BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c17283_g1_i1 len=1713 path=[1691:0-1246 2938:1247-1248
@2940@!:1249-1603 3295:1604-1712]

Length=1713
                                                                      Score     E

ref|XP_009795443.1|  PREDICTED: cytochrome P450 78A5-like               707   0.0      
ref|XP_006352190.1|  PREDICTED: cytochrome P450 78A5-like               706   0.0      
ref|XP_004239209.1|  PREDICTED: cytochrome P450 78A5-like               704   0.0      
emb|CDP13335.1|  unnamed protein product                                685   0.0      
ref|XP_006484094.1|  PREDICTED: cytochrome P450 78A5-like               681   0.0      
ref|XP_006438035.1|  hypothetical protein CICLE_v10031245mg             679   0.0      
ref|XP_002303803.2|  hypothetical protein POPTR_0003s17200g             677   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO81910.1|  hypothetical protein CISIN_1g010074mg                   675   0.0      
ref|XP_011020726.1|  PREDICTED: cytochrome P450 78A3-like               674   0.0      
ref|XP_002299298.2|  hypothetical protein POPTR_0001s13990g             669   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011002141.1|  PREDICTED: cytochrome P450 78A4-like               665   0.0      
ref|XP_004135319.1|  PREDICTED: cytochrome P450 78A3-like               661   0.0      
ref|XP_008446041.1|  PREDICTED: cytochrome P450 78A5-like               661   0.0      
ref|XP_002271641.2|  PREDICTED: cytochrome P450 78A4-like               660   0.0      Vitis vinifera
emb|CAN70074.1|  hypothetical protein VITISV_028565                     659   0.0      Vitis vinifera
ref|XP_008389856.1|  PREDICTED: cytochrome P450 78A5-like               658   0.0      
ref|XP_010682779.1|  PREDICTED: cytochrome P450 78A5-like               655   0.0      
ref|XP_002514920.1|  cytochrome P450, putative                          655   0.0      Ricinus communis
ref|XP_008222229.1|  PREDICTED: cytochrome P450 78A5-like               656   0.0      
ref|XP_007227037.1|  hypothetical protein PRUPE_ppa024213mg             654   0.0      
ref|XP_011087111.1|  PREDICTED: cytochrome P450 78A5-like               649   0.0      
ref|XP_009337480.1|  PREDICTED: cytochrome P450 78A5-like               649   0.0      
ref|XP_004504443.1|  PREDICTED: cytochrome P450 78A4-like               648   0.0      
ref|XP_009372289.1|  PREDICTED: cytochrome P450 78A5-like               649   0.0      
ref|XP_003524168.1|  PREDICTED: cytochrome P450 78A5-like               645   0.0      
gb|KEH20594.1|  cytochrome P450 family 78 protein                       645   0.0      
ref|XP_010087195.1|  Cytochrome P450 78A4                               641   0.0      
ref|XP_008361844.1|  PREDICTED: cytochrome P450 78A5-like               642   0.0      
ref|XP_010249000.1|  PREDICTED: cytochrome P450 78A5-like               636   0.0      
ref|XP_003531193.1|  PREDICTED: cytochrome P450 78A5-like               633   0.0      
ref|XP_007163754.1|  hypothetical protein PHAVU_001G261500g             633   0.0      
gb|KHN44434.1|  Cytochrome P450 78A4                                    632   0.0      
gb|KHN34817.1|  Cytochrome P450 78A4                                    629   0.0      
ref|XP_003538551.1|  PREDICTED: cytochrome P450 78A5-like               629   0.0      
ref|XP_004159682.1|  PREDICTED: cytochrome P450 78A3-like               624   0.0      
ref|XP_004310075.1|  PREDICTED: cytochrome P450 78A4-like               621   0.0      
ref|XP_007158688.1|  hypothetical protein PHAVU_002G173900g             620   0.0      
gb|KHG25397.1|  Cytochrome P450                                         615   0.0      
gb|KDP26798.1|  hypothetical protein JCGZ_17956                         609   0.0      
ref|XP_010531610.1|  PREDICTED: cytochrome P450 78A5-like               612   0.0      
gb|KHN12393.1|  Cytochrome P450 78A4                                    601   0.0      
ref|XP_010025313.1|  PREDICTED: cytochrome P450 78A5-like               599   0.0      
ref|XP_008801841.1|  PREDICTED: cytochrome P450 78A4-like               594   0.0      
ref|XP_010917534.1|  PREDICTED: cytochrome P450 78A4-like               592   0.0      
ref|XP_010905212.1|  PREDICTED: cytochrome P450 78A5-like               587   0.0      
gb|EYU25896.1|  hypothetical protein MIMGU_mgv1a019031mg                575   0.0      
ref|XP_008805331.1|  PREDICTED: cytochrome P450 78A4-like               575   0.0      
ref|XP_010257993.1|  PREDICTED: cytochrome P450 78A5                    555   0.0      
ref|XP_009405485.1|  PREDICTED: cytochrome P450 78A4-like               553   0.0      
ref|XP_010260472.1|  PREDICTED: cytochrome P450 78A5                    548   0.0      
ref|XP_008786022.1|  PREDICTED: cytochrome P450 78A5-like               546   0.0      
ref|XP_008787550.1|  PREDICTED: cytochrome P450 78A5-like               542   0.0      
ref|XP_010923556.1|  PREDICTED: cytochrome P450 78A5-like               541   0.0      
ref|XP_009617550.1|  PREDICTED: cytochrome P450 78A5-like               535   0.0      
ref|XP_006345108.1|  PREDICTED: cytochrome P450 78A5-like               531   2e-180   
ref|XP_009419067.1|  PREDICTED: cytochrome P450 78A5-like               530   6e-180   
ref|XP_004236064.1|  PREDICTED: cytochrome P450 78A5-like               530   9e-180   
ref|XP_002273829.1|  PREDICTED: cytochrome P450 78A5                    530   1e-179   Vitis vinifera
ref|XP_009792560.1|  PREDICTED: cytochrome P450 78A5-like               527   9e-179   
ref|XP_009407609.1|  PREDICTED: cytochrome P450 78A5-like               526   2e-178   
ref|XP_009388744.1|  PREDICTED: cytochrome P450 78A5-like               525   5e-178   
ref|XP_008785621.1|  PREDICTED: cytochrome P450 78A5-like               522   5e-177   
ref|XP_007221915.1|  hypothetical protein PRUPE_ppa026871mg             521   3e-176   
ref|XP_008445440.1|  PREDICTED: cytochrome P450 78A5                    521   5e-176   
gb|KDP31370.1|  hypothetical protein JCGZ_11746                         520   1e-175   
ref|XP_008339790.1|  PREDICTED: cytochrome P450 78A5-like               519   2e-175   
ref|XP_007209897.1|  hypothetical protein PRUPE_ppa004083mg             519   3e-175   
ref|XP_004158291.1|  PREDICTED: cytochrome P450 78A3-like               518   3e-175   
ref|XP_008350889.1|  PREDICTED: cytochrome P450 78A5-like               518   5e-175   
emb|CDP15252.1|  unnamed protein product                                518   7e-175   
ref|XP_009346128.1|  PREDICTED: cytochrome P450 78A5-like               518   8e-175   
ref|XP_009338053.1|  PREDICTED: cytochrome P450 78A5-like               518   8e-175   
ref|XP_004144260.1|  PREDICTED: cytochrome P450 78A3-like               517   1e-174   
ref|XP_002514632.1|  cytochrome P450, putative                          515   1e-174   Ricinus communis
ref|XP_003550706.1|  PREDICTED: cytochrome P450 78A5-like               516   2e-174   
ref|XP_008389401.1|  PREDICTED: cytochrome P450 78A5                    516   2e-174   
ref|XP_008240112.1|  PREDICTED: cytochrome P450 78A5                    516   3e-174   
gb|KDO65681.1|  hypothetical protein CISIN_1g036575mg                   516   5e-174   
ref|XP_011087366.1|  PREDICTED: cytochrome P450 78A5                    516   5e-174   
ref|XP_008352954.1|  PREDICTED: cytochrome P450 78A5-like               515   5e-174   
ref|XP_007155212.1|  hypothetical protein PHAVU_003G183100g             516   7e-174   
ref|XP_004979279.1|  PREDICTED: cytochrome P450 78A4-like               514   1e-173   
ref|XP_002265310.1|  PREDICTED: cytochrome P450 78A5                    513   4e-173   Vitis vinifera
ref|XP_004299287.1|  PREDICTED: cytochrome P450 78A3-like               513   4e-173   
emb|CAN80496.1|  hypothetical protein VITISV_000124                     512   1e-172   Vitis vinifera
gb|KHN15204.1|  Cytochrome P450 78A3                                    511   1e-172   
ref|XP_010939200.1|  PREDICTED: cytochrome P450 78A5-like               511   1e-172   
ref|XP_006440793.1|  hypothetical protein CICLE_v10023859mg             511   3e-172   
ref|XP_003614135.1|  Cytochrome P450 78A11                              511   3e-172   
ref|XP_006579491.1|  PREDICTED: cytochrome P450 78A5-like               511   3e-172   
ref|XP_006437950.1|  hypothetical protein CICLE_v10031237mg             510   5e-172   
ref|XP_008374654.1|  PREDICTED: cytochrome P450 78A5-like               510   9e-172   
ref|XP_009356423.1|  PREDICTED: cytochrome P450 78A5                    509   9e-172   
ref|XP_009400167.1|  PREDICTED: cytochrome P450 78A5-like               509   1e-171   
ref|XP_007153503.1|  hypothetical protein PHAVU_003G041200g             509   2e-171   
ref|XP_010031012.1|  PREDICTED: cytochrome P450 78A5                    509   3e-171   
ref|XP_009775574.1|  PREDICTED: cytochrome P450 78A5-like               508   6e-171   
gb|AFK46135.1|  unknown                                                 507   9e-171   
ref|XP_010091592.1|  Cytochrome P450 78A4                               507   1e-170   
ref|XP_007045833.1|  Cytochrome P450, family 78, subfamily A, pol...    505   5e-170   
ref|XP_003517846.1|  PREDICTED: cytochrome P450 78A5-like               503   2e-169   
ref|XP_010527976.1|  PREDICTED: cytochrome P450 78A5                    503   3e-169   
ref|XP_006477732.1|  PREDICTED: cytochrome P450 78A5-like               500   7e-169   
ref|XP_004298365.1|  PREDICTED: cytochrome P450 78A4-like               501   1e-168   
ref|XP_010087351.1|  Cytochrome P450 78A4                               501   2e-168   
ref|XP_010539987.1|  PREDICTED: cytochrome P450 78A5                    500   4e-168   
ref|XP_004490206.1|  PREDICTED: cytochrome P450 78A3-like               500   6e-168   
ref|XP_010936450.1|  PREDICTED: cytochrome P450 78A5-like               499   6e-168   
ref|XP_006417097.1|  hypothetical protein EUTSA_v10007373mg             498   3e-167   
ref|XP_008452229.1|  PREDICTED: cytochrome P450 78A5-like               498   3e-167   
ref|XP_010695255.1|  PREDICTED: cytochrome P450 78A5-like               498   5e-167   
gb|AAB37231.1|  cytochrome P-450                                        491   1e-165   Phalaenopsis sp. SM9108
emb|CDX73053.1|  BnaC06g35010D                                          494   2e-165   
ref|XP_010476396.1|  PREDICTED: cytochrome P450 78A5-like               492   4e-165   
ref|XP_006390465.1|  hypothetical protein EUTSA_v10019645mg             493   6e-165   
ref|NP_172827.1|  cytochrome P450, family 78, subfamily A, polype...    492   7e-165   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177551.1|  cytochrome P450, family 78, subfamily A, polype...    491   2e-164   Arabidopsis thaliana [mouse-ear cress]
emb|CDX98123.1|  BnaA06g08740D                                          490   2e-164   
emb|CDY36404.1|  BnaC05g10050D                                          490   3e-164   
ref|XP_010495542.1|  PREDICTED: cytochrome P450 78A5-like               490   4e-164   
ref|XP_009123953.1|  PREDICTED: cytochrome P450 78A5                    489   4e-164   
emb|CBI27301.3|  unnamed protein product                                489   4e-164   
ref|XP_003554680.1|  PREDICTED: cytochrome P450 78A5-like               489   6e-164   
ref|XP_009106488.1|  PREDICTED: cytochrome P450 78A5-like               489   1e-163   
ref|XP_008243829.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    488   1e-163   
emb|CDY68665.1|  BnaA09g57150D                                          486   3e-163   
emb|CDY49134.1|  BnaA02g16720D                                          488   3e-163   
ref|XP_009128027.1|  PREDICTED: cytochrome P450 78A5-like               488   3e-163   
ref|XP_010458833.1|  PREDICTED: cytochrome P450 78A5                    487   4e-163   
ref|XP_008810738.1|  PREDICTED: cytochrome P450 78A5-like               487   5e-163   
ref|XP_006307257.1|  hypothetical protein CARUB_v10008872mg             487   6e-163   
ref|XP_009616350.1|  PREDICTED: cytochrome P450 78A5-like               487   6e-163   
ref|XP_004137603.1|  PREDICTED: cytochrome P450 78A3-like               487   7e-163   
ref|XP_003518773.1|  PREDICTED: cytochrome P450 78A5-like               486   8e-163   
emb|CDY16102.1|  BnaC08g40210D                                          485   1e-162   
ref|XP_002888965.1|  CYP78A10                                           486   2e-162   
ref|XP_009117978.1|  PREDICTED: cytochrome P450 78A5-like               485   2e-162   
gb|KCW83756.1|  hypothetical protein EUGRSUZ_B00627                     482   3e-162   
ref|XP_004157482.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    486   3e-162   
ref|XP_010428380.1|  PREDICTED: cytochrome P450 78A5-like               485   7e-162   
ref|XP_006856424.1|  hypothetical protein AMTR_s00047p00221540          484   1e-161   
gb|AJD25189.1|  cytochrome P450 CYP78A113                               483   1e-161   
ref|XP_006301501.1|  hypothetical protein CARUB_v10021927mg             483   3e-161   
ref|XP_002449497.1|  hypothetical protein SORBIDRAFT_05g016750          483   4e-161   Sorghum bicolor [broomcorn]
gb|AED99879.1|  cytochrome P450                                         481   2e-160   
ref|XP_009142616.1|  PREDICTED: cytochrome P450 78A6-like               481   2e-160   
emb|CDY41546.1|  BnaC04g00760D                                          481   2e-160   
ref|XP_002892768.1|  CYP78A5                                            480   3e-160   
ref|XP_010416244.1|  PREDICTED: cytochrome P450 78A5-like               479   1e-159   
ref|XP_004984001.1|  PREDICTED: cytochrome P450 78A4-like               478   1e-159   
emb|CDX80036.1|  BnaA05g01200D                                          478   2e-159   
ref|XP_010471502.1|  PREDICTED: cytochrome P450 78A5-like               479   2e-159   
gb|KHN29974.1|  Cytochrome P450 78A1                                    474   2e-159   
tpg|DAA45811.1|  TPA: putative cytochrome P450 superfamily protein      478   3e-159   
gb|KFK43629.1|  hypothetical protein AALP_AA1G150900                    477   3e-159   
ref|XP_008656985.1|  PREDICTED: cytochrome P450 78A5-like               476   5e-159   
gb|AGT16621.1|  phytochrome P450                                        475   2e-158   
gb|EYU23623.1|  hypothetical protein MIMGU_mgv1a004353mg                475   3e-158   
ref|XP_010506682.1|  PREDICTED: cytochrome P450 78A6-like               473   9e-158   
ref|XP_010413088.1|  PREDICTED: cytochrome P450 78A6-like               473   4e-157   
ref|XP_004959817.1|  PREDICTED: cytochrome P450 78A4-like               472   4e-157   
ref|XP_008459740.1|  PREDICTED: cytochrome P450 78A9-like               473   5e-157   
ref|XP_009142434.1|  PREDICTED: cytochrome P450 78A6                    471   1e-156   
emb|CDY61720.1|  BnaA04g27100D                                          471   1e-156   
emb|CDY27309.1|  BnaC04g50960D                                          470   3e-156   
gb|KFK41856.1|  hypothetical protein AALP_AA2G179900                    466   3e-156   
ref|XP_006660360.1|  PREDICTED: cytochrome P450 78A9-like               469   8e-156   
tpg|DAA63513.1|  TPA: putative cytochrome P450 superfamily protein      468   1e-155   
ref|XP_002882080.1|  CYP78A6                                            468   2e-155   
ref|XP_006290851.1|  hypothetical protein CARUB_v10016961mg             468   3e-155   
ref|XP_010507986.1|  PREDICTED: cytochrome P450 78A6                    468   3e-155   
ref|XP_008390271.1|  PREDICTED: cytochrome P450 78A9-like               468   3e-155   
ref|XP_006293985.1|  hypothetical protein CARUB_v10022976mg             467   4e-155   
ref|XP_010546209.1|  PREDICTED: cytochrome P450 78A5-like               468   5e-155   
emb|CBI27648.3|  unnamed protein product                                459   3e-154   
ref|XP_002518911.1|  cytochrome P450, putative                          464   6e-154   Ricinus communis
gb|AAP44628.1|  putative cytochrome P-450                               463   1e-153   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004168367.1|  PREDICTED: cytochrome P450 78A3-like               464   1e-153   
gb|KGN46546.1|  hypothetical protein Csa_6G108440                       463   1e-153   
gb|KFK35375.1|  hypothetical protein AALP_AA5G277100                    463   2e-153   
ref|XP_002878418.1|  CYP78A9                                            463   2e-153   
ref|XP_006849151.1|  hypothetical protein AMTR_s00027p00127290          462   4e-153   
ref|XP_010245857.1|  PREDICTED: cytochrome P450 78A7-like               462   6e-153   
ref|XP_010261110.1|  PREDICTED: cytochrome P450 78A7-like               461   9e-153   
ref|XP_007039393.1|  Cytochrome P450 78A3                               460   3e-152   
ref|XP_008233084.1|  PREDICTED: cytochrome P450 78A9                    461   3e-152   
gb|KDO86564.1|  hypothetical protein CISIN_1g009292mg                   460   4e-152   
ref|XP_006397858.1|  hypothetical protein EUTSA_v10001398mg             459   4e-152   
sp|O65012.1|C78A4_PINRA  RecName: Full=Cytochrome P450 78A4             460   5e-152   Pinus radiata
ref|XP_006491339.1|  PREDICTED: cytochrome P450 78A9-like               459   5e-152   
ref|XP_009607111.1|  PREDICTED: cytochrome P450 78A3                    461   7e-152   
ref|XP_002460977.1|  hypothetical protein SORBIDRAFT_02g038670          458   8e-152   Sorghum bicolor [broomcorn]
ref|XP_010267448.1|  PREDICTED: cytochrome P450 78A9                    459   8e-152   
gb|KHG03059.1|  Cytochrome P450                                         457   1e-151   
ref|XP_001771134.1|  predicted protein                                  459   1e-151   
ref|XP_002462709.1|  hypothetical protein SORBIDRAFT_02g030640          458   3e-151   Sorghum bicolor [broomcorn]
ref|XP_007048116.1|  Cytochrome P450, family 78, subfamily A, pol...    457   3e-151   
emb|CDX89135.1|  BnaA04g00510D                                          457   3e-151   
ref|XP_003554779.1|  PREDICTED: cytochrome P450 78A3-like               457   4e-151   
gb|KDO81784.1|  hypothetical protein CISIN_1g047310mg                   454   5e-151   
ref|XP_006444772.1|  hypothetical protein CICLE_v10019326mg             459   6e-151   
ref|NP_001142261.1|  putative cytochrome P450 superfamily protein       457   7e-151   Zea mays [maize]
gb|ADE77659.1|  unknown                                                 452   7e-151   
sp|O48927.1|C78A3_SOYBN  RecName: Full=Cytochrome P450 78A3             456   1e-150   Glycine max [soybeans]
gb|KHG09414.1|  Cytochrome P450                                         455   1e-150   
dbj|BAK05332.1|  predicted protein                                      455   1e-150   
ref|NP_182189.1|  cytochrome P450, family 78, subfamily A, polype...    455   2e-150   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002300886.1|  hypothetical protein POPTR_0002s06170g             456   2e-150   Populus trichocarpa [western balsam poplar]
ref|XP_009615499.1|  PREDICTED: cytochrome P450 78A6-like               455   2e-150   
ref|XP_004230013.1|  PREDICTED: cytochrome P450 78A3-like               456   2e-150   
ref|XP_009348537.1|  PREDICTED: cytochrome P450 78A6-like               455   3e-150   
gb|KHG00006.1|  Cytochrome P450                                         454   4e-150   
ref|XP_009771499.1|  PREDICTED: cytochrome P450 78A6-like               457   4e-150   
ref|XP_010692663.1|  PREDICTED: cytochrome P450 78A3-like               454   4e-150   
ref|XP_004148459.1|  PREDICTED: cytochrome P450 78A4-like               454   4e-150   
gb|KGN62106.1|  hypothetical protein Csa_2G298280                       454   5e-150   
ref|XP_009359545.1|  PREDICTED: cytochrome P450 78A9-like               455   6e-150   
ref|XP_007051469.1|  Cytochrome P450, family 78, subfamily A, pol...    454   8e-150   
gb|ACG28027.1|  cytochrome P450 CYP78A52                                454   8e-150   Zea mays [maize]
ref|XP_010676906.1|  PREDICTED: cytochrome P450 78A3-like               454   9e-150   
ref|XP_008374120.1|  PREDICTED: cytochrome P450 78A9-like               454   1e-149   
ref|XP_010469033.1|  PREDICTED: cytochrome P450 78A9-like               453   1e-149   
ref|XP_006402432.1|  hypothetical protein EUTSA_v10005883mg             453   1e-149   
gb|ACG29756.1|  cytochrome P450 CYP78A54                                453   1e-149   Zea mays [maize]
tpg|DAA40592.1|  TPA: putative cytochrome P450 superfamily protein      454   2e-149   
ref|NP_001062428.1|  Os08g0547300                                       453   2e-149   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83990.1|  hypothetical protein OsI_30143                          453   2e-149   Oryza sativa Indica Group [Indian rice]
ref|XP_010413334.1|  PREDICTED: cytochrome P450 78A9                    452   2e-149   
ref|XP_009804294.1|  PREDICTED: cytochrome P450 78A3-like               452   3e-149   
ref|XP_004306631.1|  PREDICTED: cytochrome P450 78A3-like               452   3e-149   
gb|KHN43231.1|  Cytochrome P450 78A4                                    451   3e-149   
gb|AJD25191.1|  cytochrome P450 CYP78A115                               452   3e-149   
ref|XP_004309538.1|  PREDICTED: cytochrome P450 78A3-like               452   3e-149   
ref|XP_004248458.1|  PREDICTED: cytochrome P450 78A6-like               452   4e-149   
emb|CDO33954.1|  cyp450                                                 453   4e-149   
ref|XP_010100687.1|  Cytochrome P450 78A3                               452   4e-149   
gb|EEC82405.1|  hypothetical protein OsI_26780                          452   4e-149   Oryza sativa Indica Group [Indian rice]
ref|XP_009138745.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    453   5e-149   
emb|CDX71698.1|  BnaC08g31760D                                          452   5e-149   
ref|XP_002310601.1|  hypothetical protein POPTR_0007s06570g             452   5e-149   Populus trichocarpa [western balsam poplar]
ref|XP_010100198.1|  Cytochrome P450 78A3                               452   5e-149   
ref|XP_004140614.1|  PREDICTED: cytochrome P450 78A3-like               451   6e-149   
gb|EMS50564.1|  Cytochrome P450 78A3                                    452   9e-149   
ref|XP_006362126.1|  PREDICTED: cytochrome P450 78A6-like isoform X1    451   9e-149   
ref|XP_006473879.1|  PREDICTED: cytochrome P450 78A7-like               451   9e-149   
ref|NP_191747.1|  cytochrome p450 78a9                                  451   1e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512566.1|  PREDICTED: cytochrome P450 78A9-like               451   1e-148   
dbj|BAK02559.1|  predicted protein                                      451   1e-148   
ref|NP_001190156.1|  cytochrome p450 78a9                               451   1e-148   
ref|XP_006362127.1|  PREDICTED: cytochrome P450 78A6-like isoform X2    451   1e-148   
emb|CDO33957.1|  cyp450                                                 452   1e-148   
ref|XP_008457922.1|  PREDICTED: cytochrome P450 78A7                    453   1e-148   
ref|XP_009358711.1|  PREDICTED: cytochrome P450 78A6-like               451   1e-148   
emb|CDO33950.1|  cyp450                                                 452   1e-148   
ref|XP_002307129.1|  hypothetical protein POPTR_0005s08640g             450   2e-148   Populus trichocarpa [western balsam poplar]
ref|NP_001060215.1|  Os07g0603700                                       450   2e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011025604.1|  PREDICTED: cytochrome P450 78A7-like               450   2e-148   
gb|ABU48660.1|  phytochrome P450                                        449   2e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009608319.1|  PREDICTED: cytochrome P450 78A3-like               450   3e-148   
gb|ABU48661.1|  phytochrome P450                                        449   3e-148   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002320887.1|  cytochrome P450 78A3p family protein               449   3e-148   Populus trichocarpa [western balsam poplar]
ref|XP_010096828.1|  Cytochrome P450 78A11                              449   4e-148   
ref|XP_011026286.1|  PREDICTED: cytochrome P450 78A7-like               449   4e-148   
ref|XP_006434576.1|  hypothetical protein CICLE_v10000771mg             449   5e-148   
ref|XP_011038836.1|  PREDICTED: cytochrome P450 78A3                    449   5e-148   
ref|XP_008670338.1|  PREDICTED: cytochrome P450 78A9-like               449   6e-148   
ref|XP_011015161.1|  PREDICTED: cytochrome P450 78A7-like               449   7e-148   
ref|XP_011100894.1|  PREDICTED: cytochrome P450 78A7                    449   7e-148   
ref|XP_009116856.1|  PREDICTED: cytochrome P450 78A9                    448   9e-148   
gb|EAY80954.1|  hypothetical protein OsI_36134                          447   9e-148   Oryza sativa Indica Group [Indian rice]
emb|CDY57871.1|  BnaA09g55530D                                          448   9e-148   
gb|KFK37425.1|  hypothetical protein AALP_AA4G255500                    448   1e-147   
ref|XP_010692579.1|  PREDICTED: cytochrome P450 78A9-like               448   1e-147   
ref|XP_006339754.1|  PREDICTED: cytochrome P450 78A3-like               448   1e-147   
emb|CDO33955.1|  cyp450                                                 449   2e-147   
ref|XP_010522901.1|  PREDICTED: cytochrome P450 78A6                    448   2e-147   
gb|KDP21939.1|  hypothetical protein JCGZ_03150                         448   3e-147   
gb|EAY90471.1|  hypothetical protein OsI_12059                          448   3e-147   Oryza sativa Indica Group [Indian rice]
ref|XP_010251605.1|  PREDICTED: cytochrome P450 78A9-like               447   3e-147   
gb|ABU48659.1|  phytochrome P450                                        447   3e-147   
gb|KDP25203.1|  hypothetical protein JCGZ_20359                         446   4e-147   
ref|XP_009375445.1|  PREDICTED: cytochrome P450 78A6-like               448   6e-147   
gb|AAM64492.1|  cytochrome p450 (CYP78A9)                               446   6e-147   
ref|NP_001067918.2|  Os11g0487600                                       445   8e-147   
gb|ABU48658.1|  phytochrome P450                                        445   1e-146   
ref|XP_002280129.1|  PREDICTED: cytochrome P450 78A3                    445   1e-146   
ref|XP_006827101.1|  hypothetical protein AMTR_s00010p00242830          446   1e-146   
ref|XP_002280007.2|  PREDICTED: cytochrome P450 78A7-like               448   1e-146   
ref|XP_003578487.1|  PREDICTED: cytochrome P450 78A9-like               445   2e-146   
ref|NP_001050370.1|  Os03g0417700                                       446   2e-146   
gb|ABA93802.1|  Cytochrome P450 family protein, expressed               445   2e-146   
ref|XP_002307535.2|  hypothetical protein POPTR_0005s22220g             445   3e-146   
ref|XP_011021938.1|  PREDICTED: cytochrome P450 78A7-like               444   4e-146   
ref|XP_011044812.1|  PREDICTED: cytochrome P450 78A7-like               444   4e-146   
emb|CAN83498.1|  hypothetical protein VITISV_026968                     444   5e-146   
ref|XP_008343443.1|  PREDICTED: cytochrome P450 78A9-like               444   5e-146   
gb|KDP35242.1|  hypothetical protein JCGZ_09401                         444   5e-146   
ref|XP_007200298.1|  hypothetical protein PRUPE_ppa003868mg             444   6e-146   
ref|XP_011023135.1|  PREDICTED: cytochrome P450 78A3-like               444   6e-146   
ref|XP_002264483.1|  PREDICTED: cytochrome P450 78A7                    444   7e-146   
gb|KDP28438.1|  hypothetical protein JCGZ_14209                         444   7e-146   
ref|NP_001153095.1|  cytochrome P450 CYP78A53                           444   8e-146   
ref|XP_010473782.1|  PREDICTED: cytochrome P450 78A9-like               449   9e-146   
ref|XP_010559142.1|  PREDICTED: cytochrome P450 78A9-like               443   1e-145   
ref|XP_007135293.1|  hypothetical protein PHAVU_010G117100g             443   1e-145   
ref|XP_006360643.1|  PREDICTED: cytochrome P450 78A3-like               442   2e-145   
ref|XP_001785686.1|  predicted protein                                  443   2e-145   
ref|XP_009597604.1|  PREDICTED: cytochrome P450 78A7-like               442   2e-145   
ref|XP_002889377.1|  T25K16.18                                          442   2e-145   
ref|NP_001063738.1|  Os09g0528700                                       443   2e-145   
ref|XP_002532268.1|  cytochrome P450, putative                          442   2e-145   
ref|XP_002266493.1|  PREDICTED: cytochrome P450 78A3                    442   2e-145   
ref|XP_010916946.1|  PREDICTED: cytochrome P450 78A11                   442   3e-145   
ref|XP_008237411.1|  PREDICTED: cytochrome P450 78A7                    442   4e-145   
ref|XP_006476290.1|  PREDICTED: cytochrome P450 78A9-like               442   4e-145   
ref|XP_011026787.1|  PREDICTED: cytochrome P450 78A9-like               441   5e-145   
ref|XP_006439222.1|  hypothetical protein CICLE_v10019657mg             441   7e-145   
ref|XP_010911415.1|  PREDICTED: cytochrome P450 78A3-like               441   7e-145   
ref|XP_003528776.1|  PREDICTED: cytochrome P450 78A3-like               441   8e-145   
gb|KDO76722.1|  hypothetical protein CISIN_1g009414mg                   441   8e-145   
gb|KDO59918.1|  hypothetical protein CISIN_1g009612mg                   441   8e-145   
gb|KHG01700.1|  Cytochrome P450                                         441   8e-145   
ref|XP_002301423.1|  cytochrome P450 78A3p family protein               441   8e-145   
gb|KHG15687.1|  Cytochrome P450                                         441   8e-145   
ref|XP_004974121.1|  PREDICTED: cytochrome P450 78A3-like               441   1e-144   
ref|XP_010065944.1|  PREDICTED: cytochrome P450 78A6-like               441   1e-144   
gb|KCW63671.1|  hypothetical protein EUGRSUZ_G01318                     441   1e-144   
ref|XP_003548215.1|  PREDICTED: cytochrome P450 78A3-like               440   2e-144   
ref|XP_009613296.1|  PREDICTED: cytochrome P450 78A7-like               441   3e-144   
ref|XP_010474708.1|  PREDICTED: cytochrome P450 78A6-like               440   3e-144   
ref|XP_010480585.1|  PREDICTED: cytochrome P450 78A6-like               439   4e-144   
ref|XP_006428027.1|  hypothetical protein CICLE_v10025343mg             439   5e-144   
dbj|BAK05123.1|  predicted protein                                      440   1e-143   
ref|XP_011094898.1|  PREDICTED: cytochrome P450 78A3-like               438   1e-143   
ref|XP_009777104.1|  PREDICTED: cytochrome P450 78A6-like               437   1e-143   
ref|XP_007218987.1|  hypothetical protein PRUPE_ppa003997mg             437   2e-143   
emb|CDP01150.1|  unnamed protein product                                437   3e-143   
gb|KDO83861.1|  hypothetical protein CISIN_1g046313mg                   436   3e-143   
ref|XP_009118796.1|  PREDICTED: cytochrome P450 78A6-like               437   3e-143   
ref|NP_171627.1|  cytochrome P450, family 78, subfamily A, polype...    437   3e-143   
ref|XP_004959619.1|  PREDICTED: cytochrome P450 78A3-like               444   4e-143   
ref|XP_002304580.1|  hypothetical protein POPTR_0003s14670g             436   5e-143   
ref|XP_010457158.1|  PREDICTED: cytochrome P450 78A6-like               436   5e-143   
ref|XP_008811218.1|  PREDICTED: cytochrome P450 78A11                   436   6e-143   
ref|XP_002297948.2|  hypothetical protein POPTR_0001s11360g             436   6e-143   
gb|AAF26465.1|AC007323_6  T25K16.18                                     436   7e-143   
ref|XP_002464651.1|  hypothetical protein SORBIDRAFT_01g022690          436   1e-142   
ref|XP_006307157.1|  hypothetical protein CARUB_v10008749mg             436   1e-142   
emb|CBI35511.3|  unnamed protein product                                434   2e-142   
ref|XP_010054130.1|  PREDICTED: cytochrome P450 78A6-like               435   3e-142   
emb|CDY37995.1|  BnaCnng08560D                                          434   4e-142   
ref|XP_004510631.1|  PREDICTED: cytochrome P450 78A3-like               434   8e-142   
ref|XP_011022416.1|  PREDICTED: cytochrome P450 78A9-like               433   9e-142   
ref|XP_009779043.1|  PREDICTED: cytochrome P450 78A7-like               432   1e-141   
gb|EYU31086.1|  hypothetical protein MIMGU_mgv1a027145mg                433   1e-141   
emb|CDY21618.1|  BnaC09g46740D                                          432   1e-141   
ref|XP_002977638.1|  hypothetical protein SELMODRAFT_107475             428   2e-141   
ref|XP_006660875.1|  PREDICTED: cytochrome P450 78A9-like               433   2e-141   
gb|KCW69109.1|  hypothetical protein EUGRSUZ_F02654                     431   2e-141   
tpg|DAA50052.1|  TPA: cytochrome P-450 8                                433   2e-141   
ref|XP_010062039.1|  PREDICTED: cytochrome P450 78A7-like               432   2e-141   
gb|KHG25983.1|  Cytochrome P450                                         432   2e-141   
ref|XP_004252635.1|  PREDICTED: cytochrome P450 78A7                    432   3e-141   
emb|CAN73323.1|  hypothetical protein VITISV_014249                     430   3e-141   
ref|XP_008381035.1|  PREDICTED: cytochrome P450 78A7                    432   3e-141   
ref|XP_006418397.1|  hypothetical protein EUTSA_v10007320mg             432   4e-141   
ref|XP_002527123.1|  cytochrome P450, putative                          431   4e-141   
ref|XP_002979616.1|  hypothetical protein SELMODRAFT_110896             427   5e-141   
emb|CDY15193.1|  BnaC05g00720D                                          431   5e-141   
ref|XP_002979625.1|  hypothetical protein SELMODRAFT_110820             427   6e-141   
ref|XP_011090628.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    431   6e-141   
gb|AEX20385.1|  cytochrome P450 family 78 subfamily A polypeptide 8     431   7e-141   
ref|XP_010053067.1|  PREDICTED: cytochrome P450 78A9-like               430   9e-141   
ref|XP_007210570.1|  hypothetical protein PRUPE_ppa003882mg             430   1e-140   
ref|XP_004240114.1|  PREDICTED: cytochrome P450 78A9-like               430   2e-140   
gb|ACG43035.1|  cytochrome P450 CYP78A1                                 430   2e-140   
ref|XP_009122106.1|  PREDICTED: cytochrome P450 78A7                    429   2e-140   
gb|KEH43601.1|  cytochrome P450 family 78 protein                       429   2e-140   
ref|XP_007020207.1|  Cytochrome P450, family 78, subfamily A, pol...    429   3e-140   
emb|CDX69873.1|  BnaA10g22220D                                          429   3e-140   
ref|XP_002979636.1|  hypothetical protein SELMODRAFT_111015             425   3e-140   
ref|XP_006360309.1|  PREDICTED: cytochrome P450 78A7-like               429   3e-140   
ref|XP_003627517.1|  Cytochrome P450 78A3                               429   3e-140   
emb|CDX90016.1|  BnaA10g00660D                                          429   4e-140   
ref|XP_006362805.1|  PREDICTED: cytochrome P450 78A7-like               429   4e-140   
ref|XP_009119678.1|  PREDICTED: cytochrome P450 78A6                    429   5e-140   
ref|XP_010545165.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    427   5e-140   
ref|XP_009339753.1|  PREDICTED: cytochrome P450 78A7                    429   5e-140   
ref|XP_006399481.1|  hypothetical protein EUTSA_v10013216mg             428   6e-140   
ref|XP_011093010.1|  PREDICTED: cytochrome P450 78A3-like               429   6e-140   
ref|XP_002977649.1|  hypothetical protein SELMODRAFT_107419             424   6e-140   
ref|XP_002979632.1|  hypothetical protein SELMODRAFT_111024             423   1e-139   
gb|EYU32284.1|  hypothetical protein MIMGU_mgv1a004092mg                426   9e-139   
gb|KHN44936.1|  Cytochrome P450 78A1                                    421   1e-138   
ref|XP_009790925.1|  PREDICTED: cytochrome P450 78A7-like               426   1e-138   
ref|XP_004496818.1|  PREDICTED: cytochrome P450 78A11-like              423   6e-138   
gb|AGT16132.1|  cytochrome P450                                         420   8e-138   
ref|XP_008239228.1|  PREDICTED: cytochrome P450 78A9-like               423   1e-137   
ref|XP_004983137.1|  PREDICTED: cytochrome P450 78A11-like              422   2e-137   
gb|ACN33797.1|  unknown                                                 418   3e-137   
ref|XP_010667226.1|  PREDICTED: cytochrome P450 78A7                    422   3e-137   
ref|XP_009383603.1|  PREDICTED: cytochrome P450 78A11                   423   4e-137   
ref|XP_011100994.1|  PREDICTED: cytochrome P450 78A7-like               421   8e-137   
ref|XP_006414771.1|  hypothetical protein EUTSA_v10027474mg             420   8e-137   
ref|XP_004985811.1|  PREDICTED: cytochrome P450 78A3-like               420   1e-136   
ref|XP_003574887.1|  PREDICTED: cytochrome P450 78A9-like               421   2e-136   
ref|XP_002966598.1|  hypothetical protein SELMODRAFT_1587               417   2e-136   
ref|XP_010025502.1|  PREDICTED: cytochrome P450 78A7-like               420   2e-136   
ref|XP_008792006.1|  PREDICTED: cytochrome P450 78A3-like               420   2e-136   
ref|XP_009382716.1|  PREDICTED: cytochrome P450 78A9-like               419   3e-136   
ref|XP_004298100.1|  PREDICTED: cytochrome P450 78A4-like               419   4e-136   
gb|ACK44530.1|  AT5G09970-like protein                                  418   6e-136   
ref|XP_009383226.1|  PREDICTED: cytochrome P450 78A6-like               418   8e-136   
ref|NP_196559.1|  cytochrome P450, family 78, subfamily A, polype...    417   1e-135   
ref|NP_001106069.1|  cytochrome P450 78A1                               418   1e-135   
ref|XP_010519990.1|  PREDICTED: cytochrome P450 78A7                    417   1e-135   
ref|XP_002871395.1|  CYP78A7                                            417   1e-135   
ref|XP_006287462.1|  hypothetical protein CARUB_v10000671mg             416   3e-135   
ref|NP_001064552.1|  Os10g0403000                                       416   5e-135   
gb|EAY78409.1|  hypothetical protein OsI_33499                          416   6e-135   
ref|XP_010054976.1|  PREDICTED: cytochrome P450 78A9-like               416   8e-135   
gb|KHN15903.1|  Cytochrome P450 78A3                                    414   3e-134   
ref|XP_002977657.1|  hypothetical protein SELMODRAFT_107837             409   3e-134   
ref|XP_008376199.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    414   3e-134   
emb|CBI34586.3|  unnamed protein product                                412   4e-134   
dbj|BAC76730.1|  cytochrome P450 78A11                                  414   4e-134   
ref|XP_009386194.1|  PREDICTED: cytochrome P450 78A6-like               411   5e-133   
ref|XP_002964877.1|  hypothetical protein SELMODRAFT_83483              407   6e-133   
gb|AJD25190.1|  cytochrome P450 CYP78A114                               410   9e-133   
ref|XP_006380471.1|  hypothetical protein POPTR_0007s06570g             409   1e-132   
ref|XP_002465914.1|  hypothetical protein SORBIDRAFT_01g048030          408   6e-132   
ref|XP_010453010.1|  PREDICTED: cytochrome P450 78A7                    407   9e-132   
ref|XP_008660056.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    407   1e-131   
ref|XP_009395496.1|  PREDICTED: cytochrome P450 78A9-like               407   2e-131   
ref|XP_009388074.1|  PREDICTED: cytochrome P450 78A5-like               402   2e-131   
ref|XP_010491644.1|  PREDICTED: cytochrome P450 78A7-like               408   3e-131   
gb|KFK25292.1|  hypothetical protein AALP_AA8G093700                    402   5e-131   
gb|ACG29577.1|  cytochrome P450 CYP78A55                                405   7e-131   
gb|EPS62828.1|  hypothetical protein M569_11959                         404   1e-130   
ref|XP_009420787.1|  PREDICTED: cytochrome P450 78A6-like               404   2e-130   
gb|AAN05501.1|  Putative cytochrome P450                                402   5e-130   
gb|EEC74459.1|  hypothetical protein OsI_09883                          402   2e-129   
emb|CDP08636.1|  unnamed protein product                                402   3e-129   
dbj|BAJ85822.1|  predicted protein                                      401   5e-129   
ref|NP_001146265.1|  uncharacterized protein LOC100279840               399   3e-128   
ref|XP_010422915.1|  PREDICTED: cytochrome P450 78A7-like               397   8e-128   
tpg|DAA43220.1|  TPA: putative cytochrome P450 superfamily protein      397   8e-128   
ref|XP_006651015.1|  PREDICTED: cytochrome P450 78A9-like               396   3e-127   
ref|XP_001768377.1|  predicted protein                                  391   1e-125   
gb|EEE69109.1|  hypothetical protein OsJ_28178                          389   1e-124   
ref|XP_003558876.1|  PREDICTED: cytochrome P450 78A9-like               389   2e-124   
emb|CDY71495.1|  BnaCnng73170D                                          377   5e-122   
ref|XP_006663452.1|  PREDICTED: cytochrome P450 78A5-like               372   2e-119   
emb|CDY42443.1|  BnaC02g22650D                                          367   3e-117   
emb|CBI15326.3|  unnamed protein product                                363   2e-115   
emb|CAN78960.1|  hypothetical protein VITISV_008154                     364   3e-115   
gb|EAZ45439.1|  hypothetical protein OsJ_30089                          365   6e-115   
emb|CBI21506.3|  unnamed protein product                                363   6e-115   
ref|XP_002465125.1|  hypothetical protein SORBIDRAFT_01g032440          360   2e-114   
gb|EEE58282.1|  hypothetical protein OsJ_09308                          362   3e-114   
ref|XP_010419186.1|  PREDICTED: cytochrome P450 78A5-like               349   3e-112   
emb|CDY42442.1|  BnaC02g22660D                                          347   2e-111   
ref|XP_006387954.1|  hypothetical protein POPTR_0456s00200g             345   8e-111   
gb|EMS61238.1|  Cytochrome P450 78A3                                    332   2e-105   
ref|XP_002977642.1|  hypothetical protein SELMODRAFT_107558             328   5e-104   
ref|XP_002979624.1|  hypothetical protein SELMODRAFT_111062             327   1e-103   
gb|EMT17542.1|  Cytochrome P450 78A3                                    326   5e-103   
gb|AFK36151.1|  unknown                                                 319   2e-101   
ref|XP_002533334.1|  cytochrome P450, putative                          322   2e-101   
gb|EAZ18388.1|  hypothetical protein OsJ_33920                          318   3e-101   
gb|EMT11705.1|  Cytochrome P450 78A3                                    322   1e-100   
ref|XP_002961803.1|  hypothetical protein SELMODRAFT_77009              305   5e-95    
ref|XP_010923653.1|  PREDICTED: cytochrome P450 78A5-like               295   3e-92    
gb|EAY79271.1|  hypothetical protein OsI_34386                          298   3e-92    
ref|XP_002488872.1|  hypothetical protein SORBIDRAFT_2967s002010        286   4e-89    
ref|XP_007044033.1|  Cytochrome P450, putative                          286   5e-88    
gb|ABX10789.1|  putative cytochrome P-450                               261   3e-80    
gb|ABX10790.1|  putative cytochrome P-450                               257   1e-78    
gb|ADE75681.1|  unknown                                                 254   5e-77    
emb|CDO33958.1|  cyp450                                                 265   7e-77    
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         263   2e-76    
ref|XP_006848363.1|  hypothetical protein AMTR_s00013p00191450          252   2e-76    
ref|XP_006651585.1|  PREDICTED: cytochrome P450 78A5-like               260   2e-76    
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                261   5e-76    
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      261   5e-76    
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              261   5e-76    
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              261   8e-76    
ref|XP_006399285.1|  hypothetical protein EUTSA_v10013289mg             260   1e-75    
emb|CDX69984.1|  BnaA10g23330D                                          260   2e-75    
ref|NP_196416.1|  Flavonoid 3'-monooxygenase                            259   5e-75    
ref|XP_008779471.1|  PREDICTED: cytochrome P450 78A9-like               249   5e-75    
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             258   1e-74    
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         257   2e-74    
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             257   2e-74    
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                      256   5e-74    
ref|XP_002985246.1|  hypothetical protein SELMODRAFT_121799             245   1e-73    
ref|XP_002970054.1|  hypothetical protein SELMODRAFT_92671              244   2e-73    
ref|XP_001767245.1|  predicted protein                                  254   2e-73    
gb|AFI71898.1|  flavonoid 3'-hydroxylase                                253   9e-73    
gb|AAG49301.1|AF313491_1  flavonoid 3'-hydroxylase                      253   1e-72    



