDADLREELK-GVLGITNLGGMSSYLGIPESLGGSKTKVFSFVQDRL  519

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
                  GW    LSR G EV++K+V  A+P++ M  F L  T+ R++   +++FWW+    
Sbjct  520   QKRTGGWPARLLSRGGKEVMIKSVAIAVPTFVMSCFRLPKTVTRKLTSAVSNFWWSASGD  579

Query  545   RRLGIRWKAWKALCT-KIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYP  712
              R G+ W AW  LC  KI   LG   + D        Q WRL++ PD+L  +VFK RYY 
Sbjct  580   TR-GLHWIAWDKLCVDKIDGGLGFRCLDDFNTALLAKQLWRLISAPDALFAKVFKGRYYR  638

Query  713   NSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS--  883
             +S+ ++ +  ++P + WRS+V   + V +     +G   S ++  D W + A+ P  +  
Sbjct  639   HSNPLDPIKSYSPSYGWRSMVSARSLVNKGLIKRVGSGDSISVWSDPW-IPAQPPRPALR  697

Query  884   --THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV--PPKVRVFAWKL  1051
               + +  ++R   V +L++    SW+   +   F   D   I  +P+  P    +  W L
Sbjct  698   SGSPIDPTLR---VETLIDRSSRSWNLALLSASFKPEDVAIISALPIGKPDSPDMLGWHL  754

Query  1052  AMS  1060
               +
Sbjct  755   TKT  757



>ref|XP_007226707.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
 gb|EMJ27906.1| hypothetical protein PRUPE_ppa020120mg [Prunus persica]
Length=1011

 Score =   166 bits (419),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 113/344 (33%), Positives = 160/344 (47%), Gaps = 19/344 (6%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I  + R G L GV + RGAP ISH+ FADD  LF RAN  +             ASGQ V
Sbjct  558   IAQKEREGFLKGVSICRGAPAISHLFFADDSVLFARANMADCMR----------ASGQQV  607

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N+ KS   F      G Q      +Q       D   +YLGLP ++ K K A    +K+R
Sbjct  608   NFQKSAVCFSKNVHRGDQLM---LAQFMGIPCVDHHSQYLGLPMVLDKKKGASFNHLKER  664

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +   ++ W    LS AG E+L+K V QA+P Y M  F L   +C ++  ++  FWW    
Sbjct  665   LWKKLQTWKGKLLSGAGKEILIKVVAQAIPIYTMSYFLLPKYVCEDLNKLVAQFWWNSST  724

Query  542   ARRLGIRWKAWKALCT-KIKRWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRYY  709
               +  I W AW  LC  K +  LG  +L          Q WRLL  PDSL+ +V K++Y+
Sbjct  725   ENK-KIHWMAWDRLCAPKEEGGLGFRNLHAFNLALLAKQGWRLLQNPDSLITKVLKAKYF  783

Query  710   PN-SDLMNAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
             P  S L  AV  +   +W+S+ E    + Q  R  +G   +  I +D WL       +  
Sbjct  784   PTRSFLETAVSLHASVVWKSLYEARTVIIQGSRWQVGSGDTIGIWEDRWLPQPNSFRIFF  843

Query  887   HLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                E      VS L++G    W+   + +VF   +   I +IP+
Sbjct  844   PKPEHSAITKVSDLIHGDSREWNVPLLQNVFFPEEVMLIRSIPL  887



>ref|XP_010418618.1| PREDICTED: uncharacterized protein LOC104704191 [Camelina sativa]
Length=1833

 Score =   166 bits (421),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 109/351 (31%), Positives = 170/351 (48%), Gaps = 14/351 (4%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
              G ++G+Q +   P I H+LFADD    ++A+ ++   ++ IL  Y   +GQL+N +KS 
Sbjct  1127  EGKIYGIQFSTEGPAIHHLLFADDSLFMIKASEDQGCALQKILSDYGEVTGQLINLEKSS  1186

Query  200   SVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
               F  Q     Q+     + R         G YLGLP     +K  +L ++ DR+   + 
Sbjct  1187  ITFGAQVE---QSLKTMIATRLGIFKEGGAGTYLGLPECFSGSKVEMLSYIHDRMKGRMS  1243

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
             GW    LS+ G E+LLK+V  A+P +AM  F L    C  +   ++ FWW     ++  +
Sbjct  1244  GWFARTLSQGGKEILLKSVAMAMPVFAMTCFKLPKKTCENLSSAMSAFWWDSTENKK-KM  1302

Query  560   RWKAWKALC-TKIKRWLGVYDLKGDEPG---TQTWRLLTRPDSLVERVFKSRYYPNSDLM  727
              W +W+ LC  K    LG  D++         Q WR+L   D L  R FKSRY+P+SD +
Sbjct  1303  HWISWEKLCLPKHAGGLGFKDIQIFNQALLSKQAWRVLQDKDCLFARFFKSRYFPDSDFL  1362

Query  728   NA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV--MAEDPYVSTHLHE  898
             +A +G+ P + WRSI+   + +K+  R  IGD  ST +    W++  +   P +   L +
Sbjct  1363  SATLGYRPSYAWRSILHGRDLLKRGLRQMIGDGASTFVWSSRWVLDGIMRAPLMKNILFD  1422

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI-PVPPKVRVFAWK  1048
                +  V  L++    SWD   +   F  RD   IL I PV        W+
Sbjct  1423  --LDLMVKDLLDTTTQSWDLAKLQYHFYPRDVELILKIKPVMSSEDYLIWE  1471



>gb|EAZ29765.1| hypothetical protein OsJ_13823 [Oryza sativa Japonica Group]
Length=490

 Score =   161 bits (408),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 110/337 (33%), Positives = 161/337 (48%), Gaps = 10/337 (3%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G++ G++  R  PPISH+LFADD   F R++      +K  L  Y  ASGQ +N  KS  
Sbjct  149   GVIQGIRNGRLGPPISHLLFADDSIFFARSDLHSVQGLKDALQAYCKASGQKINLQKSSI  208

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRG  382
              F        +N      Q       DT   YLG+P+ +G+       F+ +R+   V G
Sbjct  209   FFGQNCLEDIKNSVKETLQVSVEILQDT---YLGMPTEIGRASTGSFHFLPERVWRRVNG  265

Query  383   WNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIR  562
             WN   +SRA  E +LK V QA+P+Y M  F L ++ C +++  +   WW  +  ++  + 
Sbjct  266   WNDRPMSRARKETMLKAVAQAIPTYVMSCFKLPVSTCEKMKSCILDHWWGFEDGKK-KMH  324

Query  563   WKAWKALCT-KIKRWLGVYDL---KGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
             W++W+ + T K    +G  DL          Q WR++T   SL  RV K RY+PNSDL N
Sbjct  325   WRSWEWMTTPKSLGGMGFRDLGLFNQAMLARQGWRIVTDLVSLCARVLKGRYFPNSDLWN  384

Query  731   AVGHNPL-FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVR  907
             A       F W SI+   + +++  R  IG+  S  I KD W +    P +   L     
Sbjct  385   APKPTATSFTWPSILFGRDLLRKGVRWGIGNGSSVKILKDHW-IPGIKPSMVRPLLPLPE  443

Query  908   EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +  V  L+N     WD D +   F+   A  IL IPV
Sbjct  444   DVTVDFLVNDAIGEWDEDKVFSFFDETTAQQILQIPV  480



>ref|XP_010419439.1| PREDICTED: uncharacterized protein LOC104705159 [Camelina sativa]
Length=1840

 Score =   166 bits (420),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 109/351 (31%), Positives = 170/351 (48%), Gaps = 14/351 (4%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
              G ++G+Q +   P I H+LFADD    ++A+ ++   ++ IL  Y   +GQL+N +KS 
Sbjct  1127  EGKIYGIQFSTEGPAIHHLLFADDSLFMIKASEDQGCALQKILSDYGEVTGQLINLEKSS  1186

Query  200   SVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
               F  Q     Q+     + R         G YLGLP     +K  +L ++ DR+   + 
Sbjct  1187  ITFGAQVE---QSLKTMIATRLGIFKEGGAGTYLGLPECFSGSKVEMLSYIHDRMKGRMS  1243

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
             GW    LS+ G E+LLK+V  A+P +AM  F L    C  +   ++ FWW     ++  +
Sbjct  1244  GWFARTLSQGGKEILLKSVAMAMPVFAMTCFKLPKKTCENLSSAMSAFWWDSTENKK-KM  1302

Query  560   RWKAWKALC-TKIKRWLGVYDLKGDEPG---TQTWRLLTRPDSLVERVFKSRYYPNSDLM  727
              W +W+ LC  K    LG  D++         Q WR+L   D L  R FKSRY+P+SD +
Sbjct  1303  HWISWEKLCLPKHAGGLGFKDIQIFNQALLSKQAWRVLQDKDCLFARFFKSRYFPDSDFL  1362

Query  728   NA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV--MAEDPYVSTHLHE  898
             +A +G+ P + WRSI+   + +K+  R  IGD  ST +    W++  +   P +   L +
Sbjct  1363  SATLGYRPSYAWRSILHGRDLLKRGLRQMIGDGASTFVWSSRWVLDGIMRAPLMKNILFD  1422

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI-PVPPKVRVFAWK  1048
                +  V  L++    SWD   +   F  RD   IL I PV        W+
Sbjct  1423  --LDLMVKDLLDTTTQSWDLAKLQYHFYPRDVELILKIKPVMSSEDYLIWE  1471



>ref|XP_010513742.1| PREDICTED: uncharacterized protein LOC104789794 [Camelina sativa]
Length=1787

 Score =   166 bits (420),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 119/347 (34%), Positives = 173/347 (50%), Gaps = 16/347 (5%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             + G L G+++    P I H+LFADD     RA+  E +N+   L LY  ASGQ +N  KS
Sbjct  1077  QEGRLTGLKLTPECPSIQHLLFADDSLFLCRASLLECSNLLQCLRLYGDASGQEINLQKS  1136

Query  197   LSVF*YQYRSG*QNCSD*RSQ-RQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
                F  +     +      +   Q GG+    GKYLGLP     +KK +L ++ DR+ S 
Sbjct  1137  SITFGKKLDPYMRRVIGLFTGIEQEGGA----GKYLGLPECFSGSKKDMLAYITDRLTSR  1192

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             +RGW    LS  G EVLLK V  ALP YAM  F LS   C++I  ++ +FWW   V  + 
Sbjct  1193  LRGWFEKTLSLGGKEVLLKAVALALPVYAMSCFRLSKHQCKKITSVMANFWWNA-VEEKQ  1251

Query  554   GIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
              + W +W+ +C +K +  LG  D+          Q WRLL  P SL+ RV+K+RY+P+  
Sbjct  1252  KMHWVSWEKMCKSKDQGGLGFRDIGRFNQALLAKQAWRLLDAPSSLLARVYKARYFPSIS  1311

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
              M A +G  P + WRSI+     +++    SIGD   T +  D W V  E P    +  +
Sbjct  1312  FMEANLGPRPSYAWRSILFGRELLEKGLMKSIGDGLDTNVWLDKW-VFDELPRRPCNKEQ  1370

Query  899   SVR-EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVRV  1036
              +     VS L+   G  W+   + ++F   D   I +   PP  R+
Sbjct  1371  MINLNLRVSELITNQG-DWNLQALQELFPPCDVIKIRSF--PPDTRL  1414



>gb|EEE55133.1| hypothetical protein OsJ_02920 [Oryza sativa Japonica Group]
Length=1049

 Score =   165 bits (417),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 105/333 (32%), Positives = 162/333 (49%), Gaps = 18/333 (5%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G+LHG++     PPISH+LFADD   F +++      +K  L  Y  ASGQ +N  KS  
Sbjct  401   GLLHGIRNGHQGPPISHLLFADDSIFFAKSDPRSVQVLKSTLQSYCNASGQKINLQKSSL  460

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRG  382
             +F        + C     Q       DT   YLG+P+ +     +   F+ +R+   V G
Sbjct  461   LFGRYCPDAIKTCVKDCLQVSNEALQDT---YLGMPTEINCAVTSSFNFLSERVWKRVNG  517

Query  383   WNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIR  562
             WN   LSRAG E +LK V+QA+P+Y M  F +  T+C +++  + + WW  +  R+  + 
Sbjct  518   WNDRPLSRAGKETMLKAVVQAIPTYIMSCFQVPTTICDKMKSSMANHWWGYEDGRK-KMH  576

Query  563   WKAWKALCTKIKRWLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMNAVG-  739
             W++             +          Q WR+LT P+SL  RV K RY+P+SD  +A   
Sbjct  577   WRS------------DLVIFNQAMLARQGWRILTDPNSLCSRVLKGRYFPDSDFWSAPKP  624

Query  740   HNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREAPV  919
              +  F WRSI+     +K+  R ++GD  +  I KD W+   +   V+T       +  V
Sbjct  625   RSASFTWRSILFGRELLKKGVRWAVGDGSTIKITKDKWIPGVQAGMVNTRF-PIPDDVTV  683

Query  920   SSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
               LMN    +WD + +  VFN   A  +L +P+
Sbjct  684   DWLMNPERNAWDEEIVKAVFNDDIAREVLQVPI  716



>ref|XP_010670096.1| PREDICTED: uncharacterized protein LOC104887198 [Beta vulgaris 
subsp. vulgaris]
Length=1298

 Score =   165 bits (418),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/340 (30%), Positives = 169/340 (50%), Gaps = 19/340 (6%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             +HG ++  GAP ISH+ FADD  LF +A   + + +  I+  Y  ASGQ VN DK+  VF
Sbjct  630   IHGAKICNGAPRISHLFFADDSILFAKATVRQCSVITEIISQYERASGQSVNLDKTDVVF  689

Query  209   *YQYRSG*QNCSD*RSQRQAGGSGDTT-----GKYLGLPSLVGKNKKAILGFVKDRILSW  373
                       C D   +++   +          KYLGLP+++G++KK I   +K+RI   
Sbjct  690   --------SKCVDANRRQEIVATLGVKEVVQHAKYLGLPTIIGRSKKVIFASLKERIWKK  741

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             ++GW    LSR G EVLLK V+QA+ +Y M +F +   L  EI  ++  FWW G    + 
Sbjct  742   IQGWKEKSLSRPGKEVLLKAVVQAILTYMMSVFKIPEGLINEIHTLMARFWW-GSTDTQR  800

Query  554   GIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
              + W +W  LC  K    +G  +L          + WRL T P SL+ ++ K+RY+ + +
Sbjct  801   KMHWSSWAELCKPKAMGGMGFCNLHVFNQALLAKKIWRLHTNPTSLLHKLLKARYFKHDE  860

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
             ++NA  G +P + WRS+    + + +  +  +GD  + +  ++ W+       +   +  
Sbjct  861   VLNARRGFDPSYSWRSLWGAKSLLLEGLQWRVGDGVNISAWENAWVPGCRAAPIPRSMES  920

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                   V+  +   G++W +  +   F+  D   IL  P+
Sbjct  921   KELIVNVADCIEPNGSTWKQHLVSQCFSDEDGQRILKTPL  960



>ref|XP_009103791.1| PREDICTED: uncharacterized protein LOC103829852 [Brassica rapa]
Length=1374

 Score =   165 bits (418),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/338 (32%), Positives = 169/338 (50%), Gaps = 17/338 (5%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G + G++ +   P I H+ FADD FL ++A+ E+   ++ IL +Y   SGQ+++  KS  
Sbjct  664   GEIEGIKFSAEGPVIHHLFFADDSFLMVKASDEQCTKLRSILKVYEENSGQMISLTKSSI  723

Query  203   VF*YQYRSG*Q-NCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
              F  +     +    +       GG    TGKYLGLP     +K  +L ++++++ S   
Sbjct  724   TFGAKIAPSRKVKIKEILGIEAEGG----TGKYLGLPECFSGSKVEMLQYIQEKMKSRFH  779

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
             GW   FLS  G ++LLK V  A+P +AM +F L  T C+ +   ++ FWW  +  +   I
Sbjct  780   GWYGRFLSAGGKDILLKTVAMAMPVFAMSVFKLPKTTCKNLTSAMSKFWWDVQEGKS-KI  838

Query  560   RWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLM  727
              W +W+ LC  K +  +G  D++         Q WRLL   +SL  R  +SRYYPN   M
Sbjct  839   HWISWEKLCLGKNQGGMGFRDIEKFNQALLAKQGWRLLMDSESLCARFLRSRYYPNGKFM  898

Query  728   NA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESV  904
              A +G  P + WRSI+     +++  R +IG    T++  D WL  +E P     L + +
Sbjct  899   EASLGARPSYAWRSILFGRQLLEKGLRRTIGSGEDTSVWWDKWL-FSESPMAP--LRKPI  955

Query  905   R---EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILN  1009
                 +  VS L+N    SWDR  + D F   D   IL 
Sbjct  956   FFEVDLRVSELINPQTKSWDRGKLEDNFFPPDVERILK  993



>ref|XP_009105597.1| PREDICTED: uncharacterized protein LOC103831468 [Brassica rapa]
Length=773

 Score =   163 bits (412),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 113/337 (34%), Positives = 165/337 (49%), Gaps = 14/337 (4%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G+L G+QVARG+P ++H+LFADD   F RAN   +A +K IL  Y  ASGQ +N  KS  
Sbjct  92    GLLAGIQVARGSPHVNHLLFADDTMFFTRANKASAAALKEILRQYEVASGQCINPSKSTV  151

Query  203   VF*YQYRSG*QNC-SD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
              F  +     + C  D  +  + GG     GKYLGLP   G+ K+ +   + DRI     
Sbjct  152   TFSRKAPGTLKACIKDCLNISKEGG----IGKYLGLPEHFGRRKRDMFTSIVDRIKIKAS  207

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
             GW+  FLS AG  ++LK+VL  +PS+AM  F L  +LC  I+  +  FWW  +   R  I
Sbjct  208   GWSNKFLSTAGKMIMLKSVLSPIPSHAMSCFKLPRSLCNRIQSAVTRFWWDDRSGNR-KI  266

Query  560   RWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLM  727
              W +W  +  TK    LG  D +          +WRL+  P  L+ RV   +Y  +   +
Sbjct  267   AWVSWDKMTNTKGDGGLGFRDFESFNDAFLAKLSWRLIHNPSGLLSRVLMGKYGGDGTFL  326

Query  728   NAVGHNPL--FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
              A GH  +    W+ I+   + + Q    ++GD  S ++  D WL ++          E 
Sbjct  327   EA-GHRSVESHGWKGILIGRDLILQNAGWAVGDGESISVWADPWLSLSAPRRPMGPTPER  385

Query  902   VREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
                  V  LM   G+ W+RD I  +    +A  IL+I
Sbjct  386   FANLKVKDLMLPNGSDWNRDLIQQIMPQEEAT-ILSI  421



>ref|XP_004289367.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=1152

 Score =   165 bits (417),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 114/347 (33%), Positives = 167/347 (48%), Gaps = 29/347 (8%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G + GV+V   AP ISH+ FADD F+F RA   +   MK I   Y   SGQ +NY+KS  
Sbjct  420   GEIQGVKVCTDAPSISHLYFADDSFIFSRAEERDMLCMKDIFVTYETMSGQQINYEKSSV  479

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSG----DTTGKYLGLPSLVGKNKKAILGFVKDRILS  370
              F        +N    +    A   G    +   KYLGLP+ +  +K     ++ DR+  
Sbjct  480   SFS-------RNVPLWKQHDLAAVLGVQRVENHEKYLGLPTELSYSKDEAFRYLIDRVRK  532

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
               +GW    LS  G EVLLK V+Q++P+Y M  F L   LC E+  ++  FWW G+    
Sbjct  533   RTQGWRDKTLSGVGKEVLLKAVIQSIPTYVMSCFELPRHLCNEMHQLMARFWW-GEFGDE  591

Query  551   LGIRWKAWKALCTKIKR-WLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNS  718
               I W AW  LC+  K   LG  D+          Q WR+L RP SL+ +V K +Y+P S
Sbjct  592   RKIHWIAWDKLCSSKKEGGLGFRDMHVFNKALLAKQGWRMLCRPQSLLAQVLKMKYFPTS  651

Query  719   DLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPY------  877
              L+ A VG    + WRS++     ++Q  R  +G+  +  +  D WL +   PY      
Sbjct  652   SLIQAEVGKRISYSWRSLMRGKELLQQGLRFQVGNGENIHLWDDPWLPL---PYTFKPFS  708

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +  H  E +R   V  L+      W+   + ++F   ++  IL IP+
Sbjct  709   LPMHGSEGMR---VCELIEEGTGGWNEWLLEELFTPMESEIILKIPL  752



>gb|ABB46931.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1853

 Score =   165 bits (418),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 111/344 (32%), Positives = 175/344 (51%), Gaps = 16/344 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             ++ ++ +G ++ + + R AP + H+LFADD  LF +A  +++  MK +L+ Y   +GQL+
Sbjct  1191  LEEKVDQGAMNPIHICRHAPAVLHLLFADDTPLFFKAANDQAVVMKEVLETYASCTGQLI  1250

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N  K   +F     +  QN    + ++    S     KYLG P+  G+  K     +++R
Sbjct  1251  NPSKCSIMFGQSSPTAVQN----QIKQTLQISNSFEDKYLGFPTPEGRMTKGKFQSLQER  1306

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +   +  W   FLS  G E+L+K VLQA+P Y M +F L  ++C E+  ++ +FWW  + 
Sbjct  1307  LWKRIMLWGEKFLSTGGKEILIKAVLQAMPVYVMGLFKLPESVCEELTKLVRNFWWGAEK  1366

Query  542   ARRLGIRWKAWKAL-CTKIKRWLGVYDLKGDEPGT---QTWRLLTRPDSLVERVFKSRYY  709
               R    WK+W  L   K+K  +G  D +         Q WRLL RPDSL  R+ K+ YY
Sbjct  1367  GMRR-THWKSWDCLIAQKLKGGMGFRDFRLFNQALLARQAWRLLDRPDSLCARILKAIYY  1425

Query  710   PNSDLMN-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL--VMAEDPYV  880
             PN  L++ + G N    WR+I      +K+     IG+ +S  + +D W+    +  P  
Sbjct  1426  PNGSLIDTSFGGNASPGWRAIEYGLELLKKGIIWRIGNGKSVRLWRDPWIPRSYSRRPIS  1485

Query  881   STHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
             +     + R   VS L++  G SWD D I   F   DA  ILNI
Sbjct  1486  AKR---NCRLRWVSDLIDQSG-SWDTDKISQHFLPMDAEAILNI  1525



>ref|XP_009107553.1| PREDICTED: uncharacterized protein LOC103833206 [Brassica rapa]
Length=800

 Score =   163 bits (412),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 104/334 (31%), Positives = 170/334 (51%), Gaps = 13/334 (4%)
 Frame = +2

Query  35    GVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*Y  214
             G++VAR +P ISH+LFADD   F +A   +   +  ILD Y  ASGQ +N  KS  +F  
Sbjct  166   GLRVARASPRISHLLFADDSLFFCKAEVRQCKEILDILDSYGKASGQQLNATKSSIIFGN  225

Query  215   QY-RSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT  391
             +  ++  QN          GG     GKYLGLP  +  +K  +  +V+DR+   V  W+ 
Sbjct  226   KVDQNIKQNIKAVLGITTEGG----MGKYLGLPEQICGSKMKVFSYVQDRLNGCVTSWSA  281

Query  392   *FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKA  571
               LS+ G EV +K+V QA+P+Y M  + L   +  +++  +++FWW+     R G+ W A
Sbjct  282   RLLSKGGKEVQIKSVAQAVPTYNMSCYLLPQGIVEKLKSAISNFWWSSSQNNR-GLHWIA  340

Query  572   WKALCTKIKR----WLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYP-NSDLMNAV  736
             W  +C    +    +L ++D        Q WRL+  P+SL+ RV + RYY  +S L +  
Sbjct  341   WDKICVPHDQGGLGFLDLHDFNIALLAKQLWRLIQFPNSLLARVLRGRYYNRSSPLEDRK  400

Query  737   GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL--VMAEDPYVSTHLHESVRE  910
              ++P + WRSI+     +K   R +IG  ++T +  + W+  + A  P  S  +     +
Sbjct  401   VYSPSYGWRSIMAAKPLLKSGLRKTIGAGQNTCVWSEPWIPDIEARPPRPSNQITHRHPK  460

Query  911   APVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
               V S +      WD + +++ F+  D   IL +
Sbjct  461   LLVHSFIRRDTRDWDTNLLLEYFHPEDIPLILKL  494



>gb|AAM01179.2|AC113336_31 Putative retroelement [Oryza sativa Japonica Group]
Length=1888

 Score =   165 bits (418),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 111/344 (32%), Positives = 175/344 (51%), Gaps = 16/344 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             ++ ++ +G ++ + + R AP + H+LFADD  LF +A  +++  MK +L+ Y   +GQL+
Sbjct  1226  LEEKVDQGAMNPIHICRHAPAVLHLLFADDTPLFFKAANDQAVVMKEVLETYASCTGQLI  1285

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N  K   +F     +  QN    + ++    S     KYLG P+  G+  K     +++R
Sbjct  1286  NPSKCSIMFGQSSPTAVQN----QIKQTLQISNSFEDKYLGFPTPEGRMTKGKFQSLQER  1341

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +   +  W   FLS  G E+L+K VLQA+P Y M +F L  ++C E+  ++ +FWW  + 
Sbjct  1342  LWKRIMLWGEKFLSTGGKEILIKAVLQAMPVYVMGLFKLPESVCEELTKLVRNFWWGAEK  1401

Query  542   ARRLGIRWKAWKAL-CTKIKRWLGVYDLKGDEPGT---QTWRLLTRPDSLVERVFKSRYY  709
               R    WK+W  L   K+K  +G  D +         Q WRLL RPDSL  R+ K+ YY
Sbjct  1402  GMRR-THWKSWDCLIAQKLKGGMGFRDFRLFNQALLARQAWRLLDRPDSLCARILKAIYY  1460

Query  710   PNSDLMN-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL--VMAEDPYV  880
             PN  L++ + G N    WR+I      +K+     IG+ +S  + +D W+    +  P  
Sbjct  1461  PNGSLIDTSFGGNASPGWRAIEYGLELLKKGIIWRIGNGKSVRLWRDPWIPRSYSRRPIS  1520

Query  881   STHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
             +     + R   VS L++  G SWD D I   F   DA  ILNI
Sbjct  1521  AKR---NCRLRWVSDLIDQSG-SWDTDKISQHFLPMDAEAILNI  1560



>gb|AAG03119.1|AC004133_13 F5A9.24 [Arabidopsis thaliana]
Length=1254

 Score =   165 bits (417),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 118/362 (33%), Positives = 179/362 (49%), Gaps = 28/362 (8%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
              G L G+Q +   P + H+LFADD     +A+ E+S  ++ IL +Y  A+GQ +N +KS 
Sbjct  627   EGALEGIQFSENGPMVHHLLFADDSLFLCKASREQSLVLQKILKVYGNATGQTINLNKSS  686

Query  200   SVF*Y----QYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRIL  367
               F      Q +   + C    ++   GG+G     YLGLP     +K  +L ++KDR+ 
Sbjct  687   ITFGEKVDEQLKGTIRTCLGIFTE---GGAG----TYLGLPECFSGSKVDMLHYLKDRLK  739

Query  368   SWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVAR  547
               +  W T  LS+ G EVLLK+V  A+P +AM  F L IT C  +E  +  FWW      
Sbjct  740   EKLDVWFTRCLSQGGKEVLLKSVALAMPVFAMSCFKLPITTCENLESAMASFWWDSCDHS  799

Query  548   RLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPN  715
             R  I W++W+ LC  K    LG  D++         Q WRLL  PD L+ R+ KSRY+  
Sbjct  800   R-KIHWQSWERLCLPKDSGGLGFRDIQSFNQALLAKQAWRLLHFPDCLLSRLLKSRYFDA  858

Query  716   SDLMN-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAED-----PY  877
             +D ++ A+   P F WRSI+     + +  +  +GD  S  +  D W+   +D     P+
Sbjct  859   TDFLDAALSQRPSFGWRSILFGRELLSKGLQKRVGDGASLFVWIDPWI---DDNGFRAPW  915

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI-PVPPKVRVFAWKLA  1054
                 +++   +  V +L+N     WD + + D+F   D   I  I PV  +   F WKL 
Sbjct  916   RKNLIYDVTLK--VKALLNPRTGFWDEEVLHDLFLPEDILRIKAIKPVISQADFFVWKLN  973

Query  1055  MS  1060
              S
Sbjct  974   KS  975



>ref|XP_009123326.1| PREDICTED: uncharacterized protein LOC103848097 [Brassica rapa]
Length=1740

 Score =   165 bits (418),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 111/353 (31%), Positives = 165/353 (47%), Gaps = 35/353 (10%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I   +  G L G+Q     P I H+LFADDC L  +A+ +++  +  IL +Y  A+GQLV
Sbjct  1021  IHKAVENGSLQGIQFCEEGPMIHHLLFADDCLLISKASPDQARKLMEILKIYERATGQLV  1080

Query  182   NYDKSLSVF*YQYRSG*Q-NCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             N  KS   F  + +   +    +     + GGSG     YLGLP     +K  IL ++ D
Sbjct  1081  NVSKSAITFGAKLKENLKVAIKEITGIEKEGGSGS----YLGLPECFSGSKTKILAYIYD  1136

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             R+   + GW    LS  G E+L+K V  A+  YAM  F L+   C  +   +  FWW   
Sbjct  1137  RLKGRLSGWFLKLLSLGGKEILIKAVAMAMLVYAMSCFKLTKIFCENLTKAMADFWWNSL  1196

Query  539   VARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRY  706
               +R  + W +W  LC  K +  LG  D++         Q WR+L  PDSL  +VFKSRY
Sbjct  1197  EHKR-KLHWLSWSKLCLAKDQGGLGFKDIQSFNQALLAKQAWRILAFPDSLFAKVFKSRY  1255

Query  707   YPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             + NSD+++A +G  P + WRSI      + Q  R  +G+  +  +  D W          
Sbjct  1256  FENSDVVSAKIGSRPSYAWRSIQFGKELLVQGLRKQVGNGETIFVWVDRW----------  1305

Query  884   THLHESVREAP------------VSSLMNGVGTSWDRDCIIDVFNARDANCIL  1006
               +   VR AP            VS L++     W+ + + ++F   D   IL
Sbjct  1306  --IEGDVRRAPLMKNIFVDLLLKVSDLIDHQNNCWNLEKLRELFYEEDIERIL  1356



>ref|XP_010495286.1| PREDICTED: uncharacterized protein LOC104772356 [Camelina sativa]
Length=1158

 Score =   164 bits (416),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 119/347 (34%), Positives = 172/347 (50%), Gaps = 16/347 (5%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             + G L G+++    P I H+LFADD     RA+  E +N+   L LY  ASGQ +N  KS
Sbjct  448   QEGRLTGLKLTPECPSIQHLLFADDSLFLCRASLLECSNLLQCLRLYGDASGQEINLQKS  507

Query  197   LSVF*YQYRSG*QNCSD*RSQ-RQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
                F  +     +      +   Q GG+    GKYLGLP     +KK +L ++ DR+ S 
Sbjct  508   SITFGKKLDPYMRRVIGLFTGIEQEGGA----GKYLGLPECFSGSKKDMLAYITDRLTSR  563

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             +RGW    LS  G EVLLK V  ALP YAM  F LS   C++I   + +FWW   V  + 
Sbjct  564   LRGWFEKTLSLGGKEVLLKAVALALPVYAMSCFRLSKHQCKKITSAMANFWWNA-VEEKQ  622

Query  554   GIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
              + W +W+ +C +K +  LG  D+          Q WRLL  P SL+ RV+K+RY+P+  
Sbjct  623   KMHWVSWEKMCKSKDQGGLGFRDIGRFNQALLAKQAWRLLDAPSSLLARVYKARYFPSIS  682

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
              M A +G  P + WRSI+     +++    SIGD   T +  D W V  E P    +  +
Sbjct  683   FMEANLGPRPSYAWRSILFGRELLEKGLMKSIGDGLDTNVWLDKW-VFDELPRRPCNKEQ  741

Query  899   SVR-EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVRV  1036
              +     VS L+   G  W+   + ++F   D   I +   PP  R+
Sbjct  742   MINLNLRVSELITNQG-DWNLQALQELFPPCDVIKIRSF--PPDTRL  785



>ref|XP_010474031.1| PREDICTED: uncharacterized protein LOC104753480 [Camelina sativa]
Length=1402

 Score =   165 bits (417),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 148/291 (51%), Gaps = 11/291 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             ++ R  +G L G       P I H+LFADD  L  RA  EE   +   L LY  ASGQ +
Sbjct  725   MERRKTQGRLTGFSFNEVCPSIQHLLFADDSLLICRATKEECEEVLNCLHLYGKASGQKI  784

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDT-TGKYLGLPSLVGKNKKAILGFVKD  358
             N++KS   F     S   +      ++  G S +  TG YLGLP     +K+A+L F+ D
Sbjct  785   NFEKSAITF----GSKTPDTVKVLIKQTLGISAEGGTGSYLGLPECFSGSKQALLAFIGD  840

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             ++   ++GW++  LS  G E+LLK++  ALP YAM  F LS  LCR+I   +  +WW+  
Sbjct  841   KLKKRLQGWHSKSLSLGGKEILLKSIAMALPVYAMSCFRLSKHLCRKITSSMCEYWWSN-  899

Query  539   VARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRY  706
                +  I W AW  LC  K +  LG  DL          Q W+++  P+S V R +KSRY
Sbjct  900   CQGKTKIAWVAWSKLCKPKSEGGLGFKDLADFNQALLAKQAWQIMNNPESFVSRFYKSRY  959

Query  707   YPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL  856
             +  S ++       P + WRSI+   N +KQ     IG+ R T +  + WL
Sbjct  960   FRKSSILECGTRSRPSYAWRSIIHGRNLLKQGLMKIIGNGRDTYVWTEKWL  1010



>ref|XP_009108660.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=655

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/289 (35%), Positives = 154/289 (53%), Gaps = 13/289 (4%)
 Frame = +2

Query  17   RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
              G + G++VARG+P I+H+LFADD   FL+A+ E +  +K IL  Y  ASGQL+N +KS
Sbjct  90   EEGRIQGIRVARGSPRINHLLFADDTMFFLKADKEAAITLKAILKRYEEASGQLINAEKS  149

Query  197  LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
               F  +  +  +      S+ Q    G   GKYLGLP L G+ K+ +   + D I    
Sbjct  150  SITFSRKAPAALKQMI--HSELQILKEGGV-GKYLGLPELFGRKKRDLFSSIVDCIKQKA  206

Query  377  RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
             GW+  +LS AG  V+L++VL  +PSY+M  F L I+LC  I+  L  FWW  +  +R  
Sbjct  207  SGWSNRYLSSAGKMVMLQSVLSPIPSYSMTCFKLPISLCNRIQSALKRFWWDDRTGKR-K  265

Query  557  IRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDL  724
            + W AW+ +  +K    LG+ D++          +WRLL  PD L+ R+  S+Y P+ DL
Sbjct  266  MAWIAWEKMTLSKCNGGLGIRDVQTFNDAYLAKISWRLLENPDCLLGRILLSKYCPDGDL  325

Query  725  MNAVGHNPLFI---WRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVM  862
            +      P+     W SI+   + + +     +GD  S +I  + WL +
Sbjct  326  LKC--SQPISASHGWHSILVGIDLLIKNLGWVVGDGASISIWNEPWLSL  372



>ref|XP_009139326.1| PREDICTED: uncharacterized protein LOC103863321 [Brassica rapa]
Length=971

 Score =   164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 108/326 (33%), Positives = 165/326 (51%), Gaps = 12/326 (4%)
 Frame = +2

Query  20   RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             G + G+++ +  P I H+LFADD     +A  +E +N    LDLY  ASGQ +N+ KS 
Sbjct  298  EGNITGMRLTKHCPSIQHLLFADDSLFLCKATLKECSNFLHCLDLYGKASGQEINFHKSS  357

Query  200  SVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
              F        +       + +  GS    G YLGLP     +K+ +L F+ +++   + 
Sbjct  358  ITFGAAIDPVMKRVISELLEIENEGSA---GSYLGLPECFSGSKQKLLAFISEKLGKRLS  414

Query  380  GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
            GW    LS  G EVLLK++  ALP YAM  F L+   C++I   +  FWW     +R  I
Sbjct  415  GWYAKTLSLWGKEVLLKSIAMALPVYAMSCFRLTKHHCQKIMSAMAAFWWNESSDKR-KI  473

Query  560  RWKAWKALCTKIKR-WLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLM  727
             W +W  LCT  K   LG  D++         Q W+LL  PDSL+ RV+K RYY N D +
Sbjct  474  HWVSWPKLCTSKKSGGLGFRDIEDFNQALLAKQAWKLLNEPDSLLARVYKGRYYANKDFL  533

Query  728  NA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESV  904
                G+ P + WRSI+     + +    SIG+ RST++  + W +M   P    H     
Sbjct  534  ECGKGYRPSYAWRSILFGRELLVKGLIKSIGNGRSTSVWSENW-IMDSTPRRPVHRQLLF  592

Query  905  REA-PVSSLMNGVGTSWDRDCIIDVF  979
              +  VS L++ +G +W+ + ++++F
Sbjct  593  DVSLKVSELIDNLG-NWNIERLVELF  617



>dbj|BAM28751.1| reverse transcriptase-like protein, partial [Camellia sinensis 
var. sinensis]
Length=255

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/248 (38%), Positives = 133/248 (54%), Gaps = 6/248 (2%)
 Frame = +2

Query  302   GLPSLVGKNKKAILGFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLS  481
             GLP  VG +K+A+LGFVK+R+ S + GW    LS AG EVL+K+V QA+P+Y M  F L 
Sbjct  1     GLPYCVGHSKRAVLGFVKERVWSRLNGWKEKSLSVAGREVLIKSVAQAIPTYIMSCFRLP  60

Query  482   ITLCREIEVILNHFWWTGKVARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQT  649
               +C EIE ++ +FWW  K   R  I W +WK LC +K++  +G   L+         Q 
Sbjct  61    DGVCXEIESMVCNFWWGQKEETR-KIHWTSWKQLCKSKLRGGMGFRCLQHFNSALLAKQC  119

Query  650   WRLLTRPDSLVERVFKSRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDER  826
             WRL  RP SLV RVFK+RY+P +  ++A VG NP F WRSIV     +    R  +G+  
Sbjct  120   WRLXQRPQSLVARVFKARYFPQTSFLDALVGSNPSFTWRSIVGSRRLLNAGLRWRVGNGA  179

Query  827   STTIGKDMWLVMAEDPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCIL  1006
             S ++  D W+       V         +A VS L++    +W  + +   F   D   I 
Sbjct  180   SISVKYDKWVPRPHSFKVILPPSTLSDDARVSDLIDSEKGAWYDEMLTQNFLGMDVEAIR  239

Query  1007  NIPVPPKV  1030
              IP+ P +
Sbjct  240   CIPICPTL  247



>ref|XP_009142123.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=774

 Score =   162 bits (410),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 162/321 (50%), Gaps = 13/321 (4%)
 Frame = +2

Query  17   RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
              G+L G+++ARG P I+H+LFADD   F+ AN      +K IL  Y  ASGQ +N +KS
Sbjct  90   EEGLLQGIKIARGCPRINHLLFADDTMFFVNANERNCKALKTILQTYEEASGQCINAEKS  149

Query  197  LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
               F     +  +       Q Q  G     GKYLGLP L G+ K+ +   + DRI    
Sbjct  150  AITFSKHTPADLKTLIKTSLQIQKEGG---VGKYLGLPELFGRKKRDLFSSIVDRIKQKA  206

Query  377  RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW-TGKVARRL  553
            RGW+T  LS AG  V+L++VL  +  Y+M  F L ++LC+ I+ +L  FWW   + A+++
Sbjct  207  RGWSTKLLSSAGKMVMLQSVLSPISLYSMTCFKLPVSLCKRIQTVLMRFWWDNNENAKKM  266

Query  554  GIRWKAWKALCTKIKRW--LGVYDLKGDEPGTQT---WRLLTRPDSLVERVFKSRYYPNS  718
               W AW  + TK K    LG+ D +           WRLL  P+ L+ ++ K +Y+ + 
Sbjct  267  A--WVAWDKI-TKPKSAGGLGMRDCQSFNDALLAKIGWRLLNNPNCLLGKLLKGKYFDDC  323

Query  719  DLMNAVGHNPL-FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLH  895
             ++ A   + +   WRS++   + + +    ++GD  S  I +D WL + +         
Sbjct  324  SILQATEASVMSHGWRSVLIGRDLLLKNLGWTVGDGSSINIWQDPWLCLTKQERPMGPSS  383

Query  896  ESVREAPVSSLMNGVGTSWDR  958
            E   +  V+ L+   G  WDR
Sbjct  384  EQSVDLCVADLLVDGGKHWDR  404



>pir||T00833 RNA-directed DNA polymerase homolog T13L16.7 - Arabidopsis thaliana 
(fragment)
Length=1365

 Score =   164 bits (416),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 111/347 (32%), Positives = 168/347 (48%), Gaps = 10/347 (3%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G + G+Q       ++H+LFADD  L  +A  +E   +   L  Y   SGQ++N +KS  
Sbjct  661   GKITGIQFQDKKVSVNHLLFADDTLLMCKATKQECEELMQCLSQYGQLSGQMINLNKSAI  720

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRG  382
              F        ++    RS     G    TGKYLGLP  +  +K+ + GF+K+++ S + G
Sbjct  721   TFGKNVDIQIKDWIKSRSGISLEGG---TGKYLGLPECLSGSKRDLFGFIKEKLQSRLTG  777

Query  383   WNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIR  562
             W    LS+ G EVLLK++  ALP Y M  F L   LC+++  ++  FWW     +R  I 
Sbjct  778   WYAKTLSQGGKEVLLKSIALALPVYVMSCFKLPKNLCQKLTTVMMDFWWNSMQQKR-KIH  836

Query  563   WKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
             W +W+ L   K +   G  DL+         Q WR+L    SL  RVF+SRY+ NSD ++
Sbjct  837   WLSWQRLTLPKDQGGFGFKDLQCFNQALLAKQAWRVLQEKGSLFSRVFQSRYFSNSDFLS  896

Query  731   AV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVR  907
             A  G  P + WRSI+     + Q  R  IG+ + T +  D WL    +            
Sbjct  897   ATRGSRPSYAWRSILFGRELLMQGLRTVIGNGQKTFVWTDKWLHDGSNRRPLNRRRFINV  956

Query  908   EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI-PVPPKVRVFAW  1045
             +  VS L++    +W+ + + D+F  +D   IL   P+  K   F W
Sbjct  957   DLKVSQLIDPTSRNWNLNMLRDLFPWKDVEIILKQRPLFFKEDSFCW  1003



>ref|XP_008387184.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=887

 Score =   163 bits (412),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 173/350 (49%), Gaps = 23/350 (7%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             +  R   G LHG++V      ISH+ FADD  +F +A   E   +  +L+ Y  ASGQ++
Sbjct  242   LRKREEHGSLHGIRVTPEGMQISHLFFADDAVIFCKATEVEVREILEVLNCYAEASGQII  301

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGS------GDTTGKYLGLPSLVGKNKKAIL  343
             N  K    F  Q       C   R QR+   S       +T G+YLGL +  G +KK + 
Sbjct  302   NRAKCSLYFGNQ-------CP--RKQRRLIESCTNFVGNETFGRYLGLSADFGASKKVVF  352

Query  344   GFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHF  523
               V++ +   + GW   FLS AG EV++K V  ALP+YAM  F L + LC+E+E  + +F
Sbjct  353   EGVREALEGRINGWAEQFLSPAGKEVMIKTVAMALPNYAMSCFKLPVNLCKEMETNIANF  412

Query  524   WWTGKVARRLGIRWKAWKALCTKIK-RWLGVYDLKGDEPGTQT---WRLLTRPDSLVERV  691
             WW G   +  G+ W +W+ +  + K   LG  D+        T   WR+LT P SL+ ++
Sbjct  413   WWRGSREKN-GMHWISWEKMKRRKKVGGLGFRDILSFNLAYLTKIGWRILTNPLSLLGKI  471

Query  692   FKSRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAE  868
              K +Y+P    M A VG    + W+ I++    +++  R  +GD  S  +  D WL    
Sbjct  472   LKEKYFPECSFMEAKVGKRSSWGWKGIMQGKRILERGRRWRVGDGSSIRVKIDPWLPRPH  531

Query  869   DPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                V+++ H  +    V  L++ V  SW  + +   F   ++N IL IP 
Sbjct  532   TFRVNSN-HPDM-PVMVKDLIDPVTGSWMVELVKGCFEEEESNIILGIPT  579



>gb|AAF97969.1|AC000103_19 F21J9.30 [Arabidopsis thaliana]
Length=1270

 Score =   164 bits (415),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 118/362 (33%), Positives = 179/362 (49%), Gaps = 28/362 (8%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
              G L G+Q +   P + H+LFADD     +A+ E+S  ++ IL +Y  A+GQ +N +KS 
Sbjct  624   EGALEGIQFSENGPMVHHLLFADDSLFLCKASREQSLVLQKILKVYGNATGQTINLNKSS  683

Query  200   SVF*Y----QYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRIL  367
               F      Q +   + C    ++   GG+G     YLGLP     +K  +L ++KDR+ 
Sbjct  684   ITFGEKVDEQLKGTIRTCLGIFTE---GGAG----TYLGLPECFSGSKVDMLHYLKDRLK  736

Query  368   SWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVAR  547
               +  W T  LS+ G EVLLK+V  A+P +AM  F L IT C  +E  +  FWW      
Sbjct  737   EKLDVWFTRCLSQGGKEVLLKSVALAMPVFAMSCFKLPITTCENLESAMASFWWDSCDHS  796

Query  548   RLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPN  715
             R  I W++W+ LC  K    LG  D++         Q WRLL  PD L+ R+ KSRY+  
Sbjct  797   R-KIHWQSWERLCLPKDSGGLGFRDIQSFNQALLAKQAWRLLHFPDCLLSRLLKSRYFDA  855

Query  716   SDLMN-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAED-----PY  877
             +D ++ A+   P F WRSI+     + +  +  +GD  S  +  D W+   +D     P+
Sbjct  856   TDFLDAALSQRPSFGWRSILFGRELLSKGLQKRVGDGASLFVWIDPWI---DDNGFRAPW  912

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI-PVPPKVRVFAWKLA  1054
                 +++   +  V +L+N     WD + + D+F   D   I  I PV  +   F WKL 
Sbjct  913   RKNLIYDVTLK--VKALLNPRTGFWDEEVLHDLFLPEDILRIKAIKPVISQADFFVWKLN  970

Query  1055  MS  1060
              S
Sbjct  971   KS  972



>ref|XP_009116203.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=820

 Score =   162 bits (411),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 107/343 (31%), Positives = 169/343 (49%), Gaps = 19/343 (6%)
 Frame = +2

Query  5     DNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVN  184
             DNR++     G++++   P + H+LFADD  L   AN  E+  +   L  Y  ASGQ++N
Sbjct  106   DNRIK-----GIKLSSSGPSVHHLLFADDSLLLCHANISEATEIMACLKAYEEASGQIIN  160