>ref|XP_009795443.1| PREDICTED: cytochrome P450 78A5-like [Nicotiana sylvestris]
Length=521

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/470 (76%), Positives = 401/470 (85%), Gaps = 8/470 (2%)
 Frame = +3

Query  168   VEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSLG  347
             V GGFAWRNY + Q  K L GP SWP LGFLPQMGSHAHRKLA++ATS+G  RLM  SLG
Sbjct  49    VPGGFAWRNYIHYQKHKILLGPFSWPLLGFLPQMGSHAHRKLATLATSLGSTRLMIISLG  108

Query  348   TTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHM  527
              TR+IISSHPDTAKEILCG+SF +RPVKESAKLLMFERAIGFAP  SYWR LRR+AAN M
Sbjct  109   ATRVIISSHPDTAKEILCGTSFANRPVKESAKLLMFERAIGFAPYESYWRNLRRIAANLM  168

Query  528   FSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQ  707
             FSPRRI+  EG+R  IA+ MI  + KEM E GFVEVRG++ +GSL N++ESVFGS LGL+
Sbjct  169   FSPRRISSFEGLRQLIADNMIEGVVKEMNEIGFVEVRGILRKGSLSNIMESVFGSTLGLE  228

Query  708   GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEKRKRQ  887
             GE+LGLMVKEGYELIGEFNW DYFPL F LDF GTKR+CH+LA +VN+LVG+I+++R+R+
Sbjct  229   GEKLGLMVKEGYELIGEFNWSDYFPLRF-LDFWGTKRRCHKLAAQVNELVGEIVKERRRE  287

Query  888   FEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARMVL  1067
              E     +N   DFLS+LLSL KEDQL DAD+VAVLWEM+FRGTDTVAIL+EWIMARMVL
Sbjct  288   GE-----LNMKNDFLSLLLSLAKEDQLTDADMVAVLWEMVFRGTDTVAILLEWIMARMVL  342

Query  1068  HQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDV  1247
             HQDVQAKAQ EIDTCVG ++HV+DSDI NLPYLQAIVKEVLRLHPPGPLLSWARL +HD 
Sbjct  343   HQDVQAKAQKEIDTCVGHNKHVRDSDIQNLPYLQAIVKEVLRLHPPGPLLSWARLTIHDT  402

Query  1248  YVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERF--MEEEVSIMGSDLRLAPFGSG  1421
             YVDKCFIPAGTTAMVNMWAITHD  IW DPW F+PER    EE++SIMGSDLRLAPFGSG
Sbjct  403   YVDKCFIPAGTTAMVNMWAITHDSTIWEDPWAFKPERLCDKEEDISIMGSDLRLAPFGSG  462

Query  1422  RRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             RRVCP R LGL+TVHLWLAR LQ FKWLP   VDL+ECLKLSLEM+K LA
Sbjct  463   RRVCPRRVLGLATVHLWLARLLQQFKWLPSKPVDLAECLKLSLEMEKPLA  512



>ref|XP_006352190.1| PREDICTED: cytochrome P450 78A5-like [Solanum tuberosum]
Length=516

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/476 (74%), Positives = 409/476 (86%), Gaps = 13/476 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSN----NQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNR  326
             +W+V GGFAWRNY++    ++NP KL+GP SWPFLGFLPQMGS AHRKLA +A+S+G  R
Sbjct  40    YWLVPGGFAWRNYTHYHHHHRNPNKLHGPFSWPFLGFLPQMGSCAHRKLAMIASSLGSTR  99

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LM  SLG TR+IISSHPDTAKEIL  +SF+ RP+KES KLLMFERAIGFAP GSYWR LR
Sbjct  100   LMTISLGATRVIISSHPDTAKEILWSASFSSRPLKESTKLLMFERAIGFAPYGSYWRNLR  159

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVF  686
             R+A NHMFSPRRI+C E +R  IA+ MIG++ +EM ESGFVEVR ++ +GSL N++ESVF
Sbjct  160   RIATNHMFSPRRISCFESLRQLIADNMIGEVVREMNESGFVEVRELLRQGSLSNILESVF  219

Query  687   GSCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQI  866
             GS LGL+GE+LGLMVKEGYELIGEFNW DYFP    LDF GTKR+C++L  +VN+LVG+I
Sbjct  220   GSSLGLEGEKLGLMVKEGYELIGEFNWSDYFP----LDFWGTKRRCYKLGAQVNELVGEI  275

Query  867   IEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEW  1046
             ++KR+R  EG  +N+ N  DFLSVLLSL KEDQL D D+VA+LWEM+FRGTDT+AILVEW
Sbjct  276   MKKRRR--EGELVNMKN--DFLSVLLSLAKEDQLKDEDMVAILWEMVFRGTDTIAILVEW  331

Query  1047  IMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWA  1226
             I+ARM+LHQDVQ KAQ EIDTCVG +R+VQDSDI NLPYLQAIVKEVLRLHPPGPLLSWA
Sbjct  332   ILARMILHQDVQEKAQEEIDTCVGHNRNVQDSDIQNLPYLQAIVKEVLRLHPPGPLLSWA  391

Query  1227  RLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-EEEVSIMGSDLRL  1403
             RLA+HD Y++KCFIPAGTTAMVNMWAITHDP IW DPW F+PERF+ +E+ SIMGSDLRL
Sbjct  392   RLAMHDTYINKCFIPAGTTAMVNMWAITHDPTIWEDPWAFKPERFINKEDFSIMGSDLRL  451

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             APFGSGRRVCPGR LGL+TVHLWLAR LQ FKWLP   VDLSECLKLSLEMKK LA
Sbjct  452   APFGSGRRVCPGRVLGLATVHLWLARLLQRFKWLPSKPVDLSECLKLSLEMKKPLA  507



>ref|XP_004239209.1| PREDICTED: cytochrome P450 78A5-like [Solanum lycopersicum]
Length=512

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/473 (74%), Positives = 407/473 (86%), Gaps = 10/473 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSN-NQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMA  335
             +W+V GGFAWRNY+  ++NP KL+GP SWPFLGFLPQMGS AHRKLA +A+S+G  RLM 
Sbjct  39    YWLVPGGFAWRNYTYYHRNPNKLHGPFSWPFLGFLPQMGSCAHRKLAKIASSLGSTRLMT  98

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
              SLG T++IISSHPDTAKEIL  +SF+ RP+KES KLLMFERAIGFAP GSYWR LRR+A
Sbjct  99    ISLGATQVIISSHPDTAKEILWSASFSSRPLKESTKLLMFERAIGFAPYGSYWRNLRRIA  158

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
              NHMFSPRRI+C E +R  IA++MIG++ KEM ESGF+E+RG++ +GSL N++ESVFGS 
Sbjct  159   TNHMFSPRRISCFESLRQLIADKMIGEVVKEMNESGFIEIRGLLRQGSLSNILESVFGSS  218

Query  696   LGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK  875
             LGL+GE LGLMVKEGYELIGEFNW DYFP    LDF GTKR+C++L  +VN++VG+I++K
Sbjct  219   LGLEGERLGLMVKEGYELIGEFNWSDYFP----LDFWGTKRRCYKLGAQVNEVVGEIMKK  274

Query  876   RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
             R+R  EG  +N+ N  DFLSVLLSL KEDQL D D+VA+LWEM+FRGTDT+AILVEWI+A
Sbjct  275   RRR--EGELVNMKN--DFLSVLLSLAKEDQLKDEDMVAILWEMVFRGTDTIAILVEWILA  330

Query  1056  RMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLA  1235
             R +LHQDVQ KAQ EIDTCVG +R+VQDSDI NLPYLQAIVKEVLRLHPPGPLLSWARLA
Sbjct  331   RTILHQDVQEKAQEEIDTCVGQNRNVQDSDIQNLPYLQAIVKEVLRLHPPGPLLSWARLA  390

Query  1236  VHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-EEEVSIMGSDLRLAPF  1412
             +HD Y+DKCFIPAGTTAMVNMWAITHDP IW D W F+PERF+ +E+ SIMGSDLRLAPF
Sbjct  391   MHDTYIDKCFIPAGTTAMVNMWAITHDPTIWEDSWAFKPERFINKEDFSIMGSDLRLAPF  450

Query  1413  GSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             GSGRRVCPGR LGL+TVHLWLAR LQ FKWLP   VDLSECLKLSLEMKK LA
Sbjct  451   GSGRRVCPGRVLGLATVHLWLARLLQRFKWLPNKPVDLSECLKLSLEMKKPLA  503



>emb|CDP13335.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/471 (72%), Positives = 393/471 (83%), Gaps = 9/471 (2%)
 Frame = +3

Query  168   VEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSLG  347
             V GGFAWRN+  N       GP+ WPFLG LPQMGSHAHRKLA +ATS+G  RLM F+LG
Sbjct  50    VPGGFAWRNHRQNLTSTNNRGPICWPFLGLLPQMGSHAHRKLAFLATSLGSARLMPFTLG  109

Query  348   -TTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANH  524
               TR+IISSHPDTA+EILCGSSF+DRP+KESA+ LMF+RAIGFAPSG YWR LRR+AANH
Sbjct  110   FNTRLIISSHPDTAREILCGSSFSDRPIKESARTLMFQRAIGFAPSGKYWRHLRRIAANH  169

Query  525   MFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGL  704
             MFSP+RI+ LEG+R  +A+ MI  +  EM E+  VE+R ++ +GSL NV+ESVFGS LG 
Sbjct  170   MFSPKRISNLEGLRQRVADGMIASVRVEMNETSIVELRSILKKGSLINVLESVFGSNLGS  229

Query  705   QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEKRKR  884
             +GE+LG MV+EGYELI EFNW DY P  +L DFGG K++CH+LAG V+ LVG+II++R+R
Sbjct  230   EGEKLGSMVEEGYELISEFNWADYIPSKWL-DFGGVKKRCHKLAGEVSCLVGRIIKERRR  288

Query  885   QFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARMV  1064
                  E NVN   DF+SV LSLP+EDQL DADLVAVLWEM+FRGTDTVAIL+EWIMARMV
Sbjct  289   -----EGNVNARNDFVSVCLSLPEEDQLTDADLVAVLWEMVFRGTDTVAILLEWIMARMV  343

Query  1065  LHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHD  1244
             LHQD+QA+AQ EIDTCVG  R VQDSD+PNLPYLQA+VKEVLRLHPPGPLLSW+RLA+HD
Sbjct  344   LHQDIQARAQREIDTCVGHGRDVQDSDVPNLPYLQAVVKEVLRLHPPGPLLSWSRLAIHD  403

Query  1245  VYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFGSGR  1424
             V+VDK F+PAGTTAMVNMWAITHDP IW DPW FRP+RFMEE+VSIMGSDLRLAPFGSGR
Sbjct  404   VHVDKFFVPAGTTAMVNMWAITHDPAIWQDPWAFRPDRFMEEDVSIMGSDLRLAPFGSGR  463

Query  1425  RVCPGRALGLSTVHLWLARFLQHFKWL--PGPSVDLSECLKLSLEMKKHLA  1571
             RVCPGR LGL+TV LWLAR LQ FKW+      VDLSECLKLSLEMK  LA
Sbjct  464   RVCPGRMLGLTTVQLWLARLLQQFKWINPAAEQVDLSECLKLSLEMKNRLA  514



>ref|XP_006484094.1| PREDICTED: cytochrome P450 78A5-like [Citrus sinensis]
Length=519

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/474 (72%), Positives = 392/474 (83%), Gaps = 7/474 (1%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             +  W+V GGFAWRNY  N+   KL GP+ WP +G LP MGS AHRKLASMA S+G NRLM
Sbjct  43    LNLWLVPGGFAWRNY--NEISAKLRGPVGWPIVGTLPCMGSLAHRKLASMAASLGANRLM  100

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             A S G TR+IISSHP+TAKEIL G SF+DRP+KESA+LLMFERAIGFAPSG YWR LRR+
Sbjct  101   ALSFGPTRVIISSHPETAKEILSGPSFSDRPIKESARLLMFERAIGFAPSGKYWRHLRRI  160

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG-  689
             AANHMFSPRRI+ LE +R  +A+EM+ K++++M   G V VR V+ +GSL N++ES+FG 
Sbjct  161   AANHMFSPRRISGLEILRQRLADEMLSKVNQQMENKGVVRVREVLQKGSLGNILESLFGG  220

Query  690   SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
             S + L+ EEL  MVKEGYELI +FNW DYFPL  LLDF G KR+CH+LA RV  L+GQ++
Sbjct  221   SVISLKKEELEAMVKEGYELIAQFNWEDYFPLN-LLDFYGVKRRCHKLAARVKTLIGQVV  279

Query  870   EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWI  1049
             E+RK+     E N N   DFLS LLSLPKEDQL+DAD VA+LWEM+FRGTDTVAIL+EWI
Sbjct  280   EERKKN--SGEFN-NGGNDFLSALLSLPKEDQLSDADTVAILWEMVFRGTDTVAILLEWI  336

Query  1050  MARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR  1229
             MAR+VLHQD+Q K Q EIDT VG  RHV+DSDIPNLPYLQAIVKEVLR+HPPGPLLSWAR
Sbjct  337   MARIVLHQDIQTKVQNEIDTWVGRDRHVEDSDIPNLPYLQAIVKEVLRMHPPGPLLSWAR  396

Query  1230  LAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAP  1409
             LAVHDV+VDK F+PAGTTAMVNMWAITHDP IW +PWTF+PERF+EE+V IMGSDLRLAP
Sbjct  397   LAVHDVHVDKVFVPAGTTAMVNMWAITHDPTIWKNPWTFKPERFIEEDVPIMGSDLRLAP  456

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             FGSGRRVCPG+ALGL+TVHLWLAR L  F+WLP   VDLSE LKLSLEMKK L 
Sbjct  457   FGSGRRVCPGKALGLATVHLWLARLLHRFRWLPAEPVDLSETLKLSLEMKKPLT  510



>ref|XP_006438035.1| hypothetical protein CICLE_v10031245mg [Citrus clementina]
 gb|ESR51275.1| hypothetical protein CICLE_v10031245mg [Citrus clementina]
Length=519

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/474 (71%), Positives = 392/474 (83%), Gaps = 7/474 (1%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             +  W+V GGFAWRNY  N+   KL GP+ WP +G LP MGS AHRKLASMA S+G NRLM
Sbjct  43    LNLWLVPGGFAWRNY--NEISAKLRGPVGWPIVGTLPCMGSLAHRKLASMAASLGANRLM  100

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             A S G TR+IISSHP+TAKEIL G SF+DRP+KESA+LLMFERAIGFAPSG YWR LRR+
Sbjct  101   ALSFGPTRVIISSHPETAKEILSGPSFSDRPIKESARLLMFERAIGFAPSGKYWRHLRRI  160

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG-  689
             AANHMFSPRRI+ LE +R  +A+EM+ K++++M   G V VR V+ +GSL N++ES+FG 
Sbjct  161   AANHMFSPRRISGLEILRRRLADEMLSKVNQQMENKGVVRVREVLQKGSLGNILESLFGG  220

Query  690   SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
             S + L+ EEL  MVKEGYELI +FNW DYFPL  LLDF G KR+CH+LA RV  L+GQ++
Sbjct  221   SVISLKKEELEAMVKEGYELIAQFNWEDYFPLN-LLDFYGVKRRCHKLAARVKTLIGQVV  279

Query  870   EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWI  1049
             E+RK+     E N N   DFLS LLSLPKEDQL+DAD VA+LWEM+FRGTDTVAIL+EWI
Sbjct  280   EERKKN--SGEFN-NGGNDFLSALLSLPKEDQLSDADTVAILWEMVFRGTDTVAILLEWI  336

Query  1050  MARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR  1229
             M+R+VLHQD+Q K Q EIDT VG  RHV+DSDIPNLPYLQAIVKEVLR+HPPGPLLSWAR
Sbjct  337   MSRIVLHQDIQTKVQNEIDTWVGRDRHVEDSDIPNLPYLQAIVKEVLRMHPPGPLLSWAR  396

Query  1230  LAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAP  1409
             LAVHDV+VDK F+PAGTTAMVNMWAITHDP IW +PWTF+PERF+EE+V IMGSDLRLAP
Sbjct  397   LAVHDVHVDKVFVPAGTTAMVNMWAITHDPTIWKNPWTFKPERFIEEDVPIMGSDLRLAP  456

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             FGSGRRVCPG+ALGL+TVHLWLAR L  F+WLP   VDLSE LKLSLEMKK L 
Sbjct  457   FGSGRRVCPGKALGLATVHLWLARLLHRFRWLPAEPVDLSETLKLSLEMKKPLT  510



>ref|XP_002303803.2| hypothetical protein POPTR_0003s17200g [Populus trichocarpa]
 gb|EEE78782.2| hypothetical protein POPTR_0003s17200g [Populus trichocarpa]
Length=518

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/471 (69%), Positives = 395/471 (84%), Gaps = 6/471 (1%)
 Frame = +3

Query  156   KFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMA  335
              +W+V GGFAWRN+ +NQNP +  GP+ WP +G LPQMGS AHRKLASMA S+G  +LMA
Sbjct  42    NYWLVPGGFAWRNHHDNQNPSRFRGPIGWPIVGTLPQMGSLAHRKLASMAASLGATKLMA  101

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FSLG+TR+IISSHPDTA+EILCG SF DRP+KESA+LLMFERAIGFAPSG YWR LRR+A
Sbjct  102   FSLGSTRVIISSHPDTAREILCGCSFADRPIKESARLLMFERAIGFAPSGDYWRHLRRIA  161

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             AN+MFSPR+I+ LE +R  +A EM+ ++ +EM E   V +R ++ +GSL NV+ESVFGS 
Sbjct  162   ANYMFSPRKISALEPLRQRLANEMVAEVREEMKERRVVVLRDILQKGSLSNVLESVFGSD  221

Query  696   LGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK  875
             + ++ EELG MVKEG++LI EFN  DYFPL FL DF G KR+C +LAG+VN +VGQI+++
Sbjct  222   VSIEREELGFMVKEGFDLIAEFNLDDYFPLRFL-DFHGVKRRCCQLAGKVNSVVGQIVKE  280

Query  876   RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
             RK   +       + +DFLS LLSLP+EDQL ++D+VA+LWEMIFRGTDTVA+L+EWIMA
Sbjct  281   RKGAGDS-----RSGSDFLSALLSLPEEDQLNESDMVALLWEMIFRGTDTVALLLEWIMA  335

Query  1056  RMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLA  1235
             RMV+H ++QAKAQ E+DTC+G  R VQDSDIPNLPYL+AIVKEVLRLHPPGPLLSWARLA
Sbjct  336   RMVVHPEIQAKAQEELDTCIGGHREVQDSDIPNLPYLRAIVKEVLRLHPPGPLLSWARLA  395

Query  1236  VHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFG  1415
             +HDV+VDK FIPAGTT MVNMWAITHDP IW DPW+F P+RF+EE+V IMGSDLRLAPFG
Sbjct  396   IHDVHVDKTFIPAGTTVMVNMWAITHDPSIWRDPWSFNPDRFIEEDVLIMGSDLRLAPFG  455

Query  1416  SGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             +GRRVCPG+ALGL+TVHLWLAR L  ++WLP   VDLSECL+LSLEMK+ L
Sbjct  456   AGRRVCPGKALGLATVHLWLARLLHEYRWLPAKPVDLSECLRLSLEMKRPL  506



>gb|KDO81910.1| hypothetical protein CISIN_1g010074mg [Citrus sinensis]
Length=519

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/474 (71%), Positives = 391/474 (82%), Gaps = 7/474 (1%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             +  W+V GGFAWRNY  N+   KL GP+ WP +G LP MGS AHRKLASMA S+G NRLM
Sbjct  43    LNLWLVPGGFAWRNY--NEISAKLRGPVGWPIVGTLPCMGSLAHRKLASMAASLGANRLM  100

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             A S G TR+IISSHP+TAKEIL G SF+DRP+KESA+LLMFERAIGFAPSG YWR LRR+
Sbjct  101   ALSFGPTRVIISSHPETAKEILSGPSFSDRPIKESARLLMFERAIGFAPSGKYWRHLRRI  160

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG-  689
             AANHMFSPRRI+ LE +R  +A+EM+ K++++M   G V VR V+ +GSL N++ES+FG 
Sbjct  161   AANHMFSPRRISGLEILRQRLADEMLSKVNQQMENKGVVRVREVLQKGSLGNILESLFGG  220

Query  690   SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
             S + L+ EEL  MVKEGYELI +FNW DYFPL  LLDF G KR+CH+LA RV  L+GQ++
Sbjct  221   SVISLKKEELEAMVKEGYELIAQFNWEDYFPLN-LLDFYGVKRRCHKLAARVKTLIGQVV  279

Query  870   EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWI  1049
             E+RK+     E N N   DFLS LLSLPKEDQL+DAD VA+LWEM+FRGTDTVAIL+EWI
Sbjct  280   EERKKN--SGEFN-NGGNDFLSALLSLPKEDQLSDADTVAILWEMVFRGTDTVAILLEWI  336

Query  1050  MARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR  1229
             MAR+VLHQD+Q K Q EIDT VG  RHV+DSDI +LPYLQAIVKEVLR+HPPGPLLSWAR
Sbjct  337   MARIVLHQDIQTKVQNEIDTWVGRDRHVEDSDISSLPYLQAIVKEVLRMHPPGPLLSWAR  396

Query  1230  LAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAP  1409
             LAVHDV+VDK F+PAGTTAMVNMWAITHDP IW +PWTF+PERF+EE+V I+GSDLRLAP
Sbjct  397   LAVHDVHVDKVFVPAGTTAMVNMWAITHDPTIWKNPWTFKPERFIEEDVPILGSDLRLAP  456

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             FGSGRRVCPG+ALGL+TVHLWLAR L  F+WLP   VDLSE LKLSLEMKK L 
Sbjct  457   FGSGRRVCPGKALGLATVHLWLARLLHRFRWLPAEPVDLSETLKLSLEMKKPLT  510



>ref|XP_011020726.1| PREDICTED: cytochrome P450 78A3-like [Populus euphratica]
Length=519

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/471 (68%), Positives = 393/471 (83%), Gaps = 6/471 (1%)
 Frame = +3

Query  156   KFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMA  335
              +W+V GGFAWRN+ +NQNP +  GP+ WP +G LPQMGS AHRKLAS+A S+G  +LMA
Sbjct  42    NYWLVPGGFAWRNHHDNQNPSRFRGPIGWPIVGTLPQMGSLAHRKLASVAASLGATKLMA  101

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FSLG+TR+IISSHPDTA+EILCG SF DRP+KE+A+LLMFERAIGFAPSG YWR LRR+A
Sbjct  102   FSLGSTRVIISSHPDTAREILCGCSFADRPIKEAARLLMFERAIGFAPSGDYWRHLRRIA  161

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             AN+MFSPR+I+ LE +R  +A EM+ ++ +EM E   V +R ++ +GSL NV+ESVFGS 
Sbjct  162   ANYMFSPRKISALEPLRQRLANEMVAEVREEMKERRVVVLRDILQKGSLSNVLESVFGSD  221

Query  696   LGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK  875
             + ++GEELG MVKEG++LI +FN+ DYFPL FL DF G KR+C +LAG+VN +VGQI+++
Sbjct  222   VSIEGEELGFMVKEGFDLIAKFNFDDYFPLRFL-DFNGVKRRCCKLAGKVNSVVGQIVKE  280

Query  876   RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
             RKR  +       + +DFLS LLSLP+EDQL ++D+VA+LWEMIFRGTDTVA+L+EWIMA
Sbjct  281   RKRAGDS-----RSGSDFLSALLSLPEEDQLNESDMVALLWEMIFRGTDTVALLLEWIMA  335

Query  1056  RMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLA  1235
             RMV H ++QAKAQ E+D C+G  R V DSDIPNLPYL+AIVKEVLRLHPPGPLLSWARLA
Sbjct  336   RMVEHPEIQAKAQEELDRCIGSHREVLDSDIPNLPYLRAIVKEVLRLHPPGPLLSWARLA  395

Query  1236  VHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFG  1415
             +HDV+VDK FIPAGTT MVNMWAITHDP IW DPW F P+RF+EE+V IMGSDLRLAPFG
Sbjct  396   IHDVHVDKTFIPAGTTVMVNMWAITHDPSIWRDPWVFNPDRFIEEDVLIMGSDLRLAPFG  455

Query  1416  SGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             +GRRVCPG+ALGL+TVHLW AR L  ++WLP   VDLSECL+LSLEMK+ L
Sbjct  456   AGRRVCPGKALGLATVHLWFARLLHEYRWLPAKPVDLSECLRLSLEMKRPL  506



>ref|XP_002299298.2| hypothetical protein POPTR_0001s13990g [Populus trichocarpa]
 gb|EEE84103.2| hypothetical protein POPTR_0001s13990g [Populus trichocarpa]
Length=556

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/472 (69%), Positives = 388/472 (82%), Gaps = 6/472 (1%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             + +W+V GGFAWRN+ +NQNP K  GP+ WP  G LPQMGS AHRKLASMATS+G  +LM
Sbjct  74    INYWLVPGGFAWRNHHDNQNPSKFRGPIGWPVFGTLPQMGSLAHRKLASMATSLGATKLM  133

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFSLGTTR+IISSHPDTA+EIL GSSF DRPVKESA+LLMFERAIGFAPSG YWR LRR+
Sbjct  134   AFSLGTTRVIISSHPDTAREILWGSSFADRPVKESARLLMFERAIGFAPSGDYWRHLRRI  193

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AANHMFSP++I+ LE +R  +A EM+ ++  EM E   V +RG++ + SL NV+ESV GS
Sbjct  194   AANHMFSPKKISGLEPLRQRLANEMLAEVSGEMKERRAVVLRGILQKSSLSNVLESVLGS  253

Query  693   CLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
              + ++ EELG M +EG++L+  FN  DYFPL FL DF G KR+C++LAG+VN LVGQI+ 
Sbjct  254   DVHVKREELGFMAQEGFDLVSRFNLEDYFPLRFL-DFYGVKRRCYKLAGKVNSLVGQIVR  312

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             +RKR       +  + TDFLS LLSLP++++L ++D+V +LWEMIFRGTDTVAIL+EWIM
Sbjct  313   ERKRAG-----DFRSRTDFLSALLSLPEQERLDESDMVPLLWEMIFRGTDTVAILLEWIM  367

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             ARMVLH ++QAKA  E++  +G  R VQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL
Sbjct  368   ARMVLHPEIQAKAHQELEKFIGNHRRVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  427

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPF  1412
             A+HDV+VDK  IPAGTTAMVNMWAITHDP IW DPW F P+RFMEE+V IMGSDLRLAPF
Sbjct  428   AIHDVHVDKMSIPAGTTAMVNMWAITHDPSIWRDPWAFNPDRFMEEDVLIMGSDLRLAPF  487

Query  1413  GSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             GSGRRVCPG+ALGL+TVHLWLAR L  +KWLP   VDLSECL+LSLEMK+ L
Sbjct  488   GSGRRVCPGKALGLATVHLWLARLLHEYKWLPAKPVDLSECLRLSLEMKRPL  539



>ref|XP_011002141.1| PREDICTED: cytochrome P450 78A4-like [Populus euphratica]
Length=523

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/472 (68%), Positives = 388/472 (82%), Gaps = 6/472 (1%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             + +W+V GGFAWRN+ +NQNP K  GP+ WP LG LPQMGS AHRKLASMA S+G  +LM
Sbjct  41    LNYWLVPGGFAWRNHHDNQNPSKFRGPIGWPVLGTLPQMGSLAHRKLASMANSLGATKLM  100

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFSLGTTR+IISSHPDTA+EILC SSF DRPVKESA+LLMFERAIGFAPSG YWR LRR+
Sbjct  101   AFSLGTTRVIISSHPDTAREILCASSFADRPVKESARLLMFERAIGFAPSGDYWRHLRRI  160

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AANHMFSPR+I+ LE +R  +A EM+ ++  EM E   V +RG++ +GSL NV+ESV GS
Sbjct  161   AANHMFSPRKISGLEPLRQRLANEMLAEVSGEMKERRGVVLRGILQKGSLSNVLESVLGS  220

Query  693   CLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
              + ++ EELG M +EG++L+  FN  DYFPL FL DF G KR+C++LAG+VN +VGQ + 
Sbjct  221   DVHVKREELGFMAQEGFDLVSRFNLEDYFPLRFL-DFHGVKRRCYKLAGKVNSVVGQFVR  279

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             +RKR       +  + +DFLS LLSLP++++L ++D+V +LWEMIFRGTDTVAIL+EWIM
Sbjct  280   ERKRAG-----DFRSRSDFLSALLSLPEQERLDESDMVPLLWEMIFRGTDTVAILLEWIM  334

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             ARMVLH ++QAKA  E++  +G  R VQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR+
Sbjct  335   ARMVLHPEIQAKAHQELEKFIGNHRQVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARI  394

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPF  1412
             A+HDV+VDK  IPAGTTAMVNMWAITHDP IW DPW F P+RFMEE+V IMGSDLRLAPF
Sbjct  395   AIHDVHVDKMSIPAGTTAMVNMWAITHDPSIWKDPWAFNPDRFMEEDVLIMGSDLRLAPF  454

Query  1413  GSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             GSGRRVCPG+ALGL+TVHLWLAR L  +KWLP   VDLSECL+LSLEMK+ L
Sbjct  455   GSGRRVCPGKALGLATVHLWLARLLHEYKWLPAKPVDLSECLRLSLEMKRPL  506



>ref|XP_004135319.1| PREDICTED: cytochrome P450 78A3-like [Cucumis sativus]
 gb|KGN51675.1| hypothetical protein Csa_5G589920 [Cucumis sativus]
Length=505

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/476 (68%), Positives = 390/476 (82%), Gaps = 13/476 (3%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             + +W++ GGFAWRN+  ++    L GP  WP LG LPQMG  AHR LA++A S    RLM
Sbjct  32    LNYWLIPGGFAWRNH--HRFSVNLPGPSGWPLLGTLPQMGPLAHRNLATIAHSFKATRLM  89

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             +FS+G TR IISSHPDTAK+ILCGS+F+DRPVK+SA+L+MFERAIGFAP+G+YWR LRR+
Sbjct  90    SFSMGATRAIISSHPDTAKQILCGSAFSDRPVKQSARLMMFERAIGFAPNGAYWRNLRRI  149

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AANHMFSPR+I+ LEG+R  +A+EM+ ++   M   G V +R V+ + SL+N++ESVFGS
Sbjct  150   AANHMFSPRKISDLEGLRREVADEMVAELSGNMASEGVVRLREVLQKHSLKNIIESVFGS  209

Query  693   CLGL-QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
              +G+ +  EL  MV+EGYELI  FNW DYFP+ FL DF G KR+C+ LAGRVN ++GQI+
Sbjct  210   GMGMGRKGELSDMVREGYELIAMFNWEDYFPVSFL-DFSGVKRRCNELAGRVNVVIGQIV  268

Query  870   EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWI  1049
             E+RKR+      N   + DFL+ LL+LPKEDQL+D+D+VAVLWEMIFRGTDT+AIL+EWI
Sbjct  269   EERKRE------NTEFHNDFLTTLLTLPKEDQLSDSDMVAVLWEMIFRGTDTIAILLEWI  322

Query  1050  MARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR  1229
             MARM+LH D+QAKAQ EIDTCVG +RHV DSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR
Sbjct  323   MARMILHPDIQAKAQNEIDTCVGCNRHVCDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR  382

Query  1230  LAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAP  1409
             LA+HDV+VDK  IPAGTTAMVNMWAI HDP IW DPWTF+PERF+E ++SIMGSDLRLAP
Sbjct  383   LAIHDVHVDKILIPAGTTAMVNMWAIAHDPSIWKDPWTFKPERFIENDMSIMGSDLRLAP  442

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP---GPSVDLSECLKLSLEMKKHL  1568
             FG+GRR CPGRALGL+TVHLWLA FL  F+W P     SV+LSECLKLSLEMKK L
Sbjct  443   FGAGRRACPGRALGLATVHLWLANFLHRFRWTPCSSTKSVNLSECLKLSLEMKKPL  498



>ref|XP_008446041.1| PREDICTED: cytochrome P450 78A5-like [Cucumis melo]
Length=522

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/477 (68%), Positives = 390/477 (82%), Gaps = 15/477 (3%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             + +W++ GGFAWRN+  ++    L GP  WP LG LPQMG  AHR LA++A S    RLM
Sbjct  49    LNYWLIPGGFAWRNH--HRFSVNLPGPSGWPLLGTLPQMGPLAHRNLAAIAHSFKATRLM  106

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             +FS+G TR IISSHPDTAK+ILCGS+F+DRPVK+SAKL+MFERAIGFAP+G YWR LRR+
Sbjct  107   SFSMGATRAIISSHPDTAKQILCGSAFSDRPVKQSAKLMMFERAIGFAPNGVYWRNLRRI  166

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AANHMFSPR+I+ LEG+R  +A+EM+ ++   M   G V +R V+ + SL+N++ESVFGS
Sbjct  167   AANHMFSPRKISDLEGLRREVADEMVAEVSGNMASEGVVRLREVLQKHSLKNIIESVFGS  226

Query  693   CL--GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQI  866
              +  G +GE L  MV+EGYELI  FNW DYFP+ FL DF G KR+C+ LAGRVN ++GQI
Sbjct  227   GMEMGRKGE-LSDMVREGYELIAMFNWEDYFPISFL-DFSGVKRRCNELAGRVNVVIGQI  284

Query  867   IEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEW  1046
             +E+RKR      +N   N DFL+ LL+LPKEDQL+D+D+VAVLWEMIFRGTDT+AIL+EW
Sbjct  285   VEERKR------VNNEFNNDFLTTLLTLPKEDQLSDSDMVAVLWEMIFRGTDTIAILLEW  338

Query  1047  IMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWA  1226
             IMARM+LH D+QAKAQ EID CVG +RHV+DSDIPNLPYLQAIVKEVLRLHPPGPLLSWA
Sbjct  339   IMARMILHPDIQAKAQDEIDLCVGGNRHVRDSDIPNLPYLQAIVKEVLRLHPPGPLLSWA  398

Query  1227  RLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLA  1406
             RLAVHDV+VDK  IPAGTTAMVNMWAI HDP IW DPWTF+PERF+E ++SIMGSDLRLA
Sbjct  399   RLAVHDVHVDKILIPAGTTAMVNMWAIAHDPSIWKDPWTFKPERFIENDMSIMGSDLRLA  458

Query  1407  PFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP---GPSVDLSECLKLSLEMKKHL  1568
             PFG+GRR CPGRALGL+TVHLWLA FL  F+W+P     SV+LSECLKLSLEMKK L
Sbjct  459   PFGAGRRACPGRALGLATVHLWLANFLHRFRWIPCSSTKSVNLSECLKLSLEMKKPL  515



>ref|XP_002271641.2| PREDICTED: cytochrome P450 78A4-like [Vitis vinifera]
Length=516

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/473 (70%), Positives = 388/473 (82%), Gaps = 7/473 (1%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             + FW+V GGFAWRN+ + +   KL+GP+ WP LG LP MGS AHRKLA+MA S G  RLM
Sbjct  42    LNFWLVPGGFAWRNH-HGKYSSKLSGPIGWPLLGSLPLMGSLAHRKLATMAASCGATRLM  100

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             A SLG T +IISSHPDTAKEILCGSSF++RPVK SA+LLMFERAIGFAPSG YWR LRR+
Sbjct  101   ALSLGVTPVIISSHPDTAKEILCGSSFSNRPVKASARLLMFERAIGFAPSGDYWRHLRRI  160

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AAN+MFSP+RI+  E VR  +A+EM+  + KEM E   V++RG++ +GSL N++ESVFG 
Sbjct  161   AANYMFSPKRISGSEAVRLRVADEMVVGVRKEMEERSVVKLRGILQKGSLSNIMESVFGR  220

Query  693   CLG-LQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
              LG ++GE LG MV EGYELI +FNW DYFPLGF+ DF G KR+C +LA +VN +VG++I
Sbjct  221   GLGSVEGEGLGFMVIEGYELIAKFNWEDYFPLGFI-DFYGVKRRCSKLAAKVNGVVGKMI  279

Query  870   EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWI  1049
             E+RKR  E          DFLSVLLSLPKEDQL+D+D+VAVLWEMIFRGTDTVAIL+EWI
Sbjct  280   EERKRVGE----LSGGGNDFLSVLLSLPKEDQLSDSDMVAVLWEMIFRGTDTVAILLEWI  335

Query  1050  MARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR  1229
             MARMV+HQD+QAKAQ E+DTC+G   HVQDS I +LPYLQAIVKE LR+HPPGPLLSWAR
Sbjct  336   MARMVIHQDIQAKAQEELDTCLGNQSHVQDSHIQSLPYLQAIVKEALRMHPPGPLLSWAR  395

Query  1230  LAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAP  1409
             LA+HDV+V K F+PAGTTAMVNMWAI HDP IW DPW F+P+RF+ E+VSIMGSDLRLAP
Sbjct  396   LAIHDVHVGKFFVPAGTTAMVNMWAIAHDPTIWKDPWAFKPDRFINEDVSIMGSDLRLAP  455

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             FGSGRR CPG+ALGL+TVHLWLAR L  FKWLP   VDL ECL+LSLEMKK L
Sbjct  456   FGSGRRACPGKALGLATVHLWLARLLHQFKWLPTHPVDLGECLRLSLEMKKPL  508