Query  185   YDKSLSVF*YQYRSG*Q-NCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
               KS  +F  +  +  +    +     Q GG G     YLGLP     +K  +L F+K++
Sbjct  161   LQKSSVIFGSKVPADLKLEIKEVLGIDQEGGEGS----YLGLPECFSGSKIKLLSFIKEK  216

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +   ++GW    LS+ G EVLLK+V  ALP YAM  F L   +C ++   +  FWW+   
Sbjct  217   LQGRLQGWFAKSLSQGGKEVLLKSVALALPIYAMSCFKLPKDVCSKLTSAMIEFWWSSGT  276

Query  542   ARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYY  709
              R+  I W AWK +C  K    LG  D++         Q WR+ + P SLV R+ + RY+
Sbjct  277   NRK-KIPWVAWKKMCKAKELGGLGFRDIEKFNQSLLSKQAWRIWSNPSSLVARILEQRYF  335

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
               S  M   VG  P + WRSI+     + Q     IGD  ++ +  + WL +++ P    
Sbjct  336   ARSSFMECGVGTRPSYAWRSILHGRELLSQGLLQKIGDGTTSRVWTENWL-LSDTPRPPR  394

Query  887   HLHESVRE--APVSSLMNGVGTSWDRDCIIDVFNARDANCILN  1009
             +  +++ +    V+ L++     WD   I D+ +  D   +LN
Sbjct  395   YRQDAIVDLTLTVNDLIDVQRGGWDIQRIRDIVHEEDVELVLN  437



>ref|XP_009140393.1| PREDICTED: uncharacterized protein LOC103864388 [Brassica rapa]
Length=1377

 Score =   164 bits (415),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 181/360 (50%), Gaps = 16/360 (4%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             + G+L G+++A   P + H+LFADD F   RA+  E       L LY  +SGQ++N+ KS
Sbjct  668   QEGVLTGMKLAPSCPAVQHLLFADDSFFLCRASLAECTEFLRRLKLYGDSSGQMINFQKS  727

Query  197   LSVF*YQYRSG*QNC-SD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
                F        +   ++  +  + GG     GKYLGLP     +K+ +L F+ +++   
Sbjct  728   AITFGAGIDPIMRRVLAELLNIEKEGGD----GKYLGLPECFSGSKQQLLAFIGEKMSKR  783

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             ++GW    LS  G EVLLK++  ALP YAM  F L+  LC++I   +  FWW     ++ 
Sbjct  784   LKGWFAKKLSFGGKEVLLKSIAMALPVYAMSCFRLTKHLCQKIMSAMASFWWDENDEKK-  842

Query  554   GIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
              I W +WK LC +K    LG  D++         Q WRLL  P SL+ R++K RY+ +SD
Sbjct  843   KIHWISWKKLCISKENGGLGFRDIEDFNQALLAKQAWRLLNDPTSLIARIYKGRYFASSD  902

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
              MN+  G+ P + WRSI+     + +    SIG+  ST +    W ++ E P    +   
Sbjct  903   FMNSGKGYRPSYAWRSILFGRELLNKGLMKSIGNGNSTFVWSHNW-ILDETPRRPINKQP  961

Query  899   SVR-EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP--PKVRVFAWKLAMSYSL  1069
              +     VSSL+   G  WD + +   F   +   I  +PV   P   ++A+    SY++
Sbjct  962   EIDINLRVSSLIGDDG-QWDVNKLQCRFPQNEVTRIRQLPVGDVPDRDIWAYSPNGSYTV  1020



>ref|XP_010476358.1| PREDICTED: uncharacterized protein LOC104755638 [Camelina sativa]
Length=1553

 Score =   164 bits (415),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 108/356 (30%), Positives = 172/356 (48%), Gaps = 43/356 (12%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R  ++ G++VA   PPI+H+LFADD   F +A+ E+   +  IL  Y   SGQ +N+ KS
Sbjct  762   RDKLITGIKVANKCPPITHLLFADDSLFFCKADREQCRAILDILKQYELVSGQQINFSKS  821

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRI  364
                F ++     +N          G  G  T    G YLGLP  +G  K  I  FV++RI
Sbjct  822   SVQFGHKIDDQTKN-------ELQGVLGIMTLGGMGSYLGLPESLGGAKTKIFSFVRERI  874

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
              S   GW    LS+ G EV++K+V   +P++ M  F L  T+  ++   + +FWW+    
Sbjct  875   QSRTNGWTANLLSKGGREVMIKSVATVVPTFVMSCFRLPKTITSKLTSAVANFWWSTN-G  933

Query  545   RRLGIRWKAWKALCTKIKRWLG------VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRY  706
             +  G+ W AW+ LC  + + LG      V D        Q WRL+  P+SL  RVFKSRY
Sbjct  934   QSGGMHWLAWEKLC--VSKQLGGLGFRNVDDFNSALLAKQLWRLIDAPESLFARVFKSRY  991

Query  707   YPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV--------  859
             Y N++ ++ +  ++P + WRSI    + V +     +G   + +I  D W+         
Sbjct  992   YRNTNPLDPIRSYSPSYGWRSICSARSLVNKGLIKRVGSGDTISIWSDPWVPAQFPRPAV  1051

Query  860   ---MAEDPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                + +DPY+            ++ L++    +W  D + + F+  D   I  IP+
Sbjct  1052  SKGLVKDPYLQ-----------MNHLIDRHTNTWRMDMLNEHFDPLDVALIRAIPL  1096



>ref|XP_009115748.1| PREDICTED: uncharacterized protein LOC103840987 [Brassica rapa]
Length=820

 Score =   162 bits (410),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 104/334 (31%), Positives = 167/334 (50%), Gaps = 13/334 (4%)
 Frame = +2

Query  35    GVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*Y  214
             G++VAR +P ISH+LFADD   F +A   +   +  ILD Y  ASGQ +N  KS  +F  
Sbjct  149   GLRVARASPRISHLLFADDSLFFCKAEVRQCKEILDILDSYGKASGQQLNATKSSIIFGN  208

Query  215   QYRSG*-QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT  391
             +      QN          GG     GKYLGLP  +  +K  +  +V+DR+   V  W+ 
Sbjct  209   KVDQNIKQNIKAVLGITTEGG----MGKYLGLPEQICGSKMKVFSYVQDRLNGCVTSWSA  264

Query  392   *FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKA  571
               LS+ G EV +K+V QA+P+Y M  + L   +  +++  +++FWW+     R G+ W A
Sbjct  265   RLLSKGGKEVQIKSVAQAVPTYNMSCYLLPQGIVEKLKSAISNFWWSSSQNNR-GLHWIA  323

Query  572   WKALCTKIKR----WLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYP-NSDLMNAV  736
             W  +C    +    +L ++D        Q WRL+  P SL+ RV + RYY  +S L +  
Sbjct  324   WDKICVPHDQGGLGFLDLHDFNIALLAKQLWRLIQFPKSLLARVLRGRYYNRSSPLEDRK  383

Query  737   GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL--VMAEDPYVSTHLHESVRE  910
              ++P + WRSI+     +K   R +IG  ++T +  + W+  + A  P  S  +     +
Sbjct  384   VYSPSYGWRSIMAAKPLLKSGLRKTIGAGQNTCVWSEPWIPDIEARPPRPSNQITHRHPK  443

Query  911   APVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
               V S +      WD + +++ F+  D   IL +
Sbjct  444   LLVHSFIRRDTRDWDTNLLLEYFHPEDIPLILKL  477



>ref|XP_010430691.1| PREDICTED: uncharacterized protein LOC104714925 [Camelina sativa]
Length=1239

 Score =   164 bits (414),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 111/361 (31%), Positives = 174/361 (48%), Gaps = 33/361 (9%)
 Frame = +2

Query  26    MLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSV  205
             ++ G++VA   PPI+H+LFADD   F +   ++   +  IL  Y   SGQ +N+ KS   
Sbjct  549   LITGIKVANQCPPITHLLFADDSLFFCKVAKDQCEVILKILRNYEAVSGQQINFAKSSVQ  608

Query  206   F*YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRILSW  373
             F ++        ++       G  G TT    G YLGLP  +G +K  +  FV++R+   
Sbjct  609   FGHK-------VAEQTKMEIQGILGITTQGGMGSYLGLPESLGGSKTKVFSFVRERLQGR  661

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
               GW+   LS+ G EV++K++  A+P++ M  F L  T+  ++   + +FWW+    R  
Sbjct  662   TTGWSAKLLSKGGKEVMVKSIATAVPTFVMSCFRLPKTITSKLTSAVANFWWSSD-GRTG  720

Query  554   GIRWKAWKAL-CTKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSD  721
             G+ W AW  L CTK    LG   V D        Q WRL+  PDSL  RVFK RYY NS+
Sbjct  721   GMHWLAWDKLCCTKQMGGLGFRNVDDFNSALLAKQLWRLIEFPDSLFARVFKGRYYRNSN  780

Query  722   LMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV-------MAEDPY  877
              M  +  ++P + WRSIV   + V++     +G   S +I  D W++       +++ P+
Sbjct  781   PMEPIRSYSPSYGWRSIVSACSLVQKGLIIRVGSGESISIWTDPWILAQFPRPAISKGPF  840

Query  878   VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVP--PKVRVFAWKL  1051
                 L        +S L++     W  D + + F+  D   I  +P+   PK     W  
Sbjct  841   KDPSLK-------ISHLIDCRTRLWRMDVLSEHFDPVDVELIGALPLGSCPKDDTLGWHF  893

Query  1052  A  1054
              
Sbjct  894   T  894



>gb|EPS73861.1| hypothetical protein M569_00896, partial [Genlisea aurea]
Length=1651

 Score =   164 bits (415),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 102/333 (31%), Positives = 169/333 (51%), Gaps = 10/333 (3%)
 Frame = +2

Query  35    GVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*Y  214
             G+Q+   AP ISH+LFADD  +++RA  E    ++ IL  Y  ASGQ +N DKSL +   
Sbjct  978   GIQINPLAPKISHLLFADDTVIYIRATLEALQRIRAILTAYAMASGQQINLDKSLLIL--  1035

Query  215   QYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT*  394
               R G +N     ++          G+YLGLPS +GK+++AI   +++++ + +  W++ 
Sbjct  1036  -SRGGDENHRHLLAESVGIPLASDLGRYLGLPSAIGKSRRAIFQSIQEKVEAKIMHWSSR  1094

Query  395   FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKAW  574
              LS+AG  VL+K VLQ +P Y M  F L  +   ++   +  FWW+G  ++++   W   
Sbjct  1095  MLSQAGRSVLIKAVLQVIPVYTMSCFLLPKSFLHKLMAAITRFWWSGSGSKKM--HWLPR  1152

Query  575   KALCTKIKR-WLGVYDL---KGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSD-LMNAVG  739
             + L   +    L   DL          Q+WRLL+ P+S+  R+ K++YYP+S  LM  +G
Sbjct  1153  EELTVNLAAGGLSFRDLLLFNRAMVAKQSWRLLSHPNSICSRLIKAKYYPHSSFLMAPLG  1212

Query  740   HNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREAPV  919
              +P ++WR I      +    R  IG+  S    KD W+        ++   + V    V
Sbjct  1213  RSPSYVWRGIHSSREVLLGGLRWRIGNGLSVDAWKDPWIPNTFAFKPTSAAPQGVGSILV  1272

Query  920   SSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                +    + W+   +  +F+  D   IL+IP+
Sbjct  1273  KDFILSNHSGWNHTRLRQIFSPLDVKHILSIPL  1305



>ref|XP_009126341.1| PREDICTED: uncharacterized protein LOC103851249 [Brassica rapa]
Length=1160

 Score =   163 bits (413),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 164/344 (48%), Gaps = 24/344 (7%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             RG L G+Q     P + H+ FADD     +A   +    + IL  Y  A+GQ++N  KS 
Sbjct  499   RGDLKGIQFNLAGPEVHHLFFADDSLFLFKAELSQCQVFQDILLKYGEATGQVINLSKSS  558

Query  200   SVF*YQYRSG*QNCSD*RSQRQAG---GSGDTTGKYLGLPSLVGKNKKAILGFVKDRILS  370
               F      G   C   ++Q ++     S    G YLGLP     +K  +L +++D++  
Sbjct  559   LTF------GKNTCPSLKAQIKSKLGICSEGGAGSYLGLPECFSGSKVEMLAYIQDKMKG  612

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
              + GW + FLS+AG EV+LK+V  A+P YAM  F L  T C  ++  +  FWW     + 
Sbjct  613   RMSGWYSRFLSQAGKEVILKSVAMAMPIYAMTCFKLPKTTCNNLKSAMAAFWWQASEDKS  672

Query  551   LGIRWKAWKALCTKIKRWLGVYDLKGDE------PGTQTWRLLTRPDSLVERVFKSRYYP  712
               I W +W  LC  I + +G    K  E         Q WR+LT  DSL+ R  +SRY+ 
Sbjct  673   -KIHWLSWDKLC--ISKEMGGMGFKDIELFNQALLAKQAWRILTNQDSLLTRFLQSRYFS  729

Query  713   NSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAED---PYV  880
             N   ++A +G  P + WRSI+     +++  R S+G+  S ++    WL+  E    P +
Sbjct  730   NGSFLSATLGSRPSYAWRSILHGRELLEKGLRNSVGNGLSISVWSTPWLIDGERLRIPLM  789

Query  881   STHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
                L +      VS LM      WD   + ++F  +D   IL I
Sbjct  790   KNILVD--LNLKVSDLMIPNSDLWDHQKLENLFYDQDIEIILKI  831



>ref|XP_010507122.1| PREDICTED: uncharacterized protein LOC104783698 [Camelina sativa]
Length=1200

 Score =   163 bits (412),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 108/354 (31%), Positives = 169/354 (48%), Gaps = 29/354 (8%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I    R   + G++VA   PPI+H+LFADD   F +A   +   + GIL+ Y   SGQ +
Sbjct  621   IKRAEREKQITGIKVANKCPPITHLLFADDSLFFCKAEKAQCEVILGILNQYEAVSGQQI  680

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQA-------GGSGDTTGKYLGLPSLVGKNKKAI  340
             N+ KS   F      G +     RS+ Q        GG     G YLGLP  +G +K  +
Sbjct  681   NFAKSSVQF------GHKVDDTVRSEMQGVLGISNLGG----MGSYLGLPESLGGSKTKV  730

Query  341   LGFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNH  520
               FV+DR+     GW+   LS+ G EV++K+V  A+P++ M  F +   +  ++   + +
Sbjct  731   FSFVRDRLQGRTTGWSAKLLSKGGKEVMIKSVATAVPTFVMSCFRIPKIITSKLTSAVAN  790

Query  521   FWWTGKVARRLGIRWKAWKALCTKIKRWLGVYDLKGDEP------GTQTWRLLTRPDSLV  682
             FWW+    +  G+ W AW  LC    + LG    +  +         Q WRL+  PD+L 
Sbjct  791   FWWSTS-GQSGGLHWLAWDKLC--FSKQLGGLGFRNVDAFNTALLAKQLWRLIEAPDTLF  847

Query  683   ERVFKSRYYPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-  856
              RVFK RYY NS+ M+ +  ++P + WRSI    + V +     +    S +I  D W+ 
Sbjct  848   ARVFKGRYYRNSNPMDPLRSYSPSYGWRSITSARSLVNKGLIIRVSSGESISIWTDPWVP  907

Query  857   VMAEDPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
               +  P  S   H+      +S L++    +W  D + + F   D + I  IP+
Sbjct  908   AQSPRPAFSKGPHKDP-SLKISHLIDCHTNTWRMDRLKEFFAPEDVDLIGAIPL  960



>ref|XP_008351830.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=1106

 Score =   162 bits (410),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 167/349 (48%), Gaps = 25/349 (7%)
 Frame = +2

Query  14    MRRGM----LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             +R+G+    LHG +      PI+H+ FADD  +F  A  +E+  +   L +Y   SGQ V
Sbjct  378   LRKGLEQDALHGFKFTDTGTPITHLFFADDSVVFGNATVDEARAVAEALKVYACGSGQEV  437

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGS-----GDTTGKYLGLPSLVGKNKKAILG  346
             N  KS   F  +  +        R++R   G+         GKYLGL +  G +KKA+  
Sbjct  438   NLTKSSVFFSPKTPN--------RTKRDIEGTLGIQCKQGFGKYLGLQADFGHSKKAVFA  489

Query  347   FVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFW  526
              V+D++ + + GW   FLS+AG EVL+K+V  ALP+YAM  F L I +CR+IE  +  FW
Sbjct  490   EVRDKVEARLAGWTEQFLSQAGKEVLIKSVAMALPNYAMSCFKLPIGVCRDIEKAIRKFW  549

Query  527   WTGKVARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEPGTQT---WRLLTRPDSLVERVF  694
             W G   +R GI W +W  +   K+   LG  D++           WRL   P SL+  V 
Sbjct  550   WKGN-DQRHGIHWVSWDRISKRKMSGGLGFKDIQCFNLALLAKIGWRLTCYPTSLLATVL  608

Query  695   KSRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAED  871
             K +Y+P      A  G    + W+ I E    + Q  R  +G+ +   I  D W      
Sbjct  609   KDKYHPGCTFKEAGRGKLTSWGWKGIYEARKVLLQGIRWRVGNGQRINIRDDPWFPKPST  668

Query  872   PYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
               V    +E++    V  L+     SW  + I   F+  DA  IL+IP+
Sbjct  669   FRVCP--YENLDATMVCELIEPASNSWKDNRIFAGFHREDAETILSIPL  715



>ref|XP_009770639.1| PREDICTED: uncharacterized protein LOC104221303 [Nicotiana sylvestris]
Length=473

 Score =   158 bits (399),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/250 (35%), Positives = 134/250 (54%), Gaps = 5/250 (2%)
 Frame = +2

Query  284   TTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAM  463
             T+ KYLGLPS+VG+ KK I  +V D++   ++ W   +  RAG E+LLK V+QA+P+Y M
Sbjct  221   TSSKYLGLPSIVGRKKKDIFQYVLDKVWKKMQRWKQKYFFRAGKEILLKTVVQAIPNYVM  280

Query  464   MIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKAWKALCTKIKR----WLGVYDLKGD  631
             M+F +    C  IE  +N FWW GK     G+R  AWK LC + +     +  V D    
Sbjct  281   MLFLVPTRTCDSIEKAMNGFWWRGKGGDPRGMRCMAWKGLCKRKEDGGLVFREVQDFNLA  340

Query  632   EPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMN-AVGHNPLFIWRSIVEVNNAVKQWYRG  808
                   W LLTRP++LV R++K+RY+P  D ++  VG+NP ++WRS+      ++     
Sbjct  341   MLAKTAWSLLTRPEALVSRIYKARYFPTGDFLSVTVGNNPSYVWRSLCVGLQVLQGGCVR  400

Query  809   SIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNAR  988
              IGD R+  I    WL   +   + +  +  + E  VS L+     +W       +FNA+
Sbjct  401   RIGDGRTIKIFHTPWLPSDQLQVIQSVSNNGIEEMVVSELICEETRTWREVKPETIFNAQ  460

Query  989   DANCILNIPV  1018
             +   I  IP+
Sbjct  461   EIELIQKIPL  470



>ref|XP_010513760.1| PREDICTED: uncharacterized protein LOC104789816 [Camelina sativa]
Length=950

 Score =   162 bits (409),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 110/354 (31%), Positives = 170/354 (48%), Gaps = 22/354 (6%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G L+G+Q +   P I H+LFADD    ++A+ +++  ++GIL  Y   +GQL+N DKS  
Sbjct  256   GSLNGIQFSPVGPSIHHLLFADDSLFLIKASVDQALTLQGILVDYGKVTGQLINLDKSSI  315

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDT-TGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
              F  +   G +       Q + G   +   G YLGLP     +K  +L ++ D++ S + 
Sbjct  316   TFGSKVDLGVRAII----QEKLGIVKEGGAGVYLGLPECFSGSKADLLAYIHDKMKSRMS  371

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
             GW    LS+ G E+LLK+V  A+P +AM  F L    C ++   ++ FWW   V  +  +
Sbjct  372   GWFARSLSQGGKEILLKSVAMAMPVFAMSCFKLPKMTCEKLTSAMSAFWWDS-VEDKRKM  430

Query  560   RWKAWKALCTKIKRWLGVYDLKGDEP------GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
              W  W  LC  + + LG    K  +         Q WR+L   +SL    FKSRY+   D
Sbjct  431   HWLGWDKLC--LPKHLGGLGFKDIQIFNQALLAKQAWRILQEENSLFASFFKSRYFVEGD  488

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
              ++A +G  P + WRSI+   + +K+  R  IGD  ST +    WL+   D  +   L +
Sbjct  489   FLSAELGDRPSYAWRSILHGRDLLKRGLRQMIGDGESTYVWSSRWLL---DGVIRAPLMK  545

Query  899   SV---REAPVSSLMNGVGTSWDRDCIIDVFNARDANCIL-NIPVPPKVRVFAWK  1048
             ++    +  V  L+N    SWD   +   F  RD   I    PVP       W+
Sbjct  546   NIIFDLDLKVKELINPSTLSWDLSVLNHHFYPRDVELICKQKPVPLSKDFLIWE  599



>ref|XP_010445303.1| PREDICTED: uncharacterized protein LOC104727950 [Camelina sativa]
Length=867

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 111/351 (32%), Positives = 167/351 (48%), Gaps = 23/351 (7%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I    R   L G+ +A G+P +SH+LF DD   F +A  +E   +  I+  Y  ASGQ V
Sbjct  367   IKKAEREKKLTGITIACGSPTVSHLLFTDDSLFFCKATAQECRTVMDIIGTYGRASGQEV  426

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQ-------RQAGGSGDTTGKYLGLPSLVGKNKKAI  340
             N  KS  +F      G +   D RSQ        Q GG     G Y G+P  +  +K  +
Sbjct  427   NLAKSSIMF------GKKVTPDIRSQLKLVIGISQEGG----MGSYFGIPENLQGSKTKV  476

Query  341   LGFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNH  520
               +VKDR+   V GW+   LS+ G E+++K+V  ALP++ M  + L   L  ++   ++ 
Sbjct  477   FSYVKDRLDDRVNGWSAKCLSKGGKEIMIKSVALALPTHVMSCYKLPQELTSKLTSAIST  536

Query  521   FWWTGKVARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVER  688
             FWW      R G+ W AW  LC  K +  LG   L+         Q WRL+  P SL+ +
Sbjct  537   FWWKSNDKAR-GMHWVAWDKLCKDKAEGGLGFRALEQFNEAMLAKQFWRLIQYPTSLMAK  595

Query  689   VFKSRYYPNSD-LMNAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMA  865
             V KSRY+ N   LM    +NP F WRSI  +   V+Q  R ++G   S ++ +D W+   
Sbjct  596   VMKSRYFRNKHPLMAKKPYNPSFAWRSIYSIKGLVEQGARWAVGSGNSISVWRDPWIPDI  655

Query  866   EDPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                  +      +    V+ L+N    +W    + + F+  D   I ++PV
Sbjct  656   RPRPANGRGRLWLPSLMVNHLINPETKNWHLPTLEEFFDPGDIQLIQSMPV  706



>ref|XP_009150816.1| PREDICTED: uncharacterized protein LOC103874152 [Brassica rapa]
Length=1205

 Score =   162 bits (409),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 107/344 (31%), Positives = 163/344 (47%), Gaps = 24/344 (7%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             RG L G+Q     P + H+ FADD     +A   +    + I   Y  A+GQ++N  KS 
Sbjct  499   RGDLKGIQFNLAGPEVHHLFFADDSLFLFKAELSQCQVFQDIFLKYGEATGQVINLSKSS  558

Query  200   SVF*YQYRSG*QNCSD*RSQRQAG---GSGDTTGKYLGLPSLVGKNKKAILGFVKDRILS  370
               F      G   C   ++Q ++     S    G YLGLP     +K  +L +++D++  
Sbjct  559   LTF------GKNTCPSLKAQIKSKLGIYSEGGAGSYLGLPECFSGSKVEMLAYIQDKMKG  612