>emb|CAN70074.1| hypothetical protein VITISV_028565 [Vitis vinifera]
Length=516

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/473 (70%), Positives = 388/473 (82%), Gaps = 7/473 (1%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             + FW+V GGFAWRN+ + +   KL+GP+ WP LG LP MGS AHRKLA MA S G  RLM
Sbjct  42    LNFWLVPGGFAWRNH-HGKYSSKLSGPIGWPLLGSLPLMGSLAHRKLAXMAASCGATRLM  100

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             A SLG T +IISSHPDTAKEILCGSSF++RPVK SA+LLMFERAIGFAPSG YWR LRR+
Sbjct  101   ALSLGVTPVIISSHPDTAKEILCGSSFSNRPVKASARLLMFERAIGFAPSGDYWRHLRRI  160

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AAN+MFSP+RI+  E VR  +A+EM+  + KEM E G V++RG++ +GSL N++ESVFG 
Sbjct  161   AANYMFSPKRISGSEAVRLRVADEMVVGVRKEMEERGVVKLRGILQKGSLSNIMESVFGR  220

Query  693   CLG-LQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
              LG ++GE LG MV EGYELI +FNW DYFPLGF+ DF G KR+C +LA +VN +VG++I
Sbjct  221   GLGSVEGEGLGFMVIEGYELIAKFNWEDYFPLGFI-DFYGVKRRCSKLAAKVNGVVGKMI  279

Query  870   EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWI  1049
             E+RKR  E          DFLSVLLSLPKEDQL+D+D+VAVLWEMIFRGTDTVAIL+EWI
Sbjct  280   EERKRVGE----LSGGGNDFLSVLLSLPKEDQLSDSDMVAVLWEMIFRGTDTVAILLEWI  335

Query  1050  MARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR  1229
             MARMV+HQD+QAKAQ E+DTC+G   HVQDS I +LPYLQAIVKE LR+HPPGPLLSWAR
Sbjct  336   MARMVIHQDIQAKAQEELDTCLGNQSHVQDSHIQSLPYLQAIVKEALRMHPPGPLLSWAR  395

Query  1230  LAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAP  1409
             LA+HDV+V K F+PAGTTAMVNMWAI HDP IW DPW F+P+RF+ E+VSIMGSDLRLAP
Sbjct  396   LAIHDVHVGKFFVPAGTTAMVNMWAIAHDPTIWKDPWAFKPDRFINEDVSIMGSDLRLAP  455

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             FGSGRR CPG+ALGL+TVHLWLAR L  FKWLP   VDL ECL+LSLEMKK L
Sbjct  456   FGSGRRACPGKALGLATVHLWLARLLHQFKWLPTHPVDLGECLRLSLEMKKPL  508



>ref|XP_008389856.1| PREDICTED: cytochrome P450 78A5-like [Malus domestica]
Length=530

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/480 (69%), Positives = 390/480 (81%), Gaps = 16/480 (3%)
 Frame = +3

Query  162   WVVEGGFAWRNYS---NNQNPKKLNGPMSWPFLGFLP-QMGSHAHRKLASMATSMGLNRL  329
             W+V GGFAW  Y+   N+QN   L GP  WP LGFLP QMGS AH+KL+SMATS+   RL
Sbjct  48    WLVPGGFAWSCYNHDQNSQNESSLRGPAGWPILGFLPHQMGSLAHQKLSSMATSLKATRL  107

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLGTTR++ISSHPDTA++IL GSSF+DRP+K SAKLLMFERAIGFAPSG+YWR LR 
Sbjct  108   MAFSLGTTRVVISSHPDTARQILGGSSFSDRPIKHSAKLLMFERAIGFAPSGTYWRHLRS  167

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +AA HMFSPRRI  LE +R  +A+EM+ K+  EM E+  V ++ ++ +GSL N+++SVFG
Sbjct  168   IAAVHMFSPRRIGGLETLRQQVADEMVVKIWDEMKENRVVGLKAILQKGSLDNIIQSVFG  227

Query  690   S-CLGLQGE-----ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVND  851
             +  LGL+ E      L L+VKEGY+LI  FN  DYFPL FL DF G KRKCH+LA  V  
Sbjct  228   TNYLGLEKEVSTNRTLMLLVKEGYDLIYRFNLEDYFPLRFL-DFYGVKRKCHKLAAEVKS  286

Query  852   LVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVA  1031
             +VGQI+ +RKR       +    +DFLS LL+LP+ED+L+D+D VAVLWEMIFRGTDTVA
Sbjct  287   VVGQIVRERKRAG-----DFGGGSDFLSALLALPEEDKLSDSDTVAVLWEMIFRGTDTVA  341

Query  1032  ILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGP  1211
             IL+EWIMAR+VLHQD+QAKAQ E+DT VG  RHV+DSD+PNLPYLQAIVKEVLR+HPPGP
Sbjct  342   ILLEWIMARIVLHQDIQAKAQQELDTHVGNKRHVRDSDLPNLPYLQAIVKEVLRMHPPGP  401

Query  1212  LLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGS  1391
             LLSWARLA+HDV+VDK FIPAGTTAMVNMWAITHDP IW DP  FRPERF+EE+VSIMGS
Sbjct  402   LLSWARLAIHDVHVDKVFIPAGTTAMVNMWAITHDPSIWKDPMVFRPERFIEEDVSIMGS  461

Query  1392  DLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             DLRLAPFGSGRRVCPG+ALGL+TVHLWLARFL  F+WLP   +DLSECLKLSLEMKK L 
Sbjct  462   DLRLAPFGSGRRVCPGKALGLATVHLWLARFLHQFRWLPAEPIDLSECLKLSLEMKKPLT  521



>ref|XP_010682779.1| PREDICTED: cytochrome P450 78A5-like [Beta vulgaris subsp. vulgaris]
Length=519

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/471 (70%), Positives = 389/471 (83%), Gaps = 10/471 (2%)
 Frame = +3

Query  168   VEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSLG  347
             + GGFAWR+Y+ N  PK L GP  WP LG LPQMGS AHRKLA+MATS+G  RLMA SLG
Sbjct  43    IPGGFAWRSYNLNSVPK-LIGPSGWPLLGSLPQMGSLAHRKLATMATSLGCTRLMALSLG  101

Query  348   TTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHM  527
             TT MIISSHP+TAK+ILC  SF+DRP+K SA+LLMFERAIGFAP G+YWR LRR+AA++M
Sbjct  102   TTPMIISSHPETAKQILCSPSFSDRPIKASARLLMFERAIGFAPHGTYWRHLRRIAASYM  161

Query  528   FSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQ  707
             FSPRRI+ LE VR  +A+ M+  + KEM   G VE+RG++   SL+N++ESVFGS LG +
Sbjct  162   FSPRRISSLEEVRQCLADAMLENVSKEMKSRGVVELRGILLGVSLKNMLESVFGSNLGSE  221

Query  708   GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEKRKRQ  887
             GE+LGLMV+EGYELI EFN  DYFPLG LLDF G KR+CH+LA RVN+L+G+ IE RK+ 
Sbjct  222   GEKLGLMVREGYELISEFNLEDYFPLG-LLDFNGVKRRCHKLACRVNELLGKFIEVRKK-  279

Query  888   FEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARMVL  1067
                 ++N     DFLSVLLSLP +++L+ +D+VAVLWE IFRG DTVA L+EWIMARMVL
Sbjct  280   ----DVNFKQRNDFLSVLLSLPDDERLSHSDMVAVLWETIFRGADTVATLLEWIMARMVL  335

Query  1068  HQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHD  1244
             HQD+Q KAQ E+D C+G + R VQDSD+ NLP+LQAIVKEVLRLHPPGPLLSWARLA+HD
Sbjct  336   HQDIQTKAQEELDLCIGNNQRQVQDSDLQNLPFLQAIVKEVLRLHPPGPLLSWARLAIHD  395

Query  1245  VYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFGSGR  1424
             V+VDK  IPAGTTAMVNMWAITHDP IWNDPW F+P RF++E+VSIMG+DLRLAPFG+GR
Sbjct  396   VHVDKVKIPAGTTAMVNMWAITHDPTIWNDPWAFKPMRFIDEDVSIMGTDLRLAPFGAGR  455

Query  1425  RVCPGRALGLSTVHLWLARFLQHFKWLPGP--SVDLSECLKLSLEMKKHLA  1571
             RVCPGRALGL+TVHLWLAR L  FKWLP    +VDLSE L+LSLE+KK LA
Sbjct  456   RVCPGRALGLATVHLWLARMLHQFKWLPAQFNTVDLSERLRLSLELKKPLA  506



>ref|XP_002514920.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF47474.1| cytochrome P450, putative [Ricinus communis]
Length=519

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/476 (68%), Positives = 393/476 (83%), Gaps = 9/476 (2%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             + +W+V GGFAWR++ ++    KL GP+ WP LGFLP MGS AHRKLA+MATS+G N+LM
Sbjct  42    LNYWLVPGGFAWRDHRHHHG--KLVGPVGWPILGFLPHMGSLAHRKLATMATSLGANKLM  99

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFSLGTTR++ISSHPDTAKEIL GSSF+DRP+KESA+LLMFERAIGFAPSG+YWR LRR+
Sbjct  100   AFSLGTTRVVISSHPDTAKEILSGSSFSDRPIKESARLLMFERAIGFAPSGNYWRNLRRI  159

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AAN+MFSPRRI+ LE +R  +A+EM+  + KEM E G V +R ++ + SL NV+ESVFGS
Sbjct  160   AANYMFSPRRISGLEPLRQLLADEMVVTISKEMEERGVVVLRKILQKASLSNVLESVFGS  219

Query  693   ---CLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                CL  + E L  MVKEGYELI + N  DYFPL FL DF G KR+C++LA +VN++VGQ
Sbjct  220   SYACLEKEEELLTSMVKEGYELITKLNLEDYFPLRFL-DFYGVKRRCYKLACKVNNIVGQ  278

Query  864   IIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             I+  R+R+    +   +   DFLS LL LP++++L++AD+V VLWEMIFRGTDTVAI++E
Sbjct  279   IV--RERKISAKQNGFSGGNDFLSALLYLPEQEELSEADMVPVLWEMIFRGTDTVAIILE  336

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  1223
             W MAR+V+HQD+QA+AQ E+D C+G +R +QDSDIPNLPYLQAIVKEVLRLHPPGPLLSW
Sbjct  337   WSMARIVMHQDIQARAQQELDRCIGRNRRMQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  396

Query  1224  ARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRL  1403
             ARLA+ DV+VDK FIPAGTTAMVNMWAITHDP IW DP  F P+RF+EE+V+IMGSDLRL
Sbjct  397   ARLAIQDVHVDKIFIPAGTTAMVNMWAITHDPSIWKDPLEFNPDRFLEEDVAIMGSDLRL  456

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPG-PSVDLSECLKLSLEMKKHL  1568
             APFGSGRRVCPG+ALGL+TVHLWL R LQ +KWLP    VDLSECLKLSLEMKK L
Sbjct  457   APFGSGRRVCPGKALGLATVHLWLGRLLQQYKWLPTVQPVDLSECLKLSLEMKKPL  512



>ref|XP_008222229.1| PREDICTED: cytochrome P450 78A5-like [Prunus mume]
Length=528

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/485 (68%), Positives = 391/485 (81%), Gaps = 18/485 (4%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLP-QMGSHAHRKLASMATSMGLNRL  329
             + +W+V GGFAW NY N+    KL GP+ WP LGFLP QMGS AH+KL++MATS+   RL
Sbjct  39    LNYWLVPGGFAWSNYQNSPKGPKLRGPVGWPVLGFLPHQMGSLAHQKLSTMATSLKATRL  98

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLGTTR+IISSHPDTA+EIL GSSF+DRP+K+SAKLLMFERAIGFAPSG+YWR LRR
Sbjct  99    MAFSLGTTRVIISSHPDTAREILGGSSFSDRPIKQSAKLLMFERAIGFAPSGTYWRHLRR  158

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +AA HMFSPRRI  LE +R  +A EMI ++  EM E+  V ++ ++ +GSL N++ESVFG
Sbjct  159   IAAVHMFSPRRIGGLEALRQKVANEMIVEIWDEMKENRVVGLKEILQKGSLSNIIESVFG  218

Query  690   S-CLGLQGEE----------LGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLA  836
             +   GL+ +E          L  MVK+GYELI   N  DYFPL FL DF G +RKCH+LA
Sbjct  219   TNYFGLEEKEGSSTSNLTLMLHDMVKQGYELISRSNLEDYFPLRFL-DFYGVRRKCHKLA  277

Query  837   GRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRG  1016
               V+ +VGQI+ +RKR  +      +   DFLS +L+LP+ED+L D+D+ AVLWEMIFRG
Sbjct  278   AEVSCVVGQIVRERKRAGD-----FSAGNDFLSAMLALPQEDKLTDSDMAAVLWEMIFRG  332

Query  1017  TDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRL  1196
             TDTVA+L+EWIMAR+VLH D+QAKAQ E+DT VG +RHVQDSD+PNLPYLQAIVKEVLR+
Sbjct  333   TDTVALLLEWIMARIVLHPDIQAKAQQELDTHVGNNRHVQDSDLPNLPYLQAIVKEVLRM  392

Query  1197  HPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEV  1376
             HPPGPLLSWARLAVHDV+VDK FIPAGTTAMVNMWAITHDP IW DP  FRPERF+EE+V
Sbjct  393   HPPGPLLSWARLAVHDVHVDKVFIPAGTTAMVNMWAITHDPSIWKDPSEFRPERFIEEDV  452

Query  1377  SIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEM  1556
             SIMGSDLRLAPFGSGRRVCPG+ALGL+TVHLWLAR L  FKW P  +VDLSECL+LSLEM
Sbjct  453   SIMGSDLRLAPFGSGRRVCPGKALGLATVHLWLARLLHQFKWFPAEAVDLSECLRLSLEM  512

Query  1557  KKHLA  1571
             KK LA
Sbjct  513   KKPLA  517



>ref|XP_007227037.1| hypothetical protein PRUPE_ppa024213mg [Prunus persica]
 gb|EMJ28236.1| hypothetical protein PRUPE_ppa024213mg [Prunus persica]
Length=523

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/480 (69%), Positives = 387/480 (81%), Gaps = 13/480 (3%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLP-QMGSHAHRKLASMATSMGLNRL  329
             + +W+V GGFAW NY N+    KL GP+ WP LGFLP QMGS AH+KL++MATS+   RL
Sbjct  39    LNYWLVPGGFAWSNYQNSPKGPKLRGPVGWPVLGFLPHQMGSLAHQKLSTMATSLKATRL  98

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLGTTR+IISSHPDTA+EIL GSSF+DRP+K+SAKLLMFERAIGFAPSG+YWR LRR
Sbjct  99    MAFSLGTTRVIISSHPDTAREILGGSSFSDRPIKQSAKLLMFERAIGFAPSGTYWRHLRR  158

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +AA HMFSPRRI  LE +R  +A EMI ++  EM E+  V ++ ++ +GSL N++ESVFG
Sbjct  159   IAAVHMFSPRRIGGLEALRQKVANEMIVEIWDEMKENRVVGLKEILQKGSLSNIIESVFG  218

Query  690   --SCLGLQGEELGLM----VKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVND  851
                  G     L LM    VK+GYELI   N  DYFPL FL DF G KRKCH+LA  V+ 
Sbjct  219   LEEKEGSSTSNLTLMLHDMVKQGYELISRSNLEDYFPLRFL-DFYGVKRKCHKLAAEVSC  277

Query  852   LVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVA  1031
             +VGQI+ +RKR       + +   DFLS LL+LP+ED+L D D+VAVLWEM+FRGTDTVA
Sbjct  278   VVGQIVRERKRAG-----DFSAGNDFLSALLALPQEDKLTDTDMVAVLWEMVFRGTDTVA  332

Query  1032  ILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGP  1211
             IL+EWIMAR+VLH D+QAKAQ E+DT VG +R VQDSD+PNLPYLQAIVKEVLR+HPPGP
Sbjct  333   ILLEWIMARIVLHPDIQAKAQQELDTHVGNNRLVQDSDLPNLPYLQAIVKEVLRMHPPGP  392

Query  1212  LLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGS  1391
             LLSWARLAVHDV+VDK FIPAGTTAMVNMWAITHDP IW DP  FRPERF+EE+VSIMGS
Sbjct  393   LLSWARLAVHDVHVDKVFIPAGTTAMVNMWAITHDPSIWKDPSEFRPERFIEEDVSIMGS  452

Query  1392  DLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             DLRLAPFGSGRRVCPG+ALGL+TVHLWLAR L  FKW+P  +VDLSECL+LSLEMKK LA
Sbjct  453   DLRLAPFGSGRRVCPGKALGLATVHLWLARLLHQFKWIPAEAVDLSECLRLSLEMKKPLA  512



>ref|XP_011087111.1| PREDICTED: cytochrome P450 78A5-like [Sesamum indicum]
Length=514

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/472 (70%), Positives = 394/472 (83%), Gaps = 13/472 (3%)
 Frame = +3

Query  165   VVEGGFAWRNYSNNQNPKK-LNGP-MSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAF  338
             ++ GGFAW+N  ++QNP+  L GP  SWPFLGFLPQMG  AHRKLASMA+S+   RLMA 
Sbjct  45    LIPGGFAWKN--SHQNPRNPLKGPRFSWPFLGFLPQMGPLAHRKLASMASSLRATRLMAV  102

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             SLG+TR++ISSHP+TAKEILCG++F++RP++ES +LLMF+ AIGFAPSG+YWR LRR+A+
Sbjct  103   SLGSTRVVISSHPETAKEILCGTAFSNRPIRESTRLLMFDCAIGFAPSGNYWRHLRRIAS  162

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG-SC  695
              HMFSP+R++ LEG R ++A  MI ++ + M E G VE+RG++ +GSL NV+ESVFG S 
Sbjct  163   THMFSPKRVSGLEGFRQSVANSMIEEVRRAMVERGVVELRGILQKGSLDNVLESVFGGSD  222

Query  696   LGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK  875
             LG  GE LGLMVKEGYELIGEFNWGDYFPLGFL DF G KRKCH+L  RV DLV +II++
Sbjct  223   LGFGGE-LGLMVKEGYELIGEFNWGDYFPLGFL-DFSGVKRKCHKLGARVKDLVNKIIQE  280

Query  876   RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
             R++  +     V N  DFLSVLLSLP+E+QL+DAD+VAVLWEM+FRG D V +L+EWIMA
Sbjct  281   RRKMGD---FKVRN--DFLSVLLSLPEEEQLSDADMVAVLWEMVFRGVDNVVVLLEWIMA  335

Query  1056  RMVLHQDVQAKAQLEIDTCVG-PSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             RMVLHQDVQAK Q EIDT +G   +++QDSDI NLPYLQ++VKE LRLHPPGPLLSWARL
Sbjct  336   RMVLHQDVQAKVQREIDTNIGDQDKYIQDSDIVNLPYLQSVVKEALRLHPPGPLLSWARL  395

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPF  1412
             A+HDV++DKCFIPAGTTAMVNMWAI HDP IW DPW FRPERFME++ SIMGSD+RLAPF
Sbjct  396   AIHDVHLDKCFIPAGTTAMVNMWAIAHDPSIWADPWAFRPERFMEQDFSIMGSDMRLAPF  455

Query  1413  GSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             GSGRR CPG+ALGL+TVHLWLAR LQ FKWLP   VDL E LKLSLEMKK L
Sbjct  456   GSGRRACPGKALGLATVHLWLARVLQEFKWLPSQPVDLGENLKLSLEMKKPL  507



>ref|XP_009337480.1| PREDICTED: cytochrome P450 78A5-like [Pyrus x bretschneideri]
Length=535

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/480 (68%), Positives = 389/480 (81%), Gaps = 17/480 (4%)
 Frame = +3

Query  165   VVEGGFAWRNYS---NNQNPKKLNGPMSWPFLGFLPQ-MGSHAHRKLASMATSMGLNRLM  332
             ++ GGFAW  Y+   N+QN   L GP  WP LGFLP  MGS AH+KL++MATS+   RLM
Sbjct  47    LIPGGFAWSCYNHAQNSQNSSSLRGPAGWPILGFLPHHMGSLAHQKLSTMATSLKATRLM  106

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFSLGTTR+IISSHPDTA++IL GSSF+DRP+K+SAKLLMFERAIGFAPSG+YWR LRR+
Sbjct  107   AFSLGTTRVIISSHPDTARQILGGSSFSDRPIKQSAKLLMFERAIGFAPSGTYWRHLRRI  166

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AA HMFSP+RI  LE +R  +A+EM+  +  EM E+  V ++ ++ +GSL N+++SVFG+
Sbjct  167   AAVHMFSPKRIGGLETLRQKVADEMVVTIWDEMKENRVVGLKAILQKGSLDNIIQSVFGT  226

Query  693   -CLGLQGE------ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVND  851
               LGL+ E       L L+VK+GY+LI  FN  DYFPL FL DF G KRKCH+LA  V  
Sbjct  227   NYLGLEKELVSTNLTLMLLVKQGYDLISRFNLEDYFPLRFL-DFYGVKRKCHKLAAEVKC  285

Query  852   LVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVA  1031
             +VGQI+ +R +  +         +DFLS LL+LP+ED+L+D+D+VAVLWEMIFRGTDTVA
Sbjct  286   VVGQIVRERIKAGD-----FGGGSDFLSALLALPEEDKLSDSDMVAVLWEMIFRGTDTVA  340

Query  1032  ILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGP  1211
             IL+EWIMAR+VLHQD+QAKAQ E+DT VG  RHVQDSD+PNLPYLQAIVKEVLR+HPPGP
Sbjct  341   ILLEWIMARIVLHQDIQAKAQQELDTHVGNKRHVQDSDLPNLPYLQAIVKEVLRMHPPGP  400

Query  1212  LLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGS  1391
             LLSWARLAVHDV+VDK FIPAGTTAMVNMWAITHDP IW DP  FRPERF+EE+VSIMGS
Sbjct  401   LLSWARLAVHDVHVDKVFIPAGTTAMVNMWAITHDPSIWKDPMVFRPERFIEEDVSIMGS  460

Query  1392  DLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             DLRLAPFGSGRRVCPG+ALGL+TVHLWLAR L  FKWLP   VDLSECL+LSLEMKK LA
Sbjct  461   DLRLAPFGSGRRVCPGKALGLATVHLWLARLLHQFKWLPAEPVDLSECLRLSLEMKKPLA  520



>ref|XP_004504443.1| PREDICTED: cytochrome P450 78A4-like [Cicer arietinum]
Length=526

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/473 (68%), Positives = 383/473 (81%), Gaps = 9/473 (2%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             + +W+V GGFAWR+Y  +    KL GPM WP LG LPQMG  AH KLAS+AT +   +LM
Sbjct  51    LNYWLVPGGFAWRDYKQS---TKLIGPMGWPILGTLPQMGFSAHTKLASLATCLKAKKLM  107

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             A SLG TR++ISSHP+T +EIL G  F+DRP+KESA+ LMFERAIGFAPSGSYWR+LRR+
Sbjct  108   ALSLGATRVVISSHPETTREILFGQPFSDRPIKESARSLMFERAIGFAPSGSYWRKLRRI  167

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AA HMFSPRRI  LE +R  +A+EM+ ++ KEM E+G VE+RG++ EGS  N++ESVFG+
Sbjct  168   AAFHMFSPRRILGLESLRQRVADEMVVRVWKEMEENGAVEIRGILQEGSFSNILESVFGN  227

Query  693   CLGLQG-EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
             CL L G EELG MVKEGYELI  FN  DYFPL FL DF G KR+CH+LA +V+ +VGQI+
Sbjct  228   CLSLGGSEELGNMVKEGYELIAMFNLEDYFPLKFL-DFYGVKRRCHKLAAKVSSIVGQIV  286

Query  870   EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWI  1049
             E+RKR  E        + DFLS LLSLP E++L D+D+VA+LWEMIFRGTDTVAIL+EW 
Sbjct  287   EERKRAQELFV----EDYDFLSTLLSLPNEERLGDSDMVAILWEMIFRGTDTVAILLEWT  342

Query  1050  MARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR  1229
             MARMVLHQD+Q KA+ EIDTC+  + HV+DSDIPNLPYLQ+IVKEVLRLHPPGPLLSWAR
Sbjct  343   MARMVLHQDIQTKARQEIDTCIAQNSHVRDSDIPNLPYLQSIVKEVLRLHPPGPLLSWAR  402

Query  1230  LAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAP  1409
             LAVHDV+VDK  +PAGTTAMVNMWAI+HD  IW DPW F+PERF++E+VSIMGSDLRLAP
Sbjct  403   LAVHDVHVDKVLVPAGTTAMVNMWAISHDSSIWEDPWAFKPERFLKEDVSIMGSDLRLAP  462

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             FG+GRRVCPGRALGL+ VHLWLA+ L  FKW P   VDLSE L LSLEMK HL
Sbjct  463   FGAGRRVCPGRALGLAIVHLWLAQLLHKFKWFPAQPVDLSENLNLSLEMKNHL  515



>ref|XP_009372289.1| PREDICTED: cytochrome P450 78A5-like [Pyrus x bretschneideri]
Length=534

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/479 (69%), Positives = 388/479 (81%), Gaps = 16/479 (3%)
 Frame = +3

Query  165   VVEGGFAWRNYS---NNQNPKKLNGPMSWPFLGFLPQ-MGSHAHRKLASMATSMGLNRLM  332
             +V GGFAW  YS   N+QN   L GP  WP LGFLP  MGS AH+KL++MATS+   RLM
Sbjct  47    LVPGGFAWSCYSHVQNSQNGSSLRGPAGWPILGFLPHHMGSLAHQKLSTMATSLKATRLM  106

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFSLGTTR+IISSHPDTA++IL GSSF+DRP+K+SAKLLMFERAIGFAPSG+YWR LRR+
Sbjct  107   AFSLGTTRVIISSHPDTARQILGGSSFSDRPIKQSAKLLMFERAIGFAPSGTYWRHLRRI  166

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AA HMFSP+RI  LE +R  +A+EM+  +  EM E+  V ++ ++ +GSL N+++SVFG+
Sbjct  167   AAVHMFSPKRIGGLETLRQKVADEMVLTIWDEMKENRVVGLKAILQKGSLDNIIQSVFGT  226

Query  693   -CLGLQGE-----ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
               LGL+ E      L L+VK+GY+LI  FN  DYFPL FL DF G KR+CH+LA  V  +
Sbjct  227   NYLGLEKEVGTNLTLMLLVKQGYDLISRFNLEDYFPLRFL-DFYGVKRECHKLAAEVKFV  285

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             VGQI+ +R R  +         +DFLS LL+LP+ED+L+D+D+VAVLWEMIFRGTDTVAI
Sbjct  286   VGQIVRERIRAGD-----FGGGSDFLSALLALPEEDKLSDSDMVAVLWEMIFRGTDTVAI  340

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EWIMAR+VLHQD+QAKAQ E+DT VG  RHVQDSD+PNLPYLQAIVKEVLR+HPPGPL
Sbjct  341   LLEWIMARIVLHQDIQAKAQQELDTHVGNKRHVQDSDLPNLPYLQAIVKEVLRMHPPGPL  400

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSD  1394
             LSWARLAVHDV+VDK FIP GTTAMVNMWAITHDP IW DP  FRPERF+EE+VSIMGSD
Sbjct  401   LSWARLAVHDVHVDKVFIPGGTTAMVNMWAITHDPSIWKDPMVFRPERFIEEDVSIMGSD  460

Query  1395  LRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             LRLAPFGSGRRVCPG+ALGL+TVHLWLAR L  FKWLP   VDLSECL+LSLEMKK LA
Sbjct  461   LRLAPFGSGRRVCPGKALGLATVHLWLARLLHQFKWLPAKPVDLSECLRLSLEMKKPLA  519



>ref|XP_003524168.1| PREDICTED: cytochrome P450 78A5-like [Glycine max]
Length=508

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/472 (69%), Positives = 385/472 (82%), Gaps = 8/472 (2%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             + +W+V GGFAWRNY   Q  KKL GPM WP LG LP MGS AH+KLA++ATS+   RLM
Sbjct  38    LNYWLVPGGFAWRNYDYYQTKKKLTGPMGWPILGTLPLMGSLAHQKLAALATSLNAKRLM  97

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             A SLG T ++ISSHP+TA+EIL GSSF+DRP+KESA+ LMFERAIGFA SG+YWR LRR+
Sbjct  98    ALSLGPTPVVISSHPETAREILLGSSFSDRPIKESARALMFERAIGFAHSGTYWRHLRRI  157

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AA HMFSPRRI  LEG+R  + ++M+    +EMGE G VEVR V  EGSL N++ESVFGS
Sbjct  158   AAFHMFSPRRIHGLEGLRQRVGDDMVKSAWREMGEKGVVEVRRVFQEGSLCNILESVFGS  217

Query  693   CLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
                 + EEL  MV+EGYELI  FN  DYFP  FL DF G KR+CH+LA +V  +VGQI+E
Sbjct  218   --NDKSEELRDMVREGYELIAMFNLEDYFPFKFL-DFHGVKRRCHKLAAKVGSVVGQIVE  274

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             +RKR  +G  +  N   DFLS LLSLPKE++LAD+DLVA+LWEM+FRGTDTVAIL+EW+M
Sbjct  275   ERKR--DGGFVGKN---DFLSTLLSLPKEERLADSDLVAILWEMVFRGTDTVAILLEWVM  329

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             ARMVLHQD+Q KA+ EIDTCVG + HV+DSDI NLPYLQAIVKEVLRLHPPGPLLSWARL
Sbjct  330   ARMVLHQDLQKKAREEIDTCVGQNSHVRDSDIANLPYLQAIVKEVLRLHPPGPLLSWARL  389

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPF  1412
             AVHDV+ DK  +PAGTTAMVNMWAI+HD  IW DPW F+PERF++E+VSIMGSDLRLAPF
Sbjct  390   AVHDVHADKVLVPAGTTAMVNMWAISHDSSIWEDPWAFKPERFLKEDVSIMGSDLRLAPF  449

Query  1413  GSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             G+GRRVCPGRALGL+T HLWLA+ L+HF WLP  +VDLSECL+LS+EMK  L
Sbjct  450   GAGRRVCPGRALGLATAHLWLAQLLRHFIWLPAQTVDLSECLRLSMEMKTPL  501



>gb|KEH20594.1| cytochrome P450 family 78 protein [Medicago truncatula]
Length=530

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/479 (70%), Positives = 387/479 (81%), Gaps = 15/479 (3%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             + +W+V GGFAWRNY  +    KL GPM WP LG LPQMGS AH KLAS+ATS    RLM
Sbjct  48    INYWLVPGGFAWRNYKQST---KLIGPMGWPILGTLPQMGSSAHTKLASLATSFKAKRLM  104

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             A SLG T ++ISSHP+TA+EIL GSSF+DRP+K+SA LLMFERAIGFAPSG+YWR+LRR+
Sbjct  105   ALSLGATPVVISSHPETAREILFGSSFSDRPIKDSAGLLMFERAIGFAPSGTYWRKLRRI  164

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AA +MFSPRRI  LE +R  +A+EM+ K+ K+M E G VEVRG++ EGSL N++ESVFGS
Sbjct  165   AAFNMFSPRRILGLESLRQRVADEMMLKVFKDMEEKGVVEVRGILQEGSLSNILESVFGS  224

Query  693   -----CLGLQG-EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
                  CL L G EELG MVKEGYELI +FN  DYF   FL DF G KRKCH+LA +V  +
Sbjct  225   ISNYNCLSLGGSEELGNMVKEGYELIAKFNLEDYFDFKFL-DFYGVKRKCHKLAAKVTSV  283

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             VGQI+E+RKR  E     V  + DFLS LLSLPKE++L D+D+VA+LWEMIFRGTDTVAI
Sbjct  284   VGQIVEERKRSKE----LVIGDNDFLSTLLSLPKEERLGDSDMVAILWEMIFRGTDTVAI  339

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EW MARMVLHQD+Q KA+ EID CVG + HV+DSDIPNLPYLQAIVKEVLRLHPPGPL
Sbjct  340   LLEWTMARMVLHQDIQMKARQEIDICVGQNSHVRDSDIPNLPYLQAIVKEVLRLHPPGPL  399

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSD  1394
             LSWARLAVHDV+VDK  +PAGTTAMVNMWAI+HD  IW DP TF PERF++E+VS+MGSD
Sbjct  400   LSWARLAVHDVHVDKTLVPAGTTAMVNMWAISHDSSIWEDPLTFNPERFLKEDVSVMGSD  459

Query  1395  LRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKKHL  1568
             LRLAPFG+GRRVCPGRALGL+TVHLWLA+ L +F WLP    VDLSE LKLSLEMK  L
Sbjct  460   LRLAPFGAGRRVCPGRALGLATVHLWLAQLLHNFVWLPAQVPVDLSESLKLSLEMKNPL  518



>ref|XP_010087195.1| Cytochrome P450 78A4 [Morus notabilis]
 gb|EXC35683.1| Cytochrome P450 78A4 [Morus notabilis]
Length=455

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/447 (71%), Positives = 376/447 (84%), Gaps = 5/447 (1%)
 Frame = +3

Query  234   MSWPFLGFLPQMGSH-AHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSS  410
             M WP LG LP+M S  AHRKLA +A+S+   RLMA SLG+TR++ISSHPDTAKEIL GSS
Sbjct  1     MGWPVLGNLPEMASRLAHRKLAHLASSLDAKRLMALSLGSTRVVISSHPDTAKEILAGSS  60

Query  411   FTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMI  590
             F+DRP+KESA+LLMFERAIGFAP+G +WR LRR+AA HMFSPR +A LEG+R  +A+EM+
Sbjct  61    FSDRPIKESARLLMFERAIGFAPAGFHWRHLRRIAAVHMFSPRSVAGLEGLRQRVADEML  120

Query  591   GKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQGEELGLMVKEGYELIGEFNWG  770
              ++  +M E G V +RG++ EGSL N++ESVFGS    +  ELG MVKEGYELI  FN  
Sbjct  121   ARVGVQMEEKGVVGLRGMLQEGSLTNILESVFGSSSSCRFGELGQMVKEGYELISTFNLE  180

Query  771   DYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSL  950
             DYFPLGF+ DF G KR+CH+LA +VN +VGQI+E RK + E  E N NN  DFLS LLSL
Sbjct  181   DYFPLGFM-DFHGVKRRCHKLAAKVNTVVGQIVEGRKTR-ESHENNSNN--DFLSALLSL  236

Query  951   PKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRH  1130
             PKEDQL+D+D+VA+LWE+IFRGTDTVAIL+EWIMARMVLHQD+QAK Q EIDT VG +RH
Sbjct  237   PKEDQLSDSDMVAILWELIFRGTDTVAILLEWIMARMVLHQDIQAKVQQEIDTFVGNNRH  296

Query  1131  VQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAIT  1310
             V+DS+IPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDV++DK FIPAGTTAMVNMWAIT
Sbjct  297   VRDSNIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVHIDKVFIPAGTTAMVNMWAIT  356

Query  1311  HDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQ  1490
             HDP +W DPW F+P+RF+EEEV+IMGSD RLAPFGSGRRVCPG+ALGL+TVH+WLAR L 
Sbjct  357   HDPSVWKDPWAFKPDRFIEEEVTIMGSDTRLAPFGSGRRVCPGKALGLATVHVWLARLLH  416

Query  1491  HFKWLPGPSVDLSECLKLSLEMKKHLA  1571
              + WLP   VDLSECL+LS+EMKK LA
Sbjct  417   QYTWLPAQPVDLSECLRLSMEMKKPLA  443



>ref|XP_008361844.1| PREDICTED: cytochrome P450 78A5-like [Malus domestica]
Length=528

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/479 (69%), Positives = 385/479 (80%), Gaps = 16/479 (3%)
 Frame = +3

Query  165   VVEGGFAWRNYS---NNQNPKKLNGPMSWPFLGFLPQ-MGSHAHRKLASMATSMGLNRLM  332
             +V GGFAW  YS   N+QN   L GP  WP LGFLP  MGS AH+KL++MATS+   RLM
Sbjct  47    LVPGGFAWSCYSHTQNSQNGSSLRGPAGWPILGFLPHHMGSLAHQKLSTMATSLKATRLM  106

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFSLGTTR+IISSHPDTA++IL GSSF+DRP+K+SAKLLMFERAIGFAPSG+YWR LRR+
Sbjct  107   AFSLGTTRVIISSHPDTARQILGGSSFSDRPIKQSAKLLMFERAIGFAPSGTYWRHLRRI  166

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG-  689
             AA HMFSP+RI  LE VR  +A+EM+  +  EM E+  V ++ ++ +GSL N+++SVFG 
Sbjct  167   AAVHMFSPKRIGGLETVRQKVADEMVVTIWDEMKENRVVGLKAILQKGSLDNIIQSVFGT  226

Query  690   SCLGLQGE-----ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
             S LGL+ E      L L+VK+GY+LI  FN  DYFPL FL DF G KRKCH+LA  V  +
Sbjct  227   SYLGLEKEVXTNLTLMLLVKQGYDLISRFNLEDYFPLRFL-DFYGVKRKCHKLAAEVKCV  285

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             VGQI+ +RKR  +         +DFLS LL+LP+ED+L D+D VAVLWEMIFRGTDTVAI
Sbjct  286   VGQIVRERKRAGD-----FGGGSDFLSALLALPEEDKLNDSDTVAVLWEMIFRGTDTVAI  340

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EWIMARMVLHQD+QAKAQ E+DT VG +RHV+DSD+PNL YLQAIVKEVLR+HPPGPL
Sbjct  341   LLEWIMARMVLHQDIQAKAQQELDTHVGNNRHVRDSDLPNLSYLQAIVKEVLRMHPPGPL  400

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSD  1394
             LSWARLAVHDV+VDK FIPAGTTAMVNMWAITHDP IW DP  FRPERF+EE+V IMGSD
Sbjct  401   LSWARLAVHDVHVDKVFIPAGTTAMVNMWAITHDPSIWKDPMVFRPERFIEEDVLIMGSD  460

Query  1395  LRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             L+LAPFGSGRRVCPG+ALGL+TVHLWLAR L  FK LP   VDLSECL+LSLEMKK L 
Sbjct  461   LKLAPFGSGRRVCPGKALGLATVHLWLARLLHQFKXLPTEPVDLSECLRLSLEMKKPLT  519



>ref|XP_010249000.1| PREDICTED: cytochrome P450 78A5-like [Nelumbo nucifera]
Length=520

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/472 (68%), Positives = 381/472 (81%), Gaps = 11/472 (2%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMG--LNRLMA  335
             W+V GGFAWRN+  ++N  +L GP+ WP LG +  M   AHRKLA ++ S+    NRLMA
Sbjct  46    WLVPGGFAWRNH--HRNSPQLRGPIGWPLLGSISHMSRLAHRKLAEISASLDGDANRLMA  103

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
              SLG TR+IISSHPDTAKEIL GS+F+DRP+KESA+LLMFERAIGFAPSG YWR LRR+A
Sbjct  104   ISLGATRVIISSHPDTAKEILSGSAFSDRPMKESARLLMFERAIGFAPSGDYWRHLRRIA  163

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             ANHMFSP+R+A LEG+R  IA++M+ ++ KEM   G VE RG++ +GSL NV+ESVFG  
Sbjct  164   ANHMFSPKRVAALEGLRRRIADDMVDQVWKEMESRGEVEPRGILHKGSLSNVIESVFGRG  223

Query  696   LGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK  875
             L   GE+LG MV+EGY+LI +FN  DYFPLGFL DF G KR+CH+LA RV   +G+II++
Sbjct  224   LCSDGEQLGSMVREGYDLIAQFNLEDYFPLGFL-DFYGVKRRCHKLAARVKCFLGEIIKE  282

Query  876   RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
             R+++            DFLSVLL+LPKEDQL D+D+V+VLWEMIFRGTDT+AIL+EWI+A
Sbjct  283   RRKE------ECKGRDDFLSVLLTLPKEDQLNDSDMVSVLWEMIFRGTDTIAILLEWIIA  336

Query  1056  RMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLA  1235
             RMVLH DVQAKAQ EID C+G  R VQDSDIP+LPYLQAIVKEVLRLHPPGPLLSWARLA
Sbjct  337   RMVLHPDVQAKAQQEIDECMGSHREVQDSDIPSLPYLQAIVKEVLRLHPPGPLLSWARLA  396

Query  1236  VHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFG  1415
             +HDV+V K F+PAGT AMVNMWAITHD  IW DP  F+PERF+EE+V IMGSDLRLAPFG
Sbjct  397   IHDVHVGKFFVPAGTAAMVNMWAITHDESIWKDPLAFKPERFIEEDVGIMGSDLRLAPFG  456

Query  1416  SGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             SGRRVCPG+ LGL+TVHLWLA+ L  F WLP   +DLSECL+LSLE K+ LA
Sbjct  457   SGRRVCPGKTLGLATVHLWLAQLLHRFTWLPAQPIDLSECLRLSLEKKQPLA  508



>ref|XP_003531193.1| PREDICTED: cytochrome P450 78A5-like [Glycine max]
Length=514

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/476 (68%), Positives = 384/476 (81%), Gaps = 12/476 (3%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNY----SNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGL  320
             + +W+V GGFAWRNY    +N +  KKL GPM WP LG LP MGS AH+KLA++A ++  
Sbjct  40    LNYWLVPGGFAWRNYHSYHTNEKPNKKLTGPMGWPILGSLPLMGSLAHQKLAALAATLNA  99

Query  321   NRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQ  500
              RLMA SLG T ++ISSHP+TA+EIL GSSF+DRP+KESA+ LMFERAIGFAPSG+YWR 
Sbjct  100   KRLMALSLGPTPVVISSHPETAREILLGSSFSDRPIKESARALMFERAIGFAPSGTYWRH  159

Query  501   LRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVES  680
             LRR+AA HMFSPRRI  LEG+R  + ++M+    KEM   G VEVRGV  EGSL N++ES
Sbjct  160   LRRIAAFHMFSPRRIQGLEGLRQRVGDDMVKSAWKEMEMKGVVEVRGVFQEGSLCNILES  219