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
              + GW + FLS+AG EV+LK+V  A+P YAM  F L  T C  ++  +  FWW     + 
Sbjct  613   RMSGWYSRFLSQAGKEVILKSVAMAMPIYAMTCFKLPKTTCNNLKSAMAAFWWQASEDKS  672

Query  551   LGIRWKAWKALCTKIKRWLGVYDLKGDE------PGTQTWRLLTRPDSLVERVFKSRYYP  712
               I W +W  LC  I + +G    K  E         Q WR+LT  DSL+ R  +SRY+ 
Sbjct  673   -KIHWLSWDKLC--ISKEMGGMGFKDIELFNQALLAKQAWRILTNQDSLLTRFLQSRYFS  729

Query  713   NSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAED---PYV  880
             N   ++A +G  P + WRSI+     +++  R S+G+  S ++    WL+  E    P +
Sbjct  730   NGSFLSATLGSRPSYAWRSILHGRELLEKGLRNSVGNGLSISVWSTPWLIDGERLRIPLM  789

Query  881   STHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
                L +      VS LM      WD   + ++F  +D   IL I
Sbjct  790   KNILVD--LNLKVSDLMIPNSDLWDHQKLENLFYDQDIEIILKI  831



>ref|XP_007210987.1| hypothetical protein PRUPE_ppa021345mg [Prunus persica]
 gb|EMJ12186.1| hypothetical protein PRUPE_ppa021345mg [Prunus persica]
Length=759

 Score =   160 bits (404),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 114/347 (33%), Positives = 166/347 (48%), Gaps = 18/347 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I N     +L G+++  G P +SH+LFADD  +FL+A T+   N+  +L  Y  ASGQ V
Sbjct  49    IKNACETDLLQGIKLNSGGPTLSHLLFADDTLIFLKATTQNCQNISRLLQAYCAASGQQV  108

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTT--GKYLGLPSLVGKNKKAILGFVK  355
             +  KS  VF     S  +      S     G  D T  GKYLGLP+  G+ KK  L +VK
Sbjct  109   SLTKSNVVFSSNTPSYVR-----ASMCAILGMPDVTDAGKYLGLPTSWGRAKKEELVYVK  163

Query  356   DRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTG  535
             DRIL  V GWN   LS+AG E+L+K+V  A+P+Y M IF    TLC+EI+ +L  F W G
Sbjct  164   DRILRKVHGWNQHCLSQAGREILIKSVALAVPAYPMNIFKFPTTLCKEIDSVLAGF-WCG  222

Query  536   KVARRLGIRWKAWKALCTKIKRWLGVYDLKGDEP------GTQTWRLLTRPDSLVERVFK  697
             ++     + W  W  L        G  D +            Q WR+L  P SL  +V K
Sbjct  223   QIGDNRKLHWINWDTLGQPKHE--GGMDFRNLHKFNLALLAKQCWRILMEPQSLWVKVLK  280

Query  698   SRYYPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDP  874
              RY+PN   + A       + W S++E  + + +     + +     +  D WL  + + 
Sbjct  281   GRYFPNVSFLEAKRSGRTSWAWASLLEGRDILLRGAHWQVMNGAHIRLWIDRWLPNSLND  340

Query  875   YVSTHLHESV-REAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
                 H  E++ R   V +++N     W+ D I    +  DA  I  +
Sbjct  341   CPRLHSTETLDRNLRVEAIINRELDEWNLDPIRHAISDSDARAITRV  387



>gb|EEC81552.1| hypothetical protein OsI_24974 [Oryza sativa Indica Group]
Length=1015

 Score =   161 bits (408),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 118/343 (34%), Positives = 174/343 (51%), Gaps = 13/343 (4%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             ++ R+  G +  V++ RGAP ISH+LFADD  LF +A+ E++  +KG+L+ Y   +GQLV
Sbjct  488   MEERVAAGDITPVKICRGAPGISHLLFADDTLLFFKADCEQARLIKGVLNEYALGTGQLV  547

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N +K   +F     +  Q+      Q       D   KYLG P+  G+  K     ++++
Sbjct  548   NSNKCSILFDDTSPAETQDAIKNLLQIVCHNFED---KYLGFPTPEGRLNKGKFQSLQEK  604

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +   +  W   +LS  G E++LK V+QA+P Y M IF L  ++C ++  +  +FWW    
Sbjct  605   MWKRIILWGENYLSSGGKEIMLKAVIQAIPVYVMSIFRLPESVCEDLNKLARNFWWGADK  664

Query  542   ARRLGIRWKAWKALCTKIKR--WLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRY  706
              +R    W+AW  L TK K    LG  D +         Q WRLL +PDSL  RV K++Y
Sbjct  665   GKR-KTHWQAWSCL-TKPKHNGGLGFRDFRLFNQALLARQAWRLLDKPDSLCARVMKAKY  722

Query  707   YPNSDLMN-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             YPN  L++ A G N    WR+I      +K+     IG+ RS  I +D W+         
Sbjct  723   YPNGSLVDTAFGGNASPGWRAIEHGLALLKKGIVWRIGNGRSVRIWRDPWIPRDHSRRPI  782

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
             T    + R   VS L+ G   SWD   +  VF   DA+ IL I
Sbjct  783   T-TKRNCRVKWVSDLL-GQDGSWDVQNVSRVFLPIDADEILKI  823



>ref|XP_010468497.1| PREDICTED: uncharacterized protein LOC104748579 [Camelina sativa]
Length=1041

 Score =   161 bits (408),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 110/357 (31%), Positives = 176/357 (49%), Gaps = 20/357 (6%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G L G++ +   P   H+LFADD     +A+ E+ + ++  L  Y  A+GQ++N +KS  
Sbjct  345   GRLQGIKFSEEGPETHHLLFADDSLFMCKASVEQCSFLQESLGRYGAATGQVINLNKSSI  404

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRG  382
              F  +     +  +D ++       G   G YLG+P     +K   LG++KDR+ + + G
Sbjct  405   TFGSKVNPLLK--TDIQALMGISREGGA-GTYLGMPESFSGSKVEFLGYIKDRVKANLTG  461

Query  383   WNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIR  562
             W + FLS+ G EVLLK+V  A+P + M  F LS T+C  +   +  FWW+     + GI 
Sbjct  462   WYSRFLSQGGKEVLLKSVAMAMPVFVMSCFKLSKTICANLSSAMADFWWSNAEHTK-GIH  520

Query  563   WKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
             W +W+ LC  K +  +G  D+          Q WR+L  PDSL  +V KSRY+P +D ++
Sbjct  521   WLSWEKLCLPKEQGGMGFRDISTFNQALLAKQAWRILQFPDSLFAQVMKSRYFPENDFLS  580

Query  731   A-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAED-----PYVSTHL  892
             A +G  P + WRSI+     + Q     +G+ +S  +  D W+   ED     P+   + 
Sbjct  581   ANLGPRPSYAWRSILHGRELLIQEMEKKVGNGKSIKVWIDEWI---EDDGWRAPWRRNNF  637

Query  893   HESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI-PVPPKVRVFAWKLAMS  1060
                  +  VS L++     WD++ +   F   D   I  I PV      ++WK   S
Sbjct  638   FNP--DLRVSELLDLRSRDWDQEALEHHFLPGDIIRINKIKPVTSIEDFYSWKFNKS  692



>ref|XP_010495131.1| PREDICTED: uncharacterized protein LOC104772187 [Camelina sativa]
Length=1814

 Score =   162 bits (410),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 118/347 (34%), Positives = 172/347 (50%), Gaps = 16/347 (5%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             + G L G+++    P I H+LFADD     RA+  E +N+   L LY  ASGQ +N  KS
Sbjct  1104  QEGRLTGLKLTPECPSIQHLLFADDSLFLCRASLLECSNLLQCLRLYGDASGQEINLQKS  1163

Query  197   LSVF*YQYRSG*QNCSD*RSQ-RQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
                F  +     +      +   Q GG+    GKYLGLP     +KK +L ++ DR+ S 
Sbjct  1164  SITFGKKLDPYMRRVIGLFTGIEQEGGA----GKYLGLPECFSGSKKDMLAYITDRLTSR  1219

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             +RGW    LS  G EVLLK V  ALP YAM  F LS   C++I   + +FWW   V  + 
Sbjct  1220  LRGWFEKTLSLGGKEVLLKAVALALPVYAMSCFRLSKHQCKKITSAMANFWWNA-VEEKQ  1278

Query  554   GIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
              + W +W+ +C +K +  LG  D+          Q W LL  P SL+ RV+K+RY+P++ 
Sbjct  1279  KMHWVSWEKMCKSKDQGGLGFRDIGRFNQALLAKQAWCLLDGPSSLLARVYKARYFPSTS  1338

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
              M A +G  P + WRSI+     +++    SIGD   T +  D W V  E P    +  +
Sbjct  1339  FMEANLGPRPSYAWRSILFGRELLEKGLMKSIGDGLDTNVWLDKW-VFDELPRRPCNKEQ  1397

Query  899   SVR-EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVRV  1036
              +     VS L+   G  W+   + ++F   D   I +   PP  R+
Sbjct  1398  MINLNLRVSELITNQG-DWNLQALQELFPPCDVIKIRSF--PPDTRL  1441



>gb|AAK52166.1|AC084831_20 putative reverse transcriptase [Oryza sativa Japonica Group]
Length=1185

 Score =   161 bits (408),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 115/343 (34%), Positives = 172/343 (50%), Gaps = 21/343 (6%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             RG L G++V R AP ISH+LFADD  + ++A+   + ++K ILD+Y   SGQ ++  KS 
Sbjct  479   RGDLVGIRVCREAPMISHLLFADDSLILMQADKNNADHLKAILDIYCQNSGQKISEAKS-  537

Query  200   SVF*YQYRSG*QNCSD*RSQRQAGGSGDT-----TGKYLGLPSLVGKNKKAILGFVKDRI  364
             S+F +   +  ++      +    GS D        KYLGLP+++G +K      + DR+
Sbjct  538   SIF-FSRNTAVED------KAAVCGSLDIMTEALNDKYLGLPAMIGVDKSDCFRHLIDRV  590

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
              + + G     LS  G EVL+K++ QA+P +AM +F +   +C  I   +  FWW G   
Sbjct  591   NNRINGRKEKMLSTGGKEVLIKSIAQAIPVFAMSVFRIPKKICDCISEAIARFWW-GDDE  649

Query  545   RRLGIRWKAWKALCTKIKR-WLGVYDL---KGDEPGTQTWRLLTRPDSLVERVFKSRYYP  712
                 I WKAW  +C   +R  LG  DL          Q WR L  PDSL  RV + +YYP
Sbjct  650   NHRRIHWKAWWRMCIPKQRGGLGFRDLYCFNRAMLAKQIWRFLCDPDSLCARVMRCKYYP  709

Query  713   NSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTH  889
             + +++ A       + W+SI+  +   K  Y   IGD     I +D  +  + +  V T 
Sbjct  710   DGNILRARPKKGSSYAWQSILSGSECFKG-YIWRIGDGSQVNIWEDSLIPSSSNGKVLTP  768

Query  890   LHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                ++    V  L+N V   WD D I  +F   DAN IL IP+
Sbjct  769   RGRNII-TKVEELINPVSGGWDEDLIDTLFWPIDANRILQIPI  810



>gb|ABF97084.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1184

 Score =   161 bits (408),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 115/343 (34%), Positives = 172/343 (50%), Gaps = 21/343 (6%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             RG L G++V R AP ISH+LFADD  + ++A+   + ++K ILD+Y   SGQ ++  KS 
Sbjct  479   RGDLVGIRVCREAPMISHLLFADDSLILMQADKNNADHLKAILDIYCQNSGQKISEAKS-  537

Query  200   SVF*YQYRSG*QNCSD*RSQRQAGGSGDT-----TGKYLGLPSLVGKNKKAILGFVKDRI  364
             S+F +   +  ++      +    GS D        KYLGLP+++G +K      + DR+
Sbjct  538   SIF-FSRNTAVED------KAAVCGSLDIMTEALNDKYLGLPAMIGVDKSDCFRHLIDRV  590

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
              + + G     LS  G EVL+K++ QA+P +AM +F +   +C  I   +  FWW G   
Sbjct  591   NNRINGRKEKMLSTGGKEVLIKSIAQAIPVFAMSVFRIPKKICDCISEAIARFWW-GDDE  649

Query  545   RRLGIRWKAWKALCTKIKR-WLGVYDL---KGDEPGTQTWRLLTRPDSLVERVFKSRYYP  712
                 I WKAW  +C   +R  LG  DL          Q WR L  PDSL  RV + +YYP
Sbjct  650   NHRRIHWKAWWRMCIPKQRGGLGFRDLYCFNRAMLAKQIWRFLCDPDSLCARVMRCKYYP  709

Query  713   NSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTH  889
             + +++ A       + W+SI+  +   K  Y   IGD     I +D  +  + +  V T 
Sbjct  710   DGNILRARPKKGSSYAWQSILSGSECFKG-YIWRIGDGSQVNIWEDSLIPSSSNGKVLTP  768

Query  890   LHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                ++    V  L+N V   WD D I  +F   DAN IL IP+
Sbjct  769   RGRNII-TKVEELINPVSGGWDEDLIDTLFWPIDANRILQIPI  810



>ref|XP_008364002.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=839

 Score =   159 bits (403),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 106/348 (30%), Positives = 170/348 (49%), Gaps = 16/348 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I   + R  L GV+++   P ISHI F DD  +FL+ + +   N+  +L  Y  ASGQ +
Sbjct  241   IQEAVERRQLEGVKLSVAGPVISHIFFTDDTLIFLKEDRKNCNNLVDLLKDYCNASGQAI  300

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N  KS   F    +S     S+           +  G YLG+P++ G++KK  L +VK R
Sbjct  301   NMQKSSVFFGNNVQS---TLSEELGNILGMTVVENPGSYLGVPAIWGRSKKLGLAYVKGR  357

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             IL  ++GW    LSRAG+EVL+K V+QA+P+Y M IF    TLC+E++ ++  FWW    
Sbjct  358   ILGKLQGWKQSMLSRAGNEVLIKAVVQAIPAYPMNIFKFPATLCKELDALIAKFWWDDSS  417

Query  542   ARRLGIRWKAWKALCTKIKRWLG------VYDLKGDEPGTQTWRLLTRPDSLVERVFKSR  703
              RR    W + + L   + + LG        D        Q WRL+  PDSL  +V K+R
Sbjct  418   GRR-KTHWVSMETL--GLPKHLGGMGFRNFQDFNDALLAKQCWRLIVEPDSLWAQVMKAR  474

Query  704   YYPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL--VMAEDP  874
             Y+ N   ++A  G    + W S++   + +++     I       +  D W   ++   P
Sbjct  475   YFSNCSFLDATKGDRTSWAWSSLLVGRDLIQKGAHWQIMGGEEVRLWVDRWXPALLLGHP  534

Query  875   YVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
               S  +  + R   VSS++     +WD + ++   +A +   I + P+
Sbjct  535   SPSGDVAVT-RNTRVSSIICPSSKTWDFEFLLPFLSAEECAAIRDTPI  581



>ref|XP_010481092.1| PREDICTED: uncharacterized protein LOC104759918 [Camelina sativa]
Length=742

 Score =   158 bits (400),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 104/337 (31%), Positives = 169/337 (50%), Gaps = 13/337 (4%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             +  ++VA   PPI+H+LFADD   F +A  EE   +  +L  Y  ASGQ +N+ KS   F
Sbjct  69    ITSIKVANKCPPITHLLFADDSLFFCKATKEECGAILDVLKNYEAASGQQINFSKSSLQF  128

Query  209   *YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWN  388
              +      +  ++  S       G   G YLGLP  +G +K  +  FV+DR+     GW 
Sbjct  129   GHLVPEKIR--TEVHSTLGITNIGG-MGSYLGLPESLGGSKTKVFSFVRDRLQIRTTGWT  185

Query  389   T*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWK  568
                LS+ G EV++K+V  A+P++ M  + +  T+  ++   + +FWW+    +  G+ W 
Sbjct  186   AKLLSKGGKEVMIKSVATAVPTFVMSCYRIPKTITSKLTSAVANFWWSSN-GQTGGMHWL  244

Query  569   AWKALCTKIKR----WLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMNAV  736
             AW+ LC+  +     +  V D        Q WRL+  PDSL  RVFKSRYY NS+ M  +
Sbjct  245   AWEKLCSSNQLGGLGFRNVDDFNTALLAKQLWRLIEVPDSLFARVFKSRYYRNSNPMVPI  304

Query  737   -GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREA  913
               ++P + WRSI+   + V +     +G   + +I  D W V A+ P       +S ++ 
Sbjct  305   KSYSPSYSWRSIISARSLVNKVLITRVGYGDTISIWTDSW-VPAQFPR-PAQSKDSFKDP  362

Query  914   --PVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                ++ L++    +W  D +   F + D + I  IP+
Sbjct  363   LLQMNDLIDRANNTWRMDRLAAHFASADVDLIGAIPL  399



>ref|XP_010424608.1| PREDICTED: uncharacterized protein LOC104709742 [Camelina sativa]
Length=804

 Score =   159 bits (402),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 104/342 (30%), Positives = 165/342 (48%), Gaps = 15/342 (4%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R  ++ G++VA   PPI+H+LFADD   F +A+  +   +  IL  Y    GQ +N+ KS
Sbjct  105   REKLITGIKVANKCPPITHLLFADDSLFFCKADKGQCRVILDILKQYESVLGQQINFTKS  164

Query  197   LSVF*YQYRSG*QN-CSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
                F ++     +    D       GG     G YLGLP  +G  K  +  FV++RI S 
Sbjct  165   SVQFGHKIDEQTKTELQDVLGITTLGG----MGSYLGLPESLGGAKTKVFSFVRERIQSR  220

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
               GW    LS+ G EV++K+V  A+P++ M  F L  T+  ++   + +FWW+    +  
Sbjct  221   TNGWTANLLSKGGREVMIKSVATAVPTFVMSCFRLPKTITSKLTSAVANFWWSTN-GQTG  279

Query  554   GIRWKAWKALCTKIKRWLG------VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPN  715
             G+ W AW+ LC  + + LG      V D        Q WRL+  P+SL  RVFKSRYY N
Sbjct  280   GMHWLAWEKLC--VSKQLGGLGFRNVDDFNSALLAKQLWRLIDVPESLFARVFKSRYYRN  337

Query  716   SDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHL  892
             +  ++ +  ++P + WRSI    + V +     +G   + +I  D W+        S+  
Sbjct  338   THPLDPIRSYSPSYGWRSICSARSLVNKGLIKRVGSGDTISIWSDPWVPAQFPRPASSKG  397

Query  893   HESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                     ++ L++    SW  D + + F+  D   I  IP+
Sbjct  398   PLKDPSLQMNQLIDRQNNSWRLDMLNEHFDPLDVVLIRAIPL  439



>ref|XP_009115101.1| PREDICTED: uncharacterized protein LOC103840357 [Brassica rapa]
Length=918

 Score =   159 bits (403),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 97/327 (30%), Positives = 168/327 (51%), Gaps = 11/327 (3%)
 Frame = +2

Query  29   LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
            + G+++AR  P +SH+LFADD   F +A   E   +  ++D+Y  ASGQ +N  KS  +F
Sbjct  245  ITGIKIARACPSVSHLLFADDSLFFWKAEPNECKELMRLIDVYGNASGQQLNKAKSSVLF  304

Query  209  *YQYRSG*Q-NCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGW  385
              +  +  + +     +  Q GG     G YLGLP  +  +KK +  FV++R+ +    W
Sbjct  305  GSKVVASRKTDLKRSLAINQEGG----MGMYLGLPEKICGSKKQVFSFVQERLNNRTNSW  360

Query  386  NT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRW  565
            +T  LS+ G EV +K++ QA+PSY M  + L   + + +   ++ +WW+ K   R G+ W
Sbjct  361  STKLLSKGGKEVQIKSIAQAVPSYVMSCYLLPQGITQNLSGAVSRYWWSTKDNNR-GMHW  419

Query  566  KAWKALCTKIKR----WLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLM-N  730
             AW  +C  +      +    D        Q WRLL  P+SL+ RV K RYY +S+ M +
Sbjct  420  VAWDKICIPLDEGGLGFRNFRDFNLALLAKQLWRLLKYPNSLLARVLKGRYYRHSNPMAS  479

Query  731  AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVRE  910
               +NP + WRS+  +   ++Q  R  IG+   T + ++ WL +      +   ++  ++
Sbjct  480  GSANNPSYGWRSLTALRQVLQQGLRKKIGNGLDTKVWEEPWLPVTPARPPTRRSNQFDQD  539

Query  911  APVSSLMNGVGTSWDRDCIIDVFNARD  991
              V  L+N    +W+ + + +  +A D
Sbjct  540  LRVHHLINHQNQTWNVELLNEFISAGD  566



>ref|XP_010463404.1| PREDICTED: uncharacterized protein LOC104744076 [Camelina sativa]
Length=751

 Score =   158 bits (400),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 112/343 (33%), Positives = 169/343 (49%), Gaps = 19/343 (6%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R G L GV+VA+G+P ++H+LFADD   F+RA+      +K IL  Y  ASGQ +N  KS
Sbjct  68    REGNLIGVKVAKGSPRVNHLLFADDTMFFIRADQHSCLTLKNILHKYEAASGQKINQSKS  127

Query  197   LSVF*YQ----YRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRI  364
                F  +     R+      D    ++ GG G    KYLGLP L G+ KK +   + DRI
Sbjct  128   SITFSAKTPMYMRT---QAKDVLEIQKEGGQG----KYLGLPELFGRKKKDLFTSIVDRI  180

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
                   W++ FLS AG   +LK+VL A+P+Y M  F L   LC+ I+  L  FWW     
Sbjct  181   KQKALSWSSRFLSTAGKLTMLKSVLSAMPTYTMSCFHLPGLLCKRIQSALTRFWWDTNTE  240

Query  545   RRLGIRWKAWKALCTKIKRW--LGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYY  709
             ++  + W AW+ + TK  ++  LG+ D+K          +WRLLT+P +L+ RV   +Y 
Sbjct  241   KK-KMSWIAWRKI-TKPTKFGGLGIRDIKHFNKALLAKLSWRLLTKPHTLLARVLLGKYC  298

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
              N  L++  +  +    WRSI    + +K      IG   +T I +  WL  +       
Sbjct  299   KNLSLLDCKIPSSASHGWRSIGMGRDLLKSKLGRVIGSGANTPIWRTPWLSTSSPLAPIG  358

Query  887   HLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIP  1015
                E+ +   V+ L+      W+ D I  +  A + + +L  P
Sbjct  359   PPTEASQHLNVADLLLPNSRGWNVDLIKHILPAFEQDILLLKP  401



>ref|XP_010513001.1| PREDICTED: uncharacterized protein LOC104788939 [Camelina sativa]
Length=1583

 Score =   160 bits (405),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 108/352 (31%), Positives = 171/352 (49%), Gaps = 35/352 (10%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R  ++ G++VA   PPI+H+LFADD   F +A+  +   +  IL  Y   SGQ +N+ KS
Sbjct  952   RDKLITGIKVANKCPPITHLLFADDSLFFCKADRGQCQVILDILKKYESVSGQQINFSKS  1011

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRI  364
                F ++         D       G  G  T    G YLGLP  +G  K  +  F ++RI
Sbjct  1012  SVQFGHK-------IDDQTKTELQGVLGIMTLGGMGSYLGLPESLGGAKTKVFSFARERI  1064

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
              S   GW    LS+ G EV++K+V  A+P++ M  F L  T+  ++   + +FWW+    
Sbjct  1065  QSRTNGWTANLLSKGGREVMIKSVATAVPTFVMSCFRLPKTITSKLTSAVANFWWSTN-G  1123