Query  681   VFGSCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVG  860
             VFGS    + EELG MV+EGYELI   N  DYFPL FL DF G KR+CH+LA +V  +VG
Sbjct  220   VFGS--NDKSEELGDMVREGYELIAMLNLEDYFPLKFL-DFHGVKRRCHKLAAKVGSVVG  276

Query  861   QIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             QI+E RKR+   +  N     DFLS LLSLPKE++LAD+D+ A+LWEM+FRGTDTVAIL+
Sbjct  277   QIVEDRKREGSFVVKN-----DFLSTLLSLPKEERLADSDMAAILWEMVFRGTDTVAILL  331

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EW+MARMVLHQDVQ KA+ EIDTC+G + HV+DSDI NLPYLQAIVKEVLRLHPPGPLLS
Sbjct  332   EWVMARMVLHQDVQKKAREEIDTCIGQNSHVRDSDIANLPYLQAIVKEVLRLHPPGPLLS  391

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WARLAV+DV+VDK  +PAGTTAMVNMWAI+HD  IW DPW F+PERF++E+VSIMGSDLR
Sbjct  392   WARLAVNDVHVDKVLVPAGTTAMVNMWAISHDSSIWEDPWAFKPERFLKEDVSIMGSDLR  451

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             LAPFG+GRRVCPGRALGL+T HLWLA+ L+HF WLP   VDLSECL+LS+EMK  L
Sbjct  452   LAPFGAGRRVCPGRALGLATTHLWLAQLLRHFIWLPAQPVDLSECLRLSMEMKTPL  507



>ref|XP_007163754.1| hypothetical protein PHAVU_001G261500g [Phaseolus vulgaris]
 gb|ESW35748.1| hypothetical protein PHAVU_001G261500g [Phaseolus vulgaris]
Length=516

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/471 (66%), Positives = 379/471 (80%), Gaps = 10/471 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAF  338
             +W++ GG AWR + +     KL+GPM WP LG LP+MGS AH KLASMATS+   RLMA 
Sbjct  40    YWLLPGGLAWRKHHDRY---KLSGPMGWPILGSLPEMGSLAHGKLASMATSLSAKRLMAL  96

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             SLGT R++ISSHP+TA+EILCG  F+DRPVKESA+ LMFERAIGFAP G+YWR LR++A 
Sbjct  97    SLGTNRVVISSHPETAREILCGPGFSDRPVKESARTLMFERAIGFAPYGTYWRHLRKVAT  156

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              HMFSPRRI+ LE +R  +A +M+ K  +EM   G VEV+G++  GSLR ++ESVFG  +
Sbjct  157   THMFSPRRISDLESLRQRVAADMVKKTWEEMEVKGVVEVKGILHAGSLRTMLESVFGMNI  216

Query  699   GLQGEE-LGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK  875
               + EE LG M+KEGYELI +FNW DYFP  FL DF G KR+CHRL  +V  +VG+++E+
Sbjct  217   ESETEEVLGDMIKEGYELIAKFNWEDYFPFRFL-DFHGVKRRCHRLTSKVKSVVGEMVEQ  275

Query  876   RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
             RK     I   V   +DFLS LLSLP+E+++ ++D+VA+LWEM+FRGTDTVAIL+EWIMA
Sbjct  276   RK-----IRGEVVGESDFLSALLSLPQEERIGESDMVAILWEMLFRGTDTVAILLEWIMA  330

Query  1056  RMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLA  1235
             RMVLHQDVQ+KA+ EIDTC+G + HV+DSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLA
Sbjct  331   RMVLHQDVQSKARQEIDTCMGQNSHVRDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLA  390

Query  1236  VHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFG  1415
              HDV++DK  +PAGTTAMVNMWAI+HD  +W DPW F+PERFM+EEVS+MGSD+RLAPFG
Sbjct  391   THDVHIDKVLVPAGTTAMVNMWAISHDSSVWKDPWAFKPERFMDEEVSVMGSDMRLAPFG  450

Query  1416  SGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             +GRRVCPG+ LGL+TVHLWLA+FL  F  +    VDLSECLKLS+EMKK L
Sbjct  451   AGRRVCPGKNLGLATVHLWLAQFLHRFILVSAQPVDLSECLKLSMEMKKPL  501



>gb|KHN44434.1| Cytochrome P450 78A4 [Glycine soja]
Length=522

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/476 (66%), Positives = 386/476 (81%), Gaps = 10/476 (2%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNY-SNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRL  329
             + +W+V GGFAWR Y S  +   KL+GPM WP LG LP MG  AHRKLA+MATS    +L
Sbjct  40    LNYWLVPGGFAWRKYHSRYKGHAKLSGPMGWPILGTLPAMGPLAHRKLAAMATSPKAKKL  99

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             M  SLGT  ++ISSHP+TA+EILCGS+F DRPVKESA++LMFERAIGFAP G+YWR LR+
Sbjct  100   MTLSLGTNPVVISSHPETAREILCGSNFADRPVKESARMLMFERAIGFAPYGTYWRHLRK  159

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +A  HMFSPRRI+ LE +R  +  EM+ ++ KEMG+ G VEVRG++ EGSL +++ESVFG
Sbjct  160   VAITHMFSPRRISDLESLRQHVVGEMVMRIWKEMGDKGVVEVRGILYEGSLSHMLESVFG  219

Query  690   --SCLGLQGEE-LGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVG  860
               + LG Q +E LG MV+EGY+LI +FNW DYFP GFL DF G KR+CH+LA +VN +VG
Sbjct  220   INNSLGSQTKEALGDMVEEGYDLIAKFNWADYFPFGFL-DFHGVKRRCHKLATKVNSVVG  278

Query  861   QIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             +I+E+RK   + +  N     DFLS LL LPKE+ + D+D+VA+LWEMIFRGTDT+AIL+
Sbjct  279   KIVEERKNSGKYVGQN-----DFLSALLLLPKEESIGDSDVVAILWEMIFRGTDTIAILL  333

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EWIMA MVLHQDVQ KA+ EID+C+  + +++DSDIPNLPYLQAIVKEVLRLHPPGPLLS
Sbjct  334   EWIMAMMVLHQDVQMKARQEIDSCIKQNGYMRDSDIPNLPYLQAIVKEVLRLHPPGPLLS  393

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WARLA+HDV+VDK  +PAGTTAMVNMWAI+HD  IW DPW F+PERFM+E+VSIMGSD+R
Sbjct  394   WARLAIHDVHVDKVIVPAGTTAMVNMWAISHDSSIWEDPWAFKPERFMKEDVSIMGSDMR  453

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             LAPFG+GRRVCPG+ LGL+TVHLWLA+ L HF W+P   VDLSECLKLSLEMKK L
Sbjct  454   LAPFGAGRRVCPGKTLGLATVHLWLAQLLHHFIWIPVQPVDLSECLKLSLEMKKPL  509



>gb|KHN34817.1| Cytochrome P450 78A4 [Glycine soja]
Length=498

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/472 (68%), Positives = 379/472 (80%), Gaps = 18/472 (4%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             + +W+V GGFAWRNY   Q  KKL GPM WP LG LP MGS AH+KLA++ATS+   RLM
Sbjct  38    LNYWLVPGGFAWRNYDYYQTKKKLTGPMGWPILGTLPLMGSLAHQKLAALATSLNAKRLM  97

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             A SLG T ++ISSHP+TA+EIL GSSF+DRP+KESA+ LMFERAIGFA SG+YWR LRR+
Sbjct  98    ALSLGPTPVVISSHPETAREILLGSSFSDRPIKESARALMFERAIGFAHSGTYWRHLRRI  157

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AA HMFSPRRI            +M+    +EMGE G VEVR V  EGSL N++ESVFGS
Sbjct  158   AAFHMFSPRRIHG----------DMVKSAWREMGEKGVVEVRRVFQEGSLCNILESVFGS  207

Query  693   CLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
                 + EEL  MV+EGYELI  FN  DYFP  FL DF G KR+CH+LA +V  +VGQI+E
Sbjct  208   --NDKSEELRDMVREGYELIAMFNLEDYFPFKFL-DFHGVKRRCHKLAAKVGSVVGQIVE  264

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             +RKR  +G  +  N   DFLS LLSLPKE++LAD+DLVA+LWEM+FRGTDTVAIL+EW+M
Sbjct  265   ERKR--DGGFVGKN---DFLSTLLSLPKEERLADSDLVAILWEMVFRGTDTVAILLEWVM  319

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             ARMVLHQD+Q KA+ EIDTCVG + HV+DSDI NLPYLQAIVKEVLRLHPPGPLLSWARL
Sbjct  320   ARMVLHQDLQKKAREEIDTCVGQNSHVRDSDIANLPYLQAIVKEVLRLHPPGPLLSWARL  379

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPF  1412
             AVHDV+VDK  +PAGTTAMVNMWAI+HD  IW DPW F+PERF++E+VSIMGSDLRLAPF
Sbjct  380   AVHDVHVDKVLVPAGTTAMVNMWAISHDSSIWEDPWAFKPERFLKEDVSIMGSDLRLAPF  439

Query  1413  GSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             G+GRRVCPGRALGL+T HLWLA+ L+HF WLP  +VDLSECL+LS+EMK  L
Sbjct  440   GAGRRVCPGRALGLATAHLWLAQLLRHFIWLPAQTVDLSECLRLSMEMKTPL  491



>ref|XP_003538551.1| PREDICTED: cytochrome P450 78A5-like [Glycine max]
Length=522

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/476 (66%), Positives = 385/476 (81%), Gaps = 10/476 (2%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNY-SNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRL  329
             + +W+V GGFAWR Y S  +   K++GPM WP LG LP MG  AHRKLA+MATS    +L
Sbjct  40    LNYWLVPGGFAWRKYHSRYKGHAKVSGPMGWPILGTLPAMGPLAHRKLAAMATSPKAKKL  99

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             M  SLGT  ++ISSHP+TA+EILCGS+F DRPVKESA++LMFERAIGFAP G+YWR LR+
Sbjct  100   MTLSLGTNPVVISSHPETAREILCGSNFADRPVKESARMLMFERAIGFAPYGTYWRHLRK  159

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +A  HMFSPRRI+ LE +R  +  EM+ ++ KEMG+ G VEVRG++ EGSL +++E VFG
Sbjct  160   VAITHMFSPRRISDLESLRQHVVGEMVMRIWKEMGDKGVVEVRGILYEGSLSHMLECVFG  219

Query  690   --SCLGLQGEE-LGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVG  860
               + LG Q +E LG MV+EGY+LI +FNW DYFP GFL DF G KR+CH+LA +VN +VG
Sbjct  220   INNSLGSQTKEALGDMVEEGYDLIAKFNWADYFPFGFL-DFHGVKRRCHKLATKVNSVVG  278

Query  861   QIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             +I+E+RK   + +  N     DFLS LL LPKE+ + D+D+VA+LWEMIFRGTDT+AIL+
Sbjct  279   KIVEERKNSGKYVGQN-----DFLSALLLLPKEESIGDSDVVAILWEMIFRGTDTIAILL  333

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EWIMA MVLHQDVQ KA+ EID+C+  + +++DSDIPNLPYLQAIVKEVLRLHPPGPLLS
Sbjct  334   EWIMAMMVLHQDVQMKARQEIDSCIKQNGYMRDSDIPNLPYLQAIVKEVLRLHPPGPLLS  393

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WARLA+HDV+VDK  +PAGTTAMVNMWAI+HD  IW DPW F+PERFM+E+VSIMGSD+R
Sbjct  394   WARLAIHDVHVDKVIVPAGTTAMVNMWAISHDSSIWEDPWAFKPERFMKEDVSIMGSDMR  453

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             LAPFG+GRRVCPG+ LGL+TVHLWLA+ L HF W+P   VDLSECLKLSLEMKK L
Sbjct  454   LAPFGAGRRVCPGKTLGLATVHLWLAQLLHHFIWIPVQPVDLSECLKLSLEMKKPL  509



>ref|XP_004159682.1| PREDICTED: cytochrome P450 78A3-like [Cucumis sativus]
Length=438

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/438 (70%), Positives = 365/438 (83%), Gaps = 11/438 (3%)
 Frame = +3

Query  267   MGSHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKL  446
             MG  AHR LA++A S    RLM+FS+G TR IISSHPDTAK+ILCGS+F+DRPVK+SA+L
Sbjct  1     MGPLAHRNLATIAHSFKATRLMSFSMGATRAIISSHPDTAKQILCGSAFSDRPVKQSARL  60

Query  447   LMFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgf  626
             +MFERAIGFAP+G+YWR LRR+AANHMFSPR+I+ LEG+R  +A+EM+ ++   M   G 
Sbjct  61    MMFERAIGFAPNGAYWRNLRRIAANHMFSPRKISDLEGLRREVADEMVAELSGNMASEGV  120

Query  627   vevrgvvgegSLRNVVESVFGSCLGL-QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDF  803
             V +R V+ + SL+N++ESVFGS +G+ +  EL  MV+EGYELI  FNW DYFP+ FL DF
Sbjct  121   VRLREVLQKHSLKNIIESVFGSGMGMGRKGELSDMVREGYELIAMFNWEDYFPVSFL-DF  179

Query  804   GGTKRKCHRLAGRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADL  983
              G KR+C+ LAGRVN ++GQI+E+RKR+      N   + DFL+ LL+LPKEDQL+D+D+
Sbjct  180   SGVKRRCNELAGRVNVVIGQIVEERKRE------NTEFHNDFLTTLLTLPKEDQLSDSDM  233

Query  984   VAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPY  1163
             VAVLWEMIFRGTDT+AIL+EWIMARM+LH D+QAKAQ EIDTCVG +RHV DSDIPNLPY
Sbjct  234   VAVLWEMIFRGTDTIAILLEWIMARMILHPDIQAKAQNEIDTCVGCNRHVCDSDIPNLPY  293

Query  1164  LQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWT  1343
             LQAIVKEVLRLHPPGPLLSWARLA+HDV+VDK  IPAGTTAMVNMWAI HDP IW DPWT
Sbjct  294   LQAIVKEVLRLHPPGPLLSWARLAIHDVHVDKILIPAGTTAMVNMWAIAHDPSIWKDPWT  353

Query  1344  FRPERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP---GP  1514
             F+PERF+E ++SIMGSDLRLAPFG+GRR CPGRALGL+TVHLWLA FL  F+W P     
Sbjct  354   FKPERFIENDMSIMGSDLRLAPFGAGRRACPGRALGLATVHLWLANFLHRFRWTPCSSTK  413

Query  1515  SVDLSECLKLSLEMKKHL  1568
             SV+LSECLKLSLEMKK L
Sbjct  414   SVNLSECLKLSLEMKKPL  431



>ref|XP_004310075.1| PREDICTED: cytochrome P450 78A4-like [Fragaria vesca subsp. vesca]
Length=522

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/482 (66%), Positives = 381/482 (79%), Gaps = 22/482 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLP-QMGSHAHRKLASMATSMGLNRLMA  335
             +++V GG AW  Y +     KL GP+ WP LG +P QM S AHR+LASMA S+   RLM 
Sbjct  41    YYLVPGGSAWSGYGHAM---KLRGPVGWPVLGSIPEQMSSLAHRRLASMAASLDAKRLMV  97

Query  336   FSLG-TTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             +SLG TTR+IISSHPDTAK+IL GSSF+DRP+K+SA+ LMF+RAIGFAPSG+YWR LRR+
Sbjct  98    YSLGVTTRVIISSHPDTAKQILGGSSFSDRPIKQSARALMFKRAIGFAPSGAYWRHLRRL  157

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AA HMFSP+RIA LEG+R  +A++M  ++ +EM E  FV VRG++  GS+ N++ESVFG 
Sbjct  158   AAVHMFSPKRIAGLEGLRQNVADQMAVRVQEEMEERRFVLVRGILQVGSMNNIIESVFG-  216

Query  693   CLGLQGEE---------LGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRV  845
              LGL+ EE         L  MVKEGY+LI  FN  DY PL FL DF G KRKCH LA +V
Sbjct  217   -LGLEDEEGSSSDLTLTLHDMVKEGYDLISRFNLEDYIPLRFL-DFYGVKRKCHNLAAKV  274

Query  846   NDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDT  1025
               +VG+I+++RKR       + +  +DFLS LL+LP EDQL+D+DLVAVLWEMIFRGTDT
Sbjct  275   KSVVGEIVKERKRGG-----DFSGRSDFLSALLALPVEDQLSDSDLVAVLWEMIFRGTDT  329

Query  1026  VAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             VAIL+EWIMAR+ LHQD+QAKAQ E++T VG  R+V+DSD+P LPYLQAIVKEVLR+HPP
Sbjct  330   VAILLEWIMARIALHQDIQAKAQEELNTIVGNHRNVRDSDLPKLPYLQAIVKEVLRMHPP  389

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIM  1385
             GPLLSWARL VHDV+VDK  +PAGTTAMVNMWAITHDP IW DPW F+PERF+EE+VSIM
Sbjct  390   GPLLSWARLTVHDVHVDKVLVPAGTTAMVNMWAITHDPAIWKDPWVFKPERFIEEDVSIM  449

Query  1386  GSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKH  1565
             GSDLRLAPFGSGRR CPG+ALGL+TVHLWLAR L  FKWLP   VDLSECL LS+EMKK 
Sbjct  450   GSDLRLAPFGSGRRACPGKALGLATVHLWLARLLHQFKWLPAVPVDLSECLMLSMEMKKP  509

Query  1566  LA  1571
             L 
Sbjct  510   LT  511



>ref|XP_007158688.1| hypothetical protein PHAVU_002G173900g [Phaseolus vulgaris]
 gb|ESW30682.1| hypothetical protein PHAVU_002G173900g [Phaseolus vulgaris]
Length=532

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/478 (68%), Positives = 384/478 (80%), Gaps = 14/478 (3%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNY-----SNNQNPK-KLNGPMSWPFLGFLPQMGSHAHRKLASMATSM  314
             + +W+V GGFAWRNY      NN+ P  KL+GPM WP LG LP MGS AH KLA++A S+
Sbjct  56    LNYWLVPGGFAWRNYPVQHHHNNEKPNAKLSGPMGWPILGSLPLMGSLAHAKLAALAASL  115

Query  315   GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYW  494
                RLMA SLG T ++ISSHP+TA++IL GSSF+DRP+KESA+ LMFERAIGFAPSG+YW
Sbjct  116   NAKRLMALSLGPTPVVISSHPETARQILFGSSFSDRPIKESARALMFERAIGFAPSGTYW  175

Query  495   RQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVV  674
             R LRR+AA +MFSPRRI  LEGVR  +A++M+    KEM + G V+VRGV  EGSL N++
Sbjct  176   RHLRRIAAFNMFSPRRIQGLEGVRQRVADDMVKSAWKEMEQKGVVDVRGVFQEGSLCNIL  235

Query  675   ESVFGSCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
             ESVFG+    + EELG MVKEGYELI +FN  DYFPL FL DF G KR+CH+LA +V  +
Sbjct  236   ESVFGN--NDKSEELGDMVKEGYELIAKFNLEDYFPLKFL-DFHGVKRRCHKLAAKVGSV  292

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             VG+I+E+RKR    +  N     DFLS LLSLPKE++L D+D+VA+LWEM+FRGTDTVAI
Sbjct  293   VGEIVEERKRDGSFVGKN-----DFLSTLLSLPKEERLDDSDMVAILWEMVFRGTDTVAI  347

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EW+MARMVLHQDVQ KA+ EIDTC+    HV+DSDI NLPYLQAIVKEVLRLHPPGPL
Sbjct  348   LLEWVMARMVLHQDVQKKAREEIDTCISQKSHVRDSDIANLPYLQAIVKEVLRLHPPGPL  407

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSD  1394
             LSWARLAV DV+VDK  +PAGTTAMVNMWAI+HD  IW DPW F+PERF++E+VSIMGSD
Sbjct  408   LSWARLAVQDVHVDKVLVPAGTTAMVNMWAISHDSSIWEDPWAFKPERFLKEDVSIMGSD  467

Query  1395  LRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             LRLAPFG+GRRVCPGRALGL T HLWLA+ L+HF W+P   VDLSECLKLS+EMK  L
Sbjct  468   LRLAPFGAGRRVCPGRALGLGTAHLWLAQLLRHFIWVPAQQVDLSECLKLSMEMKTPL  525



>gb|KHG25397.1| Cytochrome P450 [Gossypium arboreum]
Length=524

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/475 (67%), Positives = 377/475 (79%), Gaps = 14/475 (3%)
 Frame = +3

Query  168   VEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSLG  347
             V GGFAWRN S +     + GP+ WP LG LP M + AHR LA+ A S+   RLM FSLG
Sbjct  44    VPGGFAWRNSSPD-----VPGPVGWPLLGTLPVMNAVAHRNLAAAAASLSATRLMKFSLG  98

Query  348   TTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHM  527
              TR+IISSHPDTAKEIL GS+F+DRP+K+SA+ LMFERAIGFAPSG+YWR LRR+AANHM
Sbjct  99    ATRVIISSHPDTAKEILGGSAFSDRPIKDSARSLMFERAIGFAPSGAYWRHLRRIAANHM  158

Query  528   FSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLG-L  704
             FSP+RI  LE +R  +   M+ +  + M   GFVE+R ++ +GSL N++++VFGS L   
Sbjct  159   FSPKRILNLEPLRQQVVNHMVVQTQRAMETKGFVELRMILQKGSLTNILDTVFGSFLSSA  218

Query  705   QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEKRKR  884
               +ELGLMVKEGYELI  FNW D+FP+ FL DF G KR CH+L+ +V  +VG+I+E+R++
Sbjct  219   MADELGLMVKEGYELIAMFNWEDHFPVRFL-DFNGVKRMCHKLSNKVKIVVGRIVEERRK  277

Query  885   QFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARMV  1064
             +     IN   N DFL+ LL+L KEDQL+D+D++AVLWEMIFRGTDTVAIL+EWIMARMV
Sbjct  278   EALDQSIN-GGNHDFLTALLTLSKEDQLSDSDMIAVLWEMIFRGTDTVAILLEWIMARMV  336

Query  1065  LHQDVQAKAQLEIDTCVG--PSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAV  1238
             LHQD+QAK Q EID+C+     R V DSD+PNLPYLQA+VKEVLRLHPPGPLLSWARLA+
Sbjct  337   LHQDIQAKVQEEIDSCISHHDDRCVHDSDLPNLPYLQAVVKEVLRLHPPGPLLSWARLAI  396

Query  1239  HDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFGS  1418
             HDV++ K FIPAGTTAMVNMWAITHDP IW DPWTFRPERF+EE+VSIMGSDLRLAPFGS
Sbjct  397   HDVHIGKSFIPAGTTAMVNMWAITHDPSIWKDPWTFRPERFIEEDVSIMGSDLRLAPFGS  456

Query  1419  GRRVCPGRALGLSTVHLWLARFLQHFKWLPGP----SVDLSECLKLSLEMKKHLA  1571
             GRRVCPG+ALGL+TV LWLAR LQ FKWLP       VDLSE L+LSLEMKK L 
Sbjct  457   GRRVCPGKALGLATVQLWLARLLQSFKWLPTTVAHQRVDLSEMLRLSLEMKKPLT  511



>gb|KDP26798.1| hypothetical protein JCGZ_17956 [Jatropha curcas]
Length=444

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/437 (69%), Positives = 368/437 (84%), Gaps = 8/437 (2%)
 Frame = +3

Query  267   MGSHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKL  446
             MGS AHRKLASMA S+G  +LMAFSLG TR++ISSHPDTAKEIL GS F+DRP+KESA+L
Sbjct  1     MGSLAHRKLASMANSLGATKLMAFSLGATRVVISSHPDTAKEILSGSCFSDRPIKESARL  60

Query  447   LMFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgf  626
             LMFE+AIGFAPSG YWR LRR+AAN+MFSPRRI+ LE  R  +A++MI ++ KEM E G 
Sbjct  61    LMFEKAIGFAPSGDYWRHLRRIAANYMFSPRRISGLEPTRQRLADKMIAEVRKEMDERGT  120

Query  627   vevrgvvgegSLRNVVESVFG-SCLGLQGEEL-GLMVKEGYELIGEFNWGDYFPLGFLLD  800
             V +R ++ +GSL NV+ESVFG +C+ L+ EEL   MVKEGYELI +FN  DYFPL FL D
Sbjct  121   VVLREILQKGSLSNVLESVFGRNCVCLEKEELLSCMVKEGYELITKFNLEDYFPLRFL-D  179

Query  801   FGGTKRKCHRLAGRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADAD  980
             F G KR+C++LAG+VN +VG+I+ +RKR     + + N+ +DFLS LLSLP+++QL+++D
Sbjct  180   FYGVKRRCYKLAGQVNSVVGEIVRERKR-----DGSFNSGSDFLSALLSLPEQEQLSESD  234

Query  981   LVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLP  1160
             +V VLWEM+FRGTDTVAIL+EWIMAR+V+HQD+QAKAQ E++ C+G +RHVQDSDIPNLP
Sbjct  235   MVPVLWEMLFRGTDTVAILLEWIMARLVMHQDIQAKAQKELNACIGSNRHVQDSDIPNLP  294

Query  1161  YLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPW  1340
             YLQAIVKEVLR+HPPGPLLSWARLA+HDV+V K  IPAGTTAMVNMWAITHDP IW DP 
Sbjct  295   YLQAIVKEVLRMHPPGPLLSWARLAIHDVHVGKILIPAGTTAMVNMWAITHDPSIWKDPC  354

Query  1341  TFRPERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSV  1520
              F P+RF+ ++++IMGSDLRLAPFGSGRRVCPG+ALGL+TV LWLAR L  +KWLP   V
Sbjct  355   EFNPDRFLNDDIAIMGSDLRLAPFGSGRRVCPGKALGLATVQLWLARLLHQYKWLPAKPV  414

Query  1521  DLSECLKLSLEMKKHLA  1571
             DLSECL+LS+EMK  LA
Sbjct  415   DLSECLRLSMEMKWPLA  431



>ref|XP_010531610.1| PREDICTED: cytochrome P450 78A5-like [Tarenaya hassleriana]
Length=519

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/473 (65%), Positives = 379/473 (80%), Gaps = 12/473 (3%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNP-KKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
             W+V GGFAWRNY+      ++ +GP+  P LG LPQM GS AHRKLA MA+S+G  RLM 
Sbjct  45    WLVPGGFAWRNYTTKMTSCERRDGPVGLPLLGTLPQMMGSLAHRKLAVMASSLGAQRLMP  104

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
              SLG+TR++ISSHP+TAKEILC S+F+DRP+KESA+LLMFERA+GFAPSG +WR LRR+A
Sbjct  105   LSLGSTRVVISSHPETAKEILCSSNFSDRPIKESARLLMFERAVGFAPSGDHWRHLRRLA  164

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSP++I+ LE +R  +AEEM  K+++     G VE+RG++ +GSL N++ES+FGSC
Sbjct  165   ATHLFSPKKISALEPIRHRLAEEMARKIEESSKMHGVVELRGIIQKGSLGNMLESLFGSC  224

Query  696   LGL-QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
             L   Q  ELGLMV EGYELI +FN  D+FP+   LD  G KRKC  LA RV  L+GQI++
Sbjct  225   LSEEQKYELGLMVNEGYELITKFNLEDHFPMVRFLDIYGVKRKCQNLAVRVQSLLGQILK  284

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             +R+   EG     ++  DFL+ L+SL +EDQLADAD+++VLWEM+FRGTDTVAIL+EWIM
Sbjct  285   ERR---EG-----SHGDDFLTSLISLSEEDQLADADVISVLWEMMFRGTDTVAILLEWIM  336

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             AR+VLHQDVQA  + EI TCVG  RHV+DSD+P L YL A+VKEVLRLHPPGPLLSWARL
Sbjct  337   ARLVLHQDVQANLRREIVTCVGDHRHVRDSDVPKLRYLHAVVKEVLRLHPPGPLLSWARL  396

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME-EEVSIMGSDLRLAP  1409
             AVHDV+VDK  +PAGTTAMVNMWAITHDP +W +PW FRP RF+E ++V IMGSDLRLAP
Sbjct  397   AVHDVHVDKFLVPAGTTAMVNMWAITHDPTVWKNPWAFRPSRFLEDDDVLIMGSDLRLAP  456

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             FGSGRRVCPG+ALGL+TVHLW+AR LQ F WLP   VDLSE L++SLEMKK L
Sbjct  457   FGSGRRVCPGKALGLATVHLWVARLLQRFDWLPAEPVDLSENLRMSLEMKKPL  509



>gb|KHN12393.1| Cytochrome P450 78A4 [Glycine soja]
Length=444

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/445 (69%), Positives = 363/445 (82%), Gaps = 8/445 (2%)
 Frame = +3

Query  234   MSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSF  413
             M WP LG LP MGS AH+KLA++A ++   RLMA SLG T ++ISSHP+TA+EIL GSSF
Sbjct  1     MGWPILGSLPLMGSLAHQKLAALAATLNAKRLMALSLGPTPVVISSHPETAREILLGSSF  60

Query  414   TDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIG  593
             +DRP+KESA+ LMFERAIGFAPSG+YWR LRR+AA HMFSPRRI  LEG+R  + ++M+ 
Sbjct  61    SDRPIKESARALMFERAIGFAPSGTYWRHLRRIAAFHMFSPRRIQGLEGLRQRVGDDMVK  120

Query  594   KMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQGEELGLMVKEGYELIGEFNWGD  773
                KEM   G VEVRGV  EGSL N++ESVFGS    + EELG MV+EGYELI   N  D
Sbjct  121   SAWKEMEMKGVVEVRGVFQEGSLCNILESVFGS--NDKSEELGDMVREGYELIAMLNLED  178

Query  774   YFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLP  953
             YFPL FL DF G KR+CH+LA +V  +VGQI+E RKR+   +  N     DFLS LLSLP
Sbjct  179   YFPLKFL-DFHGVKRRCHKLAAKVGSVVGQIVEDRKREGSFVVKN-----DFLSTLLSLP  232

Query  954   KEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHV  1133
             KE++LAD+D+ A+LWEM+FRGTDTVAIL+EW+MARMVLHQDVQ KA+ EIDTC+G + HV
Sbjct  233   KEERLADSDMAAILWEMVFRGTDTVAILLEWVMARMVLHQDVQKKAREEIDTCIGQNSHV  292

Query  1134  QDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITH  1313
             +DSDI NLPYLQAIVKEVLRLHPPGPLLSWARLAVHDV+VDK  +PAGTTAMVNMWAI+H
Sbjct  293   RDSDIANLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVHVDKVLVPAGTTAMVNMWAISH  352

Query  1314  DPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQH  1493
             D  IW DPW F+PERF++E+VSIMGSDLRLAPFG+GRRVCPGRALGL+T HLWLA+ L+H
Sbjct  353   DSSIWEDPWAFKPERFLKEDVSIMGSDLRLAPFGAGRRVCPGRALGLATAHLWLAQLLRH  412

Query  1494  FKWLPGPSVDLSECLKLSLEMKKHL  1568
             F WLP   VDLSECL+LS+EMK  L
Sbjct  413   FIWLPAQPVDLSECLRLSMEMKTPL  437



>ref|XP_010025313.1| PREDICTED: cytochrome P450 78A5-like [Eucalyptus grandis]
 gb|KCW61949.1| hypothetical protein EUGRSUZ_H04642 [Eucalyptus grandis]
Length=520

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/472 (66%), Positives = 373/472 (79%), Gaps = 9/472 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRLMA  335
             +++V GGFAWRN+  ++   KL GP+ WPF+G +PQM S  AHRKLASMA S+G   LMA
Sbjct  43    YFLVPGGFAWRNH-RHEGHSKLKGPIGWPFVGSMPQMASSLAHRKLASMAASLGAKSLMA  101

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
              SLG T +IISS PDTAKEIL  SSF+DRPVKESA+ LMFERAIGFAP G+YWR LR +A
Sbjct  102   LSLGPTPVIISSDPDTAKEILHHSSFSDRPVKESARSLMFERAIGFAPLGTYWRHLRWVA  161

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
              +HMFSPRR+     +R  IAEEM  ++ +EMGE GFVE+RGV+  GS RN++ SVFGS 
Sbjct  162   VSHMFSPRRVGGFAELRGHIAEEMSARVWREMGERGFVELRGVLQGGSQRNMLVSVFGSE  221

Query  696   LGLQGEEL-GLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
             +GL+ E L   MV EGYELI +FN  D+ PL FL DF G KR+C  LA +V  +VGQI+E
Sbjct  222   IGLEREMLLSNMVSEGYELIAKFNLEDHIPLRFL-DFHGVKRRCRELATKVKSVVGQIVE  280

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             +R+R       + +   DFLS LLSLP+ED+L+D+D+VAVLWEMIFRGTDTVAIL+EWIM
Sbjct  281   ERRRGG-----DFHGGNDFLSALLSLPQEDRLSDSDMVAVLWEMIFRGTDTVAILLEWIM  335

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             ARMVLH ++QAK Q E+D  V   RHVQDSDIPNLPYLQAIVKE LR+HPPGPLLSWARL
Sbjct  336   ARMVLHPEIQAKVQQELDAHVDQDRHVQDSDIPNLPYLQAIVKEALRMHPPGPLLSWARL  395

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPF  1412
             AVHDV++ K F+PAGTTAMVNMWAITHDP IW DP TFRP+RF+EE+VS+MGSD+RLAPF
Sbjct  396   AVHDVHIGKTFVPAGTTAMVNMWAITHDPIIWKDPCTFRPDRFIEEDVSVMGSDMRLAPF  455

Query  1413  GSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             G+GRRVCPGR +GL+ V LWLAR L  FKW+P   +DLSECL+LSLEMK  L
Sbjct  456   GAGRRVCPGRVMGLAVVQLWLARLLHQFKWVPTKPLDLSECLRLSLEMKTPL  507



>ref|XP_008801841.1| PREDICTED: cytochrome P450 78A4-like [Phoenix dactylifera]
Length=519

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/473 (65%), Positives = 372/473 (79%), Gaps = 12/473 (3%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFS  341
             W+V GGFAW  YS N       GP+ WP LG LP MG  AHRKL++++ S    RLMA S
Sbjct  39    WLVPGGFAWHKYSGNAPIAP--GPIGWPLLGSLPLMGPLAHRKLSNLSKSHHARRLMALS  96

Query  342   LGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAAN  521
              G T ++ISSHPDTA+EILC ++F+DRP K SA+LLMFERAIGFAPSG YWR+LRR+AA 
Sbjct  97    FGATPVVISSHPDTAREILCSAAFSDRPTKLSARLLMFERAIGFAPSGDYWRRLRRIAAT  156

Query  522   HMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG--SC  695
             +MFSPRRIA LE +R  +A++MI ++ +EM  +G V +RGV+ +GSL ++V S+FG  S 
Sbjct  157   NMFSPRRIAALESLRHRVADDMIRRVSEEMERTGMVVLRGVLQKGSLESIVGSLFGKISP  216

Query  696   LGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK  875
               ++G+EL  MVKEGYELIG+FN  DYF LG LLDF G  R+C  L+ RV  L+G+I+E+
Sbjct  217   GEVEGKELIEMVKEGYELIGKFNLEDYFSLGGLLDFFGVGRRCKHLSARVKALMGKIMEE  276

Query  876   RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
             R+R+      + +   DFLS+LL+LPKE+ L+D+D++AVLWEMIFRGTD VAIL+EWIMA
Sbjct  277   RRRR-----CDFSEQDDFLSLLLALPKEESLSDSDIIAVLWEMIFRGTDVVAILLEWIMA  331

Query  1056  RMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLA  1235
             RMVLH  +QAKAQ E+D  VG  R VQDSD+PNL YL+AIVKEVLRLHPPGPLLSWARLA
Sbjct  332   RMVLHPSIQAKAQQELDAFVG-GRPVQDSDMPNLQYLRAIVKEVLRLHPPGPLLSWARLA  390

Query  1236  VHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFG  1415
             V DVYVDK FIPAGTTAMVNMWAITHD  +W DPW FRPERF++E+VSI+GSDLRL+PFG
Sbjct  391   VRDVYVDKFFIPAGTTAMVNMWAITHDGTVWKDPWAFRPERFLQEDVSILGSDLRLSPFG  450

Query  1416  SGRRVCPGRALGLSTVHLWLARFLQHFKWL-PGPSVDLS-ECLKLSLEMKKHL  1568
             SGRRVCPGRALGLSTVHLWLAR LQ + W   G  V LS ECL+LSLEMKK L
Sbjct  451   SGRRVCPGRALGLSTVHLWLARLLQQYNWTAAGRPVQLSAECLRLSLEMKKPL  503



>ref|XP_010917534.1| PREDICTED: cytochrome P450 78A4-like [Elaeis guineensis]
Length=517

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/470 (66%), Positives = 367/470 (78%), Gaps = 9/470 (2%)
 Frame = +3

Query  165   VVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSL  344
             +V GGFAWR Y  N       GP  WP LG LP MG   HRKLA+++ S   NRLMA S 
Sbjct  45    LVPGGFAWRKYLGNAPIAP--GPTGWPLLGNLPLMGPLVHRKLANLSKSHHANRLMALSF  102

Query  345   GTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANH  524
             G T +IISSHPDTA+EILC ++F+DRP+K SA+LLMFERAIGFAPSG YWR LRR+AAN+
Sbjct  103   GATPVIISSHPDTAREILCSTAFSDRPIKMSARLLMFERAIGFAPSGEYWRHLRRIAANN  162

Query  525   MFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLG-  701
             MFSPRRIA LE +R  +A++MI ++ KEM E+G V +RGV+ +GSL +VV SVFG  LG 
Sbjct  163   MFSPRRIASLERLRCRVADDMIDRVWKEMEETGMVVLRGVLQKGSLESVVGSVFGRSLGE  222

Query  702   LQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEKRK  881
             L+ +EL  M+KEGYELIG FN  DYF LG LLDF G  R+C  LA RV DL+  II++R+
Sbjct  223   LEEKELVEMIKEGYELIGTFNLEDYFSLGGLLDFHGVGRRCKHLALRVKDLMANIIKERR  282

Query  882   RQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARM  1061
                  I  + +N  +FLS+LL+LPKE+ L+D+D+VAVLWEMIFRGTD VAIL+EW MARM
Sbjct  283   -----ILGDFSNQDNFLSLLLALPKEESLSDSDIVAVLWEMIFRGTDVVAILLEWTMARM  337

Query  1062  VLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVH  1241
             VLH  +QAKAQ EIDT VG +R V+DSD+  L +LQAIVKEVLRLHPPGPLLSWARLA+ 
Sbjct  338   VLHPKIQAKAQQEIDTIVG-NRPVRDSDMSKLRFLQAIVKEVLRLHPPGPLLSWARLAIR  396

Query  1242  DVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFGSG  1421
             DV+VDK FIPAGTTAMVNMWAITHD  IW DPW FRPERF+EE+VS++GSDLRL+PFGSG
Sbjct  397   DVHVDKFFIPAGTTAMVNMWAITHDGSIWKDPWAFRPERFLEEDVSVLGSDLRLSPFGSG  456

Query  1422  RRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             RRVCPGR LGL+TVHLWLAR LQ + W     + LSECL+LSLEMKK L 
Sbjct  457   RRVCPGRVLGLTTVHLWLARLLQWYNWTASQPIQLSECLRLSLEMKKPLV  506



>ref|XP_010905212.1| PREDICTED: cytochrome P450 78A5-like [Elaeis guineensis]
Length=527

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/472 (64%), Positives = 362/472 (77%), Gaps = 11/472 (2%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFS  341
             W+V  GFAW  YS N       GP+ WP LG LP MG  AHRKL+ ++ S   +RLMA S
Sbjct  48    WLVPSGFAWHKYSGNGPIAP--GPIGWPLLGSLPLMGPLAHRKLSDLSKSHHASRLMALS  105

Query  342   LGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAAN  521
              G T ++ISSHPDTA+EILC ++F DRP K SA+LLMFERAIGFAPSG YWR LRR+AAN
Sbjct  106   FGATPVVISSHPDTAREILCSAAFGDRPTKVSARLLMFERAIGFAPSGDYWRHLRRIAAN  165

Query  522   HMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLG  701
             +MFSPRRIA LE +R  +A+ MI ++ KEM   G V +RGV+ +GSL ++V SVFG   G
Sbjct  166   NMFSPRRIAALESLRHRVADGMIHRVSKEMERRGMVVLRGVLQKGSLESIVGSVFGKSPG  225

Query  702   L--QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK  875
                +G+E   MV+EGYELIG+FN  DYF LG LLDF G  R+C +L  RV  L+G+I+E+
Sbjct  226   ELEEGKEFMEMVREGYELIGKFNLEDYFSLGGLLDFSGVGRRCEQLTVRVKALIGKIVEE  285

Query  876   RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
             R+RQ      +     DFLS+LL+LPKE+ L+D+D++AVLWEMIFRGTD VAIL+EWIMA
Sbjct  286   RRRQG-----DFCKQDDFLSLLLALPKEESLSDSDIIAVLWEMIFRGTDVVAILLEWIMA  340

Query  1056  RMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLA  1235
             RMVLH  +QAKAQ E+D  VG  R VQDSD+ NL YLQAIVKEVLRLHPPGPLLSWARLA
Sbjct  341   RMVLHPRIQAKAQRELDAFVG-GRPVQDSDMSNLRYLQAIVKEVLRLHPPGPLLSWARLA  399

Query  1236  VHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFG  1415
             + DV+VDK FIPAGTTAMVNMWAITHD  IW DPW F+PERF++E+V I+GSDLRL+PFG
Sbjct  400   IRDVHVDKFFIPAGTTAMVNMWAITHDGSIWKDPWAFKPERFLQEDVGILGSDLRLSPFG  459

Query  1416  SGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKKHL  1568
             SGRRVCPGRALGL+TVHLWLAR LQ + W      V LSECL+LSLEMKK L
Sbjct  460   SGRRVCPGRALGLTTVHLWLARLLQQYNWTATSLPVQLSECLRLSLEMKKPL  511