Query  545   RRLGIRWKAWKALCTKIKRWLG------VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRY  706
             +  G+ W AW+ LC  + + LG      V D        Q WRL+  P+SL  RVFKSRY
Sbjct  1124  QSGGMHWLAWEKLC--VSKQLGGLGFRNVDDFNSALLAKQLWRLIDAPESLFARVFKSRY  1181

Query  707   YPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             Y N++ ++ +  ++P + WRSI    + V +     +G   + +I  D W V A+ P   
Sbjct  1182  YRNTNPLDPIRSYSPSYGWRSICSARSLVNKGLIKRVGSGDTISIWSDPW-VPAQFP---  1237

Query  884   THLHESVREAPV-------SSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                  +V + P+       + L++    +W  D + + F+  D   I  IP+
Sbjct  1238  ---RPAVSKGPLKDHYLQMNHLIDRQTNTWRMDMLNEHFDPLDVALIRAIPL  1286



>ref|XP_009108843.1| PREDICTED: uncharacterized protein LOC103834526 [Brassica rapa]
Length=1084

 Score =   159 bits (403),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 111/343 (32%), Positives = 163/343 (48%), Gaps = 19/343 (6%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R     G+++AR  P +SH+LFADD   F RA   +   +  +L  Y   SGQ VN +KS
Sbjct  657   RENRFKGLKIARSCPSVSHLLFADDSLFFCRATVSDCQQVASLLKEYEEYSGQRVNLEKS  716

Query  197   LSVF*YQ----YRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRI  364
                F  +     R+  +N      QR  GG     GKYLGLP   G+NKK +  ++ D  
Sbjct  717   SITFGMKIDDSQRALLKNILG--IQRTGGG-----GKYLGLPEQFGRNKKELFAYLVDNT  769

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
              + V  W+  +LS+ G EV++K V    P Y+M  F +  T C EI  +L+ FWW GK  
Sbjct  770   KNNVECWSNQYLSQGGKEVMIKTVSMGKPVYSMSCFLIPKTTCDEINGLLSGFWW-GKDN  828

Query  545   RRLGIRWKAWKALCTKIKR-WLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYP  712
              R  I W AWK L T  K   +G  DL          Q W++   P SL+ R+++ RY+ 
Sbjct  829   GRRKISWIAWKRLSTPKKEGGMGFRDLHQFNMALLAKQAWKIQNNPTSLLARIYRGRYHN  888

Query  713   N-SDLMNAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYV--S  883
               + L +    NP + WRSI      + +  R  IG+ R+T + +D W+       +  +
Sbjct  889   KLTFLQSTCSSNPSYGWRSIQAGKELLLKGLRVQIGNGRTTDVWRDKWIPTIPPRQINRN  948

Query  884   THLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
                   +    VS L+     SWD++ I  +F   DA  +  I
Sbjct  949   PQFLGPLETTLVSDLLLQNTLSWDQEKIETMFTPEDAALVQTI  991



>gb|EEC76774.1| hypothetical protein OsI_14862 [Oryza sativa Indica Group]
Length=1860

 Score =   160 bits (405),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 164/338 (49%), Gaps = 12/338 (4%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G++ G++  R  PPISH+LFADD   F R++      +K  L  Y  ASGQ +N  KS  
Sbjct  1436  GVIQGIRNGRLGPPISHLLFADDSIFFARSDLHSVQGLKDALQAYCKASGQKINLQKSSI  1495

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRG  382
              F        +N      Q       DT   YLG+P+ +G+       F+ +R+   V  
Sbjct  1496  FFGQNCPEDIKNSVKETLQVSVEILQDT---YLGMPTEIGRASTGSFHFLPERVWRRVNS  1552

Query  383   WNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIE-VILNHFWWTGKVARRLGI  559
             WN   +SRAG E +LK V QA+P+Y M  F L ++ C +++  IL+H WW  +  ++  +
Sbjct  1553  WNDRPMSRAGKETMLKAVAQAIPTYVMSCFKLPVSTCEKMKSCILDH-WWGFEDGKK-KM  1610

Query  560   RWKAWKALCT-KIKRWLGVYDL---KGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLM  727
              W++W+ + T K    +G  DL          Q WR++T   SL  RV K RY+PNSDL 
Sbjct  1611  HWRSWEWMTTPKSLGGMGFRDLGLFNQAMLARQGWRIVTDLVSLCARVLKGRYFPNSDLW  1670

Query  728   NAVGHNPL-FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESV  904
             NA       F WRSI+   + +++  R  IG+  S  I KD W +    P +   L    
Sbjct  1671  NAPKPTATSFTWRSILFGRDLLRKGVRWGIGNGSSVKILKDHW-IPGIKPSMVRPLLPLP  1729

Query  905   REAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              +  V  L+N     WD D +   F+      IL IPV
Sbjct  1730  EDVTVDFLVNDAIGEWDEDKVFSFFDETTTQQILQIPV  1767



>ref|XP_004296207.1| PREDICTED: uncharacterized protein LOC101297422 [Fragaria vesca 
subsp. vesca]
Length=1096

 Score =   159 bits (403),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 107/339 (32%), Positives = 167/339 (49%), Gaps = 17/339 (5%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             + GV+V  GAP ISH+LFADD F+F +A       +  IL  Y   S Q V+  KS   F
Sbjct  429   IQGVRVCTGAPTISHLLFADDSFIFFKAEERGCRKVGSILSRYETLSRQQVSLAKSKIAF  488

Query  209   *YQYRSG*QNCSD*RSQRQAGGSG----DTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
                     QN    +    A   G    +   KYLGLP+ +  +K+    F+ +RI    
Sbjct  489   S-------QNVPRWKQDELAAVLGVKRVEKHKKYLGLPTELSYSKEKAFSFLCERIRKRT  541

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
             +GW    L+ AG EVL+K V+Q++P+Y M  F L   +C  ++ ++  FWW  K   R  
Sbjct  542   QGWRDKTLTIAGKEVLIKAVVQSIPTYIMSCFELPKHMCSAMQRLMARFWWGDKGDDR-K  600

Query  557   IRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDL  724
             I W AW+ LC TK +  LG  D++         Q WRL+ +P+SL+ +V K+RY+P+   
Sbjct  601   IHWVAWEKLCTTKAEGGLGFRDMRLFNMALLAKQGWRLIRQPNSLLAQVLKARYFPSESF  660

Query  725   MNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
             M A V     F WRSI++  + +K+  R  +G+  S ++  D W+ +       +   E 
Sbjct  661   MEAEVAKGCSFTWRSILKGRDLLKKGLRFQVGNGESISVWDDPWIPLPYSFRPYSPPMEG  720

Query  902   VREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
               E  V  L++     W+   + ++F   + + I  I +
Sbjct  721   TEELRVCDLIDPDTGDWNVWLLNELFMGNEVDIIARIAL  759



>ref|XP_010468192.1| PREDICTED: uncharacterized protein LOC104748214 [Camelina sativa]
Length=767

 Score =   158 bits (399),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 109/346 (32%), Positives = 168/346 (49%), Gaps = 23/346 (7%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R  ++ G++VA   PPI+H+LFADD   F +A+ ++   +  IL  Y   SGQ +N+ KS
Sbjct  65    RNKLITGIKVANKCPPITHLLFADDSLFFCKADNDQCRVILDILKQYECVSGQQINFSKS  124

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRI  364
                F ++                 G  G TT    G YLGLP  +G  K  +  FV+DRI
Sbjct  125   SVQFGHKIDEA-------TKTELQGVLGITTLGGMGSYLGLPESLGGAKTKVFSFVRDRI  177

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
              S    W     S+ G EV++K+V  A+ ++ M  F L  T+  ++   + +FWW     
Sbjct  178   QSRTSSWTANLFSKGGREVMIKSVAIAVLTFVMSCFRLPKTITSKLTSAVANFWWCNN-G  236

Query  545   RRLGIRWKAWKALC-TKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYP  712
             +  G+ W  WK LC +K  R LG   V D        Q W L+  PDSL  RVFKSRYY 
Sbjct  237   KSGGMHWLVWKKLCVSKQLRGLGFRNVDDFNSALLAKQLWHLIDVPDSLFARVFKSRYYR  296

Query  713   NSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTH  889
             N+  ++ +  ++P + WRSI    + V +     +G   + +I  D W V A+ P  +  
Sbjct  297   NTHPLDPIRSYSPSYGWRSICSACSLVNKGLIKRVGSGDTISIWSDPW-VPAQFPRAA--  353

Query  890   LHESVREAP---VSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             L + +   P   ++ L++    +W  D + + F+  D   I  IP+
Sbjct  354   LSKGLLRDPFLQMNQLIDRQTNTWRMDMLNEHFDPLDVALIGAIPL  399



>ref|XP_009138123.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=761

 Score =   158 bits (399),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 106/343 (31%), Positives = 165/343 (48%), Gaps = 22/343 (6%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             RG L G+Q     P + H+ FADD     +A   +    + IL  Y  A+GQ++N  KS 
Sbjct  55    RGDLKGIQFNLAGPEVHHLFFADDSLFLFKAELSQCQVFQDILLKYGEATGQVINLSKSS  114

Query  200   SVF*YQYRSG*QNCSD*RSQRQAG---GSGDTTGKYLGLPSLVGKNKKAILGFVKDRILS  370
               F      G   C   +++ Q+     S    G YLGLP     +K  +L +++D++  
Sbjct  115   LTF------GKNTCPSLKAKIQSKLGIYSEGGAGSYLGLPECFSGSKVEMLAYIQDKMKG  168

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVAR-  547
              + GW + FLS+AG EV+LK+V  A+P YAM  F L  T C  ++  +  FW  G+ +  
Sbjct  169   RMSGWYSRFLSQAGKEVILKSVAMAMPIYAMTCFKLPKTTCNNLKSAMAAFW--GQDSED  226

Query  548   RLGIRWKAWKALCTKIKRWLGVYDLKGDE------PGTQTWRLLTRPDSLVERVFKSRYY  709
             +  I W +W  LC  I + +G    K  E         Q WR+L+  DSL+ R  +SRY+
Sbjct  227   KSKIHWLSWDKLC--ISKEMGGMGFKDIELFNQALLAKQAWRILSNQDSLLTRFLQSRYF  284

Query  710   PNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
              N   ++A +G  P + WRSI+     +K+  R ++G+  S ++    WL+  E   +  
Sbjct  285   SNGSFLSATLGSRPSYAWRSILHGRELLKKGLRNAVGNGLSISVWSTPWLIDGERLRIPL  344

Query  887   HLHESVR-EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
               +  V     VS LM      WD   + ++F  +D   IL I
Sbjct  345   MKNTLVDLNLKVSDLMIPYSDLWDHQKLENLFYDQDIEIILKI  387



>ref|XP_009113016.1| PREDICTED: uncharacterized protein LOC103838337 [Brassica rapa]
Length=1257

 Score =   160 bits (404),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 106/317 (33%), Positives = 156/317 (49%), Gaps = 18/317 (6%)
 Frame = +2

Query  17   RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
            R G L G++VARG+P ++H+LFADD   F  A+ E  + +K IL  Y  ASGQ +N +KS
Sbjct  571  RDGTLQGIRVARGSPRVNHLLFADDTMFFCNASPESCSKLKSILLDYEKASGQKINSEKS  630

Query  197  LSVF*YQYRSG*QNCSD*RSQRQAGGSGDT---TGKYLGLPSLVGKNKKAILGFVKDRIL  367
               F        +   D +S  +     D    TGKYLGLP   G+ K+ +   V DRI 
Sbjct  631  SITF------SSKTPEDKKSAAKTLLGIDKEGGTGKYLGLPEYFGRKKRDMFTSVVDRIR  684

Query  368  SWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVAR  547
                 W T  LS+AG   +LK+VL ++P+Y M  F L  +LC+ I+ +L  FWW    + 
Sbjct  685  QRASSWATRRLSKAGKLTMLKSVLLSIPTYPMSCFELPASLCKRIQSVLTRFWWDDPQSN  744

Query  548  RLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPN  715
               + W AW  +   K    LG+ D++         Q WR+LT PD L+ RV   +Y   
Sbjct  745  SKKMCWIAWSKMTKPKAGGGLGLRDIQLFNQALLAKQAWRILTAPDCLLARVLLGKYCHK  804

Query  716  SDLMNAVGHNPLFI---WRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
            +  + A    P      WRSI+   + +K     +IG+   T +  D WL + E+  +  
Sbjct  805  ASFLQA--ETPAVCSHGWRSILHGRDLLKGNVGKAIGNGEDTKVWNDSWLALQENIKIYG  862

Query  887  HLHESVREAPVSSLMNG  937
             + ES  +  VS L+  
Sbjct  863  PIPESGIDLRVSDLLTS  879



>ref|XP_010513448.1| PREDICTED: uncharacterized protein LOC104789452 [Camelina sativa]
Length=1025

 Score =   159 bits (402),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/294 (33%), Positives = 148/294 (50%), Gaps = 16/294 (5%)
 Frame = +2

Query  17   RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
            R   + G++VA   PPI+H+LF DD   F + +  +   +  IL  Y   SGQ +N+DKS
Sbjct  387  RDKQIIGIKVANKCPPITHLLFVDDSLFFCKVDKAQCEVILDILKQYEAVSGQQINFDKS  446

Query  197  LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTG---KYLGLPSLVGKNKKAILGFVKDRIL  367
               F ++           R++ Q        G    YLGLP  +G +K  +  FV+DR+ 
Sbjct  447  SIQFGHKVDEAV------RTELQGVLGISNLGGMCSYLGLPESLGGSKTKVFSFVRDRLQ  500

Query  368  SWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVAR  547
                GW+   LS+ G EV++K+V  A+P++ M  F L  T+  ++  ++ +FWW+    +
Sbjct  501  GRTTGWSAKLLSKVGKEVMIKSVATAVPTFVMSCFRLPKTITSKLTSVVANFWWSAS-GQ  559

Query  548  RLGIRWKAWKAL-CTKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPN  715
              G+ W AW  L C+K    LG   V D        Q WRL+  PD+L  R FK RYY N
Sbjct  560  FGGMHWLAWDKLCCSKQTEGLGFRQVDDFNSALLAKQLWRLIDAPDTLFARAFKGRYYQN  619

Query  716  SDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDP  874
            S+ M  +  ++P + WRSI+   + V +     +G   S +I  D W V A+ P
Sbjct  620  SNPMEPIRSYSPSYGWRSIISARSLVHKGLIIRVGSGESVSIWTDPW-VPAQSP  672



>ref|XP_004310201.1| PREDICTED: uncharacterized protein LOC101298860 [Fragaria vesca 
subsp. vesca]
Length=1164

 Score =   159 bits (403),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 107/373 (29%), Positives = 186/373 (50%), Gaps = 15/373 (4%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             RG +HGV +A GAP I+H+ FADD F+FLRA   E   +K IL +Y  A GQ V++ KS 
Sbjct  621   RGGIHGVSIATGAPSINHLFFADDSFIFLRAEVVEWYRLKHILQVYEEALGQQVHFQKSS  680

Query  200   SVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
               F    R+  +   D  +        D   KYLGLP+ +  +KK    ++ D+    ++
Sbjct  681   ISF---SRNVAREAQDRLASLLGVERVDKHDKYLGLPTELSYSKKESFQYIMDKTRDKMK  737

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
              W    LS A  EV++K V+Q++P+Y M +  +   +C E+   +  FWW G   R   I
Sbjct  738   NWKDKTLSAAKKEVMIKAVVQSVPTYVMSVLEVLKHICNEMHRCMAEFWW-GDSDRGRKI  796

Query  560   RWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLM  727
              W AW  +C  K +  LG  +++         + WR++   DSLV R  K++Y+P+   +
Sbjct  797   HWVAWDKMCAPKNEGGLGFRNMELFNQALLAKKGWRIINSLDSLVTRTLKAKYFPSGHFL  856

Query  728   NA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESV  904
              A +G +  ++WRS+++  + +++  R  +G+  S ++  D W++        + + E +
Sbjct  857   KAEMGSDASYVWRSLLKGRDLLRKGIRYHVGNGESISVWHDPWILRPCTFKTYSTVMEGL  916

Query  905   REAPVSSLMNGVGTSWDRDCIIDVFNARDANCI-LNIPVPPKVRVFAWKLAMSYSLVLCP  1081
              +  V+ L++     W  D + ++F   +   I L+   P    ++ +     Y++    
Sbjct  917   EDLKVADLIDPDTRVWMVDWLNELFFEDEVEVISLSFRNPDDQLIWHYDKHGLYTV----  972

Query  1082  *RHVWYTAICVEV  1120
              R  +YTA C  V
Sbjct  973   -RRGYYTARCALV  984



>ref|XP_010478571.1| PREDICTED: uncharacterized protein LOC104757523 isoform X1 [Camelina 
sativa]
Length=653

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/255 (37%), Positives = 130/255 (51%), Gaps = 22/255 (9%)
 Frame = +2

Query  2    IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
            I   +R G LHG + +R  P ISH+ FADD  LF +A  EE A +  IL+ Y  ASGQ V
Sbjct  400  IQENIRLGKLHGFKASRNGPAISHLFFADDSLLFCKATEEECATLLNILNQYEQASGQAV  459

Query  182  NYDKSLSVF*YQYRSG*QNC----SD*RS---QRQAGGSGDTTGKYLGLPSLVGKNKKAI  340
            N+ KS   F          C    SD R    Q          G+YLGLP  +G+NK   
Sbjct  460  NFQKSAITF----------CKGIDSDKRKHICQMMKICKTQGFGRYLGLPEFIGRNKTNA  509

Query  341  LGFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNH  520
              ++  R+   +  W T  LS  G EVLLK+V+ A+PSY+M  F L   +   I   + H
Sbjct  510  FSYLAQRVDQKIDSWYTKLLSPPGKEVLLKSVITAIPSYSMSCFLLPSRIINHITRAMRH  569

Query  521  FWWTGKVARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVER  688
            FWW+    ++  I W AW  +   K    + V DLK         Q+WR+L +P+SL+ R
Sbjct  570  FWWSSNKDKK-NIPWVAWNKITDPKSIGGIAVRDLKDFNIALLAKQSWRILQKPNSLMAR  628

Query  689  VFKSRYYPNSDLMNA  733
            V K++Y+P + L+ A
Sbjct  629  VLKAKYFPKTSLLKA  643



>ref|XP_010478572.1| PREDICTED: uncharacterized protein LOC104757523 isoform X2 [Camelina 
sativa]
Length=630

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/255 (37%), Positives = 130/255 (51%), Gaps = 22/255 (9%)
 Frame = +2

Query  2    IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
            I   +R G LHG + +R  P ISH+ FADD  LF +A  EE A +  IL+ Y  ASGQ V
Sbjct  377  IQENIRLGKLHGFKASRNGPAISHLFFADDSLLFCKATEEECATLLNILNQYEQASGQAV  436

Query  182  NYDKSLSVF*YQYRSG*QNC----SD*RS---QRQAGGSGDTTGKYLGLPSLVGKNKKAI  340
            N+ KS   F          C    SD R    Q          G+YLGLP  +G+NK   
Sbjct  437  NFQKSAITF----------CKGIDSDKRKHICQMMKICKTQGFGRYLGLPEFIGRNKTNA  486

Query  341  LGFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNH  520
              ++  R+   +  W T  LS  G EVLLK+V+ A+PSY+M  F L   +   I   + H
Sbjct  487  FSYLAQRVDQKIDSWYTKLLSPPGKEVLLKSVITAIPSYSMSCFLLPSRIINHITRAMRH  546

Query  521  FWWTGKVARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVER  688
            FWW+    ++  I W AW  +   K    + V DLK         Q+WR+L +P+SL+ R
Sbjct  547  FWWSSNKDKK-NIPWVAWNKITDPKSIGGIAVRDLKDFNIALLAKQSWRILQKPNSLMAR  605

Query  689  VFKSRYYPNSDLMNA  733
            V K++Y+P + L+ A
Sbjct  606  VLKAKYFPKTSLLKA  620



>ref|XP_009145555.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=900

 Score =   158 bits (400),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/349 (30%), Positives = 165/349 (47%), Gaps = 26/349 (7%)
 Frame = +2

Query  14    MRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDK  193
             M R +L GV+++  AP ++H+LFADD   F  AN   +  +K I  +Y   SGQ +N  K
Sbjct  193   MDRSLL-GVKISNNAPAVNHLLFADDSLFFSLANERAAKKLKTIFSIYEAVSGQAINLTK  251

Query  194   SLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
             S   F  +     +  +  RS       G   GKYLGLP  VG  K  +  ++ +++ S 
Sbjct  252   SSITFGAKVNPTVK--TKMRSLLGIFNEGGI-GKYLGLPEQVGSKKSEMFAYIIEKVKSV  308

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
              + W   +LS  G EVLLK +  A+P ++M IF L   +C EI  +L  FWW      + 
Sbjct  309   TQSWKQRYLSTGGKEVLLKAIAVAMPIFSMNIFRLPKEVCAEINAVLAKFWWGA--GDKK  366

Query  554   GIRWKAWKALCT-KIKRWLGVYDLKGDEPG---TQTWRLLTRPDSLVERVFKSRYYPNSD  721
             G+ W +W  +   K +  LG  DL+         Q WR++  P  L+ R+ K+RY+P  D
Sbjct  367   GLHWYSWDRVSVPKREGGLGFKDLEIFNQALLSKQVWRVMQHPHCLMARILKARYFPEED  426

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
             ++NA +     + W+SI+   + + +  R  IGD        +MW     DP++  H   
Sbjct  427   ILNAKLKKKASYPWKSILHGRDLINKGMRYIIGDGSLV----NMW----TDPWIPDHPPR  478

Query  899   SVR-------EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPP  1024
             S R       E  V    N  G  W+   + ++    D + IL + + P
Sbjct  479   SPRARGVYQLEEKVREYFNTTGDQWNEQKLREMIIDEDVDKILALKISP  527



>ref|XP_008382376.1| PREDICTED: uncharacterized protein LOC103445169 [Malus domestica]
Length=1330

 Score =   159 bits (403),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 108/338 (32%), Positives = 166/338 (49%), Gaps = 14/338 (4%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             L GV++    P ISHI FADD  +FL+A+ +   N+  +L  Y  ASGQ +N  KS   F
Sbjct  617   LDGVKLNGAGPVISHIFFADDTLIFLKADRKNCNNLVVLLQDYCNASGQAINMQKSSVFF  676

Query  209   *YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWN  388
                 +S     S+           D  G YLG+P++ G+ KK  L +VK RIL  ++GW 
Sbjct  677   GNNVQSF---LSEELGNILGMTVVDNPGSYLGVPTIWGQLKKLGLAYVKGRILGKLQGWK  733

Query  389   T*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWK  568
                LSRAG EVL+K V+QA+P+Y M IF    TLC+E++ ++  FWW     RR  I W 
Sbjct  734   QXMLSRAGKEVLIKAVVQAIPAYPMNIFKFPATLCKELDALIAKFWWDDSGVRR-KIHWV  792

Query  569   AWKALCTKIKRWLGVYDLKGDEP------GTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
             + + L   + + LG    +  +         Q WRL+  PDSL  +V K+RY+PN   ++
Sbjct  793   SMETL--GLPKHLGGMGFRNFQEFNDALLAKQCWRLIAEPDSLWAQVMKARYFPNCSFLD  850

Query  731   AV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESV-  904
             A  G    + W S++   + + +     I       +  D WL      + S     +V 
Sbjct  851   ASKGGRASWAWSSLLVGRDLILKGAHWQIMGGEEVRLWVDRWLPALXSGHPSPLGEVAVT  910

Query  905   REAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             R   VS ++     +WD + ++   +A +   I + P+
Sbjct  911   RNTRVSXIICPSSRTWDLEFLLPFLSAGECAAICDTPI  948