>gb|EYU25896.1| hypothetical protein MIMGU_mgv1a019031mg [Erythranthe guttata]
Length=486

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/474 (64%), Positives = 365/474 (77%), Gaps = 30/474 (6%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSW--PFLGFLPQMGSHAHRKLASMATSMGLNRLMA  335
             +VV GGFAW+ Y  N     L GP +    FLGFLPQMG  AHR LA+MATS+  NRLMA
Sbjct  30    FVVPGGFAWKKYHQNHKNHHLKGPKTTCGNFLGFLPQMGPLAHRNLATMATSLRANRLMA  89

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
              SLG+ RM+ISSHP+TA+EILCG +F++RP+KES +LLMF+RAIGFAP G+YWR+LR++A
Sbjct  90    VSLGSVRMVISSHPETAREILCGPAFSNRPIKESTRLLMFDRAIGFAPYGNYWRRLRKIA  149

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG-S  692
             ++H+FSPRRI+ LEG R AIA +M+ ++  EM E GFVE+RG++ +GSL N++ESVFG +
Sbjct  150   SSHVFSPRRISSLEGSRHAIANDMVERVCVEMNERGFVELRGILQKGSLDNMLESVFGIN  209

Query  693   CLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
                  GE LGLMVKEGYE      WG              KR+C+ L GRV+DLV   ++
Sbjct  210   SDNEGGELLGLMVKEGYE------WG--------------KRRCNILGGRVSDLVTLFLK  249

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             +R++     + +     DFL VLLSL +ED   D D+V VL EM+FRG D +AIL+EWIM
Sbjct  250   ERRK-----DGDFKLRKDFLRVLLSLKEEDLFLDTDMVGVLCEMVFRGVDNIAILLEWIM  304

Query  1053  ARMVLHQDVQAKAQLEIDTCVG-PSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR  1229
             ARMVLHQD+QAKAQ EID  +G  +RH+QDSDI NLPYLQAIVKEVLRLHPPGPLLSWAR
Sbjct  305   ARMVLHQDIQAKAQNEIDAYIGHQTRHIQDSDIANLPYLQAIVKEVLRLHPPGPLLSWAR  364

Query  1230  LAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME-EEVSIMGSDLRLA  1406
             LA+HDV+VDKCFIPAGTTAMVNMWAI HD  IW DPW+FRPERF+E  + SIMGSDLRLA
Sbjct  365   LAIHDVHVDKCFIPAGTTAMVNMWAIAHDASIWADPWSFRPERFVELGDFSIMGSDLRLA  424

Query  1407  PFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             PFGSGRR CPG+ALGL+TVHLWLAR LQ FKWLP  +VDL ECLKLSLEMKK L
Sbjct  425   PFGSGRRACPGKALGLATVHLWLARILQRFKWLPSQTVDLGECLKLSLEMKKPL  478



>ref|XP_008805331.1| PREDICTED: cytochrome P450 78A4-like [Phoenix dactylifera]
Length=517

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/471 (65%), Positives = 366/471 (78%), Gaps = 10/471 (2%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFS  341
             W+V GGFAW  YS N       GP+ WP LG LP +G  AHRKLAS++ S   +RLMA S
Sbjct  44    WLVPGGFAWHKYSGNAPVAP--GPIGWPLLGSLPLLGPLAHRKLASLSKSHRASRLMALS  101

Query  342   LGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAAN  521
              G T +++SSHPDTA+EILCG++F+DRP K SA+LLMFERAIGFAPSG YWR LRR+AA 
Sbjct  102   FGATPVVVSSHPDTAREILCGAAFSDRPTKVSARLLMFERAIGFAPSGEYWRHLRRIAAG  161

Query  522   HMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS-CL  698
              MFSPRRIA  E +RSA+A+ MI ++ +EM E+G V +RGV+ +GSL ++V SVFG   L
Sbjct  162   SMFSPRRIAASETLRSAVADGMIDRVRREMEETGMVVLRGVLQKGSLESMVGSVFGRRSL  221

Query  699   G-LQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK  875
             G ++G+EL  MVKEGYELIG FN GDYF LG LLD  G  R+C  LA RV  L+G++IE+
Sbjct  222   GEVEGKELADMVKEGYELIGSFNLGDYFSLGGLLDLYGVGRRCKHLALRVKALMGKLIEE  281

Query  876   RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
             R+   E      +   DFLS+LL+LPKE+ L+D+D++AVLWEMIFRGTD VAIL+EWIMA
Sbjct  282   RRTHGE-----FSKQDDFLSLLLALPKEESLSDSDIIAVLWEMIFRGTDVVAILLEWIMA  336

Query  1056  RMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLA  1235
             RMVLH ++QAKA+ E+DT VG  R VQDSD+P L YL+AIVKE LRLHPPGPLLSWARLA
Sbjct  337   RMVLHPNIQAKAREELDTFVG-DRSVQDSDVPKLRYLRAIVKEALRLHPPGPLLSWARLA  395

Query  1236  VHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFG  1415
             + DV+VDK  IPAGTTAMVNMWAITHD  IW DPW F+PERF EE+VSI+GSDLRL+PFG
Sbjct  396   IQDVHVDKFLIPAGTTAMVNMWAITHDGSIWKDPWAFQPERFFEEDVSILGSDLRLSPFG  455

Query  1416  SGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             SGRRVCPGR LGL+TVHLWLAR +Q   W     V LSECL+LSLEMKK L
Sbjct  456   SGRRVCPGRVLGLTTVHLWLARLIQQCNWTANHPVQLSECLRLSLEMKKPL  506



>ref|XP_010257993.1| PREDICTED: cytochrome P450 78A5 [Nelumbo nucifera]
Length=519

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/478 (60%), Positives = 356/478 (74%), Gaps = 9/478 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
             FW+  GG AW   +++++   + GP  +P LG L    GS AHR LA +A       LMA
Sbjct  36    FWLAPGGLAW-ALASSKSRTAIPGPSGFPLLGLLFAFTGSAAHRVLAKLAQCFNAKPLMA  94

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR IISSHP+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++
Sbjct  95    FSVGITRFIISSHPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPFGEYWRNLRRIS  154

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             + H+FSP+RIA     R  I  +M+ K+   M   G VEV+ V+  GSL NV+ SVFG  
Sbjct  155   SIHLFSPKRIAGFGSFRREIGLKMVDKIRASMVMKGKVEVKKVLRFGSLNNVMMSVFGRS  214

Query  696   L----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                  G  G EL  +V EGYEL+G FNW D+FP+   LD  G +R+C +L  +VN  V  
Sbjct  215   YDFSEGGDGSELEGLVSEGYELLGIFNWSDHFPVLGWLDLQGVRRRCRKLVAKVNVFVKN  274

Query  864   II-EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             II E RKR+ +G+ ++  + +DF+ +LL L KED+L+D+D++AVLWEMIFRGTDTVAIL+
Sbjct  275   IIDEHRKRRVDGV-VDDESASDFVDILLDLEKEDRLSDSDMIAVLWEMIFRGTDTVAILL  333

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EWI+ARMVLH D+QAKAQ EID+ VG +R V DSD+PNLPYLQ+IVKE LR+HPPGPLLS
Sbjct  334   EWILARMVLHPDIQAKAQSEIDSVVGSTRSVSDSDLPNLPYLQSIVKESLRVHPPGPLLS  393

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WARLAVHDV++ + FIPAGTTAMVNMWAITHD  IW++P  F+PERFM+EEVSIMGSDLR
Sbjct  394   WARLAVHDVHIGENFIPAGTTAMVNMWAITHDEGIWSEPTEFKPERFMKEEVSIMGSDLR  453

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMKKHLA  1571
             LAPFGSGRRVCPG+A+GL+TV LWLA+ LQ FKW+P  + VDLSECLKLSLEMK  L 
Sbjct  454   LAPFGSGRRVCPGKAMGLATVQLWLAQLLQSFKWVPSDNGVDLSECLKLSLEMKNPLT  511



>ref|XP_009405485.1| PREDICTED: cytochrome P450 78A4-like [Musa acuminata subsp. malaccensis]
Length=517

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/472 (61%), Positives = 351/472 (74%), Gaps = 10/472 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAF  338
              W+V GGFAW  YS   +     GP+ WP LG L  MG  AHRKLA ++ S     LMA 
Sbjct  43    IWLVPGGFAWHRYSGAGSIAP--GPIGWPLLGCLTLMGPLAHRKLAKLSKSHRAAHLMAL  100

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             SLG T +++SSHPDTA+EIL G +F+DRP K SA++LMFERAIGFAP+G YWR LRR+A+
Sbjct  101   SLGATPVVVSSHPDTAREILHGPAFSDRPAKISARMLMFERAIGFAPAGDYWRHLRRVAS  160

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
               MFSPRRIA L  +R  +A  M+ ++ KEM  +G V +R ++ E  L N+V SVFG  L
Sbjct  161   TSMFSPRRIAALASLRHQVAGRMVSRVWKEMEGTGLVVLRELLQESCLENMVGSVFGLSL  220

Query  699   G-LQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK  875
             G  + +EL  MV++GYELIG+FN  DYFPLG LLD  G  R+C  L+ RV DLVG+I+E+
Sbjct  221   GEAETKELVDMVRKGYELIGQFNLEDYFPLGGLLDLSGVGRRCKHLSIRVKDLVGKIVER  280

Query  876   RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
             R++       +     DFLS+LLSLPKE+ L+D D++AVLWEM+FRGTD VA+L+EW MA
Sbjct  281   RRQG------DYRMQDDFLSLLLSLPKEETLSDTDIIAVLWEMVFRGTDAVAVLLEWTMA  334

Query  1056  RMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLA  1235
             RMVLH  +QAKAQ E+D  VG  R V+DSD P L YLQA+VKEVLR+HPPGPLLSWARLA
Sbjct  335   RMVLHPSIQAKAQQELDAVVG-GRPVEDSDTPKLRYLQAVVKEVLRMHPPGPLLSWARLA  393

Query  1236  VHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFG  1415
             V DV V K F+PAGTTAMVNMWAITHD   W DPW FRP+RF+E +VS++GSDLRL+PFG
Sbjct  394   VRDVLVGKYFVPAGTTAMVNMWAITHDESNWEDPWAFRPDRFLEADVSVLGSDLRLSPFG  453

Query  1416  SGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLA  1571
             SGRRVCPGRALG++T HLWLAR LQ F+W  G  V LSE L+LSLEMKK LA
Sbjct  454   SGRRVCPGRALGVATAHLWLARLLQQFRWTAGRPVQLSERLRLSLEMKKPLA  505



>ref|XP_010260472.1| PREDICTED: cytochrome P450 78A5 [Nelumbo nucifera]
Length=519

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/476 (60%), Positives = 350/476 (74%), Gaps = 7/476 (1%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
             FW+  GG AW   S  ++   + GP  +P +G L    GS  HR LA +A  +    LMA
Sbjct  36    FWLAPGGLAW-ALSKAKSRIAIPGPSGFPLVGLLFAFTGSTTHRVLAKLAQCLNAKPLMA  94

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR IISSHP+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++
Sbjct  95    FSVGFTRFIISSHPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRIS  154

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A HMFSP+RIA     R  I   ++ ++   M ++G VEV+ V+  GSL NV+ SVFG  
Sbjct  155   ATHMFSPKRIAGFGSFRREIGSRIVEEIRDMMVKNGMVEVKKVLHFGSLNNVMMSVFGRT  214

Query  696   L----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                  G  G EL  +V EGYEL+G FNW D+FP+  LLD  G +++C RL  +VN  V  
Sbjct  215   YDFKEGGDGFELEGLVSEGYELLGIFNWSDHFPVLGLLDLQGVRKRCRRLVTKVNAFVKN  274

Query  864   IIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             IIE+ +R+     ++  ++ +F+ VLL L KED+L D+D++AVLWEMIFRGTDTVAIL+E
Sbjct  275   IIEEHRRRRVNGALDDESDRNFVDVLLDLEKEDRLNDSDMIAVLWEMIFRGTDTVAILLE  334

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  1223
             WI+ARM++H D+QAKAQ EID  VG +R V DSD+PNLPYLQAIVKE LR+HPPGPLLSW
Sbjct  335   WILARMLMHPDIQAKAQSEIDAVVGATRSVSDSDLPNLPYLQAIVKESLRMHPPGPLLSW  394

Query  1224  ARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRL  1403
             ARLAVHDV++ + FIPAGTTAMVNMWAITHD  IW++P  F+PERFM+EEVSIMGSDLRL
Sbjct  395   ARLAVHDVHIGEFFIPAGTTAMVNMWAITHDEGIWSEPAEFKPERFMKEEVSIMGSDLRL  454

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMKKHL  1568
             APFGSGRRVCPG+A+GL+TV LWLA+ LQ FKW P  + VDLSECLKLSLEMK  L
Sbjct  455   APFGSGRRVCPGKAMGLATVQLWLAQLLQSFKWAPSDNGVDLSECLKLSLEMKNPL  510



>ref|XP_008786022.1| PREDICTED: cytochrome P450 78A5-like [Phoenix dactylifera]
Length=506

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/474 (61%), Positives = 358/474 (76%), Gaps = 14/474 (3%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFS  341
             W+  GG AW   + ++ P+ + GP   P +  L   G+ AHR LA +A S+G  RLMAFS
Sbjct  35    WLSPGGLAW---ALSRAPRSIPGP---PGV-VLALAGTAAHRALAGLARSIGATRLMAFS  87

Query  342   LGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAAN  521
             +G TR I+SSHPDTAKEIL  S+F DRP+KESA  L+F RA+GFAP G YWR LRR++A 
Sbjct  88    VGFTRFIVSSHPDTAKEILNSSAFADRPIKESAYELLFNRAMGFAPFGEYWRNLRRISAT  147

Query  522   HMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLG  701
             H+FSPRRIA     R AI E+M+G++   MG  G VEV+ V+  GSL NV+ SVFG    
Sbjct  148   HLFSPRRIAAFGEHRWAIGEQMVGEVRALMGTDGVVEVKRVLHFGSLNNVMMSVFGKRFD  207

Query  702   L-QGEELGL--MVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
               +GE L L  +VKEGYEL+G  NW D+FPL   +D  G +++C RLAGRVN LVG+IIE
Sbjct  208   FAKGEGLDLEGLVKEGYELLGMLNWSDHFPLLGWMDLQGVRKRCRRLAGRVNVLVGKIIE  267

Query  873   K-RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWI  1049
             + R+R+ +G    +N   DF+ VLL L KE++L+D+D+VAVLWEMIFRGTDTVAIL+EWI
Sbjct  268   EHRRRRIDGG--GLNGVGDFVDVLLDLEKEERLSDSDMVAVLWEMIFRGTDTVAILLEWI  325

Query  1050  MARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR  1229
             +ARMVLH ++Q+K Q EID  VG SR V D DIPNLPYLQ+IVKE LR+HPPGPLLSWAR
Sbjct  326   IARMVLHPEIQSKVQSEIDAIVGNSRLVSDCDIPNLPYLQSIVKESLRMHPPGPLLSWAR  385

Query  1230  LAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAP  1409
             LA+HDV++   F+PAGTTAMVNMWAITHD  IW +P  F+PERFM E+VS++GSDLRLAP
Sbjct  386   LAIHDVHIGNHFVPAGTTAMVNMWAITHDESIWPEPNEFKPERFMSEDVSVLGSDLRLAP  445

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKKHL  1568
             FGSGRRVCPG+ALGL+TVHLWLA+ LQ F+WLP    VDLSECL +SLEMK  L
Sbjct  446   FGSGRRVCPGKALGLATVHLWLAQLLQSFQWLPSNGGVDLSECLNMSLEMKNPL  499



>ref|XP_008787550.1| PREDICTED: cytochrome P450 78A5-like [Phoenix dactylifera]
Length=506

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/468 (61%), Positives = 347/468 (74%), Gaps = 16/468 (3%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSLGTT  353
             GG AW   + ++ P+ + GP        L   G+ AHR LA +A ++G  RLMAFS+G T
Sbjct  39    GGLAW---ALSRAPRSIPGPPGI----VLALAGTAAHRALAGLARTLGAARLMAFSVGFT  91

Query  354   RMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMFS  533
             R I+SSHPDTAKEIL  S+F DRP+KESA  L+F RA+GFAP G YWR LRR++A H+FS
Sbjct  92    RFIVSSHPDTAKEILNSSAFADRPIKESAYELLFHRAMGFAPFGEYWRNLRRISATHLFS  151

Query  534   PRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGL---  704
             PRR+A   G R AI  +M+ ++   M   G VEV+ ++  GSL NV+ SVFG        
Sbjct  152   PRRVAAFGGHRLAIGAQMVEEIKALMRTDGVVEVKRLLHFGSLNNVMMSVFGKIFDFGKG  211

Query  705   QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE--KR  878
             +G EL  +VKEGYEL+G FNW D+ PL   +D  G +++C  L  RVN  VG+I+E  +R
Sbjct  212   EGLELEGLVKEGYELLGVFNWSDHLPLLGWMDLQGVRKRCRGLVERVNVFVGKIVEEHRR  271

Query  879   KRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMAR  1058
             +R   G+    N + DF+ VLL L KE+ L+D+D+VAVLWEMIFRGTDTVAIL+EWIMAR
Sbjct  272   RRIDRGVP---NEDGDFVDVLLDLEKEETLSDSDMVAVLWEMIFRGTDTVAILLEWIMAR  328

Query  1059  MVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAV  1238
             MVLH D+Q+K Q E+D  VG SR V DSDIPNLPYLQ++VKE LR+HPPGPLLSWARLA+
Sbjct  329   MVLHPDIQSKVQSEMDAVVGNSRLVSDSDIPNLPYLQSVVKESLRMHPPGPLLSWARLAI  388

Query  1239  HDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFGS  1418
             HDV+V   FIPAGTTAMVNMWAITHD +IW DP  FRPERFM E+VSI+GSDLRLAPFGS
Sbjct  389   HDVHVGDHFIPAGTTAMVNMWAITHDERIWADPNEFRPERFMAEDVSILGSDLRLAPFGS  448

Query  1419  GRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMK  1559
             GRRVCPG+ALGL+TVHLWLA+ LQ FKW+P    VDLSECLK+SLEMK
Sbjct  449   GRRVCPGKALGLATVHLWLAQLLQSFKWVPSDGGVDLSECLKMSLEMK  496



>ref|XP_010923556.1| PREDICTED: cytochrome P450 78A5-like [Elaeis guineensis]
Length=506

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/473 (60%), Positives = 353/473 (75%), Gaps = 12/473 (3%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFS  341
             W+  GG AW   + ++ P+ + GP   P +  L   G+ AHR LA +A S+G  RLMAFS
Sbjct  35    WLSPGGLAW---ALSKAPRSIPGP---PGV-VLALAGTAAHRALAGLARSIGATRLMAFS  87

Query  342   LGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAAN  521
             +G TR I+SSHPDTA+EIL  S+F DRP+KESA  L+F RA+GFAP G YWR LRR++A 
Sbjct  88    VGLTRFIVSSHPDTAREILNSSAFADRPIKESAYELLFHRAMGFAPFGEYWRNLRRISAT  147

Query  522   HMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLG  701
             H+FSPRRIA     R AI E+M+G +   MG  G VE++ V+  GSL NV+ SVFG    
Sbjct  148   HLFSPRRIAAFGEHRWAIGEQMVGDIRALMGTDGAVELKRVLHFGSLNNVMMSVFGKRFD  207

Query  702   L---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
                 +G EL  +VKEGYEL+G FNW D+FPL   LD  G +++C RLAGRVN LVG+IIE
Sbjct  208   FAKGEGLELEALVKEGYELLGMFNWSDHFPLLGWLDLQGVRKRCRRLAGRVNVLVGKIIE  267

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             + +R+       ++   DF+ VLL L KE++L+D+D+VAVLWEMIFRGTDTVAIL+EWIM
Sbjct  268   EHRRK-RIDGGGLDGAGDFVDVLLDLEKEERLSDSDMVAVLWEMIFRGTDTVAILLEWIM  326

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             ARMVLH ++Q+K Q EID   G SR V DSDIP+LPYLQ++VKE LR+HPPGPLLSWARL
Sbjct  327   ARMVLHPEIQSKVQSEIDAITGNSRLVSDSDIPHLPYLQSMVKESLRMHPPGPLLSWARL  386

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPF  1412
             A+HDV++   FIPAGTTAMVNMWAITHD  IW +P  F+PERFM E+VSI+GSDLRLAPF
Sbjct  387   AIHDVHIGNHFIPAGTTAMVNMWAITHDEAIWANPNEFKPERFMSEDVSILGSDLRLAPF  446

Query  1413  GSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKKHL  1568
             GSGRRVCPG+ALGL+TVHLWLA+ LQ F+W+     VDLSECL +SLEMK  L
Sbjct  447   GSGRRVCPGKALGLATVHLWLAQLLQSFQWVASDGGVDLSECLNMSLEMKNPL  499



>ref|XP_009617550.1| PREDICTED: cytochrome P450 78A5-like [Nicotiana tomentosiformis]
Length=515

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/472 (59%), Positives = 341/472 (72%), Gaps = 10/472 (2%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMAF  338
             W+  GG AW   + ++    + GP   P LG L    GS  HR LA +A ++    LMAF
Sbjct  34    WLRPGGLAW---AFSKARVSIPGPSGLPVLGLLLTFTGSLTHRLLAKLADNLKAESLMAF  90

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S+G TR IISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++A
Sbjct  91    SVGVTRFIISSKPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGDYWRNLRRISA  150

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              H+FSP+RI C    R  I  +M+ K+   M  +G VEV+ V+  GSL NV+ +VFG C 
Sbjct  151   THLFSPKRITCFGEFRRDIGTKMVTKIASLMEINGHVEVKRVLHFGSLNNVMRTVFGKCY  210

Query  699   ---GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                G  G EL  +V EGYEL+G FNW D+FP+   LD  G +R+C  L  RVN  VG+II
Sbjct  211   DFNGQDGRELEYLVSEGYELLGIFNWSDHFPVLGWLDLQGVRRRCKELVARVNTFVGKII  270

Query  870   EKRK--RQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             E+ +  R     ++     +DF+ VLL L +E+ L D+D++AVLWEMIFRGTDTVAIL+E
Sbjct  271   EEHRIRRAENAGKVADEGLSDFVDVLLDLEQENSLNDSDMIAVLWEMIFRGTDTVAILLE  330

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  1223
             WI+ARMVLH D+QAKAQ EID  VG  R V DSD+PNLPY+QAIVKE LR+HPPGPLLSW
Sbjct  331   WILARMVLHPDIQAKAQREIDAVVGTDRGVCDSDLPNLPYVQAIVKETLRVHPPGPLLSW  390

Query  1224  ARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRL  1403
             ARLA+HD +V + FIPAGTTAMVNMWAITHD KIW+ P  F PERF+EEE++IMGSDLRL
Sbjct  391   ARLAIHDTHVGQHFIPAGTTAMVNMWAITHDEKIWSQPKEFMPERFLEEEIAIMGSDLRL  450

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEM  1556
             APFGSGRRVCPG+A+GL+TV LWLA+ LQ FKW+   + VDLSECLKLS+EM
Sbjct  451   APFGSGRRVCPGKAMGLATVQLWLAQLLQEFKWVASDNGVDLSECLKLSMEM  502



>ref|XP_006345108.1| PREDICTED: cytochrome P450 78A5-like [Solanum tuberosum]
Length=515

 Score =   531 bits (1368),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 279/476 (59%), Positives = 342/476 (72%), Gaps = 10/476 (2%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGF-LPQMGSHAHRKLASMATSMGLNRLMAF  338
             W+  GG AW   S ++    + GP   P LG  L   GS  HR LA ++  +    LMAF
Sbjct  34    WLTPGGLAW---SFSKARVSIPGPSGLPVLGLVLTFTGSLTHRLLAKISNGLKAESLMAF  90

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S+G TR IISS+P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++A
Sbjct  91    SVGFTRFIISSNPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRISA  150

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              H+FSP+RIAC    RS I  +M+ ++   M   G V+V+ V+  GSL NV+++VFG   
Sbjct  151   THLFSPKRIACFGDFRSEIGRKMVTEIASLMETDGHVKVKRVLHFGSLNNVMKTVFGKSY  210

Query  699   GLQGE---ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                GE   EL  +V EGYEL+G FNW D+FPL   LD  G +R+C  L  RVN  VG+II
Sbjct  211   DFNGEDGRELEYLVSEGYELLGIFNWSDHFPLLGWLDLQGVRRRCKELVARVNIFVGKII  270

Query  870   EKRKRQFEGIEINVNNNT--DFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             ++ +        NV +    DF+ VLL L KE++L+D+D++AVLWEMIFRGTDTVAIL+E
Sbjct  271   QQHRLNRVKNAGNVADECFHDFVDVLLDLEKENKLSDSDMIAVLWEMIFRGTDTVAILLE  330

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  1223
             WI+ARMVLH D+QAK Q EI+T VG  R V DSD+PNL YL A VKE LR+HPPGPLLSW
Sbjct  331   WILARMVLHPDIQAKVQSEINTVVGTDRAVCDSDLPNLQYLLATVKETLRVHPPGPLLSW  390

Query  1224  ARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRL  1403
             ARLA+HD  V   FIPAGTTAMVNMWAITHD KIW+ P  F PERF+EE+V+IMGSDLRL
Sbjct  391   ARLAIHDTSVGHHFIPAGTTAMVNMWAITHDEKIWSQPEEFMPERFLEEDVAIMGSDLRL  450

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMKKHL  1568
             APFGSGRRVCPG+A+GL+TV LWLA+ LQ FKW+P  + VDLSECL+LSLEMK+ L
Sbjct  451   APFGSGRRVCPGKAMGLATVQLWLAQLLQEFKWVPSDNGVDLSECLRLSLEMKQPL  506



>ref|XP_009419067.1| PREDICTED: cytochrome P450 78A5-like [Musa acuminata subsp. malaccensis]
Length=508

 Score =   530 bits (1365),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 277/474 (58%), Positives = 347/474 (73%), Gaps = 12/474 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAF  338
              W+  GG AW   + ++  + + GP   P +  L   GS AHR LA +A S+  + LMAF
Sbjct  35    LWLYPGGIAW---ALSRAGRSIPGP---PGM-VLALSGSAAHRVLARLAESLKASDLMAF  87

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S G TR ++SSHPDTA+EIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++A
Sbjct  88    SFGFTRFVVSSHPDTAREILNSSAFADRPVKESAYELLFHRAMGFAPFGEYWRNLRRISA  147

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              ++FSP RIA     R+AI ++MI  +   M  +G V ++ V+  GSL NV+ SVFG   
Sbjct  148   TYLFSPTRIAAFGEDRTAIGQQMIQDVMASMETNGVVGMKKVLHFGSLNNVMISVFGKRF  207

Query  699   GL---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                  +G EL  +V EGYEL+G FNW D+FPL   +D    +++C RL  RVN  VG II
Sbjct  208   DFGNAEGMELERLVTEGYELLGAFNWSDHFPLLRWVDPQDIRKRCRRLVARVNVFVGSII  267

Query  870   EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWI  1049
             E+ +R+  G ++  N   DF+ VLL L KE++L+D+D+VAVLWEMIFRGTDTVAIL+EWI
Sbjct  268   EEHRRRRSGGDLT-NEVCDFVDVLLDLEKEERLSDSDMVAVLWEMIFRGTDTVAILLEWI  326

Query  1050  MARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR  1229
             MARMVLHQ++Q+ AQ EID  VG SR V D+DI NLPYL++IVKE LR+HPPGPLLSWAR
Sbjct  327   MARMVLHQEIQSTAQSEIDAVVGSSRLVADADIANLPYLRSIVKESLRMHPPGPLLSWAR  386

Query  1230  LAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAP  1409
             LAVHDV+V   F+PAGTTAMVNMWAITHD +IW DP  F+PERFMEE VS++GSDLRLAP
Sbjct  387   LAVHDVHVGPSFVPAGTTAMVNMWAITHDGRIWADPDDFKPERFMEENVSVLGSDLRLAP  446

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMKKHL  1568
             FGSGRRVCPG+AL L+TVHLWLA+ LQ FKW+P  + VDL+E LK+SLEM+  L
Sbjct  447   FGSGRRVCPGKALALATVHLWLAQLLQRFKWVPAETGVDLAESLKMSLEMQTPL  500



>ref|XP_004236064.1| PREDICTED: cytochrome P450 78A5-like [Solanum lycopersicum]
Length=516

 Score =   530 bits (1365),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 278/477 (58%), Positives = 337/477 (71%), Gaps = 11/477 (2%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGF-LPQMGSHAHRKLASMATSMGLNRLMAF  338
             W+  GG AW   S ++    + GP   P LG  L   GS  HR LA ++  +    LMAF
Sbjct  34    WLTPGGLAW---SFSKARVSIPGPSGLPLLGLVLTFTGSLTHRMLAKLSNGLKAESLMAF  90

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S+G TR IISS+P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++A
Sbjct  91    SVGFTRFIISSNPETAKEILGSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRISA  150

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              H+FSP+RIAC    R  I  +M+ ++   M   G V+V+ V+  GSL NV+++VFG   
Sbjct  151   THLFSPKRIACFGDFRREIGSKMVTEIASLMETDGHVKVKRVLHFGSLNNVMKTVFGKTY  210

Query  699   GLQ---GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                   G EL  +V EGYEL+G FNW D+FPL   LD  G +R+C  L  RVN  VG+II
Sbjct  211   DFHEEDGRELEYLVSEGYELLGIFNWSDHFPLLGWLDLQGVRRRCKELVARVNTFVGKII  270

Query  870   EKRK--RQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             E+ +  R          +  DF+ VLL L KE++L+D+D++AVLWEMIFRGTDTVAIL+E
Sbjct  271   EEHRLNRVINAGNAADEDFHDFVDVLLDLEKENKLSDSDMIAVLWEMIFRGTDTVAILLE  330

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  1223
             WI+ARMVLH D+Q K Q EID  VG  R V DSD+PNL YLQAIVKE LR+HPPGPLLSW
Sbjct  331   WILARMVLHPDIQTKVQSEIDAEVGTDRAVCDSDLPNLQYLQAIVKETLRVHPPGPLLSW  390

Query  1224  ARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRL  1403
             ARLA+HD  V   FIPAGTTAMVNMWAITHD KIW+ P  F PERF+EE+VSIMGSDLRL
Sbjct  391   ARLAIHDTSVGHHFIPAGTTAMVNMWAITHDEKIWSQPEEFMPERFLEEDVSIMGSDLRL  450

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP--SVDLSECLKLSLEMKKHL  1568
             APFGSGRRVCPG+A+GL+TV LWLA+ LQ FKW P    +VDLSECLKLSLE+ + L
Sbjct  451   APFGSGRRVCPGKAMGLATVQLWLAQLLQEFKWFPSDKNNVDLSECLKLSLELNQPL  507



>ref|XP_002273829.1| PREDICTED: cytochrome P450 78A5 [Vitis vinifera]
Length=518

 Score =   530 bits (1364),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 280/476 (59%), Positives = 347/476 (73%), Gaps = 8/476 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
             FW+  GG AW   +  +    + GP   P  G L    GS AHR LA +A       LMA
Sbjct  36    FWLAPGGLAW-ALAKCRGRFAIPGPPGLPVTGLLHVFSGSEAHRVLAKLARRWDAVGLMA  94

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR ++SS P+TAK IL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++
Sbjct  95    FSVGLTRFVVSSDPETAKGILSSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRIS  154

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSP+RIA  EG R  I  +M+ ++   M E+G VEV+ V+  GSL NV+ +VFG  
Sbjct  155   ATHLFSPKRIAAFEGFRRDICLKMVDEIRGLMVENGEVEVKKVLHFGSLNNVMMTVFGRS  214

Query  696   L----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                  G  G EL  +V+EGYEL+G FNW D+FPL  LLD  G +++C RLA +VN  VG+
Sbjct  215   YDFDEGGVGFELEKLVREGYELLGTFNWSDHFPLLGLLDLQGVRKRCRRLASKVNVFVGK  274

Query  864   IIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             IIE+ + +  G  ++VN   DF+ VLL L KED+L D+D++AVLWEMIFRGTDTVAIL+E
Sbjct  275   IIEEHRAKRVG-GLSVNGVEDFVDVLLDLEKEDKLTDSDMIAVLWEMIFRGTDTVAILLE  333

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  1223
             WI+ARMVLH ++Q+KAQ EID  VG SR V DSDIPNLPY+Q+IVKE LR+HPPGPLLSW
Sbjct  334   WILARMVLHPEIQSKAQSEIDAMVGNSRPVSDSDIPNLPYVQSIVKESLRVHPPGPLLSW  393

Query  1224  ARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRL  1403
             ARLA  DV++    +PAGTTAMVNMWAITHD K+W +P  F+PERFM+ ++SIMGSDLRL
Sbjct  394   ARLATDDVHIGDTLVPAGTTAMVNMWAITHDEKVWPEPLEFKPERFMDTDISIMGSDLRL  453

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPG-PSVDLSECLKLSLEMKKHL  1568
             APFGSGRRVCPG+++GL+TVHLWLA+ LQ FKW+P   SVDLSE L LSLEMK  L
Sbjct  454   APFGSGRRVCPGKSMGLATVHLWLAQLLQSFKWVPSHHSVDLSETLNLSLEMKNPL  509



>ref|XP_009792560.1| PREDICTED: cytochrome P450 78A5-like [Nicotiana sylvestris]
Length=516

 Score =   527 bits (1358),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 277/477 (58%), Positives = 342/477 (72%), Gaps = 11/477 (2%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGF-LPQMGSHAHRKLASMATSMGLNRLMAF  338
             W+  GG AW   +  +    + GP   P LG  L   GS  HR LA ++ S+    LMAF
Sbjct  34    WLRPGGLAW---AFTKARVSIPGPSGLPVLGLVLTFTGSLTHRLLAKLSNSLKAEPLMAF  90

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S+G TR IISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++A
Sbjct  91    SVGFTRFIISSQPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRISA  150

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              H+FSP+RIAC    R  I  +M   +   M  +G VEV+ V+  GSL NV+ +VFG C 
Sbjct  151   THLFSPKRIACFGEFRREIGTKMATDIASLMEINGHVEVKRVLHFGSLNNVMRTVFGKCY  210

Query  699   GLQGE---ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                G+   EL  +V EGYEL+G FNW D+FP+   LD  G +R+C  L  RVN  VG+II
Sbjct  211   DFNGQDGLELEYLVSEGYELLGIFNWSDHFPVLGWLDLQGVRRRCKELVARVNVFVGKII  270

Query  870   EK-RKRQFEGIEINVNNN--TDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             E+ R ++ E       +   +DF+ VLL L K+++L+D+D++AVLWEMIFRGTDTVAIL+
Sbjct  271   EEHRSKRTENAGKGAADEGLSDFVDVLLDLEKDNKLSDSDMIAVLWEMIFRGTDTVAILL  330

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EWI+AR+VLH D+QAKA+ EID  VG  R V+DSD+PNLPYLQ IVKE LR+HPPGPLLS
Sbjct  331   EWILARLVLHPDIQAKARREIDAVVGTDRGVRDSDLPNLPYLQGIVKETLRVHPPGPLLS  390

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WARLA+HD  V + FIPAGTTAMVNMWAITHD KIW+ P  F PERF+EEE++IMGSDLR
Sbjct  391   WARLAIHDTNVGQHFIPAGTTAMVNMWAITHDEKIWSQPEEFMPERFLEEEIAIMGSDLR  450

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMKKHL  1568
             LAPFGSGRRVCPG+A+GL+TV LWLA+ LQ FKW+   + VDLSECLKLS+EM   L
Sbjct  451   LAPFGSGRRVCPGKAMGLATVQLWLAQLLQEFKWVASDNGVDLSECLKLSMEMSHPL  507



>ref|XP_009407609.1| PREDICTED: cytochrome P450 78A5-like [Musa acuminata subsp. malaccensis]
Length=508

 Score =   526 bits (1354),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 276/474 (58%), Positives = 345/474 (73%), Gaps = 14/474 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAF  338
              W   GG AW   + ++  + + GP        L   G+ AHR LA++A ++    LMAF
Sbjct  37    LWFYPGGLAW---ALSRAGRSIPGPRGM----VLALSGAAAHRSLATLAETLKATGLMAF  89

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S+G TR ++SS PDTA+EIL  S+F DRP+KESA  L+F RA+GFAP G YWR LRRM+A
Sbjct  90    SVGLTRFVVSSRPDTAREILNSSAFADRPIKESAYELLFHRAMGFAPFGEYWRNLRRMSA  149

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              H+FSP RIA     R  IA++MI  +   M ++G VEV+ V+  GSL NV+ +VFG   
Sbjct  150   THLFSPMRIAASGEHRRTIAQQMIRDVMASMEKNGAVEVKKVLHFGSLSNVMATVFGKKF  209

Query  699   GL---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                  QG EL  +V EGYEL+GEFNW D+ PL   LD  G +++C  L  RVN  VG II
Sbjct  210   DFGKGQGMELEELVTEGYELLGEFNWSDHVPLLSWLDPQGIRKRCRGLVSRVNVFVGGII  269

Query  870   EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWI  1049
              + +R+  G E   + + DF+ VLL L KE++L+D+D+VAVLWEMIFRGTDTVAIL+EWI
Sbjct  270   GEHRRRRSGGE---SVDGDFVDVLLDLEKEERLSDSDMVAVLWEMIFRGTDTVAILLEWI  326

Query  1050  MARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR  1229
             MAR+V+HQ++Q +AQ E+D  VG SR V D DIPNLPYLQ+IVKE LRLHPPGPLLSWAR
Sbjct  327   MARLVVHQEIQRRAQSELDGVVGNSRAVADGDIPNLPYLQSIVKETLRLHPPGPLLSWAR  386

Query  1230  LAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAP  1409
             LA+HDV+V   FIPAGTTAMVNMWAITHD +IW +P +F PERFMEE+VS++GSDLRLAP
Sbjct  387   LAIHDVHVGDSFIPAGTTAMVNMWAITHDERIWPNPESFEPERFMEEDVSVLGSDLRLAP  446

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMKKHL  1568
             FGSGRRVCPG+AL L+TVHLWLA+ L  FKW+P  + VDLSECLK+SLEM+  L
Sbjct  447   FGSGRRVCPGKALALATVHLWLAQLLHQFKWVPVETGVDLSECLKMSLEMQNPL  500



>ref|XP_009388744.1| PREDICTED: cytochrome P450 78A5-like [Musa acuminata subsp. malaccensis]
Length=508

 Score =   525 bits (1352),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 279/475 (59%), Positives = 345/475 (73%), Gaps = 13/475 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
              W   GG AW    +  +   + GP      GF+  + G  AHR LA +A S+    LMA
Sbjct  34    LWFCPGGLAW--AFSKAHACSIPGPP-----GFVSALSGDAAHRVLAGLANSLKAVDLMA  86

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR ++SSHPDTAKEIL  S+F DRP+KESA +L+F RA+GFAP G YWR LRR++
Sbjct  87    FSVGLTRFVVSSHPDTAKEILNSSAFADRPIKESAYMLLFHRAMGFAPFGEYWRNLRRVS  146

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A ++FSPRRIA     R AI E+M+  +   M ++G VEV+ ++  GSL NV+ SVFG  
Sbjct  147   ATYLFSPRRIAAAGEHRRAIGEQMVADIRDLMAKNGVVEVKKLLHFGSLNNVMMSVFGKR  206

Query  696   LGL---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQI  866
                   +G EL  +VKEGYEL+G FNW D+FPL   LD  G +++C  L  RVN  VG I
Sbjct  207   FDFGKGEGLELEGLVKEGYELLGVFNWADHFPLLGWLDLQGVRKRCRALVKRVNAFVGSI  266

Query  867   IEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEW  1046
             IE+ K Q   I   V+    F+ VLL L KE++L+DAD+VAVLWEMIFRGTDTVAIL+EW
Sbjct  267   IEEHK-QGRTIGAVVDGAGSFVDVLLGLQKEEKLSDADMVAVLWEMIFRGTDTVAILLEW  325

Query  1047  IMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWA  1226
             I+AR+VLH D+Q+KAQ EID+ VG SR V D+DI + PYLQAIVKE LRLHPPGPLLSWA
Sbjct  326   IVARVVLHPDIQSKAQSEIDSVVGTSRPVCDADIASFPYLQAIVKESLRLHPPGPLLSWA  385

Query  1227  RLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLA  1406
             RLA+HDV+V   FIPAGTTAMVNMWAITHD  +W +P  F+PERFM E+V+++GSDLRLA
Sbjct  386   RLAIHDVHVGDHFIPAGTTAMVNMWAITHDGSVWAEPNEFKPERFMVEDVNVLGSDLRLA  445

Query  1407  PFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKKHL  1568
             PFG+GRRVCPG+A+GL+TVHLWLA+ LQ FKW+P    VDLSE LK+SLEMKK L
Sbjct  446   PFGAGRRVCPGKAMGLATVHLWLAQLLQSFKWVPADGGVDLSESLKMSLEMKKPL  500



>ref|XP_008785621.1| PREDICTED: cytochrome P450 78A5-like [Phoenix dactylifera]
Length=508

 Score =   522 bits (1345),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 280/475 (59%), Positives = 347/475 (73%), Gaps = 13/475 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAF  338
              W+  GGFAW   + ++  + + GP   P +  L   G+ AHR LA +A S     LM F
Sbjct  34    LWLYPGGFAW---ALSRAQRSIPGP---PGI-VLALSGTAAHRALAGLARSFQAIPLMVF  86

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S+G TR ++SSHPDTA+EIL  S+F DRP+KESA  L+F RA+GFAP G YWR LRR++A
Sbjct  87    SVGFTRFVVSSHPDTAREILNSSAFADRPIKESAYELLFHRAMGFAPFGEYWRNLRRISA  146

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              ++FSPRRIA     R AI E+M+G++ + MG  G VEV+ VV  GSL N++ SVFG   
Sbjct  147   TYLFSPRRIAAFGEHRRAIGEQMVGEVKELMGRYGDVEVKRVVHFGSLNNIMMSVFGKRF  206