>gb|AAY22445.1| bZIP-like protein [Gossypium hirsutum]
Length=237

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/234 (36%), Positives = 123/234 (53%), Gaps = 8/234 (3%)
 Frame = +2

Query  44   VARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*YQYR  223
            + +  PP+SH+ FADDC LFL+ + E    +  +L  Y    GQ +N  KS S+F  +  
Sbjct  1    MGKYGPPLSHLFFADDCLLFLKDSVESIPTLLHVLTTYEKVLGQKINVTKS-SIFFAKSM  59

Query  224  SG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT*FLS  403
            +  +  +  R       SGD  G+YLGLP LVG++K+ I  ++KDRI     GW    LS
Sbjct  60   NEMRKQAIVRQLHMPRSSGD--GRYLGLPYLVGRSKREIFQYLKDRIWKKAHGWKEKLLS  117

Query  404  RAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKAWKAL  583
              G E+L+K VLQA+P++AM +F L + LC +I+ I   FWW   V       W AW  +
Sbjct  118  HGGKEILIKAVLQAIPTFAMSVFKLPLRLCCDIQAICRKFWWKS-VGDERSTSWIAWDTI  176

Query  584  C-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA  733
            C  K    LG   +          Q WR+   P SLV ++ K++Y+P+ D +  
Sbjct  177  CRPKRNGGLGFKHIPLFNQALLAKQAWRIFQYPGSLVSQILKAKYFPHHDFLQV  230



>ref|XP_004305133.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria 
vesca subsp. vesca]
Length=527

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/329 (30%), Positives = 164/329 (50%), Gaps = 10/329 (3%)
 Frame = +2

Query  29   LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
            L G++++   P +SH+ FADD   FL A +     +  I+++Y  ASGQLVN++KS    
Sbjct  69   LQGIKLSEYGPTLSHLFFADDSLFFLSATSANCYEIMRIIEVYCVASGQLVNHNKSTL--  126

Query  209  *YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWN  388
             Y   +    C     +     +    G+YLGLP++ G++KKA L F+K ++   ++ W 
Sbjct  127  -YCTPNMSDACVHVLCEILGIPATINPGRYLGLPTIWGRSKKASLSFIKSKLADKIQNWK  185

Query  389  T*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWK  568
               LS AG E L+K V QA+P++ M  F   ITLC E++ ++ +FWW G+      I WK
Sbjct  186  LCTLSMAGRETLIKAVAQAVPTFPMHCFKFPITLCNELDAMMANFWW-GQHKDEHKIHWK  244

Query  569  AWKALCTKIKR-WLGVYDLKG---DEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-  733
            +W  L     R  +G  ++K         Q WRL + P SL  R+ K  YYP++D++NA 
Sbjct  245  SWDFLGQPKDRGGMGFRNMKEFNISLLAKQVWRLHSEPTSLCARILKGIYYPSTDILNAG  304

Query  734  VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREA  913
             G    + W S+++  + +    R  +G+     I  D W+  + + ++   L  +    
Sbjct  305  KGSRASWAWSSLLDGKDLIVDGARWQVGNGELINIWADKWIPTSTNGFLCPMLPVNCSSP  364

Query  914  P-VSSLMNGVGTSWDRDCIIDVFNARDAN  997
              V  L +     W  + I D+ +  D +
Sbjct  365  HMVKDLTDWGARCWKLEMINDLISKDDQS  393



>ref|XP_004959141.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Setaria 
italica]
Length=950

 Score =   158 bits (400),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 109/341 (32%), Positives = 175/341 (51%), Gaps = 18/341 (5%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G L G+ +   AP I+H+LFADD  L L+AN E +  ++ +L +Y   SGQ++N DKS  
Sbjct  237   GRLQGISICANAPSITHLLFADDALLLLKANQENANYLQYVLQVYEACSGQMINKDKSSV  296

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRG  382
             +F    ++  Q   D          G  T +YLGLP  +G+++     ++KDR+   + G
Sbjct  297   LF---SKNTSQTSGDQFLSTLGLAQGVRTDRYLGLPVYMGRSRTQTFAYLKDRVWKRIHG  353

Query  383   WNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIR  562
             W    LS+AG E L+K V QA+PSYAM  F ++ ++  EI  ++  FWW  ++ +   + 
Sbjct  354   WKEKLLSKAGKETLIKAVAQAIPSYAMACFDITKSVSDEISTMICRFWW-AQMEKENKVH  412

Query  563   WKAWKALCTKIK------RWLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDL  724
             W +W+ L ++        R L +++L       Q WR+L  P+SL  R+  ++Y P+ DL
Sbjct  413   WVSWEILSSRKDEGGLGYRNLHLFNLA--MLAKQAWRILQNPESLCARLLTAQYCPSGDL  470

Query  725   MN-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV--MAEDPYVSTHLH  895
             +  + G    + WRSIV    A+K      IGD     I  D W+   ++  P       
Sbjct  471   LQVSEGSGISYTWRSIVRGFKALKNGLIWRIGDGSQVRIWDDPWIPTGISRQPRTP---R  527

Query  896   ESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
              SV  + V  L++ +  +WD   + ++F   D   IL+IPV
Sbjct  528   GSVLLSKVEELIDPITGTWDSQLVREIFWEEDVPNILSIPV  568



>ref|XP_010485231.1| PREDICTED: uncharacterized protein LOC104763574 [Camelina sativa]
Length=1808

 Score =   159 bits (403),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 113/341 (33%), Positives = 162/341 (48%), Gaps = 37/341 (11%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G + G+++A GAP ISH+LFADD   + R   EE   M  I++ Y+ ASGQ VNY KS  
Sbjct  1111  GKITGLKIASGAPSISHLLFADDSLFYCRKEEEEINQMVRIIEEYSLASGQRVNYQKSSI  1170

Query  203   VF*YQYRSG*QNCSD*RSQ--RQAGGSGD-TTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
              F      G     + R +   + G S +   G YLGLP     +K  IL ++K+R+   
Sbjct  1171  YF------GKLIPEETRGEIKHKLGISKEGGEGIYLGLPEAFKGSKVTILSYLKERLNQR  1224

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             V GW T FLS+ G EVLLK V+ ALP+Y M  F L           L       +   R 
Sbjct  1225  VNGWQTMFLSQGGKEVLLKAVVMALPTYTMTCFKLPRN-------ALASMGRADQAKSRG  1277

Query  554   GIRWKAWKALCTKIKRWLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA  733
             GI ++  +A    +              G Q WR++T+ +SLV RVFKSRY+  SD + A
Sbjct  1278  GIEFRDIEAFNDALL-------------GKQLWRIITQKESLVARVFKSRYFRKSDPLTA  1324

Query  734   -VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV------MAEDPYVSTHL  892
              +G+ P + WRS+      ++Q  R  +G+ +   I +  WL       ++    +    
Sbjct  1325  PLGYRPSYAWRSLQAAQELLRQGARAVVGNGKEINIWQHQWLQSKPARGLSRVKQIPPGF  1384

Query  893   HESVRE-APVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
               SV +   V  L+   G  W+RD +   F   D  CI  I
Sbjct  1385  QSSVAQLVTVKDLLGPDGREWNRDLLSLAFENEDKQCIEEI  1425



>gb|KFK27800.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1257

 Score =   159 bits (401),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 113/345 (33%), Positives = 166/345 (48%), Gaps = 29/345 (8%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             L G++++   P ++H+LFADD   F  A+      +  +L  Y   SGQ +N  KS   F
Sbjct  661   LKGMKISHTGPTVNHLLFADDALFFCHAHQLSCTTILRLLSEYERVSGQAINLSKSAITF  720

Query  209   *YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWN  388
               + R   +  S  R        G   GKYLGLP  +G+ KK I   V D++    R W+
Sbjct  721   GAKVRDDIK--SRLRHILNIHNDGGC-GKYLGLPESIGRKKKEIFQSVLDKVKQRTRSWS  777

Query  389   T*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWK  568
               +LS AG EVLLK V  ALP Y M  F L    C E+  I+ + WW+    +R  + W 
Sbjct  778   HRYLSEAGREVLLKTVALALPVYTMNCFKLPKGTCAELNTIIANDWWSKGSDKR-SVHWF  836

Query  569   AWKAL-CTKIKRWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-  733
             +WK +   K +  LG  D++       G Q  RL T P SLV ++ K RY+P +++M A 
Sbjct  837   SWKRMGLPKKEGGLGFRDIENFNLALLGKQVHRLFTNPSSLVAQLLKGRYFPATNIMEAG  896

Query  734   VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREA  913
              G  P +IWRS+++    VK+  R  +GD  +    +D WL         TH   S R  
Sbjct  897   NGSKPSYIWRSLLDGRELVKKGLRCLVGDGANIRAFQDNWL--------DTHPPRSPR--  946

Query  914   PVSSLMNGV---------GTS-WDRDCIIDVFNARDANCILNIPV  1018
             P+S +   +         GT+ W+ + +    +A D   IL +PV
Sbjct  947   PISDIPTNIQLVKDLMLRGTNRWNMELLSQTIHAADVQEILKLPV  991



>emb|CAB75484.1| putative protein [Arabidopsis thaliana]
Length=851

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/282 (36%), Positives = 151/282 (54%), Gaps = 13/282 (5%)
 Frame = +2

Query  23   GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
            G + GV++  GAP I+H+ FADD   F +AN      +K + D+Y   SGQ +N  KSL 
Sbjct  283  GDIRGVRIGNGAPAITHLQFADDSLFFCQANVRNCQALKDVFDVYEYYSGQKINVQKSLI  342

Query  203  VF*YQYRSG*QN--CSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
             F  +     Q    +      Q GG     GKYLGLP   G+ KK +  ++ DR+    
Sbjct  343  TFGSRVYGSTQTRLKTLLNIPNQGGG-----GKYLGLPEQFGRKKKEMFNYIIDRVKERT  397

Query  377  RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
              W+  FLS AG E+LLK+V  A+P YAM  F L   +  EIE +L +FWW  K + + G
Sbjct  398  ASWSAKFLSPAGKEILLKSVALAMPVYAMSCFKLPQGIVSEIESLLMNFWWE-KASNKRG  456

Query  557  IRWKAWKAL-CTKIKRWLGVYDL-KGDEP--GTQTWRLLTRPDSLVERVFKSRYYPNSDL  724
            I W AWK L  +K +  LG  DL K ++     Q WR++  P+SL  RV K+RY+ ++ +
Sbjct  457  IPWVAWKRLQYSKKEGGLGFRDLAKFNDALLAKQAWRIIQYPNSLFARVMKARYFKDNSI  516

Query  725  MNAVGHNPL-FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKD  847
            ++A   +   + W S++     +++  R  IGD ++  +G D
Sbjct  517  IDAKTRSQQSYGWSSLLSGIALLRKGTRYVIGDGKTIRLGID  558



>gb|KFK27798.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1250

 Score =   158 bits (400),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 113/345 (33%), Positives = 166/345 (48%), Gaps = 29/345 (8%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             L G++++   P ++H+LFADD   F  A+      +  +L  Y   SGQ +N  KS   F
Sbjct  661   LKGMKISHTGPTVNHLLFADDALFFCHAHQLSCTTILRLLSEYERVSGQAINLSKSAITF  720

Query  209   *YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWN  388
               + R   +  S  R        G   GKYLGLP  +G+ KK I   V D++    R W+
Sbjct  721   GAKVRDDIK--SRLRHILNIHNDGGC-GKYLGLPESIGRKKKEIFQSVLDKVKQRTRSWS  777

Query  389   T*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWK  568
               +LS AG EVLLK V  ALP Y M  F L    C E+  I+ + WW+    +R  + W 
Sbjct  778   HRYLSEAGREVLLKTVALALPVYTMNCFKLPKGTCAELNTIIANDWWSKGSDKR-SVHWF  836

Query  569   AWKAL-CTKIKRWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-  733
             +WK +   K +  LG  D++       G Q  RL T P SLV ++ K RY+P +++M A 
Sbjct  837   SWKRMGLPKKEGGLGFRDIENFNLALLGKQVHRLFTNPSSLVAQLLKGRYFPATNIMEAG  896

Query  734   VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREA  913
              G  P +IWRS+++    VK+  R  +GD  +    +D WL         TH   S R  
Sbjct  897   NGSKPSYIWRSLLDGRELVKKGLRCLVGDGANIRAFQDNWL--------DTHPPRSPR--  946

Query  914   PVSSLMNGV---------GTS-WDRDCIIDVFNARDANCILNIPV  1018
             P+S +   +         GT+ W+ + +    +A D   IL +PV
Sbjct  947   PISDIPTNIQLVKDLMLRGTNRWNMELLSQTIHAADVQEILKLPV  991



>gb|KFK27799.1| hypothetical protein AALP_AA8G430800 [Arabis alpina]
Length=1234

 Score =   158 bits (400),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 113/345 (33%), Positives = 166/345 (48%), Gaps = 29/345 (8%)
 Frame = +2

Query  29    LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
             L G++++   P ++H+LFADD   F  A+      +  +L  Y   SGQ +N  KS   F
Sbjct  638   LKGMKISHTGPTVNHLLFADDALFFCHAHQLSCTTILRLLSEYERVSGQAINLSKSAITF  697

Query  209   *YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWN  388
               + R   +  S  R        G   GKYLGLP  +G+ KK I   V D++    R W+
Sbjct  698   GAKVRDDIK--SRLRHILNIHNDGGC-GKYLGLPESIGRKKKEIFQSVLDKVKQRTRSWS  754

Query  389   T*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWK  568
               +LS AG EVLLK V  ALP Y M  F L    C E+  I+ + WW+    +R  + W 
Sbjct  755   HRYLSEAGREVLLKTVALALPVYTMNCFKLPKGTCAELNTIIANDWWSKGSDKR-SVHWF  813

Query  569   AWKAL-CTKIKRWLGVYDLKGDE---PGTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-  733
             +WK +   K +  LG  D++       G Q  RL T P SLV ++ K RY+P +++M A 
Sbjct  814   SWKRMGLPKKEGGLGFRDIENFNLALLGKQVHRLFTNPSSLVAQLLKGRYFPATNIMEAG  873

Query  734   VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREA  913
              G  P +IWRS+++    VK+  R  +GD  +    +D WL         TH   S R  
Sbjct  874   NGSKPSYIWRSLLDGRELVKKGLRCLVGDGANIRAFQDNWL--------DTHPPRSPR--  923

Query  914   PVSSLMNGV---------GTS-WDRDCIIDVFNARDANCILNIPV  1018
             P+S +   +         GT+ W+ + +    +A D   IL +PV
Sbjct  924   PISDIPTNIQLVKDLMLRGTNRWNMELLSQTIHAADVQEILKLPV  968



>gb|AAC33961.1| contains similarity to reverse trancriptase (Pfam: rvt.hmm, score: 
42.57) [Arabidopsis thaliana]
Length=1662

 Score =   159 bits (401),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 103/354 (29%), Positives = 177/354 (50%), Gaps = 18/354 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I NR+  G + G+++  G P ++H+ FADD   F ++N      +K + D+Y   SGQ +
Sbjct  1037  IKNRVAEGDIRGIRIGNGVPGVTHLQFADDSLFFCQSNVRNCQALKDVFDVYEYYSGQKI  1096

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N  KS+  F  +     QN        Q+ G G   GKYLGLP   G+ K+ +  ++ +R
Sbjct  1097  NMSKSMITFGSRVHGTTQNRLKNILGIQSHGGG---GKYLGLPEQFGRKKRDMFNYIIER  1153

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +      W+  +LS AG E++LK+V  ++P YAM  F L + +  EIE +L +FWW  K 
Sbjct  1154  VKKRTSSWSAKYLSPAGKEIMLKSVAMSMPVYAMSCFKLPLNIVSEIEALLMNFWWE-KN  1212

Query  542   ARRLGIRWKAWKAL-CTKIKRWLGVYDL-KGDEP--GTQTWRLLTRPDSLVERVFKSRYY  709
             A++  I W AWK L  +K +  LG  DL K ++     Q WR++  P+SL  R+ K+RY+
Sbjct  1213  AKKREIPWIAWKRLQYSKKEGGLGFRDLAKFNDALLAKQVWRMINNPNSLFARIMKARYF  1272

Query  710   PNSDLMNAVGHN-PLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVST  886
                 +++A       + W S++   + +K+  R  +GD ++ +     W        VS 
Sbjct  1273  REDSILDAKRQRYQSYGWTSMLAGLDVIKKGSRFIVGDGKTGSY--RYWNAHLISQLVSP  1330

Query  887   HLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVRVFAWK  1048
               H  V    +S +++     W+       +++     +  +P+ PK++   W+
Sbjct  1331  DDHRFVMNHHLSRIVHQDKLVWN-------YSSSGDYTLWKLPIIPKIKYMLWR  1377



>ref|XP_009123205.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=529

 Score =   154 bits (390),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 104/328 (32%), Positives = 159/328 (48%), Gaps = 15/328 (5%)
 Frame = +2

Query  8    NRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNY  187
            N  R G L G+QV++ +P ++H+LFADD  LF + N      +K IL  Y  +SGQ +N 
Sbjct  87   NAQRNGSLLGLQVSQRSPYVNHLLFADDTMLFCKTNERNCRVLKAILRRYELSSGQCINL  146

Query  188  DKSLSVF*YQYRSG*Q-NCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRI  364
            +KS   F  +     +          Q GG     GKYLGLP   G++K+ +   + D I
Sbjct  147  EKSSVTFSSKTPESIRIRVKAMLGINQEGG----MGKYLGLPETFGRSKRDVFTGMVDNI  202

Query  365  LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
                  W T FLS AG  V+L++VL +LP+Y+M  F + ++LC+ I+ IL  FWW     
Sbjct  203  RQRAHSWTTRFLSGAGKHVMLQSVLTSLPTYSMSSFKIPVSLCKRIQSILTRFWWDSSPD  262

Query  545  RRLGIRWKAWKALCTKIKRWLGVYDLKGDEP------GTQTWRLLTRPDSLVERVFKSRY  706
            +R  I W AW  +     ++LG    K  E       G  +WR+   PDSL+ +V K +Y
Sbjct  263  KR-KIAWVAWSDMAK--PKYLGGLGFKNIEDYNDSLLGKLSWRIYCNPDSLLAQVLKGKY  319

Query  707  YPNSDLMNAVGHN-PLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
            +P+   +++V  +     W SI+     +K+     IG+  S  +  D WL  +E     
Sbjct  320  FPDDSFLDSVEKSGSSHGWSSILAGKEVLKKGLGYIIGNGESIKVWSDHWLSASESIAPI  379

Query  884  THLHESVREAPVSSLMNGVGTSWDRDCI  967
                   +   V+ L+N     WD + I
Sbjct  380  GPPTFDNQNLLVADLLNPQTNDWDLEKI  407



>ref|XP_010451785.1| PREDICTED: uncharacterized protein LOC104733961 [Camelina sativa]
Length=1297

 Score =   158 bits (400),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 109/340 (32%), Positives = 166/340 (49%), Gaps = 25/340 (7%)
 Frame = +2

Query  38    VQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*YQ  217
              +V+   P ISH+LFADD   F RA  E+   + GIL  Y   SGQ +N+ KS   F   
Sbjct  662   TEVSTACPAISHLLFADDSLFFCRATKEQCEVILGILRQYERVSGQRINFQKSSVQF---  718

Query  218   YRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRILSWVRGW  385
                G     D R   + G  G TT      YLG+P  +G +K  I  FV+DR+     GW
Sbjct  719   ---GHTVAIDVREDLK-GILGITTLGGMNSYLGIPESLGGSKTKIFSFVQDRLQKRAGGW  774

Query  386   NT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRW  565
                 LSR G EV++K+V  A+P++ M  F +  T+ R++   +++FWW+     R G+ W
Sbjct  775   PARLLSRGGKEVMIKSVATAVPTFVMSCFRIPKTVTRKLTSAISNFWWSSTGETR-GLHW  833

Query  566   KAWKALCT-KIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA  733
              AW  LCT K +  LG   + D        Q WRL++ PDSL  +V K RYY   D ++ 
Sbjct  834   IAWDKLCTDKREGGLGFRCLDDFNTALLAKQLWRLISAPDSLFAKVLKGRYYRQLDPLDP  893

Query  734   V-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS----THLHE  898
             +  ++P + WRS++   + V +     +G   S  +  D W + A+ P  +    + +  
Sbjct  894   IKSYSPSYGWRSMISARSLVNKGLIKRVGSGASILVWTDPW-IPAQSPRPALRSGSPIDP  952

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             ++R   V + ++    SWD   +   F   D   I  IP+
Sbjct  953   TLR---VETFIDRASQSWDLALLSASFEPEDVALISAIPL  989



>ref|XP_010518579.1| PREDICTED: uncharacterized protein LOC104793852 [Camelina sativa]
Length=1098

 Score =   157 bits (398),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 116/349 (33%), Positives = 169/349 (48%), Gaps = 24/349 (7%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G L  +++    P I H+LFADD     RA  +E +     L LY   SGQ +N+ KS  
Sbjct  428   GRLTCLRLTPFIPSIQHLLFADDSLFLCRATFQECSEFLACLQLYGRTSGQEINFQKSTI  487

Query  203   VF*YQYRSG*QNCSD*RSQRQAG-----GSGDTTGKYLGLPSLVGKNKKAILGFVKDRIL  367
              F  +         D   +R  G        + T KYLGLP     +K+A+L F+ DR+ 
Sbjct  488   TFGKKM--------DPYMKRIVGLFTGIEQEEGTSKYLGLPECFSGSKRALLNFITDRLK  539

Query  368   SWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVAR  547
             S + GW    LS  G EVLLK+V  ALP YAM  F L+   C  I   +  FWW  +   
Sbjct  540   SRLGGWYEKTLSLGGKEVLLKSVAIALPVYAMSCFRLTKHQCHLITSTMASFWWK-ESED  598

Query  548   RLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPN  715
             +  + W +W+ LC +K    LG  D+          Q WRLL  P SL+ RV+K++YY +
Sbjct  599   KHKMHWVSWEKLCASKESGGLGFKDIGRFNQALLAKQAWRLLDSPTSLLARVYKAKYYAD  658

Query  716   SDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHL  892
             + L+ A +G+ P + WRSI+     +++    SIGD +ST I  D W +  E P    + 
Sbjct  659   TSLLKATIGYRPSYAWRSIMFGRELLEKGVMKSIGDGKSTNIWLDRW-IFDESPRRPFNR  717

Query  893   HESVR-EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVRV  1036
                +     VS+L+   G  W+  CI+      D + I   P PP++ +
Sbjct  718   EMQIDLNLKVSTLITSEG-GWN-TCILHRLFPPD-DVIKIQPFPPELSI  763



>ref|XP_008365211.1| PREDICTED: putative ribonuclease H protein At1g65750 [Malus domestica]
Length=458

 Score =   153 bits (387),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 106/348 (30%), Positives = 171/348 (49%), Gaps = 19/348 (5%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I   + RG LHG +++    P++H+ FADD  +F  A+ EE+ ++  +L  Y    GQ +
Sbjct  3     ITRSLERGALHGFKISPIGVPLTHLFFADDSVVFGNASVEEAKSIVEVLKTYARGFGQEI  62

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAG-GSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
             N  KS SVF   + +    C   +     G       GKYLGL +  G +KK +   ++D
Sbjct  63    NLTKS-SVF---FGANSPKCLKAKIVDTLGIQCKQGFGKYLGLQADFGHSKKVVFAEIRD  118

Query  359   RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
             +I + + GW   +LS+AG ++L+K V  ALP++AM  F L I +CR++E+ + ++WW G 
Sbjct  119   KIEARMSGWAEQYLSQAGKKILVKTVAMALPNFAMSCFKLPIGMCRDVEMAIRNYWWRGN  178

Query  539   VARRLGIRWKAWKALCTKIKR-WLGVYDLKGDEPGTQT---WRLLTRPDSLVERVFKSRY  706
                + GI W +W  L  + K   LG  D++           WR+   P SL+  V + +Y
Sbjct  179   EQHK-GIHWISWDWLMKQKKAGGLGFKDIQCVNLAFLAKIGWRITQNPSSLLASVLRDKY  237

Query  707   YPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVS  883
             +P      A  G    + W+ + E    ++   R  +G+  +  I KD W      P  S
Sbjct  238   FPGKTFGEAPKGKFTSWGWKCLFEARKVLQLGLRWRVGNGYNINIRKDPWF-----PKPS  292

Query  884   THLHE---SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             T   +   ++    VS L++    SW  D I + FN  D   IL+IP+
Sbjct  293   TFKAKPKVNLEGTKVSDLIDPATNSWRTDMISNGFNRDDVLLILSIPL  340



>gb|AAD32950.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=773

 Score =   156 bits (395),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 106/338 (31%), Positives = 165/338 (49%), Gaps = 17/338 (5%)
 Frame = +2

Query  2    IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
            I   ++   LHG + +R  P ISH+LFA D  +F +A  EE   +  +L LY  ASGQ V
Sbjct  110  IQASIKAKQLHGFKASRNGPAISHLLFAHDSLVFCKATLEECMTLVNVLKLYEKASGQAV  169

Query  182  NYDKSLSVF*--YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVK  355
            N+ KS  +F     +R+     S+  SQ       +  G+YLGLP  VG+NK     F+ 
Sbjct  170  NFQKSAILFGKGLDFRT-----SEQLSQLLGIYKTEGFGRYLGLPEFVGRNKTNAFSFIA  224

Query  356  DRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTG  535
              +   +  W    LS AG EVL+K+++ A+P+Y+M  F L + L  +I   +  FWW+ 
Sbjct  225  QTMDQKMDNWYNKLLSPAGKEVLIKSIVTAIPTYSMSCFLLPMRLIHQITSAMRWFWWSN  284

Query  536  KVARRLGIRWKAWKALCTKIKR-WLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSR  703
               +   I W AW  L    K   L + DLK         Q+WR+L +P SL+ RVFK++
Sbjct  285  TKVKH-KIPWVAWSKLNDPKKMGGLAIRDLKDFNIALLAKQSWRILQQPFSLMARVFKAK  343

Query  704  YYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVM-AEDPY  877
            Y+P   L++A       + W+SI+     + +  +   G+  +  + KD WL +    P 
Sbjct  344  YFPKERLLDAKATSQSSYAWKSILHGTKLISRGLKYIAGNGNNIQLWKDNWLPLNPPRPP  403

Query  878  VSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARD  991
            V T       +  VS L+  +   W+ D +  + +  D
Sbjct  404  VGT-CDSIYSQLKVSDLL--IEGRWNEDLLCKLIHQND  438



>gb|AAB84340.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis 
thaliana]
Length=1094

 Score =   157 bits (398),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 110/348 (32%), Positives = 170/348 (49%), Gaps = 12/348 (3%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G + G+Q     P ++H+LFADD  L  +A+  E A +   L  Y   SGQ++N +KS  
Sbjct  391   GKISGIQFNGTGPSVNHLLFADDTLLICKASQLECAEIMHCLSQYGHISGQMINSEKSAI  450

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRG  382
              F  +     +     RS  Q  G    TGKYLGLP     +K+ + GF+K+++ S + G
Sbjct  451   TFGAKVNEETKQWIMNRSGIQTEGG---TGKYLGLPECFQGSKQVLFGFIKEKLQSRLSG  507

Query  383   WNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIR  562
             W    LS+ G ++LLK++  A P YAM  F LS TLC ++  ++  FWW   V  +  I 
Sbjct  508   WYAKTLSQGGKDILLKSIAMAFPVYAMTCFRLSKTLCTKLTSVMMDFWWNS-VQDKKKIH  566

Query  563   W-KAWKALCTKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
             W  A K +  K     G  DL+         Q  RL T  DSL+ ++ KSRYY NSD ++
Sbjct  567   WIGAQKLMLPKFLGGFGFKDLQCFNQALLAKQASRLHTDSDSLLSQILKSRYYMNSDFLS  626

Query  731   AV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVR  907
             A  G  P + W+SI+     +    +  IG+  +T +  D W +  + P     L   V 
Sbjct  627   ATKGTRPSYAWQSILYGRELLVSGLKKIIGNGENTYVWMDNW-IFDDKPRRPESLQIMVD  685

Query  908   -EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI-PVPPKVRVFAW  1045
              +  VS L++    +W+ + + D+F  ++   I    P+  +   F W
Sbjct  686   IQLKVSQLIDPFSRNWNLNMLRDLFPWKEIQIICQQRPMASRQDSFCW  733



>ref|XP_010451493.1| PREDICTED: uncharacterized protein LOC104733622 [Camelina sativa]
Length=1031

 Score =   157 bits (398),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 106/352 (30%), Positives = 167/352 (47%), Gaps = 35/352 (10%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             R  ++ G++VA   PPI+H+LFADD   F +A+  +   +  IL  Y   SGQ +N+ KS
Sbjct  350   RDKLITGIKVANKCPPITHLLFADDSLFFCKADVGQCRVILDILKQYESVSGQQINFSKS  409

Query  197   LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRI  364
                F ++         D +        G TT    G YLGLP  +G  K  +  FV++RI
Sbjct  410   SVQFGHKI-------DDHKKTELQDVLGITTLGGMGSYLGLPESLGGAKTKVFSFVRERI  462

Query  365   LSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVA  544
              S   GW    LS+ G EV++K+V  A+ ++ M  F L  T+  ++   + +FWW+    
Sbjct  463   QSQTNGWTANLLSKGGREVMIKSVATAVLTFVMSCFRLPKTITSKLTSAVANFWWSTN-G  521

Query  545   RRLGIRWKAWKALCTKIKRWLG------VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRY  706
             +  G+ W AW+ +C  + + LG      V D        Q WRL+  P SL  RVFKSRY
Sbjct  522   QTGGMHWLAWEKIC--VSKQLGGLGFRNVDDFNSALLAKQLWRLIDVPQSLFARVFKSRY  579

Query  707   YPNSDLMNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-------VM  862
             Y N+  M+ +  ++P + WRSI    + V +     +G   + +I  D WL        +
Sbjct  580   YRNTHPMDPIRSYSPSYGWRSICSARSLVNKGLIKRVGSGDTISIWSDPWLPAQFPRPAL  639

Query  863   AEDPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             ++ P     L        ++  ++    SW  D + + F+  D   I  IP+
Sbjct  640   SKGPLKDPSLQ-------MNQFIDRQTNSWCVDMLNEHFDPLDVALIRAIPL  684



>ref|XP_010451584.1| PREDICTED: uncharacterized protein LOC104733725 [Camelina sativa]
Length=1267

 Score =   157 bits (398),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 112/354 (32%), Positives = 169/354 (48%), Gaps = 29/354 (8%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I    R   L G+ +AR +P +SH+LFADD   F +A   E   +  I+  Y  ASGQ V
Sbjct  556   IKKAERDKKLTGISIARDSPSVSHLLFADDSLFFCKAEESECRTVISIIGNYGKASGQEV  615

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQ-------RQAGGSGDTTGKYLGLPSLVGKNKKAI  340
             N  KS  +F      G +   + R+Q        Q GG     G YLG+P  +  +K  +
Sbjct  616   NLTKSSIMF------GKKVPPEIRAQLKSVIGISQEGG----MGSYLGIPENLQGSKTKV  665

Query  341   LGFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNH  520
               +VKDR+   V GW+   LS+ G EV++K+V  ALP++ M  + L+  L  ++   ++ 
Sbjct  666   FSYVKDRLDDRVNGWSAKLLSKGGKEVMIKSVALALPTHVMSCYKLTQDLTSKLTSAISS  725

Query  521   FWWTGKVARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVER  688
             FWW      R G+ W AW  +C  K    LG   L+         Q WRL+  PDSL+ R
Sbjct  726   FWWKSNDKAR-GMHWLAWDKMCKEKCDGGLGFRALEQFNDAMLAKQYWRLIHYPDSLMAR  784

Query  689   VFKSRYYPNSD-LMNAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMA  865
             V K RY+ N   +M    +NP F WRSI    + V++  R ++G   S ++ +D WL   
Sbjct  785   VMKGRYFRNQHPIMAKKSYNPSFAWRSIYSTKDLVEEGARWTVGSGVSISVWRDPWLPDV  844

Query  866   EDPYVSTH---LHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                  +     LH ++    V+ L+N +   W    + +  +  D   I N+ V
Sbjct  845   RPRPANGRGRLLHPNLM---VNHLINPITKDWHLPILEEFMDPVDIQLIRNMAV  895



>ref|XP_009127418.1| PREDICTED: uncharacterized protein LOC103852254 [Brassica rapa]
Length=1129

 Score =   157 bits (397),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 106/340 (31%), Positives = 166/340 (49%), Gaps = 12/340 (4%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             ++G++ G+++A   P + H+LFADD F   RA+  E A     L LY  +SGQ++N+ KS
Sbjct  420   QQGLISGMKLAPNCPTVQHLLFADDSFFLCRASLPECAEFLRRLKLYGESSGQVINFQKS  479

Query  197   LSVF*YQYRSG*QN-CSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
                F        +   ++       GG     GKYLGLP     +KK +L ++ +++   
Sbjct  480   AITFGVGIDPVLKRLLAEFLDIENEGGD----GKYLGLPECFSGSKKKLLAYIGEKMSKR  535

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             +RGW    LS  G EVLLK++  ALP YAM  F L+   C++I   +  FWW     +R 
Sbjct  536   LRGWFAKKLSLGGKEVLLKSIALALPVYAMSCFRLTKHHCQKIMSAMASFWWDECDEKR-  594

Query  554   GIRWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
              I W +W+ LC +K    +G  D++         Q WRLL  P SL+ R++K RYY N  
Sbjct  595   KIHWISWEKLCISKENGGMGFRDIEDFNQALLAKQAWRLLNDPSSLLARIYKGRYYANKG  654

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
              M    G+ P + WRSI+     + +    SIGD ++T +    W +M + P    +   
Sbjct  655   FMECGKGYRPSYAWRSILFGRELLSKGLIRSIGDGQTTLVWSQKW-IMDDIPRRPINKEV  713

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
                     S +      WD+D +  +F   +   IL++ +
Sbjct  714   CFDVNLKVSTLKLNEKQWDKDKLQTLFPINEVERILHMDI  753



>gb|AAO00713.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1557

 Score =   157 bits (398),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 174/349 (50%), Gaps = 25/349 (7%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             ++ ++ +G +  ++V   AP ISH+LFADD  LF +A+  +S  +K +   Y  ++GQL+
Sbjct  1024  LEEKVEQGAISPIRVCHQAPGISHLLFADDTLLFFKADLSQSQAIKEVFGSYATSTGQLI  1083

Query  182   NYDKSLSVF*YQY----RSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGF  349
             N  K   +F        R    NC           S +   KYLGLP+  G+  K     
Sbjct  1084  NPTKCSILFGNSLPIASRDAITNC-------LQIASTEFEDKYLGLPTPGGRMHKGRFQS  1136

Query  350   VKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW  529
             +++RI   +  W   +LS  G EVL+K V+QA+P Y M IF L  ++C ++  +  +FWW
Sbjct  1137  LRERIWKKILQWGENYLSSGGKEVLIKAVIQAIPVYVMGIFKLPESVCEDLTSLTRNFWW  1196

Query  530   TGKVARRLGIRWKAWKALCTKIKRW--LGVYDLKGDEPGT---QTWRLLTRPDSLVERVF  694
               +  +R    WKAWK+L TK K    LG  D++         Q WRL+  PDSL  RV 
Sbjct  1197  GAEKGKR-KTHWKAWKSL-TKSKSLGGLGFKDIRLFNQALLARQAWRLIDNPDSLCARVL  1254

Query  695   KSRYYPNSDLMN-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV--MA  865
             K++YYPN  +++ + G N    W++I      VK+     IG+ RS  + +D WL   ++
Sbjct  1255  KAKYYPNGSIVDTSFGGNASPGWQAIEHGLELVKKGIIWRIGNGRSVRVWQDPWLPRDLS  1314

Query  866   EDPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
               P    +   + R   V+ LM   G  WD + I  +F   D   IL +
Sbjct  1315  RRPITPKN---NCRIKWVADLMLDNGM-WDANKINQIFLPVDVEIILKL  1359



>gb|AAP54692.2| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=1585

 Score =   157 bits (398),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 174/349 (50%), Gaps = 25/349 (7%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             ++ ++ +G +  ++V   AP ISH+LFADD  LF +A+  +S  +K +   Y  ++GQL+
Sbjct  1052  LEEKVEQGAISPIRVCHQAPGISHLLFADDTLLFFKADLSQSQAIKEVFGSYATSTGQLI  1111

Query  182   NYDKSLSVF*YQY----RSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGF  349
             N  K   +F        R    NC           S +   KYLGLP+  G+  K     
Sbjct  1112  NPTKCSILFGNSLPIASRDAITNC-------LQIASTEFEDKYLGLPTPGGRMHKGRFQS  1164

Query  350   VKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWW  529
             +++RI   +  W   +LS  G EVL+K V+QA+P Y M IF L  ++C ++  +  +FWW
Sbjct  1165  LRERIWKKILQWGENYLSSGGKEVLIKAVIQAIPVYVMGIFKLPESVCEDLTSLTRNFWW  1224

Query  530   TGKVARRLGIRWKAWKALCTKIKRW--LGVYDLKGDEPGT---QTWRLLTRPDSLVERVF  694
               +  +R    WKAWK+L TK K    LG  D++         Q WRL+  PDSL  RV 
Sbjct  1225  GAEKGKR-KTHWKAWKSL-TKSKSLGGLGFKDIRLFNQALLARQAWRLIDNPDSLCARVL  1282

Query  695   KSRYYPNSDLMN-AVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLV--MA  865
             K++YYPN  +++ + G N    W++I      VK+     IG+ RS  + +D WL   ++
Sbjct  1283  KAKYYPNGSIVDTSFGGNASPGWQAIEHGLELVKKGIIWRIGNGRSVRVWQDPWLPRDLS  1342

Query  866   EDPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
               P    +   + R   V+ LM   G  WD + I  +F   D   IL +
Sbjct  1343  RRPITPKN---NCRIKWVADLMLDNGM-WDANKINQIFLPVDVEIILKL  1387



>ref|XP_009151565.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=445

 Score =   152 bits (385),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 97/315 (31%), Positives = 150/315 (48%), Gaps = 17/315 (5%)
 Frame = +2

Query  38   VQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF*YQ  217
            ++V R  P +SH+LFADD   F +A   E   +  ++  Y  ASGQ +N+DKS  +F  +
Sbjct  1    MRVTRACPSVSHLLFADDSLFFCKAEPRECEEIMKVVRKYGHASGQCINFDKSSLLFGKR  60

Query  218  YRS-G*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT*  394
                  Q   D    +  GG     G YLG+P  +  +K  +  F+KD+++  V GW   
Sbjct  61   ISVIARQEIKDVLGIQNEGG----MGTYLGIPEDISGSKCKLFAFLKDKLMHRVNGWTCR  116

Query  395  FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKAW  574
            +LS+ G EVL+K++L ALP+Y M  F L + +C  +   +  FWW+    +R GI W  W
Sbjct  117  WLSKGGKEVLIKSILLALPTYVMSTFLLPLEICENLASAIAQFWWSSNPPKR-GIHWAKW  175

Query  575  KALCTKIKR----WLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYP-NSDLMNAVG  739
              +C   +     +  +++        Q WRL+  PDSLV RV + RYY   S L     
Sbjct  176  DKVCLPREEGGIGFRMIHEFNLALLAKQLWRLVQFPDSLVARVLRGRYYRLCSPLRVNAA  235

Query  740  HNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL---VMAEDPYVSTHLHESVRE  910
              P ++W SI    N +    R  I       + +D W+          ++  +H ++R 
Sbjct  236  TGPSYVWTSISAARNLLLLGIRQKIHSGYEVKVWEDPWIPTNPARPAAPMAPVMHPNMR-  294

Query  911  APVSSLMNGVGTSWD  955
              VS L+N     WD
Sbjct  295  --VSDLINQESKDWD  307



>ref|XP_009124968.1| PREDICTED: uncharacterized protein LOC103850017 [Brassica rapa]
Length=1053

 Score =   157 bits (396),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 107/329 (33%), Positives = 159/329 (48%), Gaps = 17/329 (5%)
 Frame = +2

Query  20   RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             G + G +VARG+P I+H+LFADD   FL A+   +  +K IL  Y  ASGQ +N +KS 
Sbjct  367  EGRMRGFKVARGSPRINHLLFADDTMFFLNADKGSTEELKAILSRYEKASGQSINKEKSS  426

Query  200  SVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
              F    ++  +      S+ Q    G   GKYLGLP   G+ K+ +   + +RI     
Sbjct  427  ITF--SRKAPRELKQRVHSELQIQNEGGV-GKYLGLPEHFGRRKRDLFTSIIERIKQKAE  483

Query  380  GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
            GW+T FLS AG  V+L++VL  +PS+AM  F L ++LC+ IE  L  FWW  +  +R  +
Sbjct  484  GWSTRFLSPAGKLVMLQSVLTPIPSHAMSCFKLPVSLCQRIETALKRFWWDDRTGKR-KM  542

Query  560  RWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLM  727
             W +W  L   K    LGV D++          +WRLL +P  L+ R   S+Y P+ + +
Sbjct  543  AWISWPKLTLPKSNGGLGVRDIQAFNEAYLAKISWRLLEKPHGLLGRTLLSKYCPDGNFL  602

Query  728  -----NAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHL  892
                 ++  H     W SI+   + + +     IGD  S  I +D WL +          
Sbjct  603  ACSSPSSASHG----WHSILAGRDLLNKNLGWVIGDGNSINIWEDQWLSLDSPIRPMGPA  658

Query  893  HESVREAPVSSLMNGVGTSWDRDCIIDVF  979
             E+     V  L+      WDR  I  + 
Sbjct  659  TETSANLLVKDLILPGSGEWDRARIQQIL  687



>ref|XP_010468536.1| PREDICTED: uncharacterized protein LOC104748626 [Camelina sativa]
Length=957

 Score =   156 bits (395),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 105/337 (31%), Positives = 165/337 (49%), Gaps = 24/337 (7%)
 Frame = +2

Query  29   LHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLSVF  208
            + G++VA   PPI+H+LFADD   F + + ++   +  IL  Y G SGQ  N  KS    
Sbjct  391  ITGIKVANKCPPITHLLFADDSLFFCKVDKDQCLAILEILRQYEGVSGQQFNLAKSSIQL  450

Query  209  *YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRILSWV  376
             +   +  Q            G G T     G YLG+P  +G +K  +  +V+DR+ S  
Sbjct  451  GHTVDTVVQTEIQGVLGITNRGLGITNLGGMGSYLGIPESLGGSKIKVFSYVRDRLQSHT  510

Query  377  RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
             GW+   LS+ G EV++K+V  A+P++ M  + L  T+  ++   + +FWW+    +  G
Sbjct  511  TGWSARLLSKGGKEVMVKSVAMAVPTFVMSCYRLPKTITSKLTSAVANFWWSTN-GQSGG  569

Query  557  IRWKAWKAL-CTKIKRWLG---VYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDL  724
            + W AW+ L C+K    LG   V D        Q W+L+  PDSL  RVFKSRYY NSD 
Sbjct  570  MHWIAWERLYCSKQLGGLGFKRVDDFNTALLAKQLWKLIEFPDSLFARVFKSRYYRNSDP  629

Query  725  MNAV-GHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-------VMAEDPYV  880
            M+ +  ++P + WRSIV   + V +     +G   S  I  D W+        ++  P+ 
Sbjct  630  MDPIRSYSPSYGWRSIVSARSLVNKGLITRVGSGTSIFIWSDPWIPAQFPRPALSNGPFK  689

Query  881  STHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNARD  991
              +L        +  L++    SW +D +   F++ D
Sbjct  690  DPNLR-------IPHLIDRYTNSWRKDLLTQHFDSMD  719



>ref|XP_010667928.1| PREDICTED: uncharacterized protein LOC104884923 [Beta vulgaris 
subsp. vulgaris]
Length=834

 Score =   155 bits (393),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 97/265 (37%), Positives = 143/265 (54%), Gaps = 10/265 (4%)
 Frame = +2

Query  281   DTTGKYLGLPSLVGKNKKAILGFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYA  460
             D   KYLG+PS+ G++KK I   + DRI   ++GW    LSRAG  VLLK V+QA+P+Y 
Sbjct  262   DKHEKYLGIPSIAGRSKKVIFDSLLDRIWKKLQGWKEKLLSRAGKAVLLKAVIQAIPTYL  321

Query  461   MMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP  637
             M ++     + ++I+  +  FWW    A+R  I WK W+A+CT K    +G  DL     
Sbjct  322   MGVYKFPAVIIQKIQAAMVRFWWGSSDAKR-KIHWKNWEAMCTLKCLGGMGFKDLAVFND  380

Query  638   ---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-VGHNPLFIWRSIVEVNNAVKQWYR  805
                G Q WRLLT P SL+ RV K++Y+P+ D ++A +G++  + WRSI      VK+   
Sbjct  381   ALLGRQAWRLLTVPHSLLGRVMKAKYFPSCDFLDASLGYSCSYSWRSIWSAKALVKEGLI  440

Query  806   GSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREAPVSSLMNGVGTSWDRDCIIDVFNA  985
               +G+     I +  W+      Y+S+     +    V+ L++   T W  D I +VFN 
Sbjct  441   WRVGNGVDINIWEAPWVGDEHGKYISSPRQPEL--LTVNQLIDPSSTEWRLDIIEEVFND  498

Query  986   RDANCILNIPV--PPKVRVFAWKLA  1054
             RD  CIL IP+   P   V  W L+
Sbjct  499   RDKKCILAIPLCPTPSHDVLTWSLS  523



>ref|XP_009108635.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=770

 Score =   155 bits (392),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 100/339 (29%), Positives = 168/339 (50%), Gaps = 18/339 (5%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G + G++++   P + H+LFADD  L  +AN+ E+  +   L  Y  ASGQ++N  KS  
Sbjct  92    GRIQGIKLSPACPSVHHLLFADDSLLMCKANSTEATEILECLKKYGEASGQVINLQKSSI  151

Query  203   VF*YQYRSG*-QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
             +F  +      ++  +     Q GG G     YLGLP     +K+ +L F+++++   ++
Sbjct  152   IFGAKVPDNIKEDVKNVLGIVQEGGEGS----YLGLPECFSGSKRKLLSFIREKLQGRLK  207

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
             GW +  LS+ G E+LLK+V  ALP +AM  F L   LC ++   +  FWW+    ++  I
Sbjct  208   GWFSKSLSQGGKEILLKSVALALPVFAMSCFKLPKDLCAKLTSAMIEFWWSNGTNKK-KI  266

Query  560   RWKAWKALCTKIKRWLGVYDLKGDEP------GTQTWRLLTRPDSLVERVFKSRYYPNSD  721
              W AW+ LC   +  LG    K  E         Q WR+   PDSL+ R+ + RY+P S 
Sbjct  267   SWIAWQKLCKDKE--LGGLGFKDIEKFNQALLAKQAWRVWKHPDSLLARILQHRYFPRSS  324

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
              +   +G  P + WRSI      +K+     +G+  +T I  D W++  + P    +  +
Sbjct  325   FLECGIGTRPSYAWRSIQHGWELLKKGLLHKLGNGANTKIWTDCWII-DKVPRAPRYRQD  383

Query  899   SVRE--APVSSLMNGVGTSWDRDCIIDVFNARDANCILN  1009
             ++ +    V  L+N     W+   +  +F   D + +LN
Sbjct  384   AIVDLTLTVDHLINPASKRWNETRVRQLFEEEDVSIVLN  422