Query  699   GL---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                  +G EL  +V+EGYEL+G FNW D+ PL   LD  G +++C  L  RVN  VG II
Sbjct  207   DFVKGEGVELEGLVREGYELLGVFNWSDHLPLLGWLDLQGVRKRCRGLVRRVNVFVGNII  266

Query  870   EKRKRQFEGIEINVNNNT-DFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEW  1046
             E+ +++ E       +   DF+ VLL L +E++L+DAD+VAVLWEMIFRGTDTVAIL+EW
Sbjct  267   EEHRQRRERFGGTAGDGVGDFVDVLLDL-QEEKLSDADMVAVLWEMIFRGTDTVAILLEW  325

Query  1047  IMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWA  1226
             IMARMVLH D+QAKAQ EID  VG SR V DSDIP LPYLQ+IVKE LR+HPPGPLLSWA
Sbjct  326   IMARMVLHPDIQAKAQSEIDAVVGNSRIVSDSDIPKLPYLQSIVKESLRMHPPGPLLSWA  385

Query  1227  RLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLA  1406
             RLA+HDV + K  IPAGTTAMVNMWAITHD  IW++P  F+PERF+ ++VSI+GSDLRLA
Sbjct  386   RLAIHDVNIGKHLIPAGTTAMVNMWAITHDESIWSEPCEFKPERFVADDVSILGSDLRLA  445

Query  1407  PFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKKHL  1568
             PFGSGRRVCPG+A+ L+TVHLWLA+ LQ FKW+P    VDLSECLK+SLEMK  L
Sbjct  446   PFGSGRRVCPGKAMALATVHLWLAQLLQRFKWVPSEGGVDLSECLKMSLEMKNPL  500



>ref|XP_007221915.1| hypothetical protein PRUPE_ppa026871mg [Prunus persica]
 gb|EMJ23114.1| hypothetical protein PRUPE_ppa026871mg [Prunus persica]
Length=522

 Score =   521 bits (1342),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 266/478 (56%), Positives = 347/478 (73%), Gaps = 9/478 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
             FW+  GG AW  +   ++ K + GP  +P +G L    GS  HR LA MA S+    LM+
Sbjct  37    FWLFPGGLAW-AFCKVRDFKAIPGPPGYPLIGSLTVFTGSTRHRVLAKMAKSLKAEALMS  95

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR +ISS P+TAKEIL  ++F +RP  E+A  L+F RA+GFAP G YWR LRR+A
Sbjct  96    FSVGLTRFVISSQPETAKEILNSAAFANRPANETAYELLFYRAMGFAPYGEYWRNLRRIA  155

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSP+R+A  E  R  +  +M  ++   M E G V+++ V+  GSL NV+ +VFG C
Sbjct  156   ATHLFSPKRMAGSEVFRREVGLKMAEEIRSLMVEKGEVQMKNVLHFGSLNNVMMTVFGRC  215

Query  696   LGLQGEE----LGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                        L  +V+EGYEL+G FNW ++FP    LD  G +++C  L  +VN  VG+
Sbjct  216   YEFGEGGEGHELDKLVREGYELLGLFNWNNHFPFLGWLDLQGVRKRCRILVSKVNAFVGK  275

Query  864   IIEK-RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             IIE+ R ++ +G   + + + DF+ VLL++  + +L D+D++AVLWEMIFRGTDTVA L+
Sbjct  276   IIEEHRLKKVKGDNFDTDCSGDFVDVLLAMENDHKLGDSDMIAVLWEMIFRGTDTVATLL  335

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EW++ARMVLH ++QAKAQ EID+ VG SR V  SD+PNLPYLQ+IVKE LR+HPPGPLLS
Sbjct  336   EWVLARMVLHPEIQAKAQSEIDSAVGASRPVLGSDVPNLPYLQSIVKECLRVHPPGPLLS  395

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WAR+A+HDVYV + FIPAGTTAMVNMWAITHD K+W++P  FRPERFMEEEVS++G+DLR
Sbjct  396   WARIAIHDVYVGENFIPAGTTAMVNMWAITHDEKVWSEPKLFRPERFMEEEVSVVGTDLR  455

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPG--PSVDLSECLKLSLEMKKHL  1568
             LAPFGSGRRVCPGRALGL++V LWLA+ LQ+F W+P     VDLSECLKLS+EMK  L
Sbjct  456   LAPFGSGRRVCPGRALGLASVQLWLAQLLQNFNWVPSERSDVDLSECLKLSMEMKSPL  513



>ref|XP_008445440.1| PREDICTED: cytochrome P450 78A5 [Cucumis melo]
Length=528

 Score =   521 bits (1341),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 272/481 (57%), Positives = 340/481 (71%), Gaps = 16/481 (3%)
 Frame = +3

Query  174   GGFAWR-NYSNNQNPKKLNGPMSWPFLGFLPQMG-SHAHRKLASMATSMGLNRLMAFSLG  347
             GGFAW  +         + GP   PF+G L     S  H+ L+++A       LMAFS+G
Sbjct  38    GGFAWAISKCKTTASSAIPGPSGLPFIGLLHIFTLSTPHKSLSALANRFKAYPLMAFSVG  97

Query  348   TTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHM  527
              TR +ISSHPD AKEIL   SF DRPVKESA  L+F RA+GFAP G YWR LRR++A +M
Sbjct  98    LTRFVISSHPDVAKEILNSPSFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRISATYM  157

Query  528   FSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGL-  704
             FSP+RIA  +G R  +  +M+ +++K M   G V V+ ++  GSL NV+ +VFG C    
Sbjct  158   FSPKRIAGFQGFRKEVGFKMVREIEKSMVLKGDVRVKEILHFGSLNNVMMTVFGKCYEFC  217

Query  705   ----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
                  G EL  +VKEGY+L+G FNW D+FPL   LD  G +++C  LA +VN  VG+IIE
Sbjct  218   NDERDGLELEELVKEGYDLLGIFNWSDHFPLLGFLDLQGVRKRCRCLASKVNVFVGKIIE  277

Query  873   KRKRQFEGIEINVN---NNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             + + + E  E +     +N DF+ VLL L K+D+L+D+D++AVLWEMIFRGTDTVAIL+E
Sbjct  278   EHRMKREIKEFHQEEQEHNKDFVDVLLDLEKDDKLSDSDMIAVLWEMIFRGTDTVAILLE  337

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             WI+ARMV+H ++Q KAQ EID+ +G   R + D DI  LPYLQAIVKE LR+HPPGPLLS
Sbjct  338   WILARMVIHPEIQTKAQNEIDSVIGKKWRAISDDDIQKLPYLQAIVKECLRMHPPGPLLS  397

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WARLAV DV+VD   IPAGTTAMVNMWAITHD K+W D   F P RFMEEEVS+MGSDLR
Sbjct  398   WARLAVADVHVDGRVIPAGTTAMVNMWAITHDEKVWKDAEKFDPNRFMEEEVSVMGSDLR  457

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-----VDLSECLKLSLEMKKH  1565
             LAPFG+GRRVCPG+A+GL+TVHLWLA+ LQ +KW+P        VDLSECLKLS+EMK  
Sbjct  458   LAPFGAGRRVCPGKAMGLATVHLWLAQLLQAYKWMPCSDESTNGVDLSECLKLSMEMKTP  517

Query  1566  L  1568
             L
Sbjct  518   L  518



>gb|KDP31370.1| hypothetical protein JCGZ_11746 [Jatropha curcas]
Length=531

 Score =   520 bits (1338),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 270/486 (56%), Positives = 346/486 (71%), Gaps = 17/486 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYS---NNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNR  326
             FW+  GG AW  Y    N Q+   + GP   P LG +    GS  HR LA     +    
Sbjct  39    FWLAPGGLAWVLYKTKFNVQSKTAIPGPSGLPVLGMVFAFTGSLTHRVLAKTCNLVKAKP  98

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LMAFS+G TR IISSHP+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LR
Sbjct  99    LMAFSIGFTRFIISSHPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPFGEYWRNLR  158

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVF  686
             R+++ H+FSP+RI+     R+ I  +M+ ++   + ++G VE+R ++  GSL NV++SVF
Sbjct  159   RISSTHLFSPKRISSFGEFRTQIGRKMVDEIKGLVEKNGEVEIRRILHFGSLNNVMKSVF  218

Query  687   GSCL------GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             G          ++G EL  +V EGYEL+G FNW D+FP    LD  G K++C  L  +VN
Sbjct  219   GKSYEFSDAKDVEGSELEGLVTEGYELLGIFNWSDHFPFFGWLDLQGVKKRCRNLVAKVN  278

Query  849   DLVGQIIEKRK---RQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGT  1019
               VG+++E+ +   RQ    E   N N DF+ VLL L +E++L D+D++AVLWEMIFRGT
Sbjct  279   VFVGKVVEEHRIMRRQDRNHE--ANENGDFVDVLLDLEEENKLNDSDMIAVLWEMIFRGT  336

Query  1020  DTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLH  1199
             DTVAIL+EWI+ARMV+HQ++Q+KAQ EID  VG +R V DSD+PNLPYL+ IVKE LR+H
Sbjct  337   DTVAILLEWILARMVIHQEIQSKAQSEIDQVVGLNRLVSDSDLPNLPYLRGIVKETLRMH  396

Query  1200  PPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVS  1379
             PPGPLLSWARLA+HD  +   FIPAGTTAMVNMW+ITHD + W++P  F+PERF+EE+V+
Sbjct  397   PPGPLLSWARLAIHDTQIGHYFIPAGTTAMVNMWSITHDEQFWSEPEKFKPERFLEEDVA  456

Query  1380  IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLE  1553
             IMGSDL+LAPFGSGRRVCPG+A+GL+TV LWLA+ LQ FKW+   +  VDLSE LKLSLE
Sbjct  457   IMGSDLKLAPFGSGRRVCPGKAMGLATVELWLAQLLQSFKWVTTNNGEVDLSEKLKLSLE  516

Query  1554  MKKHLA  1571
             MK  L 
Sbjct  517   MKNPLV  522



>ref|XP_008339790.1| PREDICTED: cytochrome P450 78A5-like [Malus domestica]
Length=522

 Score =   519 bits (1336),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 268/478 (56%), Positives = 344/478 (72%), Gaps = 9/478 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
             F +  GGFAW      +  + + GP  +PF+G L    G   HR LA +A S     LM+
Sbjct  37    FCLAPGGFAW-ALCKVRAFRAIPGPTGYPFIGSLTVFTGLTRHRVLAKLAKSFKAESLMS  95

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR +I+SHP+TAKE+L  ++F +RPV E+A  L+F RA GFAP G YWR LRR++
Sbjct  96    FSVGLTRFVIASHPETAKEMLNSTAFANRPVNETAYELLFHRAXGFAPYGEYWRNLRRIS  155

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSP+RIA  E  R  +  +M+ ++ + M E+G V+V+ V+  GSL NV+ +VFG C
Sbjct  156   ATHLFSPKRIAGSEVFRREVGMKMVEELKRLMTENGEVQVKKVLHFGSLNNVMMTVFGRC  215

Query  696   L----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                  G  G EL  +V EGYEL+G FNW ++FP    LD  G +++C  L  +VN  VG+
Sbjct  216   YEFDKGGDGLELESLVTEGYELLGVFNWSNHFPFLGWLDLQGVRKRCRNLVLKVNVFVGK  275

Query  864   IIEKRK-RQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             IIE+    + +G +       DF+ VLL L ++D+L+D+D++AVLWEMIFRGTDTVAIL+
Sbjct  276   IIEEHXLERAKGDDFEKEKVGDFVDVLLDLEEDDKLSDSDMIAVLWEMIFRGTDTVAILL  335

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EWI+ARMVLH ++Q KAQ EID  VG +R VQ SDIPNLPYLQAIVKE LR+HPPGPLLS
Sbjct  336   EWILARMVLHPEIQTKAQSEIDAVVGSTRTVQGSDIPNLPYLQAIVKECLRVHPPGPLLS  395

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WAR+A+HDVYV   F+PAGT+AMVNMWAITHD K+W +P  F PERFM E+VSIMG+DLR
Sbjct  396   WARIAIHDVYVGDNFVPAGTSAMVNMWAITHDEKVWTEPEKFSPERFMAEDVSIMGTDLR  455

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKHL  1568
             LAPFGSGRRVCPG+ALGL+TV LWLA+ LQ+F W+   +  VDLSECLKLS+EMK  L
Sbjct  456   LAPFGSGRRVCPGKALGLATVQLWLAQLLQNFXWVASENCDVDLSECLKLSMEMKSPL  513



>ref|XP_007209897.1| hypothetical protein PRUPE_ppa004083mg [Prunus persica]
 gb|EMJ11096.1| hypothetical protein PRUPE_ppa004083mg [Prunus persica]
Length=531

 Score =   519 bits (1336),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 280/489 (57%), Positives = 347/489 (71%), Gaps = 22/489 (4%)
 Frame = +3

Query  159   FWVVEGGFAWR-NYSNNQNPKK--LNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNR  326
             FW+  GG AW  + S  Q+P K  + GP   P LG +    GS  HR LA +A +     
Sbjct  36    FWLSPGGLAWALSKSRAQHPSKTAIPGPSGLPVLGLVSVFTGSLTHRVLAKLAETSKAKP  95

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LMAFS+G TR +ISSHPDTAKE+L  S+F DRP+KESA  L+F +A+GFAP G YWR LR
Sbjct  96    LMAFSVGFTRFVISSHPDTAKELLNSSAFADRPIKESAYELLFHKAMGFAPFGEYWRNLR  155

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVF  686
             R++A H+FSP+RIA     R  I  +M+ +M   M  +G +EVR V+  GSL NV+ SVF
Sbjct  156   RISATHLFSPKRIASFGLFRENIGHKMVEEMKALMERAGEIEVRKVLHFGSLNNVMMSVF  215

Query  687   GSCLGL--------QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGR  842
             G             +  EL  +V EGYEL+G FNW D+FPL  LLD  G +++C +L  +
Sbjct  216   GRSYEFGEGCENDGEAHELEELVSEGYELLGIFNWSDHFPLLGLLDLQGVRKRCKKLVAK  275

Query  843   VNDLVGQIIEK-RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGT  1019
             VN  VG+IIE+ R ++  G +   + + DF+ VLL L K ++L+D+D++AVLWEMIFRGT
Sbjct  276   VNVFVGKIIEEHRVKRVVGAD---HESGDFVDVLLDLEKVNRLSDSDMIAVLWEMIFRGT  332

Query  1020  DTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGP-SRHVQDSDIPNLPYLQAIVKEVLRL  1196
             DTVAIL+EWI+ARMVLH D+QAKAQ EIDT VG  +R V DSD+PNLPYL AIVKE LR+
Sbjct  333   DTVAILLEWILARMVLHPDIQAKAQSEIDTVVGTGNRSVSDSDLPNLPYLHAIVKETLRM  392

Query  1197  HPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERF-MEEE  1373
             HPPGPLLSWARLA+HD ++   FIPAGTTAMVNM+AITHD KIW+DP  F+PERF M E+
Sbjct  393   HPPGPLLSWARLAIHDTHLGHHFIPAGTTAMVNMFAITHDEKIWSDPNEFKPERFIMNED  452

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP----GPSVDLSECLK  1541
             V IMGSDLRLAPFGSGRR CPG+A+GL+TV LWLA+ LQ FKW+        VDLSE LK
Sbjct  453   VPIMGSDLRLAPFGSGRRTCPGKAMGLATVELWLAQLLQSFKWVSSDDQSAGVDLSETLK  512

Query  1542  LSLEMKKHL  1568
             LSLEMK  L
Sbjct  513   LSLEMKHSL  521



>ref|XP_004158291.1| PREDICTED: cytochrome P450 78A3-like [Cucumis sativus]
Length=528

 Score =   518 bits (1335),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 270/481 (56%), Positives = 341/481 (71%), Gaps = 16/481 (3%)
 Frame = +3

Query  174   GGFAWR-NYSNNQNPKKLNGPMSWPFLGFLPQMG-SHAHRKLASMATSMGLNRLMAFSLG  347
             GGFAW  +         + GP   PF+G L     S  H+ L+++A       LMAFS+G
Sbjct  38    GGFAWAISKCKTTASSAIPGPSGLPFIGLLHIFTLSTPHKSLSALANRFKAYPLMAFSVG  97

Query  348   TTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHM  527
              TR +ISS+PD AKEIL  +SF DRPVKESA  L+F RA+GFAP G YWR LRR++A +M
Sbjct  98    LTRFVISSNPDVAKEILNSTSFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRISATYM  157

Query  528   FSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGL-  704
             FSP+RIA  EG R  +  +M+ +++K M   G V V+ ++  GSL NV+ +VFG C    
Sbjct  158   FSPKRIAGFEGFRKEVGFKMVREIEKSMVLKGDVRVKEILHFGSLNNVMMTVFGKCYEFC  217

Query  705   ----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
                  G EL  +VKEGY+L+G FNW D+FPL   LD  G +++C  LA +VN  VG+IIE
Sbjct  218   NGERDGLELEALVKEGYDLLGIFNWSDHFPLLGFLDLQGVRKRCRCLASKVNVFVGKIIE  277

Query  873   KRKRQFEGIEINVN---NNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             + + + E  E +     +N DF+ VLL L K+D+L+D+D++AVLWEMIFRGTDTVAIL+E
Sbjct  278   EHRMKREIKEFHQEEQEHNKDFVDVLLDLEKDDKLSDSDMIAVLWEMIFRGTDTVAILLE  337

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             WI+ARMV+H ++Q KAQ EID+ +    R + D+DI  LPYLQAIVKE LR+HPPGPLLS
Sbjct  338   WILARMVIHPEIQTKAQNEIDSVIDEKWRAISDNDIQKLPYLQAIVKECLRMHPPGPLLS  397

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WARLAV DV+VD   IPAGTTAMVNMWAITHD K+W D   F P RFMEEE+S+MGSDLR
Sbjct  398   WARLAVADVHVDGRVIPAGTTAMVNMWAITHDEKVWKDAEKFDPNRFMEEEISVMGSDLR  457

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-----VDLSECLKLSLEMKKH  1565
             LAPFG+GRRVCPG+A+GL+TVHLWLA+ LQ +KW+P        VDLSECLKLS+EMK  
Sbjct  458   LAPFGAGRRVCPGKAMGLATVHLWLAQLLQAYKWMPCSDESTNGVDLSECLKLSMEMKTP  517

Query  1566  L  1568
             L
Sbjct  518   L  518



>ref|XP_008350889.1| PREDICTED: cytochrome P450 78A5-like [Malus domestica]
Length=522

 Score =   518 bits (1333),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 264/478 (55%), Positives = 346/478 (72%), Gaps = 9/478 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLG-FLPQMGSHAHRKLASMATSMGLNRLMA  335
             F    GG AW     ++  + + GP  +P +G F   +GS  HR LA +A S     LM+
Sbjct  37    FCFAPGGLAW-ALCKDRASRAIPGPPGYPLIGSFAVFIGSTRHRVLAKLARSFKAEALMS  95

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G +R +I+S P+TAKE+L  ++F +RPV E+A  L+F RA+GFAP G YWR LRR+A
Sbjct  96    FSVGLSRFVIASQPETAKEMLNSTAFANRPVNETAYELLFNRAMGFAPYGEYWRNLRRIA  155

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSP+RIA  E  R  +  +M+ ++ + M ++G V+V+ V+  GSL NV+ +VFG C
Sbjct  156   ATHLFSPKRIAGSEAFRREVGLKMVEELRRMMLKNGQVQVKKVLHFGSLNNVMMTVFGRC  215

Query  696   L----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                  G  G EL  +V EGYEL+G FNW ++FP    LD  G +++C +L  +VN  VG+
Sbjct  216   YEFDKGGDGLELEKLVTEGYELLGLFNWSNHFPFLSWLDLQGVRKRCRKLVSKVNGFVGK  275

Query  864   IIEK-RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             IIE+ R  + +G  +      DF+ VLL L ++D+L+D+D++AVLWEMIFRGTDTVAIL+
Sbjct  276   IIEEHRLERVKGGSVENERVGDFVDVLLDLEEDDKLSDSDMIAVLWEMIFRGTDTVAILL  335

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EWI+ARMVLH ++Q+KAQ EI+  VG +R VQ SDI NLPYLQAIVKE LR+HPPGPLLS
Sbjct  336   EWILARMVLHPEIQSKAQSEIEAVVGSTRTVQGSDIANLPYLQAIVKECLRVHPPGPLLS  395

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WAR+A+HDVYV   F+PAGT+AMVNMWAITHD K+W +P  F PERFM E+VSIMG+DLR
Sbjct  396   WARIAIHDVYVGDNFVPAGTSAMVNMWAITHDAKVWTEPEKFSPERFMAEDVSIMGTDLR  455

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKHL  1568
             LAPFGSGRRVCPG+ALGL+TV LWLA+ LQ+F W+   +  VDLSECLKLS+EMK  L
Sbjct  456   LAPFGSGRRVCPGKALGLATVQLWLAQLLQNFNWIGSXNGDVDLSECLKLSMEMKSPL  513



>emb|CDP15252.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   518 bits (1334),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 279/493 (57%), Positives = 348/493 (71%), Gaps = 23/493 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQ--NPKK------LNGPMSWPFLGF-LPQMGSHAHRKLASMATS  311
             FW+  GG AW    +N+  + KK      + GP   P LG  L   GS  HR L  ++ S
Sbjct  39    FWLTPGGLAWALAVSNKKLSSKKDATSAAIPGPSGLPLLGLVLAFTGSLTHRVLGKISRS  98

Query  312   MGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSY  491
             +    LMAFS+G TR IISSHP+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G Y
Sbjct  99    LKAETLMAFSVGFTRFIISSHPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEY  158

Query  492   WRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNV  671
             WR LRR++A H+FSP+RIAC    R  I  +M+ ++   M  +G VEV+ V+  GSL NV
Sbjct  159   WRNLRRISATHLFSPKRIACSGIFRRDIGVKMVEEIKGLMERNGEVEVKKVMHFGSLNNV  218

Query  672   VESVFGSCLGLQGEE---LGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGR  842
             + SVFG C    G++   L  +V EGYEL+G FNW D+FP+   LD  G +++C  L  R
Sbjct  219   MMSVFGRCYDFDGDDGSVLEGLVSEGYELLGIFNWTDHFPILGWLDMQGVRKRCRELVAR  278

Query  843   VNDLVGQIIEKR--KRQFE-----GIEINVNNNT---DFLSVLLSLPKEDQ-LADADLVA  989
             VN  VG II++   KR  E     G +  ++++    DF+ VLL L KE+  L ++D++A
Sbjct  279   VNVFVGNIIDEHRLKRMAENRGGVGRKPAIDDDEGSGDFVDVLLDLEKENNSLTNSDMIA  338

Query  990   VLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQ  1169
             VLWEMIFRGTDTVAIL+EWI+ARMVLH D+Q+KAQ EID  VG SR V D+D+PNLPYL 
Sbjct  339   VLWEMIFRGTDTVAILLEWIIARMVLHPDIQSKAQAEIDCVVGTSRMVTDADLPNLPYLH  398

Query  1170  AIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFR  1349
             AIVKE LR+HPPGPLLSWARLAVHD +V + FIPAGTTAMVNMWAITHD  +W +P  F 
Sbjct  399   AIVKETLRMHPPGPLLSWARLAVHDTHVGRHFIPAGTTAMVNMWAITHDEMVWPEPEHFM  458

Query  1350  PERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLS  1529
             PERF+ E+V+IMGSDLRLAPFGSGRR CPG+ALGL+TV +WLA+ LQ+F+W+    VDLS
Sbjct  459   PERFLNEDVAIMGSDLRLAPFGSGRRACPGKALGLATVQMWLAQVLQNFEWIASGDVDLS  518

Query  1530  ECLKLSLEMKKHL  1568
             ECLKLS+EMK  L
Sbjct  519   ECLKLSMEMKNPL  531



>ref|XP_009346128.1| PREDICTED: cytochrome P450 78A5-like [Pyrus x bretschneideri]
Length=533

 Score =   518 bits (1333),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 276/489 (56%), Positives = 345/489 (71%), Gaps = 20/489 (4%)
 Frame = +3

Query  162   WVVEGGFAW---RNYSNNQNPKKLNGPMSWPFLGF-LPQMGSHAHRKLASMATSMGLNRL  329
             W+  GG AW   +      +   + GP   P LG  L   GS  HR LA +A +     L
Sbjct  35    WLSPGGLAWALSKFKGQIHSKTTIPGPSGLPLLGLVLSFTGSLTHRVLAKLAETSKAKPL  94

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFS+G TR +ISSHPDTAKE+L  S+F DRP+KESA  L+F +A+GFAP G YWR LRR
Sbjct  95    MAFSVGFTRFVISSHPDTAKELLNSSAFADRPIKESAYELLFHKAMGFAPFGEYWRNLRR  154

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +++ H+F P+RIA     R +I  +M+G+M   M  SG VEVR V+  GSL +V+ SVFG
Sbjct  155   ISSTHLFHPQRIASFGLFRESIGRKMVGEMKSFMKRSGEVEVRKVLHFGSLNSVMMSVFG  214

Query  690   ---------SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGR  842
                       C   +G EL  +V EGYEL+G FNW D+FPL   LD  G +R+C +L  +
Sbjct  215   RSYEFGGELGCGNGEGFELEGLVSEGYELLGIFNWSDHFPLLGFLDLQGVRRRCKKLVAK  274

Query  843   VNDLVGQIIEK---RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFR  1013
             VN  VG+IIE+   ++ +  G+      + DF+ VLL L KE++L+D+D++AVLWEMIFR
Sbjct  275   VNAFVGKIIEEHRVKRDENNGVLSADRESGDFVDVLLDLEKENKLSDSDMIAVLWEMIFR  334

Query  1014  GTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVG-PSRHVQDSDIPNLPYLQAIVKEVL  1190
             GTDTVAIL+EWI+ARMVLH DVQAKAQ EID  VG P+R V +SD+P LPYL AIVKE L
Sbjct  335   GTDTVAILLEWILARMVLHPDVQAKAQSEIDAIVGTPARSVSNSDLPKLPYLHAIVKETL  394

Query  1191  RLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE  1370
             R+HPPGPLLSWARLA+HD ++   FIPAGTTAMVNM+AITHD +IW++P  F+PERF+ E
Sbjct  395   RMHPPGPLLSWARLAIHDTHIGHHFIPAGTTAMVNMFAITHDEEIWSNPNEFKPERFVSE  454

Query  1371  EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP---GPSVDLSECLK  1541
             +V IMGSDLRLAPFGSGRRVCPG+A+GL+TV LWLA+ LQ FKW+P      VDLSE LK
Sbjct  455   DVLIMGSDLRLAPFGSGRRVCPGKAMGLATVELWLAQLLQSFKWVPCDDQSGVDLSETLK  514

Query  1542  LSLEMKKHL  1568
             LSLEMK  L
Sbjct  515   LSLEMKNSL  523



>ref|XP_009338053.1| PREDICTED: cytochrome P450 78A5-like [Pyrus x bretschneideri]
Length=534

 Score =   518 bits (1333),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 280/491 (57%), Positives = 353/491 (72%), Gaps = 21/491 (4%)
 Frame = +3

Query  159   FWVVEGGFAWR-NYSNNQNPKK--LNGPMSWPFLGF-LPQMGSHAHRKLASMATSMGLNR  326
             FW+  GG AW  +    Q P K  + GP  +P LG  L   GS  HR LA +A +     
Sbjct  36    FWLSPGGLAWALSKFKAQIPSKTAIPGPSGFPILGLVLSFTGSLTHRVLAKLAETSKAKP  95

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LMAFS+G TR +ISSHP+TAKE+L  S+F DRP+KESA  L+F +A+GFAP G YWR LR
Sbjct  96    LMAFSVGFTRFVISSHPNTAKELLNSSAFADRPIKESAYELLFHKAMGFAPFGEYWRNLR  155

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVF  686
             R+++ H+F+P+RIA     R +I  +M+ +M   M  SG VEVR V+  GSL NV+ SVF
Sbjct  156   RISSTHLFNPKRIASFGLFRDSIGCKMVEEMKGLMERSGEVEVRKVLHFGSLNNVMMSVF  215

Query  687   G---------SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAG  839
             G          C   +G EL  +V EGYEL+G FNW D+FPL   LD  G +R+C +L  
Sbjct  216   GRSYEFGGELGCGNGEGFELEGLVSEGYELLGIFNWSDHFPLLGFLDLQGVRRRCKKLVA  275

Query  840   RVNDLVGQIIEK---RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIF  1010
             +VN  VG+IIE+   ++ +  G+    + + DF+ VLL L +E++L+D+D++AVLWEMIF
Sbjct  276   KVNAFVGKIIEEHRVKRNENNGVLGTDHESGDFVDVLLDL-EENKLSDSDMIAVLWEMIF  334

Query  1011  RGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVG-PSRHVQDSDIPNLPYLQAIVKEV  1187
             RGTDTVAIL+EWI+ARM+LH D+QAKAQ EID  VG P+R V DSD+P LPYL+AIVKE 
Sbjct  335   RGTDTVAILLEWILARMILHPDIQAKAQSEIDAVVGTPTRSVSDSDLPKLPYLRAIVKET  394

Query  1188  LRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME  1367
             LR+HPPGPLLSWARLA+HD ++D  FIPAGTTAMVNM+AITHD KIW++P  F+PERF+ 
Sbjct  395   LRMHPPGPLLSWARLAIHDTHIDHHFIPAGTTAMVNMFAITHDEKIWSNPNEFKPERFIN  454

Query  1368  EEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPS-VDLSECL  1538
             E+V IMGSDLRLAPFGSGRRVCPG+A+GL+TV LWL + LQ FKW+P  G S VDLSE L
Sbjct  455   EDVPIMGSDLRLAPFGSGRRVCPGKAMGLATVELWLGQLLQSFKWVPCDGQSGVDLSETL  514

Query  1539  KLSLEMKKHLA  1571
             KLSLEMK  L 
Sbjct  515   KLSLEMKTSLV  525



>ref|XP_004144260.1| PREDICTED: cytochrome P450 78A3-like [Cucumis sativus]
 gb|KGN47658.1| hypothetical protein Csa_6G366560 [Cucumis sativus]
Length=528

 Score =   517 bits (1332),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 270/481 (56%), Positives = 340/481 (71%), Gaps = 16/481 (3%)
 Frame = +3

Query  174   GGFAWR-NYSNNQNPKKLNGPMSWPFLGFLPQMG-SHAHRKLASMATSMGLNRLMAFSLG  347
             GGFAW  +         + GP   PF+G L     S  H+ L+++A       LMAFS+G
Sbjct  38    GGFAWAISKCKTTASSAIPGPSGLPFIGLLHIFTLSTPHKSLSALANRFKAYPLMAFSVG  97

Query  348   TTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHM  527
              TR +ISS+PD AKEIL   SF DRPVKESA  L+F RA+GFAP G YWR LRR++A +M
Sbjct  98    LTRFVISSNPDVAKEILNSPSFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRISATYM  157

Query  528   FSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGL-  704
             FSP+RIA  EG R  +  +M+ +++K M   G V V+ ++  GSL NV+ +VFG C    
Sbjct  158   FSPKRIAGFEGFRKEVGFKMVREIEKSMVLKGDVRVKEILHFGSLNNVMMTVFGKCYEFC  217

Query  705   ----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
                  G EL  +VKEGY+L+G FNW D+FPL   LD  G +++C  LA +VN  VG+IIE
Sbjct  218   NGERDGLELEALVKEGYDLLGIFNWSDHFPLLGFLDLQGVRKRCRCLASKVNVFVGKIIE  277

Query  873   KRKRQFEGIEINVN---NNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             + + + E  E +     +N DF+ VLL L K+D+L+D+D++AVLWEMIFRGTDTVAIL+E
Sbjct  278   EHRMKREIKEFHQEEQEHNKDFVDVLLDLEKDDKLSDSDMIAVLWEMIFRGTDTVAILLE  337

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             WI+ARMV+H ++Q KAQ EID+ +    R + D+DI  LPYLQAIVKE LR+HPPGPLLS
Sbjct  338   WILARMVIHPEIQTKAQNEIDSVIDEKWRAISDNDIQKLPYLQAIVKECLRMHPPGPLLS  397

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WARLAV DV+VD   IPAGTTAMVNMWAITHD K+W D   F P RFMEEE+S+MGSDLR
Sbjct  398   WARLAVADVHVDGRVIPAGTTAMVNMWAITHDEKVWKDAEKFDPNRFMEEEISVMGSDLR  457

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-----VDLSECLKLSLEMKKH  1565
             LAPFG+GRRVCPG+A+GL+TVHLWLA+ LQ +KW+P        VDLSECLKLS+EMK  
Sbjct  458   LAPFGAGRRVCPGKAMGLATVHLWLAQLLQAYKWMPCSDESTNGVDLSECLKLSMEMKTP  517

Query  1566  L  1568
             L
Sbjct  518   L  518



>ref|XP_002514632.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF47738.1| cytochrome P450, putative [Ricinus communis]
Length=462

 Score =   515 bits (1326),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 264/446 (59%), Positives = 330/446 (74%), Gaps = 13/446 (3%)
 Frame = +3

Query  270   GSHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLL  449
             GS  HR LA  +  +    LMAFS+G TR IISSHP+TAKEIL  S+F DRPVKESA  L
Sbjct  7     GSLTHRVLAKTSQVLKAKTLMAFSIGLTRFIISSHPETAKEILNSSAFADRPVKESAYEL  66

Query  450   MFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfv  629
             +F R++GFAP G YWR LRR++A H+FSP+RIA   G+R+ I ++M+ ++   +   G V
Sbjct  67    LFHRSMGFAPFGEYWRNLRRISATHLFSPKRIASFAGLRAVIGQKMVAEIKGLVERDGVV  126

Query  630   evrgvvgegSLRNVVESVFGSCLGLQGE-------ELGLMVKEGYELIGEFNWGDYFPLG  788
             EVR V+  GSL NV++SVFG       +       EL  +V EGYEL+G FNW D+FP  
Sbjct  127   EVRKVLHFGSLNNVMKSVFGKSYEFSDKKHNVDAFELEGLVSEGYELLGSFNWSDHFPFL  186

Query  789   FLLDFGGTKRKCHRLAGRVNDLVGQIIEKRK--RQFEGIEINV---NNNTDFLSVLLSLP  953
               LD  G +++C  L  +V+  VG+IIE+ +  R   G +  V    N  DF+ VLL L 
Sbjct  187   GWLDLQGVRKRCRNLVAKVSVFVGKIIEEHRIRRAESGKQRAVAGDENFGDFVDVLLDLE  246

Query  954   KEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHV  1133
             +E++L D+D++AVLWEMIFRGTDTVAIL+EWI+ARMVLH D+QAKAQ EIDT VG SR V
Sbjct  247   EENRLTDSDMIAVLWEMIFRGTDTVAILLEWILARMVLHPDIQAKAQSEIDTVVGTSRSV  306

Query  1134  QDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITH  1313
              D D+PNLPYL+AIVKE LR+HPPGPLLSWARLA+HD ++   FIPAGTTAMVNMW+ITH
Sbjct  307   CDCDLPNLPYLRAIVKETLRMHPPGPLLSWARLAIHDTHIGSYFIPAGTTAMVNMWSITH  366

Query  1314  DPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQH  1493
             D + W++P  F+PERFMEE+V+IMGSDLRLAPFGSGRRVCPG+A+GL+TV LWLA+ LQ+
Sbjct  367   DQQFWSEPEKFKPERFMEEDVAIMGSDLRLAPFGSGRRVCPGKAMGLATVELWLAQLLQN  426

Query  1494  FKWLPGP-SVDLSECLKLSLEMKKHL  1568
             FKW+P    VDL+E LKLSLEMK  L
Sbjct  427   FKWVPSDCGVDLTENLKLSLEMKNSL  452



>ref|XP_003550706.1| PREDICTED: cytochrome P450 78A5-like [Glycine max]
 gb|KHN18375.1| Cytochrome P450 78A3 [Glycine soja]
Length=528

 Score =   516 bits (1330),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 278/483 (58%), Positives = 346/483 (72%), Gaps = 16/483 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFL-PQMGSHAHRKLASMATSMGLNRLMA  335
             +W+V GG AW   + ++    + GP  +P +G +   +G   HR LA +A +     LMA
Sbjct  35    YWLVPGGLAW---AFSKFKPAIPGPSGYPVVGLVWAFIGPLTHRVLAKLAETFDAKPLMA  91

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR IISSHPDTAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++
Sbjct  92    FSVGFTRFIISSHPDTAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRIS  151

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A HMFSPRRIA     R+ I  +M+  +   MG  G VEVR V+  GSL NV++SVFG  
Sbjct  152   ATHMFSPRRIAAQGVFRARIGAQMVRDIVGLMGRDGVVEVRKVLHFGSLNNVMKSVFGRS  211

Query  696   L----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                  G  G EL  +V EGY L+G FNW D+FPL   LD  G ++ C  L  RVN  VG+
Sbjct  212   YVFGEGGDGCELEGLVSEGYHLLGVFNWSDHFPLLGWLDLQGVRKSCRSLVDRVNVYVGK  271

Query  864   II--EKRKRQFEGIE---INVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
             II   + KR  +G +   I+ +++ DF+ VLL L KE++L  +D+VAVLWEMIFRGTDTV
Sbjct  272   IILEHRVKRVAQGEDNKAIDTDSSGDFVDVLLDLEKENRLNHSDMVAVLWEMIFRGTDTV  331

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             AIL+EWI+ARMVLH ++QAKAQ EID+ VG  R V D D+PNLPY++AIVKE LR+HPPG
Sbjct  332   AILLEWILARMVLHPEIQAKAQSEIDSVVGSGRSVSDDDLPNLPYVRAIVKETLRMHPPG  391

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-EEEVSIM  1385
             PLLSWARL++HD  +   F+PAGTTAMVNMWAITHD ++W +P  F+PERF+ +E+V IM
Sbjct  392   PLLSWARLSIHDTQIGNHFVPAGTTAMVNMWAITHDQEVWYEPKQFKPERFLKDEDVPIM  451

Query  1386  GSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSLEMK  1559
             GSDLRLAPFGSGRRVCPG+A+GL+TV LWLA FLQ FKW+P     VDLSECLKLS+EMK
Sbjct  452   GSDLRLAPFGSGRRVCPGKAMGLATVELWLAMFLQKFKWMPCDDSGVDLSECLKLSMEMK  511

Query  1560  KHL  1568
               L
Sbjct  512   HSL  514



>ref|XP_008389401.1| PREDICTED: cytochrome P450 78A5 [Malus domestica]
Length=522

 Score =   516 bits (1329),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 264/478 (55%), Positives = 345/478 (72%), Gaps = 9/478 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLG-FLPQMGSHAHRKLASMATSMGLNRLMA  335
             F    GG AW     ++  + + GP  +P +G F   +GS  HR LA +A S     LM+
Sbjct  37    FCFAPGGLAW-ALCKDRASRAIPGPPGYPLIGSFAVFIGSTRHRVLAKLARSFKAEALMS  95

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G +R +I+S P+TAKE+L  ++F +RPV E+A  L+F RA+GFAP G YWR LRR+A
Sbjct  96    FSVGLSRFVIASQPETAKEMLNSTAFANRPVNETAYELLFNRAMGFAPYGEYWRNLRRIA  155

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSP+RIA  E  R  +  +M+ +  + M ++G V+V+ V+  GSL NV+ +VFG C
Sbjct  156   ATHLFSPKRIAGSEAFRREVGLKMVEEXRRMMLKNGQVQVKKVLHFGSLNNVMMTVFGRC  215

Query  696   L----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                  G  G EL  +V EGYEL+G FNW ++FP    LD  G +++C +L  +VN  VG+
Sbjct  216   YEFDKGGDGLELEKLVTEGYELLGLFNWSNHFPFLSWLDLQGVRKRCRKLVSKVNGFVGK  275

Query  864   IIEK-RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             IIE+ R  + +G  +      DF+ VLL L ++D+L+D+D++AVLWEMIFRGTDTVAIL+
Sbjct  276   IIEEHRLERVKGGSVENERVGDFVDVLLDLEEDDKLSDSDMIAVLWEMIFRGTDTVAILL  335

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EWI+ARMVLH ++Q+KAQ EI+  VG +R VQ SDI NLPYLQAIVKE LR+HPPGPLLS
Sbjct  336   EWILARMVLHPEIQSKAQSEIEAVVGSTRTVQGSDIANLPYLQAIVKECLRVHPPGPLLS  395

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WAR+A+HDVYV   F+PAGT+AMVNMWAITHD K+W +P  F PERFM E+VSIMG+DLR
Sbjct  396   WARIAIHDVYVGDNFVPAGTSAMVNMWAITHDAKVWTEPEKFSPERFMAEDVSIMGTDLR  455

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKHL  1568
             LAPFGSGRRVCPG+ALGL+TV LWLA+ LQ+F W+   +  VDLSECLKLS+EMK  L
Sbjct  456   LAPFGSGRRVCPGKALGLATVQLWLAQLLQNFNWIGSXNGDVDLSECLKLSMEMKSPL  513



>ref|XP_008240112.1| PREDICTED: cytochrome P450 78A5 [Prunus mume]
Length=530

 Score =   516 bits (1329),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 282/489 (58%), Positives = 348/489 (71%), Gaps = 23/489 (5%)
 Frame = +3

Query  159   FWVVEGGFAWR-NYSNNQNPKK--LNGPMSWPFLGF-LPQMGSHAHRKLASMATSMGLNR  326
             FW+  GG AW  + S  Q+P K  + GP   P LG  L   GS  HR LA +A +     
Sbjct  36    FWLSPGGLAWALSKSRAQHPSKTAIPGPSGLPVLGLVLAFTGSLTHRVLARLAETSKAKP  95

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LMAFS+G TR +ISSHPDTAKE+L  S+F DRP+KESA  L+F +A+GFAP G YWR LR
Sbjct  96    LMAFSVGFTRFVISSHPDTAKELLNSSAFADRPIKESAYELLFHKAMGFAPFGEYWRNLR  155

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVF  686
             R++A H+FSP+RIA     R  I  +M+ +M   M  +G VEVR V+  GSL NV+ SVF
Sbjct  156   RISATHLFSPKRIASFGLFRENIGHKMVEEMKALMERAGEVEVRKVLHFGSLNNVMMSVF  215

Query  687   GSCLGL--------QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGR  842
             G             +  EL  +V EGYEL+G FNW D+FPL  LLD  G +++C +L  +
Sbjct  216   GRSYEFGEGCENDGEAHELEELVSEGYELLGIFNWSDHFPLLGLLDLQGVRKRCKKLVAK  275

Query  843   VNDLVGQIIEK-RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGT  1019
             VN  VG+IIE+ R ++  G +   + + DF+ VLL L +E++L+D+D++AVLWEMIFRGT
Sbjct  276   VNVFVGKIIEEHRVKRVAGAD---HESGDFVDVLLDL-EENRLSDSDMIAVLWEMIFRGT  331

Query  1020  DTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGP-SRHVQDSDIPNLPYLQAIVKEVLRL  1196
             DTVAIL+EWI+ARMVLH D+QAKAQ EIDT VG  +R V DSD+PNLPYL AIVKE LR 
Sbjct  332   DTVAILLEWILARMVLHPDIQAKAQSEIDTVVGTGNRSVSDSDLPNLPYLHAIVKETLRT  391

Query  1197  HPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-EEE  1373
             HPPGPLLSWARLA+HD ++   FIPAGTTAMVNM+AITHD KIW+DP  F+PERF+  E+
Sbjct  392   HPPGPLLSWARLAIHDTHLGHHFIPAGTTAMVNMFAITHDEKIWSDPNEFKPERFIVNED  451

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP----GPSVDLSECLK  1541
             V IMGSDLRLAPFGSGRR CPG+A+GL+TV LWLA+ LQ FKW+P       VDLSE LK
Sbjct  452   VPIMGSDLRLAPFGSGRRTCPGKAMGLATVELWLAQLLQSFKWVPCDDQSAGVDLSETLK  511

Query  1542  LSLEMKKHL  1568
             LSLEMK  L
Sbjct  512   LSLEMKHSL  520



>gb|KDO65681.1| hypothetical protein CISIN_1g036575mg [Citrus sinensis]
Length=528

 Score =   516 bits (1328),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 273/492 (55%), Positives = 344/492 (70%), Gaps = 24/492 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSN---NQNPKKLNGPMSWPFLGF-LPQMGSHAHRKLASMATSMGLNR  326
             F++  GG AW  Y +    Q    + GP   P LG  L   GS  HR LA +A S     
Sbjct  28    FFLAPGGLAWALYKSRFSTQTRTAIPGPSGLPILGMVLAFTGSLTHRVLAKLAVSFRAKP  87

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LMAFS+G TR +ISSHPDTAKEIL  S+F DRPVKESA  L+F RAIGFAP G YWR LR
Sbjct  88    LMAFSVGFTRFVISSHPDTAKEILNSSAFADRPVKESAYELLFHRAIGFAPFGEYWRNLR  147

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVF  686
             R++  H+FSP+R++ L   R  +  +M+ ++   M ++G VEVR V+  GSL +V+ SVF
Sbjct  148   RISGTHLFSPKRMSVLGKFRETVGLKMVKEIRVLMEKNGAVEVRKVLHFGSLNSVMMSVF  207

Query  687   GSCLGLQ----------GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLA  836
             G                  EL  +V+EGYEL+G FNW D+FP+    D  G +++C +L 
Sbjct  208   GRSYEFGEKCNYHDDDGSHELEGLVREGYELLGTFNWSDHFPVLSWFDLQGVRKRCRKLV  267

Query  837   GRVNDLVGQIIEKRKRQFEGIEINVN------NNTDFLSVLLSLPKEDQLADADLVAVLW  998
             G+VN  V +IIE+ K   + I  N+N      +  DF+ VLL L  E++L D+D++AVLW
Sbjct  268   GKVNSFVSKIIEEHK--VKRINKNINGGCCDVDEGDFVDVLLGLDGENRLTDSDMIAVLW  325

Query  999   EMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIV  1178
             EMIFRGTDTVAIL+EWI+ARMVLH D+QAKAQ+EID  VG +R V D+D+PNLPYL AIV
Sbjct  326   EMIFRGTDTVAILLEWILARMVLHPDIQAKAQIEIDNTVGTARLVSDADLPNLPYLHAIV  385

Query  1179  KEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPER  1358
             KE LR+HPPGPLLSWARLA+HD  V +  +PAGTTAMVNMW+ITHD ++W +   F+PER
Sbjct  386   KETLRMHPPGPLLSWARLAIHDTQVGQHLVPAGTTAMVNMWSITHDEEVWPEANEFKPER  445

Query  1359  FMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSE  1532
             F+ E+V+IMGS+LRLAPFGSGRRVCPG+ALGL+TV LWLA+ LQ FKW+P  +  VDLSE
Sbjct  446   FLYEDVNIMGSNLRLAPFGSGRRVCPGKALGLATVELWLAQLLQSFKWVPSDAGGVDLSE  505

Query  1533  CLKLSLEMKKHL  1568
             CLKLSLEMK  L
Sbjct  506   CLKLSLEMKNSL  517



>ref|XP_011087366.1| PREDICTED: cytochrome P450 78A5 [Sesamum indicum]
Length=548

 Score =   516 bits (1329),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 276/488 (57%), Positives = 349/488 (72%), Gaps = 18/488 (4%)
 Frame = +3

Query  159   FWVVEGGFAW---RNYSNNQNPKKLNGPMSWPFLGF-LPQMGSHAHRKLASMATSMGLNR  326
             FW+  GG AW   +  +  +  + + GP   P LG  L    S  HR L+ ++ S     
Sbjct  37    FWLRPGGLAWALSKAQAQARPGEAIPGPSGLPLLGMALSFTSSLTHRLLSRLSESFKAES  96

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LMAFS+G TR IISS+P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LR
Sbjct  97    LMAFSVGFTRFIISSNPETAKEILNSSAFADRPVKESAYGLLFHRAMGFAPYGEYWRNLR  156

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVF  686
             R++A H+FSP+RIA     R  I  +M+ ++  +M ++  VEV+ V   GSL NV+ SVF
Sbjct  157   RISATHLFSPKRIASFGDFRREIGVKMVEEIMLKMEKNCEVEVKNVFHYGSLNNVMMSVF  216

Query  687   GSCL------GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             G C       G  G EL  +VKEGYEL+G FNW D+FPL   LD  G +R+  +L  +VN
Sbjct  217   GKCYDFNGGNGDDGLELEGLVKEGYELLGIFNWSDHFPLLGWLDLQGVRRRSKKLVAKVN  276

Query  849   DLVGQIIE-KRKRQFEGIEINV---NNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRG  1016
               VG IIE KR ++ E   + V    ++ DF+ VLL L  E++L+D+D++AVLWEMIFRG
Sbjct  277   AFVGTIIEEKRLKRAENGHLEVAGDQHSHDFVDVLLDLENENRLSDSDMIAVLWEMIFRG  336

Query  1017  TDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKEVLR  1193
             TDTVAIL+EWI+ARM+LH ++QAKAQ EID+ +G + R V DSD+PNLPYLQAIVKE LR
Sbjct  337   TDTVAILLEWILARMILHPEIQAKAQDEIDSVIGTNNRPVSDSDLPNLPYLQAIVKESLR  396

Query  1194  LHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEE  1373
             +HPPGPLLSWARLA+HD  V   F+PAGTTAMVNMWAITHD K+W +P  FRPERF+E++
Sbjct  397   MHPPGPLLSWARLAIHDTCVGPYFVPAGTTAMVNMWAITHDGKVWPEPGKFRPERFLEDD  456

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP---GPSVDLSECLKL  1544
             V+IMGSDLRLAPFGSGRRVCPG+A+GL+TV LWLA+ L +FKW       +VDLSECLKL
Sbjct  457   VAIMGSDLRLAPFGSGRRVCPGKAMGLATVQLWLAQLLHNFKWTASHNNHAVDLSECLKL  516

Query  1545  SLEMKKHL  1568
             S+EMK+ L
Sbjct  517   SMEMKQPL  524



>ref|XP_008352954.1| PREDICTED: cytochrome P450 78A5-like [Malus domestica]
Length=522

 Score =   515 bits (1327),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 267/478 (56%), Positives = 343/478 (72%), Gaps = 9/478 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
             F +  GGFAW      +  + + GP  +PF+G L    G   HR LA +A S     LM+
Sbjct  37    FCLAPGGFAW-ALCKVRAFRAIPGPTGYPFIGSLTVFTGLTRHRVLAKLAKSFKAESLMS  95

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR +I+SHP+TAKE+L  ++F +RPV E+A  L+F RA GFAP G YWR LRR++
Sbjct  96    FSVGLTRFVIASHPETAKEMLNSTAFANRPVNETAYELLFHRAXGFAPYGEYWRNLRRIS  155

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSP+RIA  E  R  +  +M+ ++ + M E+G V+V+ V+  GSL NV+ +VFG C
Sbjct  156   ATHLFSPKRIAGSEVFRREVGMKMVEELKRLMTENGEVQVKKVLHFGSLNNVMMTVFGRC  215

Query  696   L----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                  G  G EL  +V EGYEL+G FNW ++FP    LD  G +++C  L  +VN  VG+
Sbjct  216   YEFDKGGDGLELESLVTEGYELLGVFNWSNHFPFLGWLDLQGVRKRCRNLVLKVNVFVGK  275

Query  864   IIEKRK-RQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             IIE+    + +G +       DF+ VLL L ++D+L+D+D++AVLWEMIFRGTDTVAIL+
Sbjct  276   IIEEHXLERAKGDDFEKEKVGDFVDVLLDLEEDDKLSDSDMIAVLWEMIFRGTDTVAILL  335

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EWI+ARMVLH ++Q KAQ EID  VG +R VQ SDIPNLPYLQAIVKE LR+ PPGPLLS
Sbjct  336   EWILARMVLHPEIQTKAQSEIDAVVGSTRTVQGSDIPNLPYLQAIVKECLRVXPPGPLLS  395

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WAR+A+HDVYV   F+PAGT+AMVNMWAITHD K+W +P  F PERFM E+VSIMG+DLR
Sbjct  396   WARIAIHDVYVGDNFVPAGTSAMVNMWAITHDEKVWTEPEKFSPERFMAEDVSIMGTDLR  455

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKHL  1568
             LAPFGSGRRVCPG+ALGL+TV LWLA+ LQ+F W+   +  VDLSECLKLS+EMK  L
Sbjct  456   LAPFGSGRRVCPGKALGLATVQLWLAQLLQNFXWVASENCDVDLSECLKLSMEMKSPL  513



>ref|XP_007155212.1| hypothetical protein PHAVU_003G183100g [Phaseolus vulgaris]
 gb|ESW27206.1| hypothetical protein PHAVU_003G183100g [Phaseolus vulgaris]
Length=540

 Score =   516 bits (1328),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 275/485 (57%), Positives = 341/485 (70%), Gaps = 15/485 (3%)
 Frame = +3

Query  159   FWVVEGGFAW-----RNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGL  320
             +W+V GG AW     R   +  N   + GP  +P +G +    G   HR LA +A +   
Sbjct  36    YWLVPGGLAWALSKFRQGKSLANKPAIPGPSGFPVVGLVSAFTGPLTHRVLAKLAHTFDA  95

Query  321   NRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQ  500
               LMAFSLG T  IISSHPDTAKE+L  S+F DRP+KESA  L+F RA+GFAP G YWR 
Sbjct  96    KPLMAFSLGFTPFIISSHPDTAKEMLSSSAFADRPIKESAYELLFHRAMGFAPYGEYWRS  155

Query  501   LRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVES  680
             LRR++A HMFSP+RIA     R+ +  +M+  +   M   G VEVR V+  GSL NV+ S
Sbjct  156   LRRISATHMFSPKRIAASGKFRTEVGAQMVKDIMDLMRRDGEVEVRKVLHFGSLNNVMMS  215

Query  681   VFGSCL----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             VFG       G  G EL  +V EGYEL+G FNW D+FPL   LD  G +++C  L  RVN
Sbjct  216   VFGKSYVFGEGGDGCELEELVSEGYELLGVFNWSDHFPLLGRLDLQGVRKRCRSLVDRVN  275

Query  849   DLVGQII-EKRKRQFEGIEINVNNNT---DFLSVLLSLPKEDQLADADLVAVLWEMIFRG  1016
               VG+II E R+++    E  V +N    DF+ VLL L KE++L  +D+VAVLWEMIFRG
Sbjct  276   VFVGKIIVEHREKRAAVGEDKVKDNESSGDFVDVLLDLEKENKLEHSDMVAVLWEMIFRG  335

Query  1017  TDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRL  1196
             TDTVAIL+EWI+ARMVLH ++QAKAQ EID+ VG  R V D D+ NLPY+++IVKE LR+
Sbjct  336   TDTVAILLEWILARMVLHPEIQAKAQSEIDSVVGCRRSVSDKDLLNLPYVRSIVKETLRM  395

Query  1197  HPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEV  1376
             HPPGPLLSWARL++HD  +   F+PAGTTAMVNMWAITHD ++W+DP  F+PERF +EEV
Sbjct  396   HPPGPLLSWARLSIHDTQIGNHFVPAGTTAMVNMWAITHDKEVWSDPEEFKPERFEKEEV  455

Query  1377  SIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLE  1553
              IMGSDLRLAPFGSGRRVCPG+A+GL+TV LWLA FLQ  KW+P  S VDLSECL+LS++
Sbjct  456   QIMGSDLRLAPFGSGRRVCPGKAMGLATVELWLAMFLQQLKWIPSDSGVDLSECLQLSMK  515

Query  1554  MKKHL  1568
             MK  L
Sbjct  516   MKCSL  520



>ref|XP_004979279.1| PREDICTED: cytochrome P450 78A4-like [Setaria italica]
Length=529

 Score =   514 bits (1324),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 262/468 (56%), Positives = 335/468 (72%), Gaps = 17/468 (4%)
 Frame = +3

Query  189   RNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMAFSLGTTRMII  365
             R+ +N      + GP  WP +G LP + G   HR+LAS+A + G  RLM+ +LG T ++I
Sbjct  60    RSRNNGAAAAAIPGPRGWPLVGSLPAVSGPLMHRRLASLADTHGARRLMSLTLGATPVVI  119

Query  366   SSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMFSPRRI  545
             SSHPDTA+EIL G++F DRP K +A+ LMF RAIGFAP+G YWR+LRR A   M SPRR+
Sbjct  120   SSHPDTAREILSGAAFVDRPPKAAARELMFTRAIGFAPAGEYWRRLRRAAGAGMLSPRRL  179

Query  546   ACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQG----E  713
             A LEG+RS +A+ M  ++   MG SG V +R ++ + SL    ES+ GS LGL+G    E
Sbjct  180   AALEGLRSRVADGMTARVAGAMGRSGEVAMRALLQKASL----ESMAGSVLGLEGGALSE  235

Query  714   ELGLMVKEGYELIGEFNWGDYFPL---GFLLDFGGTKRKCHRLAGRVNDLVGQIIEKRKR  884
             ELG MV+EGYEL+G FN GD++     G L+D  G    C  LA RV    G++IE+R+ 
Sbjct  236   ELGEMVREGYELVGTFNLGDHYYTTLWGPLMDLWGVGPACRGLAARVRGYFGKVIEERR-  294

Query  885   QFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARMV  1064
                 +  + ++  D LS +LSLP++++L D+D++AVLWEM+FRG D VAIL+EW MAR+ 
Sbjct  295   ----VARDCHDRDDLLSYMLSLPEDERLEDSDVIAVLWEMVFRGVDVVAILLEWTMARVA  350

Query  1065  LHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHD  1244
             LH D+Q+KA  EID  VG  R + D+DIPNL +LQ IVKE LR+HPPGPLLSWARLAVHD
Sbjct  351   LHPDIQSKAHEEIDAVVGVHRPITDADIPNLHFLQCIVKETLRMHPPGPLLSWARLAVHD  410

Query  1245  VYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFGSGR  1424
               V K  +PAGTTAMVNMWAI+HD  IW DPW FRPERF  E+VS++GSDLRLAPFGSGR
Sbjct  411   ARVGKYVVPAGTTAMVNMWAISHDEAIWGDPWAFRPERFRVEDVSVLGSDLRLAPFGSGR  470

Query  1425  RVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             RVCPGR +GLSTV LWL R LQ ++W P   V L+ECL+LS+EMK+ L
Sbjct  471   RVCPGRMMGLSTVQLWLGRLLQEYEWSPAKPVKLAECLRLSMEMKQPL  518



>ref|XP_002265310.1| PREDICTED: cytochrome P450 78A5 [Vitis vinifera]
Length=525

 Score =   513 bits (1321),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 275/482 (57%), Positives = 343/482 (71%), Gaps = 13/482 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
             FW+V GG AW   S  +    + GP   P +G +    GS  HR LA +A       LMA
Sbjct  36    FWLVPGGLAW-AMSKAKARSAIPGPSGLPLIGLVFAFTGSLTHRVLAKLARVSEAAPLMA  94

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR IISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++
Sbjct  95    FSVGFTRFIISSQPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPFGVYWRNLRRIS  154

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSPRRIA     R  I  +M+ ++   M + G V+V+ V+  GSL NV+ SVFG  
Sbjct  155   ATHLFSPRRIAGFGEFRRTIGLKMVDEIRVLMEKKGEVKVKKVLHFGSLNNVMMSVFGRS  214

Query  696   L----GLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLV  857
                  G+ G+  EL  +V EGYEL+G FNW D+ PL   LD  G +++C +L  +VN  V
Sbjct  215   YDFGKGVSGDAVELESLVSEGYELLGIFNWSDHLPLLGWLDLQGVRKRCKKLVSKVNVFV  274

Query  858   GQII-EKRKRQFEGIEINVNNNT---DFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDT  1025
              +II E R R+    E+  + +    DF+ VLL L KE +L+D+D++AVLWEMIFRGTDT
Sbjct  275   SRIIDEHRLRRVGDGEVGRDGDDSSGDFVDVLLDLEKESRLSDSDMIAVLWEMIFRGTDT  334

Query  1026  VAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             VAIL+EWI+ARMVLH D+Q+KAQ EID  VG +R V DSDI  LPYL AIVKE LR+HPP
Sbjct  335   VAILLEWILARMVLHPDIQSKAQSEIDAVVGATRLVSDSDIHKLPYLHAIVKETLRMHPP  394

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIM  1385
             GPLLSWARL++HD ++   FIPAGTTAMVNMWAITHD  +W++P  F+P RFMEE+VSI+
Sbjct  395   GPLLSWARLSIHDTHIGSHFIPAGTTAMVNMWAITHDDAVWDEPKEFKPSRFMEEDVSIL  454

Query  1386  GSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMKK  1562
             GSDLRLAPFGSGRRVCPG+A+GL+TV LWLA+ LQ+FKW+   S VDLSECLKLS+EMK+
Sbjct  455   GSDLRLAPFGSGRRVCPGKAMGLATVQLWLAQLLQNFKWVACDSGVDLSECLKLSMEMKQ  514

Query  1563  HL  1568
              L
Sbjct  515   SL  516



>ref|XP_004299287.1| PREDICTED: cytochrome P450 78A3-like [Fragaria vesca subsp. vesca]
Length=528

 Score =   513 bits (1321),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 275/483 (57%), Positives = 345/483 (71%), Gaps = 14/483 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGF-LPQMGSHAHRKLASMATSMGLNRLMA  335
             FW+  GG AW   S  +    + GP   P LG  L   GS  HR LA +A S     LMA
Sbjct  36    FWLSPGGLAW-ALSKPKPRSAIPGPSGLPLLGLVLAFTGSLTHRVLAKLAESSRAKSLMA  94

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G T  +ISS PDTAKE+L  S+F DRP+KESA  L+F +A+GFAP G YWR LRR++
Sbjct  95    FSVGFTPFVISSQPDTAKELLNSSAFADRPIKESAYELLFHKAMGFAPFGEYWRGLRRIS  154

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             + H+FSP+RI    G R  I  +M+ +M   M ++  VEVR V+  GSL NV+ SVFG  
Sbjct  155   STHLFSPKRITYFGGFREEIGRKMVEEMRVLMLKNDEVEVRKVLHFGSLNNVMMSVFGRS  214

Query  696   LGL----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                    +G  L  +V EGYEL+G FNW D+FPL  LLD  G +++C +L G+VND VG+
Sbjct  215   YEFGEVGEGRVLEELVSEGYELLGLFNWSDHFPLFSLLDLQGVRKRCTKLVGKVNDFVGR  274

Query  864   IIEK---RKRQFEGIEINVNNNT-DFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVA  1031
             II++   ++ +  G+    + +T DF+ VLL L KE++L+D+D++AVLWEMIFRGTDTVA
Sbjct  275   IIKEHRVKRTESNGVLGGASESTGDFVDVLLDLEKENRLSDSDMIAVLWEMIFRGTDTVA  334

Query  1032  ILVEWIMARMVLHQDVQAKAQLEIDTCVG-PSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             IL+EWI+ARMVLH ++QAKAQ EIDT +G P+R V DSD+PNLPYL+AIVKE LR+HPPG
Sbjct  335   ILLEWILARMVLHPEIQAKAQSEIDTAIGSPTRSVTDSDLPNLPYLRAIVKETLRMHPPG  394

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEE--VSI  1382
             PLLSWARLA+HD ++   F+PAGTTAMVNM+AITHD  +W     F+PERFM E+  VSI
Sbjct  395   PLLSWARLAIHDTHIGHHFVPAGTTAMVNMFAITHDEGVWPRANEFKPERFMNEDDSVSI  454

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMK  1559
             MGSDLRLAPFGSGRRVCPG+ALGL++V LWLA  LQ F+WLP    VDLSE LKLSLEMK
Sbjct  455   MGSDLRLAPFGSGRRVCPGKALGLASVELWLAVLLQSFEWLPSDDGVDLSENLKLSLEMK  514

Query  1560  KHL  1568
               L
Sbjct  515   NSL  517



>emb|CAN80496.1| hypothetical protein VITISV_000124 [Vitis vinifera]
Length=525

 Score =   512 bits (1318),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 274/482 (57%), Positives = 341/482 (71%), Gaps = 13/482 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
             FW+V GG AW   S  +    + GP   P  G +    GS  HR LA +A       LMA
Sbjct  36    FWLVPGGLAW-AMSKAKARSAIPGPSGLPLJGLVFAFTGSLTHRVLAKLARVSEAAPLMA  94

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR IISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++
Sbjct  95    FSVGFTRFIISSQPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPFGVYWRNLRRIS  154

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSPRRIA     R  I  +M+ ++   M + G V+V+ V+  GSL NV+ SVFG  
Sbjct  155   ATHLFSPRRIAGFGEFRRTIGLKMVDEIRVLMEKKGEVKVKKVLHFGSLNNVMMSVFGRS  214

Query  696   L----GLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLV  857
                  G+ G+  EL  +V EGYEL+G FNW D+ PL   LD  G +++C +L  +VN  V
Sbjct  215   YDFGXGVSGDAVELESLVSEGYELLGIFNWSDHLPLLGWLDLQGVRKRCKKLVSKVNVFV  274

Query  858   GQII-EKRKRQFEGIEINVNNNT---DFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDT  1025
              +II E R R+    E+  + +    DF+ VLL L KE +L+D+D++AVLWEMIFRGTDT
Sbjct  275   SRIIDEHRLRRVGDGEVGRDGDDSSGDFVDVLLDLEKESRLSDSDMIAVLWEMIFRGTDT  334

Query  1026  VAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             VAIL+EWI+ARMVLH D+Q+KAQ EID  VG +R V DSDI  LPYL AIVKE LR+HPP
Sbjct  335   VAILLEWILARMVLHPDIQSKAQSEIDAVVGATRLVSDSDIXKLPYLHAIVKETLRMHPP  394

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIM  1385
             GPLLSWARL++HD ++   FIPAGTTAMVNMWAITHD  +W++P  F+P RF EE+VSI+
Sbjct  395   GPLLSWARLSIHDTHIGSHFIPAGTTAMVNMWAITHDDAVWDEPXEFKPSRFXEEDVSIL  454

Query  1386  GSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMKK  1562
             GSDLRLAPFGSGRRVCPG+A+GL+TV LWLA+ LQ+FKW+   S VDLSECLKLS+EMK+
Sbjct  455   GSDLRLAPFGSGRRVCPGKAMGLATVQLWLAQLLQNFKWVACDSGVDLSECLKLSMEMKQ  514

Query  1563  HL  1568
              L
Sbjct  515   SL  516



>gb|KHN15204.1| Cytochrome P450 78A3 [Glycine soja]
Length=503

 Score =   511 bits (1316),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 274/484 (57%), Positives = 348/484 (72%), Gaps = 17/484 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFL-PQMGSHAHRKLASMATSMGLNRLMA  335
             +W+V GG AW   + ++    + GP  +P +G +   +G   HR LA +A +     LMA
Sbjct  9     YWLVPGGLAW---ALSKFKPAIPGPCGYPVVGLVWAFIGPLTHRVLAKLAETFDAKPLMA  65

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR IISSHPDTAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++
Sbjct  66    FSVGFTRFIISSHPDTAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRIS  125

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A HMFSP+RIA     R+ +  +M+ ++   MG++  VEVR V+  GSL NV++SVFG  
Sbjct  126   ATHMFSPKRIAAQGVFRARVGAQMVREIVGLMGKNDVVEVRKVLHFGSLNNVMKSVFGRS  185

Query  696   L----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                  G  G EL  +V EGY+L+G FNW D+FPL   LDF G +++C  L  RVN  VG+
Sbjct  186   YVFGEGGDGCELEELVSEGYDLLGLFNWSDHFPLLGWLDFQGVRKRCRSLVDRVNVFVGK  245

Query  864   II-EKRKRQFEGIEINV-----NNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDT  1025
             II E R ++    E N      N+  DF+ VLL L KED+L  +D+VAVLWEMIFRGTDT
Sbjct  246   IIMEHRVKRDAESEDNKARDIDNSGGDFVDVLLDLEKEDRLNHSDMVAVLWEMIFRGTDT  305

Query  1026  VAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             VAIL+EWI+ARMVLH ++QAKAQ EID+ VG    V D D+PNLPY++AIVKE LR+HPP
Sbjct  306   VAILLEWILARMVLHPEIQAKAQCEIDSVVGSGCSVTDDDLPNLPYVRAIVKETLRMHPP  365

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-EEEVSI  1382
             GPLLSWARL++H+  +   F+PAGTTAMVN+WAITHD ++W++P  F+PERF+ +E+V I
Sbjct  366   GPLLSWARLSIHETQIGNHFVPAGTTAMVNLWAITHDQQVWSEPEQFKPERFLKDEDVPI  425

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSLEM  1556
             MGSDLRLAPFG+GRRVCPG+A+GL+TV LWLA FLQ FKW+P     VDLSECLKLS+EM
Sbjct  426   MGSDLRLAPFGAGRRVCPGKAMGLATVELWLAVFLQKFKWMPCDDSGVDLSECLKLSMEM  485

Query  1557  KKHL  1568
             K  L
Sbjct  486   KHSL  489



>ref|XP_010939200.1| PREDICTED: cytochrome P450 78A5-like [Elaeis guineensis]
Length=510

 Score =   511 bits (1316),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 273/477 (57%), Positives = 343/477 (72%), Gaps = 13/477 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAF  338
              W   GG AW   + ++  + + GP   P +  L   G+  HR LA +A S+    LMAF
Sbjct  34    LWFYPGGLAW---ALSRAQRSIPGP---PGI-VLALSGTAGHRALAGLARSLQAIPLMAF  86

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S+G TR ++SSHP+TA+EIL  S+F DRP+KESA  L+F RA+GFAP G YWR LRR++A
Sbjct  87    SVGFTRFVVSSHPETAREILYSSAFADRPIKESAYELLFHRAMGFAPFGEYWRNLRRISA  146

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
             N++FSP+RI+     R AI E M+G++ + MG  G VE++ V+  GSL N++ SVFG   
Sbjct  147   NYLFSPKRISACGEQRRAIGERMVGEVKELMGRYGEVELKRVLHFGSLNNIMMSVFGKRF  206

Query  699   GL---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                  +G EL  +V+EGYEL+G FNW D+ PL   LD  G +++C  L  RVN  VG II
Sbjct  207   DFVKGEGVELEELVREGYELLGVFNWSDHLPLLGWLDLQGVRKRCRGLVRRVNVFVGNII  266

Query  870   EKRKRQFEGIEINVNNNT-DFLSVLLSLPKE-DQLADADLVAVLWEMIFRGTDTVAILVE  1043
             E+ +++ E     V +   +F+ VLL L +E ++L+DAD VAVLWEMIFRGTDTVAIL+E
Sbjct  267   EEHRKRREKFGRTVEDGVGNFVDVLLDLQEEGEKLSDADKVAVLWEMIFRGTDTVAILLE  326

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  1223
             WIMARMVLH D+Q+KAQ EID  VG S  V DSDIP LPYL +IVKE LR+HPPGPLLSW
Sbjct  327   WIMARMVLHPDIQSKAQAEIDAVVGNSGIVSDSDIPKLPYLHSIVKESLRMHPPGPLLSW  386

Query  1224  ARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRL  1403
             ARLA+HDV +   FIPAGTTAMVNMWAITHD  IW++P  F+PERFM E+VSI+GSDLRL
Sbjct  387   ARLAIHDVNIGNHFIPAGTTAMVNMWAITHDESIWSEPCEFKPERFMAEDVSIVGSDLRL  446

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKKHLA  1571
             APFGSGRRVCPG+A+ L+TVHLWLA+ L  FKW+P    VDLSECLK+SLEMK  L 
Sbjct  447   APFGSGRRVCPGKAMALATVHLWLAQLLHRFKWVPSEGGVDLSECLKMSLEMKNPLG  503



>ref|XP_006440793.1| hypothetical protein CICLE_v10023859mg [Citrus clementina]
 gb|ESR54033.1| hypothetical protein CICLE_v10023859mg [Citrus clementina]
Length=525

 Score =   511 bits (1316),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 271/493 (55%), Positives = 343/493 (70%), Gaps = 24/493 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSN---NQNPKKLNGPMSWPFLGF-LPQMGSHAHRKLASMATSMGLNR  326
             F++  GG AW  Y +    Q    + GP   P LG  L   GS  HR LA +A S     
Sbjct  25    FFLAPGGLAWALYKSRFSTQTRTAIPGPSGLPILGMVLAFTGSLTHRVLAKLAVSFRAKP  84

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LMAFS+G TR +ISSHPDTAKEIL  S+F DRPVKESA  L+F RAIGFAP G YWR LR
Sbjct  85    LMAFSVGFTRFVISSHPDTAKEILNSSAFADRPVKESAYELLFHRAIGFAPFGEYWRNLR  144

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVF  686
             R++  H+FSP+R++ L   R  +  +M+ ++   M ++G VEVR V+  GSL +V+ SVF
Sbjct  145   RISGTHLFSPKRMSVLGKFRETVGLKMVKEIRVLMEKNGAVEVRKVLHFGSLNSVMMSVF  204

Query  687   GSCLGLQ----------GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLA  836
             G                  EL  +V+EGY L+G FNW D+FP+    D  G +++C +L 
Sbjct  205   GRSYEFGEKCNYHDDDGSHELEGLVREGYVLLGTFNWSDHFPVLSWFDLQGVRKRCRKLV  264

Query  837   GRVNDLVGQIIEKRKRQFEGIEINVN------NNTDFLSVLLSLPKEDQLADADLVAVLW  998
             G+VN  V +IIE+ K   + I  N+N      +  DF+ VLL L  E++L D+D++AVLW
Sbjct  265   GKVNSFVSKIIEEHK--VKRINKNINGGCCDVDEGDFVDVLLGLDGENRLTDSDMIAVLW  322

Query  999   EMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIV  1178
             EMIFRGTDTVAIL+EWI+ARMVLH D+QAKAQ+EID  VG +R V D+D+PNLPYL AIV
Sbjct  323   EMIFRGTDTVAILLEWILARMVLHPDIQAKAQIEIDNTVGTARLVSDADLPNLPYLHAIV  382

Query  1179  KEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPER  1358
             KE LR+HPPGPLLSWARLA+HD  V +  +PAGTTAMVNMW+ITHD ++W +   F+PER
Sbjct  383   KETLRMHPPGPLLSWARLAIHDTQVGQHLVPAGTTAMVNMWSITHDEEVWPEANEFKPER  442

Query  1359  FMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSE  1532
             F+ E+++IMGS+LRLAPFGSGRRVCPG+ALGL+TV LWLA+ LQ FKW+P  +  VDLSE
Sbjct  443   FLYEDLNIMGSNLRLAPFGSGRRVCPGKALGLATVELWLAQLLQSFKWVPSDAGGVDLSE  502

Query  1533  CLKLSLEMKKHLA  1571
             CLKLSLEMK  L 
Sbjct  503   CLKLSLEMKNSLV  515



>ref|XP_003614135.1| Cytochrome P450 78A11 [Medicago truncatula]
 gb|AES97093.1| cytochrome P450 family protein [Medicago truncatula]
Length=520

 Score =   511 bits (1315),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 275/475 (58%), Positives = 336/475 (71%), Gaps = 15/475 (3%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKK--LNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSLG  347
             GGFAW  Y+   +  K  + GP      G L   G   HR LA +A S     LMAFS+G
Sbjct  43    GGFAWALYNKASSSAKSVIPGPSFSGLFGILS--GQTPHRVLAKLAKSHRAESLMAFSVG  100

Query  348   TTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHM  527
              TR IISS P+TAKEILC S+F DRPVKESA  L+F RA+GFAP G YWR LRR+++ H+
Sbjct  101   LTRFIISSEPETAKEILCSSAFGDRPVKESAYELLFHRAMGFAPYGEYWRNLRRISSTHL  160

Query  528   FSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGL-  704
             F PRRI   EG RS +  +M+ ++   MG+ G VEV+ V+  GSL NV+ +VFG C    
Sbjct  161   FCPRRINGFEGFRSEVGLKMVERIKFLMGDMGSVEVKKVLHFGSLNNVMMTVFGKCYDFF  220

Query  705   --QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE--  872
                G EL  +V EGYEL+G FNW D+FPL   LD  G K++C  L  +VN  VG+IIE  
Sbjct  221   DGDGVELEELVSEGYELLGVFNWSDHFPLLGWLDLQGVKKRCRALVTKVNTFVGKIIEEH  280

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             K KR  EG  I      DF+ VLL L ++D+L+D+D++AVLWEMIFRGTDTVAIL+EWI+
Sbjct  281   KMKRMSEGRAIV----GDFVDVLLDLEEKDKLSDSDMIAVLWEMIFRGTDTVAILLEWIL  336

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             ARMVLH ++QAKAQ EI   VG S+ + D+D+  + YLQ IVKE LR+HPPGPLLSWARL
Sbjct  337   ARMVLHPEIQAKAQEEIYRVVGNSKVITDADVQKMCYLQCIVKEALRVHPPGPLLSWARL  396

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPF  1412
             AVHDV V    IP GTTAMVNMWAITHD K+WN+P  F+PERFM E+VSIMGSDLRLAPF
Sbjct  397   AVHDVMVGDKHIPKGTTAMVNMWAITHDEKVWNEPEEFKPERFMNEDVSIMGSDLRLAPF  456

Query  1413  GSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKHLA  1571
             G+GRRVCPG+A+GL++VHLW A+ L +FKW+      VDL ECLKLS+EMKK L 
Sbjct  457   GAGRRVCPGKAMGLASVHLWFAQLLHNFKWVSCDDSLVDLDECLKLSMEMKKPLV  511



>ref|XP_006579491.1| PREDICTED: cytochrome P450 78A5-like [Glycine max]
Length=529

 Score =   511 bits (1316),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 274/484 (57%), Positives = 348/484 (72%), Gaps = 17/484 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFL-PQMGSHAHRKLASMATSMGLNRLMA  335
             +W+V GG AW   + ++    + GP  +P +G +   +G   HR LA +A +     LMA
Sbjct  35    YWLVPGGLAW---ALSKFKPAIPGPCGYPVVGLVWAFIGPLTHRVLAKLAETFDAKPLMA  91

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR IISSHPDTAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++
Sbjct  92    FSVGFTRFIISSHPDTAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRIS  151

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A HMFSP+RIA     R+ +  +M+ ++   MG++  VEVR V+  GSL NV++SVFG  
Sbjct  152   ATHMFSPKRIAAQGVFRARVGAQMVREIVGLMGKNDVVEVRKVLHFGSLNNVMKSVFGRS  211

Query  696   L----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                  G  G EL  +V EGY+L+G FNW D+FPL   LDF G +++C  L  RVN  VG+
Sbjct  212   YVFGEGGDGCELEELVSEGYDLLGLFNWSDHFPLLGWLDFQGVRKRCRSLVDRVNVFVGK  271

Query  864   II-EKRKRQFEGIEINV-----NNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDT  1025
             II E R ++    E N      N+  DF+ VLL L KED+L  +D+VAVLWEMIFRGTDT
Sbjct  272   IIMEHRVKRDAESEDNKARDIDNSGGDFVDVLLDLEKEDRLNHSDMVAVLWEMIFRGTDT  331

Query  1026  VAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             VAIL+EWI+ARMVLH ++QAKAQ EID+ VG    V D D+PNLPY++AIVKE LR+HPP
Sbjct  332   VAILLEWILARMVLHPEIQAKAQCEIDSVVGSGCSVTDDDLPNLPYVRAIVKETLRMHPP  391

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-EEEVSI  1382
             GPLLSWARL++H+  +   F+PAGTTAMVN+WAITHD ++W++P  F+PERF+ +E+V I
Sbjct  392   GPLLSWARLSIHETQIGNHFVPAGTTAMVNLWAITHDQQVWSEPEQFKPERFLKDEDVPI  451

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSLEM  1556
             MGSDLRLAPFG+GRRVCPG+A+GL+TV LWLA FLQ FKW+P     VDLSECLKLS+EM
Sbjct  452   MGSDLRLAPFGAGRRVCPGKAMGLATVELWLAVFLQKFKWMPCDDSGVDLSECLKLSMEM  511

Query  1557  KKHL  1568
             K  L
Sbjct  512   KHSL  515



>ref|XP_006437950.1| hypothetical protein CICLE_v10031237mg [Citrus clementina]
 ref|XP_006484184.1| PREDICTED: cytochrome P450 78A5-like [Citrus sinensis]
 gb|ESR51190.1| hypothetical protein CICLE_v10031237mg [Citrus clementina]
Length=521

 Score =   510 bits (1313),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 270/479 (56%), Positives = 342/479 (71%), Gaps = 11/479 (2%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQ-MGSHAHRKLASMATSMGLNRLMAF  338
             W+  GG AW   +  + PK + GP  +P +G L   +GS  HR LA +AT+     LMAF
Sbjct  33    WLSPGGLAWAR-ARAKAPKSIAGPTGYPLIGSLTVFVGSTPHRVLAKLATAFRAVPLMAF  91

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S+G TR +ISS P+TAKEIL   +F DRPVKESA  L+F RA+GFAP G YWR LRR++A
Sbjct  92    SVGLTRFVISSEPETAKEILSSPAFADRPVKESAYELLFHRAMGFAPYGDYWRNLRRISA  151

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              H+FSPRRIA +E  R  +  +M+ ++   M  +G V+V+ V+   SL NV+ SVFG   
Sbjct  152   THLFSPRRIAGIESFRREVGLKMVEQVKSLMAGNGEVKVKKVLHFASLNNVMMSVFGKRY  211

Query  699   GLQGEELGLMVKEG---YELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                  E  L+ +     YEL+G FNW D+FPL   LD  G K++C  L  +VN  V +II
Sbjct  212   DFDESEGLLLEELVSEGYELLGVFNWSDHFPLLGWLDLQGVKKRCRILVSKVNVFVEKII  271

Query  870   -EKRKRQFEGIEINVNNNT-DFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
              E R ++  G+  +      DF+ VLL L KE +L D+D++AVLWEMIFRGTDTVAIL+E
Sbjct  272   QEHRLKRTAGVSDDHKICVGDFVDVLLDLEKEAKLNDSDMIAVLWEMIFRGTDTVAILLE  331

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  1223
             WI+ARMVLH ++Q+KAQ EI + VG SR VQDSDIP+LPYLQAIVKE LR+HPPGPLLSW
Sbjct  332   WILARMVLHPEIQSKAQAEIISVVGNSRPVQDSDIPSLPYLQAIVKETLRIHPPGPLLSW  391

Query  1224  ARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRL  1403
             ARLA  DVYV   F+PAGTTAMVNMWAITHDP++W +P  F+PERF+EE++SIMGSDLRL
Sbjct  392   ARLAARDVYVGDNFVPAGTTAMVNMWAITHDPRVWAEPEKFKPERFIEEDISIMGSDLRL  451

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWL----PGPSVDLSECLKLSLEMKKHL  1568
             APFGSGRRVCPG+A+GL+TV+LWLA+ LQ F+W+       +VDL+E LKLS+EMK  L
Sbjct  452   APFGSGRRVCPGKAMGLATVNLWLAQLLQSFEWVASDEAAANVDLTESLKLSMEMKNPL  510



>ref|XP_008374654.1| PREDICTED: cytochrome P450 78A5-like [Malus domestica]
Length=533

 Score =   510 bits (1313),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 270/489 (55%), Positives = 342/489 (70%), Gaps = 20/489 (4%)
 Frame = +3

Query  162   WVVEGGFAW---RNYSNNQNPKKLNGPMSWPFLGF-LPQMGSHAHRKLASMATSMGLNRL  329
             W+  GG AW   +      +   + GP   P LG  L   GS  HR LA +A +     L
Sbjct  35    WLSPGGLAWALSKFKGQIHSKTTIPGPSGLPLLGLVLSFTGSLTHRVLAKLAETSKAKPL  94