>ref|XP_009118503.1| PREDICTED: uncharacterized protein LOC103843513 [Brassica rapa]
Length=732

 Score =   154 bits (390),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 101/322 (31%), Positives = 158/322 (49%), Gaps = 9/322 (3%)
 Frame = +2

Query  17   RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
            R G L GV+VARG+P I+H+LFADD   F R+N    +++  I+ LY   SGQ +N+ KS
Sbjct  90   RDGSLSGVRVARGSPAINHLLFADDTMFFCRSNPMSVSSLLRIIRLYESLSGQSINFAKS  149

Query  197  LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
               F    ++  +  +  +S       G   GKYLGLP   G+ K+ I   + DRI    
Sbjct  150  SITF--SAKTPPEVKARVKSTLAITAEGGL-GKYLGLPEHFGRKKRDIFASILDRIRQKT  206

Query  377  RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
              W   FLS AG E+LLK VL A+P+Y M  F + ++LC++I+ +L  FWW     ++  
Sbjct  207  LSWKNRFLSGAGKEILLKAVLTAMPAYTMSCFKIPLSLCKQIQSLLTRFWWDANPEQK-K  265

Query  557  IRWKAWKALC-TKIKRWLGVYDLKGDEPGTQT---WRLLTRPDSLVERVFKSRYYPNSDL  724
            + W AW  L   K    LG +D++           WRL+  P+SL+ +V   +Y   +  
Sbjct  266  MCWVAWDTLTLPKYAGGLGFWDIETFNDALLAKIGWRLIHSPNSLLAQVLLGKYARYTSF  325

Query  725  MNAVGHNPL-FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
            ++    + +   WR I+     +K+     +G      + +D WL           ++  
Sbjct  326  LDCTAPSSMSHGWRGILAGREILKKGLGWIVGSGEKIRVWQDPWLSCVSPQAPIGPINHQ  385

Query  902  VREAPVSSLMNGVGTSWDRDCI  967
              +  VS L+  +  SWD+D I
Sbjct  386  DAQLRVSDLLCPISNSWDKDKI  407



>ref|XP_009140200.1| PREDICTED: putative ribonuclease H protein At1g65750 [Brassica 
rapa]
Length=1086

 Score =   156 bits (395),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 109/335 (33%), Positives = 161/335 (48%), Gaps = 15/335 (4%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G L G++VARG P ++H+LFADD   F++AN E ++ +K IL  Y  ASGQ +N +KS  
Sbjct  411   GQLTGIRVARGCPQVNHLLFADDTMFFVKANKENASALKAILQQYESASGQAINTNKSSI  470

Query  203   VF*YQYRSG*QN-CSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
              F  +     +    D     + GG     GKYLGLP   G+ K+ +   + DRI     
Sbjct  471   TFSRKAPLSLKTMIKDCLHIPKEGG----VGKYLGLPEHFGRKKRDLFTSIVDRIKVKSS  526

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
             GW+  FLS AG  V+LK+VL  +PSY+M  F L  +LC+ I+  +  FWW G+   R  +
Sbjct  527   GWSNKFLSTAGKMVMLKSVLTPVPSYSMTCFKLPRSLCKRIQSAVTRFWWDGRSGNR-KM  585

Query  560   RWKAWKALCTKIKR--WLGVYDLKGDEPGTQT---WRLLTRPDSLVERVFKSRYYPNSDL  724
              W +W  + TK K+   LG  D +           WR+   P  L+ RV   +Y  ++  
Sbjct  586   AWVSWDKM-TKSKQDGGLGFRDFESFNDAYLAKLGWRIHNNPSGLLSRVLTGKYCTDTPF  644

Query  725   MNAVGHNPL--FIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
             +  V H       WR ++   + +      ++G+  S  I  D WL  +E         E
Sbjct  645   LQ-VAHRSAESHGWRGVLIGRDLMMSNAGWALGNGESINIWSDPWLSHSEQARPMGPAPE  703

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCI  1003
                   V  LM   GT W+R+ I  VF   +A  +
Sbjct  704   QFIHWTVKKLMLPNGTDWNREIIQQVFPHEEARIL  738



>ref|XP_010495271.1| PREDICTED: uncharacterized protein LOC104772340 [Camelina sativa]
Length=906

 Score =   155 bits (393),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 107/352 (30%), Positives = 169/352 (48%), Gaps = 18/352 (5%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G ++G+Q +   P I H LF DD    ++A+ E+++ +KGIL  Y   +GQ++N++KS  
Sbjct  215   GQINGIQFSPQGPSIHHPLFVDDSLFLIKASVEQASTLKGILSEYGDVTGQMINFEKSSI  274

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDT-TGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
              F  +   G +N    + Q + G   +    KYLGLP     +K  +L ++ D + S + 
Sbjct  275   TFGSKVEDGIRN----QIQVKLGIVKEGGASKYLGLPECFSCSKIDMLAYIHDNMKSRMS  330

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
             GW    LS+ G E+LLK V  A+P +AM  F L    C  +   ++ FWW     +R  +
Sbjct  331   GWFARSLSQGGKEILLKAVAMAMPIFAMSCFKLPKKTCENLTSAMSAFWWDSIEDKR-KM  389

Query  560   RWKAWKALC-TKIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLM  727
              W  W  LC  K    LG  D++         Q  R+L   +SL    FKSRY+   D +
Sbjct  390   HWIGWDKLCLPKHLGGLGFKDIQIFNQALLAKQASRILQDDNSLFALFFKSRYFEEGDFL  449

Query  728   NA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESV  904
             ++ +G  P + WRSI+   + +K+  R  IGD  S  +    W++   D  +   L +++
Sbjct  450   SSDLGERPSYAWRSILHGRDLLKRGLRQMIGDGESVMVWSSRWIL---DGVMRAPLMKNI  506

Query  905   ---REAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNI-PVPPKVRVFAWK  1048
                 +  V  L++    SWDR  +   F  RD   I    PVP     F W+
Sbjct  507   IFNLDLKVKDLIDVESHSWDRTKLHYHFYPRDVELICKFKPVPRSNDFFIWE  558



>ref|XP_010456858.1| PREDICTED: uncharacterized protein LOC104738371 [Camelina sativa]
Length=269

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/249 (39%), Positives = 129/249 (52%), Gaps = 24/249 (10%)
 Frame = +2

Query  20   RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
            +G L G       P I H+LFADD F   RA+ EE   +   L LY  ASGQ++N+ KS 
Sbjct  7    QGRLTGFSFNDSCPVIQHLLFADDSFFISRASKEECEEIMHCLHLYGKASGQVINFTKSA  66

Query  200  SVF*YQYRSG*QNCSD*R-------SQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKD  358
              F      G +   + +       +  + GG    T  YLGLP     +K A+LGF+ D
Sbjct  67   VTF------GKKTPEEVKVIVKQTLNIFEEGG----TSSYLGLPECFSGSKHALLGFIGD  116

Query  359  RILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGK  538
            ++ S  +GW    LS  G EVLLK V  ALP YAM  F LS  LCR++   +  FWW+  
Sbjct  117  KLQSRFQGWFAKSLSLGGKEVLLKAVAMALPVYAMSCFRLSKNLCRKLTSAMCEFWWSNC  176

Query  539  VARRLGIRWKAWKALC-TKIKRWLGVYDLKGDEP----GTQTWRLLTRPDSLVERVFKSR  703
              +R  I W AWK +C +K +  LG  DL GD        Q WR+L  P+SL+ R +KSR
Sbjct  177  QGKR-KIAWVAWKKMCKSKSEGGLGFRDL-GDFNQALLAKQAWRILNNPESLIGRFYKSR  234

Query  704  YYPNSDLMN  730
            Y+ +   +N
Sbjct  235  YFRSLHSLN  243



>ref|XP_010419021.1| PREDICTED: uncharacterized protein LOC104704671 [Camelina sativa]
Length=1180

 Score =   156 bits (394),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 117/355 (33%), Positives = 165/355 (46%), Gaps = 67/355 (19%)
 Frame = +2

Query  23    GMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSLS  202
             G + G+ VARGAPP+S+ILF+DD   + +   EE   +  ILD Y  ASGQ +NY KS  
Sbjct  674   GRISGLTVARGAPPVSNILFSDDNIFYCQHKDEELQCLMSILDEYNLASGQQINYQKSSI  733

Query  203   VF*YQYRSG*QNCSD*RSQRQAGGSGDTT----GKYLGLPSLVGKNKKAILGFVKDRILS  370
              F  Q         + R  R    +G T     G YLGLP   G +K  ILG+++DR+  
Sbjct  734   YFVKQ-------VPEDRRPRIKSLTGITEEGGEGFYLGLPEAFGGSKVTILGYLRDRLQQ  786

Query  371   WVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARR  550
              V GW++  LS  G E+LLK V  ALP++ M  F L                        
Sbjct  787   KVFGWHSNVLSPGGKEILLKAVALALPTHMMACFKLP-----------------------  823

Query  551   LGIRWKAWKALCTKIKRWLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYPNSDLMN  730
                     KA+C K+                  WR+L RPD+L+ R+FKS Y+   + + 
Sbjct  824   --------KAICQKM---------------ASLWRMLNRPDTLMARIFKSSYFSKLNPLQ  860

Query  731   A-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL------VMAEDPYVSTH  889
             A +G  P F WRSI E +  +KQ  R  IGD + T I K+ WL       +     +  H
Sbjct  861   AKLGSRPSFAWRSICEAHELIKQGARRVIGDGKLTDIWKEPWLSSKPARSLQRVNLIPPH  920

Query  890   LHESVRE-APVSSLMNGVGTSWDRDCIIDVFNARDANCILNI-PVPPKVR-VFAW  1045
             L   V   + V+ LM+  G +W RD    + +  D   I  + PV   ++ V++W
Sbjct  921   LKSLVSSLSRVNELMSDNGRNWRRDIQDLICSEEDMRLIEELRPVGKHIKDVYSW  975



>ref|XP_009124289.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103849230 
[Brassica rapa]
Length=1774

 Score =   156 bits (395),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 102/353 (29%), Positives = 168/353 (48%), Gaps = 19/353 (5%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             +G + G++V R  P +SH+LFADD   F +A   E   +  ++  Y  ASGQ +N+DKS 
Sbjct  613   QGKITGMRVTRACPSVSHLLFADDSLFFCKAEPRECEEVMKVVRKYGKASGQCINFDKSS  672

Query  200   SVF*YQYRSG*-QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWV  376
              +F  +      Q   D    +  GG     G YLG+P  +  +K  +  F+K++++  V
Sbjct  673   LLFGKRINVAMRQELKDVLGIQNEGG----MGTYLGIPEDISGSKCKLFAFLKEKLMHRV  728

Query  377   RGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLG  556
              GW   +LS+ G EVL+K++L ALP+Y M  F L + +C  +   +  FWW+    +R G
Sbjct  729   NGWTGRWLSKGGKEVLIKSILLALPTYVMSTFLLPLEICENLASAIAQFWWSSNPPKR-G  787

Query  557   IRWKAWKALCTKIKR----WLGVYDLKGDEPGTQTWRLLTRPDSLVERVFKSRYYP-NSD  721
             I W  W+ +C   +     +  +++        Q WRL+  PDSLV RV + RYY  +S 
Sbjct  788   IHWAKWEKVCLPREEGGIGFRMIHEFNLALLAKQLWRLVQFPDSLVARVLRGRYYRLSSP  847

Query  722   LMNAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL-VMAEDPY--VSTHL  892
             L      +P ++W SI      +    R  I       + +D W+      P   ++  +
Sbjct  848   LRVNTVTSPSYVWTSISAARKLLLLGIRQKIHSGHEVKVWEDPWVPTTPARPAIPIAPVM  907

Query  893   HESVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPVPPKVR--VFAW  1045
             H ++R   VS L++     WD   + +  +  D   I ++ +    R   F W
Sbjct  908   HPNMR---VSDLIDQASKEWDIGLLENYVSPEDIPLIRSLAISSTHRRDTFCW  957


 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 106/212 (50%), Gaps = 9/212 (4%)
 Frame = +2

Query  398   LSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGIRWKAWK  577
             LS+ G E+LLK+V  ALP +AM  F L   +C ++   +  FWW+    R+  I W AW+
Sbjct  1280  LSQVGKEILLKSVGLALPIFAMSCFKLPKDVCAKLTSAMIDFWWSSGNNRK-KISWVAWQ  1338

Query  578   ALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVERVFKSRYYPNSDLMNA-VGH  742
              LC  K    LG  +L+         Q WR+  +P+SLV R+ + RY+ NS  +++ VG 
Sbjct  1339  KLCKDKEAGGLGFKELEKFNQSLLAKQAWRIWDKPESLVARILRHRYFRNSGFLDSGVGS  1398

Query  743   NPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHESVREAP--  916
              P + WRSI+   + +K+     +GD   T +  D WL+ A  P    +   +V +    
Sbjct  1399  RPSYAWRSILHGRDLLKRGLVRVVGDGNDTKVWTDNWLI-APLPRSPRYRQGAVVDLTLR  1457

Query  917   VSSLMNGVGTSWDRDCIIDVFNARDANCILNI  1012
             V  L++     WD   + +V +  D   IL I
Sbjct  1458  VGDLLSDDSNVWDISKLREVIDDEDIPLILQI  1489



>ref|XP_010445598.1| PREDICTED: uncharacterized protein LOC104728296 [Camelina sativa]
 ref|XP_010462868.1| PREDICTED: uncharacterized protein LOC104743494 [Camelina sativa]
 ref|XP_010480424.1| PREDICTED: uncharacterized protein LOC104759164 [Camelina sativa]
Length=1208

 Score =   155 bits (393),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 148/297 (50%), Gaps = 23/297 (8%)
 Frame = +2

Query  2    IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
            I    R   + G+ +AR +P ISH+LFADD   F +A   E   +  I+  Y  ASGQ V
Sbjct  556  IKKAEREKKVTGITIARDSPTISHLLFADDSLFFCKAEATECQTVMEIIRNYGKASGQEV  615

Query  182  NYDKSLSVF*YQYRSG*QNCSD*RSQRQA-------GGSGDTTGKYLGLPSLVGKNKKAI  340
            N +KS  +F      G +  ++ R Q ++       GG     G YLG+P  +  +K  +
Sbjct  616  NLEKSSIMF------GKKVPTEIRDQLKSVIGITKEGG----MGSYLGIPESLQGSKNKV  665

Query  341  LGFVKDRILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNH  520
             G+VKDR+   V GWN   LS+ G E+++K+V  ALP++ M  + L   L  ++   ++ 
Sbjct  666  FGYVKDRLDDRVNGWNAKLLSKGGKEIMIKSVALALPTHVMSCYKLPQELTSKLTSAIST  725

Query  521  FWWTGKVARRLGIRWKAWKALCT-KIKRWLGVYDLKGDEP---GTQTWRLLTRPDSLVER  688
            FWW     +  G+ W AW  LC  K    LG   L+         Q WRL+  P SL+ R
Sbjct  726  FWWKSN-DKAHGLHWVAWDKLCKDKCDGGLGFRALEQFNDAMLAKQYWRLIQHPTSLMAR  784

Query  689  VFKSRYYPNSD-LMNAVGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWL  856
            V K RY+ N   LM     NP F WRSI    + V+   R ++G   S ++ +D W+
Sbjct  785  VLKGRYFSNKHPLMAKKPSNPSFAWRSIFSTKDLVEYGARWAVGSGSSISVWRDPWI  841



>ref|XP_008234850.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=1009

 Score =   155 bits (391),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 110/340 (32%), Positives = 166/340 (49%), Gaps = 15/340 (4%)
 Frame = +2

Query  20    RGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKSL  199
             R  LHG Q+ R    ISH+LFADD  LF  A+  E+  +  IL  Y   SGQ VN+DKS 
Sbjct  293   RQALHGFQLRRDGVSISHLLFADDSVLFCNADAREAECVLNILQCYEAGSGQSVNFDKS-  351

Query  200   SVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSWVR  379
             S+F Y      +         Q  G  +  GKYLG+ +  G +K+ +   V+ ++   + 
Sbjct  352   SIF-YSAHCSSRLRLQMEQILQIKGRKEF-GKYLGIMADFGTSKRKVFEEVRRKLDGKLH  409

Query  380   GWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRLGI  559
             GW   FLS AG EVL+K V  A+P Y M  F L +TLC+EIE  +  FWW     +  GI
Sbjct  410   GWAEQFLSPAGKEVLIKAVAMAMPCYTMSCFKLPVTLCKEIEAAMARFWWKSHTDKN-GI  468

Query  560   RWKAWKALCTKIKRW--LGVYDLKGDEPGTQT---WRLLTRPDSLVERVFKSRYYPNSDL  724
              W +W  L +++K+   LG  DL+           WR+L  P SL+  +   +Y+  +  
Sbjct  469   HWASWTKL-SQLKKAGGLGFRDLQCFNMALLAKIGWRILLNPSSLLACLLHDKYFVGASF  527

Query  725   MNAVGH-NPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHES  901
             + A    +  + W+ I+     ++   R  IGD  +  +  D WL     PY    L   
Sbjct  528   LTATSQKSSSWGWKGILLGRRLLESGLRWRIGDGTTVQVRNDPWL---PTPYTFRTLSRH  584

Query  902   VR-EAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             +   + V  L++ +  +W +D I   F   +A+ IL+IP+
Sbjct  585   LDLPSMVHELIDPLLKTWKKDVINRCFVPEEASHILSIPI  624



>ref|XP_008367994.1| PREDICTED: uncharacterized protein LOC103431605 [Malus domestica]
Length=1647

 Score =   156 bits (394),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 106/340 (31%), Positives = 166/340 (49%), Gaps = 11/340 (3%)
 Frame = +2

Query  14    MRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDK  193
             + RG+LHG +++    P++H+ FADD  +F  A+ EE+ ++  +L  Y   SGQ +N  K
Sbjct  662   LERGVLHGFKISXAGAPLTHLFFADDSVVFGNASVEEAESIVEVLKTYARGSGQEINLTK  721

Query  194   SLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRILSW  373
               SVF     S     +   S       G   GKYLGL +  G +KKA+   ++D+I + 
Sbjct  722   X-SVFFGANTSKKMRANIVDSLMIQSKXG--FGKYLGLQADFGHSKKAVFXEIRDKIEAX  778

Query  374   VRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVARRL  553
             + GW   FLS+AG E+L+K V  ALP+YAM  F L I +CR++E  + ++WW G   R+ 
Sbjct  779   MSGWAEQFLSQAGKEILVKTVAMALPNYAMSCFKLPIGVCRDVERAIRNYWWRGNEQRK-  837

Query  554   GIRWKAWKALCTKIKR-WLGVYDLKGDEPGTQT---WRLLTRPDSLVERVFKSRYYPNSD  721
             GI W +   L  + K   LG  D++           WR+   P SL+  V + +Y+P   
Sbjct  838   GIHWISXDRLMKQKKAGGLGFKDIQCVNLAFLAKIGWRITLNPMSLLASVLRDKYFPGKS  897

Query  722   LMNA-VGHNPLFIWRSIVEVNNAVKQWYRGSIGDERSTTIGKDMWLVMAEDPYVSTHLHE  898
                   G N    W+ + E    +    R  +G+ +S  I +D W    +          
Sbjct  898   FGEXPKGKNTSXGWKGLFEARKVLNLGLRWRVGNGKSINIREDPWF--PKPATFKVRPRN  955

Query  899   SVREAPVSSLMNGVGTSWDRDCIIDVFNARDANCILNIPV  1018
             ++ E  VS L++     W  D I + F+  D + IL IP+
Sbjct  956   NLVETMVSDLIDSDTKIWRTDLIANGFHRDDVSTILIIPL  995



>ref|XP_007224046.1| hypothetical protein PRUPE_ppa015219mg, partial [Prunus persica]
 gb|EMJ25245.1| hypothetical protein PRUPE_ppa015219mg, partial [Prunus persica]
Length=1221

 Score =   155 bits (392),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 95/258 (37%), Positives = 132/258 (51%), Gaps = 51/258 (20%)
 Frame = +2

Query  17    RRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLVNYDKS  196
             RRG   GVQVARGAP ++H+LFADD  LF++A  E    ++ +   +   SGQ +NY KS
Sbjct  838   RRGDFVGVQVARGAPSVTHLLFADDSILFMKATKEACMALETLFQTHEEVSGQQINYSKS  897

Query  197   ---LSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDRIL  367
                LSV          N    +S            KYLGLP++ GK +K +   +KD++ 
Sbjct  898   VFSLSVL---------NVPVVQSHE----------KYLGLPTIAGKGRKQLFQHLKDKLW  938

Query  368   SWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKVAR  547
               + GW    LSRAG E+L+K VLQA+P+Y+M  F +   LC+E+  I+  F        
Sbjct  939   KHISGWKEKLLSRAGKEILMKAVLQAIPTYSMSCFWIPKGLCKELNGIMARFGG------  992

Query  548   RLGIRWKAWKALCTKIKRWLGVYDLKGDEPG---TQTWRLLTRPDSLVERVFKSRYYPNS  718
                                LG +DL          Q WR+L  P SLV R+F++RY+P+ 
Sbjct  993   -------------------LGFHDLDAFNQALLAKQCWRILRTPKSLVARIFRARYHPSV  1033

Query  719   DLMNA-VGHNPLFIWRSI  769
               + A VG NP FIWRS+
Sbjct  1034  PFLEAEVGTNPSFIWRSL  1051



>emb|CAB40051.1| putative protein [Arabidopsis thaliana]
 emb|CAB81184.1| putative protein [Arabidopsis thaliana]
Length=1294

 Score =   155 bits (392),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/282 (33%), Positives = 151/282 (54%), Gaps = 9/282 (3%)
 Frame = +2

Query  2     IDNRMRRGMLHGVQVARGAPPISHILFADDCFLFLRANTEESANMKGILDLYTGASGQLV  181
             I NR+  G + G+++  G P ++H+ FADD   F ++N      +K + D+Y   SGQ +
Sbjct  1017  IKNRVAEGDIRGIRIGNGVPGVTHLQFADDSLFFCQSNVRNCQALKDVFDVYEYYSGQKI  1076

Query  182   NYDKSLSVF*YQYRSG*QNCSD*RSQRQAGGSGDTTGKYLGLPSLVGKNKKAILGFVKDR  361
             N  KS+  F  +     QN        Q+ G G   GKYLGLP   G+ K+ +  ++ +R
Sbjct  1077  NMSKSMITFGSRVHGTTQNRLKNILGIQSHGGG---GKYLGLPEQFGRKKRDMFNYIIER  1133

Query  362   ILSWVRGWNT*FLSRAGHEVLLKNVLQALPSYAMMIFSLSITLCREIEVILNHFWWTGKV  541
             +      W+  +LS AG E++LK+V  ++P YAM  F L + +  EIE +L +FWW  K 
Sbjct  1134  VKKRTSSWSAKYLSPAGKEIMLKSVAMSMPVYAMSCFKLPLNIVSEIEALLMNFWWE-KN  1192

Query  542   ARRLGIRWKAWKAL-CTKIKRWLGVYDL-KGDEP--GTQTWRLLTRPDSLVERVFKSRYY  709
             A++  I W AWK L  +K +  LG  DL K ++     Q WR++  P+SL  R+ K+RY+
Sbjct  1193  AKKREIPWIAWKRLQYSKKEGGLGFRDLAKFNDALLAKQVWRMINNPNSLFARIMKARYF  1252

Query  710   PNSDLMNAVGHN-PLFIWRSIVEVNNAVKQWYRGSIGDERST  832
                 +++A       + W S++   + +K+  R  +GD ++ 
Sbjct  1253  REDSILDAKRQRYQSYGWTSMLAGLDVIKKGSRFIVGDGKTV  1294



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3025133731368