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFS+G TR +ISSHPDTAKE+L  ++F DRP+KESA  L+F +A+GFAP G YWR LRR
Sbjct  95    MAFSVGFTRFVISSHPDTAKELLNSTAFADRPIKESAYELLFHKAMGFAPFGEYWRNLRR  154

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +++ H+F P+RIA     R +I  +M+G+M   M  S  VEVR V+  GSL +V+ SVFG
Sbjct  155   ISSTHLFHPQRIASFGLFRESIGRKMVGEMKSFMKRSDEVEVRKVLHFGSLNSVMMSVFG  214

Query  690   ---------SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGR  842
                       C   +G EL  +V EGYEL+G FNW D+FP    LD  G +R+C +L  +
Sbjct  215   RSYEFGGELGCGNGEGLELEGLVSEGYELLGIFNWSDHFPFLGFLDLQGVRRRCKKLVAK  274

Query  843   VNDLVGQIIEK---RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFR  1013
             VN  VG+IIE+   ++ +  G+    + + DF+ VLL L KE++L+D+D++AVLWEMIFR
Sbjct  275   VNAFVGKIIEEHRVKRDENYGVLSADHESGDFVDVLLDLEKENKLSDSDMIAVLWEMIFR  334

Query  1014  GTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVG-PSRHVQDSDIPNLPYLQAIVKEVL  1190
             GTDTVAIL+EWI+ARMVLH D+QAKAQ EID  VG P+R V + D+P LPYL AIVKE L
Sbjct  335   GTDTVAILLEWILARMVLHPDIQAKAQSEIDAVVGTPARSVSNFDLPKLPYLHAIVKETL  394

Query  1191  RLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE  1370
             R+HPPGPLLSWARLA+HD ++   FIPAGTTAMVNM+AITHD +IW++P  F+PER + E
Sbjct  395   RMHPPGPLLSWARLAIHDTHIGHHFIPAGTTAMVNMFAITHDEEIWSNPNEFKPERLVSE  454

Query  1371  EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP---GPSVDLSECLK  1541
             +V IMGSDLRLAPFGSGRRVCPG+A+GL+TV LWLA+ LQ FKW+P      VDLSE LK
Sbjct  455   DVLIMGSDLRLAPFGSGRRVCPGKAMGLATVELWLAQLLQSFKWVPCDDQSGVDLSETLK  514

Query  1542  LSLEMKKHL  1568
             LSLEMK  L
Sbjct  515   LSLEMKNSL  523



>ref|XP_009356423.1| PREDICTED: cytochrome P450 78A5 [Pyrus x bretschneideri]
Length=522

 Score =   509 bits (1312),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 263/478 (55%), Positives = 345/478 (72%), Gaps = 9/478 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQ-MGSHAHRKLASMATSMGLNRLMA  335
             F    GG AW     ++  + + GP  +P +G L   +GS  HR LA +A S     LM+
Sbjct  37    FCFAPGGLAW-ALCKDRAFRAIPGPPGYPLIGSLTVFIGSARHRVLAKLARSFRAEALMS  95

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G +R +I+S P+TAKE+L  ++F +RPV E+A  L+F RA+GFAP G YWR LRR+A
Sbjct  96    FSVGLSRFVIASQPETAKEMLNSTAFANRPVNETAYELLFNRAMGFAPYGEYWRNLRRIA  155

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSP+RIA  E  R  +  +M+ ++   M ++G V+V+ V+  GSL NV+ +VFG C
Sbjct  156   ATHLFSPKRIAGSEVFRREVGLKMVEELRCLMLKNGQVQVKKVLHFGSLNNVMMTVFGRC  215

Query  696   L----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                  G  G EL  +V EGYEL+G FNW ++FP    LD  G +++C +L  +V+  VG+
Sbjct  216   YEFDKGGDGLELERLVTEGYELLGVFNWSNHFPFLSWLDLQGVRKRCRKLVSKVDGFVGK  275

Query  864   IIEK-RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             IIE+ R  + +G         DF+ VLL+L ++D+L+D+D++AVLWEMIFRGTDTVAIL+
Sbjct  276   IIEEHRLERVKGGSFEKERVGDFVDVLLNLEEDDKLSDSDMIAVLWEMIFRGTDTVAILL  335

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EWI+ARMVLH ++Q+KAQ EI+  VG +R VQ SDI NLPYLQAIVKE LR+HPPGPLLS
Sbjct  336   EWILARMVLHPEIQSKAQSEIEAVVGSTRTVQGSDIANLPYLQAIVKECLRVHPPGPLLS  395

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WAR+A+HDVYV   F+PAGT+AMVNMWAITHD K+W +P  F PERFM E+VSIMG+DLR
Sbjct  396   WARIAIHDVYVGDNFVPAGTSAMVNMWAITHDAKVWTEPDKFSPERFMAEDVSIMGTDLR  455

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKHL  1568
             LAPFGSGRRVCPG+ALGL+TV LWLA+ LQ+F W+   +  VDLSECLKLS+EMK  L
Sbjct  456   LAPFGSGRRVCPGKALGLATVQLWLAQLLQNFNWIGSENGDVDLSECLKLSMEMKSPL  513



>ref|XP_009400167.1| PREDICTED: cytochrome P450 78A5-like [Musa acuminata subsp. malaccensis]
Length=509

 Score =   509 bits (1310),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 272/475 (57%), Positives = 339/475 (71%), Gaps = 12/475 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
              W   GG AW    +  +   + GP      GF+  + GS AHR LA +A S     LMA
Sbjct  34    LWFFPGGIAW--ALSRAHACSIPGPS-----GFVSALSGSAAHRVLAGLANSHKAIDLMA  86

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR ++SSHPD+AKEIL  S+F DRP+KESA  L+F RA+GFAP G YWR LRR++
Sbjct  87    FSVGFTRFVVSSHPDSAKEILQSSAFADRPIKESAYELLFHRAMGFAPFGEYWRNLRRIS  146

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             + H+FSPRRIA     R AI E+M+  +   M ++G VEV+ V+  GSL NV+ +VFG  
Sbjct  147   STHLFSPRRIAAFGERRRAIGEQMVVHVRDLMAKNGVVEVKKVLHVGSLNNVMMNVFGRR  206

Query  696   LGL---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQI  866
                   +G EL  +VKEGYEL+G FNW D+FPL   LD  G +++C  L+ RVN  VG I
Sbjct  207   YDFGKGEGSELEGLVKEGYELLGLFNWADHFPLLGWLDLQGVRKRCRSLSKRVNAFVGGI  266

Query  867   IEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEW  1046
             IE+ +         V+   DF+ VLL L KE++L+DAD+VAVLWEMIFRGTDTVAIL+EW
Sbjct  267   IEEHRVMGRISGGVVDGAGDFVDVLLGLEKEEKLSDADMVAVLWEMIFRGTDTVAILLEW  326

Query  1047  IMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWA  1226
             IMAR+VLH D Q+ A+ EID  VG +R V D+DI +LPYLQA+VKE LR+HPPGPLLSWA
Sbjct  327   IMARLVLHLDAQSIARSEIDAVVGNTRPVTDADIVSLPYLQAVVKESLRMHPPGPLLSWA  386

Query  1227  RLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLA  1406
             RLAVHD +V   FIPAGTTAMVNMWAITHD  IW +P  F+PERF EE+V+I+GSDLRLA
Sbjct  387   RLAVHDAHVGSHFIPAGTTAMVNMWAITHDESIWAEPNEFKPERFTEEDVNILGSDLRLA  446

Query  1407  PFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKKHL  1568
             PFG+GRR CPG+A+GL+TVHLWLA+ LQ F W+P    VDLSE L++SLEM+K L
Sbjct  447   PFGAGRRACPGKAMGLATVHLWLAQLLQSFNWVPADGGVDLSERLRMSLEMEKPL  501



>ref|XP_007153503.1| hypothetical protein PHAVU_003G041200g [Phaseolus vulgaris]
 gb|ESW25497.1| hypothetical protein PHAVU_003G041200g [Phaseolus vulgaris]
Length=520

 Score =   509 bits (1310),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 268/476 (56%), Positives = 342/476 (72%), Gaps = 12/476 (3%)
 Frame = +3

Query  168   VEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSLG  347
             V GG AW    ++  P  + GP++   LG     G   HR LA +A S    +LMAFS+G
Sbjct  40    VPGGVAWALSKSSAKPN-IPGPVT-ALLGVF--TGLTPHRALAKLARSYSAEKLMAFSIG  95

Query  348   TTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHM  527
              TR +ISS P+TAKEIL  + F DRPVKESA  L+F RA+GFAP G YWR LR+++A H+
Sbjct  96    LTRFVISSEPETAKEILGSAGFADRPVKESAYELLFYRAMGFAPYGEYWRNLRKISALHL  155

Query  528   FSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGL-  704
             FSP+RIA  EG R  +  +M+ ++ K M E   VEV+ V+  G+L NV+ +VFG   G  
Sbjct  156   FSPKRIAGFEGFRCEVGLKMVEQLKKLMSEKREVEVKKVLHFGALNNVMMTVFGKSYGFY  215

Query  705   --QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEKR  878
               +G EL  +V EGYEL+G FNW D+FPL   LD  G +++C  L  +VN  VG+IIE+ 
Sbjct  216   EGEGVELEGLVNEGYELLGVFNWSDHFPLLGWLDLQGVRKRCRSLVEKVNAFVGKIIEEH  275

Query  879   K-RQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
             K ++ +G  +     +DF+ VLL L  E++L++AD++AVLWEMIFRGTDTVAIL+EWI+A
Sbjct  276   KIKRVKGEYVKDEGMSDFVDVLLDLENENKLSEADMIAVLWEMIFRGTDTVAILLEWILA  335

Query  1056  RMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLA  1235
             RMVLH ++QAKAQ EID+  G SR V D+DIPNL YLQ IVKE LR+HPPGPLLSWARLA
Sbjct  336   RMVLHPEIQAKAQSEIDSVCGSSRLVSDADIPNLRYLQCIVKEALRVHPPGPLLSWARLA  395

Query  1236  VHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFG  1415
             VHDV V    IP GTTAMVNMWAITHD ++W +P  F PERF+E++VSIMG+DLRLAPFG
Sbjct  396   VHDVTVGDKHIPKGTTAMVNMWAITHDERVWAEPEKFIPERFVEDDVSIMGTDLRLAPFG  455

Query  1416  SGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP----SVDLSECLKLSLEMKKHLA  1571
             SGRRVCPG+ALGL++ HLWLA+ LQ+F W+       +VDL+E LKLS+EMKK L+
Sbjct  456   SGRRVCPGKALGLASAHLWLAQLLQNFNWVASDDSDGTVDLAERLKLSMEMKKPLS  511



>ref|XP_010031012.1| PREDICTED: cytochrome P450 78A5 [Eucalyptus grandis]
Length=539

 Score =   509 bits (1310),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 273/489 (56%), Positives = 340/489 (70%), Gaps = 19/489 (4%)
 Frame = +3

Query  159   FWVVEGGFAW-----RNYSNNQNPKKLNGPMSWPFLGFL-PQMGSHAHRKLASMATSMGL  320
             FW+  GG AW     R  ++      L GP   P LG +    GS  HR L  ++ S G 
Sbjct  40    FWLSPGGLAWALSKARPSNSGGVSVSLPGPSGVPVLGLVFAFTGSLTHRVLDELSRSSGA  99

Query  321   NRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQ  500
              +LMAFS+G TR +ISS P++A+E+L  S+F DRPVKESA  L+F RA+GFAP G YWR 
Sbjct  100   RKLMAFSVGLTRFVISSEPESAREMLSSSAFADRPVKESAYELLFHRAMGFAPYGEYWRN  159

Query  501   LRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVES  680
             LRR++A H+FSPRRIA     R+ I  +M+G +   M E G V VR V+  GSL NV+ +
Sbjct  160   LRRISATHLFSPRRIAASGKSRARIGLQMVGDIRALMEERGEVGVRKVLHLGSLNNVMST  219

Query  681   VFGSCL------GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGR  842
             VFG         G  G EL  +V EGYEL+G FNWGD+FPL   LD  G +R+C RL  +
Sbjct  220   VFGRSYDFGDRNGGGGVELERLVSEGYELLGGFNWGDHFPLLRSLDLQGVRRRCRRLCEK  279

Query  843   VNDLVGQIIEK---RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFR  1013
             VN  VG I+E    R+ + E  +    N  DF+ VLL L KE++L+D+D++AVLWEMIFR
Sbjct  280   VNAFVGAIVEDHRMRRLKVERSDEEDENAGDFVDVLLDLQKENRLSDSDMIAVLWEMIFR  339

Query  1014  GTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLR  1193
             GTDTVAIL+EWI+ARMVLH D+QAKAQ EID  +G +R V+DSD+P LPYL+AIVKE LR
Sbjct  340   GTDTVAILLEWILARMVLHPDIQAKAQSEIDAAIGSARPVEDSDLPRLPYLRAIVKETLR  399

Query  1194  LHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME--  1367
             +HPPGPLLSWARLAV D +V   F+PAGTTAMVNMWAITHD  +W DP  F+PERF+   
Sbjct  400   VHPPGPLLSWARLAVQDTHVGGHFVPAGTTAMVNMWAITHDEAVWPDPEEFKPERFVAGD  459

Query  1368  -EEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLK  1541
               E  IMGSDLRLAPFG+GRRVCPG+A+GL+TV LWLA+ LQ +KW+     VDLSE LK
Sbjct  460   GGEFPIMGSDLRLAPFGAGRRVCPGKAMGLATVELWLAQLLQSYKWVGSDRGVDLSERLK  519

Query  1542  LSLEMKKHL  1568
             L++EMK+ L
Sbjct  520   LTMEMKQSL  528



>ref|XP_009775574.1| PREDICTED: cytochrome P450 78A5-like [Nicotiana sylvestris]
Length=527

 Score =   508 bits (1307),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 264/479 (55%), Positives = 336/479 (70%), Gaps = 9/479 (2%)
 Frame = +3

Query  162   WVVEGGFAWR-NYSNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRLMA  335
             W+  GG AW  + S   +   + GP   P LG +    S   HR L+ ++ ++    LMA
Sbjct  40    WLTPGGLAWALSKSRVGSRPTIPGPSGLPVLGLVFTFTSSLTHRLLSKLSKNLSATPLMA  99

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR IISS P++AKEIL  S+F DRPVKESA  L+F +A+GFAP G YWR LR+++
Sbjct  100   FSIGFTRFIISSQPESAKEILNSSAFADRPVKESAYELLFHKAMGFAPYGEYWRSLRKLS  159

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSP+RIA L   R  I  +M+  +   M   G ++V+ ++  GSL NV+ SVFG C
Sbjct  160   ATHLFSPKRIASLGKCRREIGNKMVSDIISLMEIQGKIKVKRILHFGSLNNVMSSVFGKC  219

Query  696   LGL----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                    +G++L  +V EGYEL+G FNW D+FP    LD  G +R+C  LA +VN  VG+
Sbjct  220   YDFITENEGQKLEFLVCEGYELLGMFNWSDHFPFLGWLDLQGVRRRCRDLAIKVNIFVGK  279

Query  864   IIEKR--KRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
             IIE+   KR   G  +   +  DF+ VLL+L K+++L+D D+ A+LWEMIFRGTDTVAIL
Sbjct  280   IIEEHRVKRSENGGVVADEDLWDFVDVLLNLEKDNKLSDTDMTAILWEMIFRGTDTVAIL  339

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EWI+ARMVLH D+QAKAQ EID  VG +R V D D+P L YLQAIVKE LR+HPPGPLL
Sbjct  340   LEWILARMVLHPDIQAKAQQEIDNNVGTNRGVSDFDLPKLTYLQAIVKETLRIHPPGPLL  399

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDL  1397
             SWARLA++D ++   FIPAGTTAMVNMWAIT D KIW  P  F PERF+EE+V+IMGSDL
Sbjct  400   SWARLAMNDTFIGHHFIPAGTTAMVNMWAITRDEKIWPQPEKFMPERFLEEDVAIMGSDL  459

Query  1398  RLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMKKHLA  1571
             RLAPFGSGRRVCPG+ +GL+TV LWLA+ LQ F W+   + VDLSECLKLS+EMK  L 
Sbjct  460   RLAPFGSGRRVCPGKTMGLATVQLWLAQLLQSFNWIASENGVDLSECLKLSMEMKHSLV  518



>gb|AFK46135.1| unknown [Medicago truncatula]
Length=520

 Score =   507 bits (1305),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 274/475 (58%), Positives = 335/475 (71%), Gaps = 15/475 (3%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKK--LNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSLG  347
             GGFAW  Y+   +  K  + GP      G L   G   HR LA +A S     LMAFS+G
Sbjct  43    GGFAWALYNKASSSAKSVIPGPSFSGLFGILS--GQTPHRVLAKLAKSHRAESLMAFSVG  100

Query  348   TTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHM  527
              TR IISS P+TAKEILC S+F DRPVKESA  L+F RA+GFAP G YWR LRR+++ H+
Sbjct  101   LTRFIISSEPETAKEILCSSAFGDRPVKESAYELLFHRAMGFAPYGEYWRNLRRISSTHL  160

Query  528   FSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGL-  704
             F  RRI   EG RS +  +M+ ++   MG+ G VEV+ V+  GSL NV+ +VFG C    
Sbjct  161   FCLRRINGFEGFRSEVGLKMVERIKFLMGDMGSVEVKKVLHFGSLNNVMMTVFGKCYDFF  220

Query  705   --QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE--  872
                G EL  +V EGYEL+G FNW D+FPL   LD  G K++C  L  +VN  VG+IIE  
Sbjct  221   DGDGVELEELVSEGYELLGVFNWSDHFPLLGWLDLQGVKKRCRALVTKVNTFVGKIIEEH  280

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             K KR  EG  I      DF+ VLL L ++D+L+D+D++AVLWEMIFRGTDTVAIL+EWI+
Sbjct  281   KMKRMSEGRAIV----GDFVDVLLDLEEKDKLSDSDMIAVLWEMIFRGTDTVAILLEWIL  336

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             ARMVLH ++QAKAQ EI   VG S+ + D+D+  + YLQ IVKE LR+HPPGPLLSWARL
Sbjct  337   ARMVLHPEIQAKAQEEIYRVVGNSKVITDADVQKMCYLQCIVKEALRVHPPGPLLSWARL  396

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPF  1412
             AVHDV V    IP GTTAMVNMWAITHD K+WN+P  F+PERFM E+VSIMGSDLRLAPF
Sbjct  397   AVHDVMVGDKHIPKGTTAMVNMWAITHDEKVWNEPEEFKPERFMNEDVSIMGSDLRLAPF  456

Query  1413  GSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKHLA  1571
             G+GRRVCPG+A+GL++VHLW A+ L +FKW+      VDL ECLKLS+EMKK L 
Sbjct  457   GAGRRVCPGKAMGLASVHLWFAQLLHNFKWVSCDDSLVDLDECLKLSMEMKKPLV  511



>ref|XP_010091592.1| Cytochrome P450 78A4 [Morus notabilis]
 gb|EXB44858.1| Cytochrome P450 78A4 [Morus notabilis]
Length=534

 Score =   507 bits (1306),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 275/486 (57%), Positives = 342/486 (70%), Gaps = 17/486 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
              W+V GG AW   S +++  ++ GP   P  G L     +  HR LA +A    +  LMA
Sbjct  40    LWLVPGGLAW-ALSKSKSRFRIPGPHGLPLAGLLTVFTAASPHRALAELARRFNVLPLMA  98

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR +ISS PDTAKEIL  S+F DRPVKESA  L+F R +GFAP G YWR LRR++
Sbjct  99    FSVGFTRFVISSKPDTAKEILSSSTFADRPVKESAYELLFHRTMGFAPYGEYWRNLRRIS  158

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSP+RI    G R  I  +M+ ++   + + G VEV+ V+  GSL NV+ +VFG  
Sbjct  159   ATHLFSPKRIGDFGGFRKEIGLKMVDEISHPVDKKGVVEVKKVLHFGSLNNVMMTVFGRS  218

Query  696   LGLQ-----GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVG  860
              G       G EL  MV EGYEL+G FNW D+FPL   LD  G +++C  L  +VN  VG
Sbjct  219   YGFDEKDNDGFELEEMVSEGYELLGIFNWSDHFPLLGWLDLQGVRKRCKALVSKVNAFVG  278

Query  861   QII-EKRKRQFEG-IEINVNNNTDFLSVLLSLP-KEDQLADADLVAVLWEMIFRGTDTVA  1031
              II E R  +  G I  +     DF+ VLL L  K ++L+++D++AVLWEMIFRGTDTVA
Sbjct  279   NIIQEHRAMRVNGDIGDHEEKAGDFVDVLLDLENKGEKLSESDMIAVLWEMIFRGTDTVA  338

Query  1032  ILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGP  1211
             IL+EWI+ARMVLH ++QAK+Q EID+ VG SR V DSDIPNLPYLQAIVKE LR+HPPGP
Sbjct  339   ILLEWILARMVLHPEIQAKSQGEIDSVVGRSRAVSDSDIPNLPYLQAIVKESLRVHPPGP  398

Query  1212  LLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE----EVS  1379
             LLSWARLA+HDV++   FIPAGTTAMVNMW+ITHD  IW +P  F+PERF EE    +VS
Sbjct  399   LLSWARLAIHDVFIGHAFIPAGTTAMVNMWSITHDEAIWPEPEKFKPERFTEEDENRDVS  458

Query  1380  IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS---VDLSECLKLSL  1550
             ++GSDLRLAPFG+GRRVCPG+ALGL++VHLWLA+ LQ F+WLP  +   VDLSE LKLSL
Sbjct  459   VLGSDLRLAPFGAGRRVCPGKALGLASVHLWLAQLLQSFEWLPSDANTGVDLSEQLKLSL  518

Query  1551  EMKKHL  1568
             EMK  L
Sbjct  519   EMKNPL  524



>ref|XP_007045833.1| Cytochrome P450, family 78, subfamily A, polypeptide 5 [Theobroma 
cacao]
 gb|EOY01665.1| Cytochrome P450, family 78, subfamily A, polypeptide 5 [Theobroma 
cacao]
Length=518

 Score =   505 bits (1300),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 262/480 (55%), Positives = 332/480 (69%), Gaps = 8/480 (2%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             +  W   GG AW  + +  +                   GS  HR LA +A ++   +LM
Sbjct  30    IALWASPGGLAWARFRSKASFAIPGPLGFPLLGLLTVFTGSTPHRVLAKLAKTIKAVKLM  89

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFS+G TR IISS  +TA+EIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR+
Sbjct  90    AFSVGFTRFIISSDAETAREILNNSAFADRPVKESAFELLFHRAMGFAPYGEYWRNLRRI  149

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             +A H+FSP+RIA   G R  I  +++ ++   M   G V V+ V+   SL NV+ +VFG 
Sbjct  150   SATHLFSPKRIAGFAGFRQEIGVKLVEEVRCLMEAKGEVLVKKVLHFSSLNNVMATVFGK  209

Query  693   CLGLQ----GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVG  860
                 +    G EL  +V EGYEL+G FNW D+FP    LD  G + +C +L  +VN  VG
Sbjct  210   KYDFEMTGEGLELEDLVSEGYELLGIFNWSDHFPFLCWLDLQGVRTRCRKLVAKVNVFVG  269

Query  861   QIIEKR--KRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             +IIE+   KR    +E + +   DF+ VLL   K ++L D+D++AVLWEMIFRGTDTVAI
Sbjct  270   KIIEEHRLKRVNGDLEDDGSEVGDFVDVLLDWEKHEKLNDSDMIAVLWEMIFRGTDTVAI  329

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EWI+ARMVLH ++Q+K Q EIDT VG ++ V DSD+PNLPYLQAIVKE LR+HPPGPL
Sbjct  330   LIEWILARMVLHPEIQSKVQAEIDTVVGNTKQVSDSDVPNLPYLQAIVKETLRMHPPGPL  389

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSD  1394
             LSWARLA+HDV+V   F+PAGTTAMVNMWAITHD ++W +P  F+PERF+E +VSIMGSD
Sbjct  390   LSWARLAIHDVHVGDNFVPAGTTAMVNMWAITHDEEVWAEPDKFKPERFLEADVSIMGSD  449

Query  1395  LRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSLEMKKHL  1568
             LRLAPFGSGRRVCPG+A+GL TVHLWLA+ LQ FKW+P     VDL+E LKLS+EMK  L
Sbjct  450   LRLAPFGSGRRVCPGKAMGLVTVHLWLAQLLQAFKWVPCQDGDVDLTEHLKLSMEMKNPL  509



>ref|XP_003517846.1| PREDICTED: cytochrome P450 78A5-like [Glycine max]
Length=520

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 268/474 (57%), Positives = 339/474 (72%), Gaps = 11/474 (2%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSLGTT  353
             GG AW   + +     + GP+      F    GS  HR+L+ +A S    +LMAFS+G T
Sbjct  41    GGLAWAWATKSSTRPIIPGPVMALLSVF---TGSTPHRRLSMLARSYHAEKLMAFSIGLT  97

Query  354   RMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMFS  533
             R +ISS P+TAKEIL    F DRPVKESA  L+F RA+GFAP G YWR LRR++A H+FS
Sbjct  98    RFVISSEPETAKEILGSPGFADRPVKESAYQLLFHRAMGFAPYGEYWRNLRRISALHLFS  157

Query  534   PRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGL---  704
             P+RI   E  R+ +  +M+ ++ K M ++  VEV+ ++  GSL NV+ +VFG C      
Sbjct  158   PKRITGSEAFRNEVGLKMVDEVKKVMKDNRHVEVKRILHYGSLNNVMMTVFGKCYEFYEG  217

Query  705   QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK-RK  881
             +G EL  +V EGYEL+G FNW D+FP+   LD  G +++C  L  +VN  VG +IE+ R 
Sbjct  218   EGVELEALVSEGYELLGVFNWSDHFPVLGWLDLQGVRKRCRCLVEKVNAFVGGVIEEHRV  277

Query  882   RQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARM  1061
             ++  G  +      DF+ VLL L  E++L++AD++AVLWEMIFRGTDTVAIL+EWI+ARM
Sbjct  278   KRVRGGCVKDEGTGDFVDVLLDLENENKLSEADMIAVLWEMIFRGTDTVAILLEWILARM  337

Query  1062  VLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVH  1241
             VLH D+QAKAQ EID+  GP R V ++D+PNL YLQ IVKE LR+HPPGPLLSWARLAVH
Sbjct  338   VLHPDIQAKAQREIDSVCGPYRLVSEADMPNLRYLQGIVKETLRVHPPGPLLSWARLAVH  397

Query  1242  DVYV-DKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEE-VSIMGSDLRLAPFG  1415
             DV V  K  IP GTTAMVNMWAITHD + W +P  FRPERF+EEE V+IMGSDLRLAPFG
Sbjct  398   DVTVGGKHVIPKGTTAMVNMWAITHDERFWAEPERFRPERFVEEEDVNIMGSDLRLAPFG  457

Query  1416  SGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSLEMKKHLA  1571
             SGRRVCPG+ALGL++VHLWLA+ LQ+F W+   G SV+L ECLKLS+EMKK LA
Sbjct  458   SGRRVCPGKALGLASVHLWLAQLLQNFHWVQFDGVSVELDECLKLSMEMKKPLA  511



>ref|XP_010527976.1| PREDICTED: cytochrome P450 78A5 [Tarenaya hassleriana]
Length=523

 Score =   503 bits (1295),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 273/506 (54%), Positives = 340/506 (67%), Gaps = 26/506 (5%)
 Frame = +3

Query  90    YRAICCFTlfpllafsllpllMKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM  269
             + AI CF             ++ F +  GG AW  +  ++   ++ GP S     F    
Sbjct  19    FEAILCF--------FFFVAVLSFSLSPGGLAWA-WVGSKTQVQIPGP-SGSIYAF---S  65

Query  270   GSHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLL  449
             GS  HR LA +A  +    LMAFS+G +R +ISS PDTAKEIL  S+F DRPVKESA  L
Sbjct  66    GSTPHRVLADLAKRLKATPLMAFSVGFSRFVISSEPDTAKEILNSSAFADRPVKESAYEL  125

Query  450   MFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfv  629
             +F RA+GFAP G YWR LRR++A H+FSPRRI+    VR  I  EM+ K+   + E+   
Sbjct  126   LFHRAMGFAPYGEYWRNLRRISATHLFSPRRISSFGVVRREIGMEMVNKIKNFVSETVTG  185

Query  630   evrgvvgeg--SLRNVVESVFGSCL------GLQGEELGLMVKEGYELIGEFNWGDYFPL  785
             EV         SL NV+ +VFG         G  G  L  +V EGYEL+G FNW D+ P+
Sbjct  186   EVEVKKVIHFGSLNNVMMTVFGKSYDFDDKDGGNGFVLERLVSEGYELLGIFNWSDHLPV  245

Query  786   GFLLDFGGTKRKCHRLAGRVNDLVGQIIE--KRKRQFEGIEINVNNNTDFLSVLLSLPKE  959
                 DF G +++C  L   VN  VG IIE  K KR  E  + + ++  DF+ VLL L K+
Sbjct  246   LGWFDFQGVRKRCKALVSEVNAFVGGIIEEHKVKRNHEDFDEDGSSTADFVDVLLGLQKK  305

Query  960   DQLADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQ  1136
             ++L+D+D++AVLWEMIFRGTDTVAIL+EWI+ARMV+HQD+Q K   EI +    S R V 
Sbjct  306   EKLSDSDMIAVLWEMIFRGTDTVAILLEWILARMVMHQDIQEKVHSEIASVTSNSTRPVS  365

Query  1137  DSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHD  1316
             DSDIPNLPYLQAIVKE LRLHPPGPLLSWARLA+HDV+V    +P GT AMVNMWAITHD
Sbjct  366   DSDIPNLPYLQAIVKETLRLHPPGPLLSWARLAIHDVHVGPTVVPGGTIAMVNMWAITHD  425

Query  1317  PKIWNDPWTFRPERFME-EEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQH  1493
             PKIW DP  F+PERFM+ E+VS+MGSDLRLAPFGSGRRVCPG+A+GL+TVHLWLA+ +Q 
Sbjct  426   PKIWTDPEEFKPERFMDGEDVSVMGSDLRLAPFGSGRRVCPGKAMGLATVHLWLAQLIQS  485

Query  1494  FKWLPGP-SVDLSECLKLSLEMKKHL  1568
             FKW+ G   V+L+E LKLS+EMKK L
Sbjct  486   FKWVKGSCDVELTEVLKLSMEMKKPL  511



>ref|XP_006477732.1| PREDICTED: cytochrome P450 78A5-like [Citrus sinensis]
Length=466

 Score =   500 bits (1287),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 260/452 (58%), Positives = 327/452 (72%), Gaps = 20/452 (4%)
 Frame = +3

Query  270   GSHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLL  449
             GS  HR LA +A S     LMAFS+G TR +ISSHPDTAKEIL  S+F DRPVKESA  L
Sbjct  7     GSLTHRVLAKLAVSFRGKPLMAFSVGFTRFVISSHPDTAKEILNSSAFADRPVKESAYEL  66

Query  450   MFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfv  629
             +F RAIGFAP G YWR LRR++  H+FSP+R++ L   R  +  +M+ ++   M ++G V
Sbjct  67    LFHRAIGFAPFGEYWRNLRRISGTHLFSPKRMSVLGKFRETVGLKMVKEIRVLMEKNGAV  126

Query  630   evrgvvgegSLRNVVESVFGSCLGLQ----------GEELGLMVKEGYELIGEFNWGDYF  779
             EVR V+  GSL +V+ SVFG                  EL  +V+EGYEL+G FNW D+F
Sbjct  127   EVRKVLHFGSLNSVMMSVFGRSYEFGEKCNYHDDDGSHELEGLVREGYELLGTFNWSDHF  186

Query  780   PLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEKRKRQFEGIEINVN------NNTDFLSVL  941
             P+    D  G +++C +L G+VN  V +IIE+ K   + I  N+N      +  DF+ VL
Sbjct  187   PVLSWFDLQGVRKRCRKLVGKVNSFVSKIIEEHK--VKRINKNINGGCCDVDEGDFVDVL  244

Query  942   LSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGP  1121
             L L  E++L D+D++AVLWEMIFRGTDTVAIL+EWI+ARMVLH D+QAKAQ+EID  VG 
Sbjct  245   LGLDGENRLTDSDMIAVLWEMIFRGTDTVAILLEWILARMVLHPDIQAKAQIEIDNTVGT  304

Query  1122  SRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMW  1301
             +R V D+D+PNLPYL AIVKE LR+HPPGPLLSWARLA+HD  V +  +PAGTTAMVNMW
Sbjct  305   ARLVSDADLPNLPYLHAIVKETLRMHPPGPLLSWARLAIHDTQVGQHLVPAGTTAMVNMW  364

Query  1302  AITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLAR  1481
             +ITHD ++W +   F+PERF+ E+V+IMGS+LRLAPFGSGRRVCPG+ALGL+TV LWLA+
Sbjct  365   SITHDEEVWPEANEFKPERFLYEDVNIMGSNLRLAPFGSGRRVCPGKALGLATVELWLAQ  424

Query  1482  FLQHFKWLPGPS--VDLSECLKLSLEMKKHLA  1571
              LQ FKW+P  +  VDLSECLKLSLEMK  L 
Sbjct  425   LLQSFKWVPSDAGGVDLSECLKLSLEMKNSLV  456



>ref|XP_004298365.1| PREDICTED: cytochrome P450 78A4-like [Fragaria vesca subsp. vesca]
Length=522

 Score =   501 bits (1291),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 262/481 (54%), Positives = 343/481 (71%), Gaps = 12/481 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
              W+  G  AW +    +    +  P  +P +G +     S  HR LA +A S+    L++
Sbjct  34    LWLRPGRLAW-SLCKVRACNPIPVPSGYPLIGSMSIFTASTPHRVLAKLARSLNAKPLLS  92

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
              S+G TR +ISS+P+TAKE+L  S+F +RP  E+A  L+F RA+GFAP G YWR LRR+A
Sbjct  93    LSVGFTRFVISSNPETAKEVLNSSAFANRPRNETAYELLFNRAMGFAPYGEYWRNLRRIA  152

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSP+RIA  EG R  +  +M+ ++   M  +  VEV+ V+   SL NV+++VFG C
Sbjct  153   ATHLFSPKRIAGSEGFRIEMGRKMVEEIRGLMVGNVEVEVKKVLHFASLNNVMKTVFGKC  212

Query  696   L-----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVG  860
                   G +G EL  +V+EGYEL+G FNWG++FPL   LDF G +++   L  +V   VG
Sbjct  213   YEFGEDGGEGIELEGLVREGYELLGIFNWGNHFPLLGWLDFQGVRKRARVLVVKVEAFVG  272

Query  861   QIIEK-RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
             +IIE+ R ++  G +++ +   DF+ VLL L K+  L+D+D+VAVLWEMIFRGTDTVAIL
Sbjct  273   KIIEEHRVKRVRGEKLDEDCIGDFVDVLLDLEKDQNLSDSDMVAVLWEMIFRGTDTVAIL  332

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EWI+ARMVLH ++Q+KAQ EID+ VG SR V  SDIPNLPYLQAIVKE  R+HPPGPLL
Sbjct  333   LEWILARMVLHPEIQSKAQREIDSVVGSSRPVSGSDIPNLPYLQAIVKESFRVHPPGPLL  392

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME--EEVSIMGS  1391
             SWAR+A+HDVYV + F+PAGTTAMVNMWAITHD  +W++P  F+PERFME  E+V+IMGS
Sbjct  393   SWARIAIHDVYVGESFVPAGTTAMVNMWAITHDENVWSEPEKFKPERFMESSEDVNIMGS  452

Query  1392  DLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWL--PGPSVDLSECLKLSLEMKKH  1565
             D+RLAPFGSGRRVCPG+ALGL+TV LWLA+ LQ F W+      VDL ECLKLS+EMK  
Sbjct  453   DMRLAPFGSGRRVCPGKALGLATVQLWLAQLLQSFDWVGSDNAGVDLEECLKLSMEMKTP  512

Query  1566  L  1568
             L
Sbjct  513   L  513



>ref|XP_010087351.1| Cytochrome P450 78A4 [Morus notabilis]
 gb|EXB28925.1| Cytochrome P450 78A4 [Morus notabilis]
Length=538

 Score =   501 bits (1291),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 267/496 (54%), Positives = 340/496 (69%), Gaps = 24/496 (5%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNN--QNPKKLNGPMSWPFLGFLPQM--GSHAHRKLASMATSMGL  320
             + F++  GG AW    +    +   + GP   PFLG L      S  HR L+  + + G 
Sbjct  36    ISFFLSPGGLAWALSISRVAHHKAAIPGPSGLPFLGLLFTFTGSSLPHRLLSHYSKTFGA  95

Query  321   NRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQ  500
               LMAFS+G TR ++SS P+TAKE+L  S F DRPVKESA  L+F RA+GFAP G YWR 
Sbjct  96    KPLMAFSVGLTRFVVSSQPETAKELLNSSDFADRPVKESAYELLFHRAMGFAPYGDYWRS  155

Query  501   LRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgeg-SLRNVVE  677
             LRR++A H+FSPRR+A     R  I  +M+ ++   MG SG       V    SL NV+ 
Sbjct  156   LRRISATHLFSPRRLAGFGVFRREIGLKMVEEIRVLMGRSGEGVEVRKVLHFGSLNNVMM  215

Query  678   SVFGSCLGLQGE---ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             SVFG       E   EL  +V+EGY+L+G FNW D+FP   LLD  G +++C +L  RVN
Sbjct  216   SVFGKSYEFGSEGFCELDKLVREGYDLLGVFNWSDHFPFLGLLDLQGVRKRCKKLVLRVN  275

Query  849   DLVGQIIEKRKRQFEGIEINV-------NNNT----DFLSVLLSLPKEDQLADADLVAVL  995
             D VG+IIE+ + +   ++ N+       NNN     DF+ VLL L KE++L+++D++AVL
Sbjct  276   DFVGKIIEEHRIK-RDVDENIISGKEKGNNNICESGDFVDVLLDLEKENKLSNSDMIAVL  334

Query  996   WEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAI  1175
             WEMIFRGTDTVAIL+EWI+ARM+LH D+Q+K Q EID  VG  R V +SD+PNLPYLQA+
Sbjct  335   WEMIFRGTDTVAILLEWILARMILHPDIQSKVQSEIDAVVGTHRSVSNSDLPNLPYLQAV  394

Query  1176  VKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPE  1355
             VKE LRLHPPGPLLSWARLA+HD  + + FIPAGTTA+VNMW+ITHD ++W +P  F PE
Sbjct  395   VKETLRLHPPGPLLSWARLAIHDTRMGEHFIPAGTTAIVNMWSITHDDRVWPEPDKFNPE  454

Query  1356  RFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP----GPSVD  1523
             RFMEE+V IMG DLRLAPFGSGRRVCPG+A+G++TV LWLA+ LQ FKW+P       VD
Sbjct  455   RFMEEDVVIMGCDLRLAPFGSGRRVCPGKAMGVATVELWLAQLLQTFKWVPLDDHNHGVD  514

Query  1524  LSECLKLSLEMKKHLA  1571
             LSE LKLSLEMK+ L 
Sbjct  515   LSETLKLSLEMKQSLV  530



>ref|XP_010539987.1| PREDICTED: cytochrome P450 78A5 [Tarenaya hassleriana]
Length=529

 Score =   500 bits (1288),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 259/493 (53%), Positives = 336/493 (68%), Gaps = 26/493 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKK---LNGPMSWPFLGFLPQMGSHA--HRKLASMATSMGLN  323
             FW+  GGFAW  Y      K    + GP   P +G L    ++A  HR LAS+A S    
Sbjct  32    FWLTPGGFAWALYKARPESKTRPAIPGPTGLPIVGLLFAFVNNALTHRVLASLAQSFKAK  91

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
              LMAFS+G+TR +ISS P+TAKE+L  S+F DRPVKESA  L+F RA+GFAP G YWR+L
Sbjct  92    SLMAFSVGSTRFVISSEPETAKELLNSSAFADRPVKESAYELLFHRAMGFAPFGGYWREL  151

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             RR+++ H+FSP+RIA   G R  I + M+G++ K M   G V+++ ++  GSL NV+ +V
Sbjct  152   RRISSTHLFSPKRIASFGGFRQKIGQTMVGEIKKSMESHGEVQIKRILHFGSLNNVMTTV  211

Query  684   FGSCLGLQGE-----------ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHR  830
             FG      GE           EL  +V EGYEL+G FNW D+FP+   LD  G +R+C  
Sbjct  212   FGKTYDFSGESDKTIDSRESRELEHLVSEGYELLGIFNWSDHFPVLGWLDLQGVRRRCRN  271

Query  831   LAGRVNDLVGQIIE--KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEM  1004
             L  +VN  VG+ IE  + KR     E   +   DF+ VLL +  + +++D+D++AVLWEM
Sbjct  272   LVAKVNVFVGKTIEEHRSKRLNHSSE---DGKGDFVDVLLDMQHDTKISDSDMIAVLWEM  328

Query  1005  IFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVK  1181
             IFRGTDTVAIL+EWI+ARMVLH D+QAKAQ E+D  +G S + + DSD+P LPYL+AIVK
Sbjct  329   IFRGTDTVAILLEWILARMVLHPDIQAKAQAELDAVMGLSGQRLTDSDLPKLPYLRAIVK  388

Query  1182  EVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERF  1361
             E LR+HPPGPLLSWARL++HD  V   F+PAGTTAMVNMW+ITHD  +W     F+PERF
Sbjct  389   ETLRMHPPGPLLSWARLSIHDTTVGTHFVPAGTTAMVNMWSITHDESVWAQAHEFKPERF  448

Query  1362  M----EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLS  1529
             +     +   IMGSDLRLAPFGSGRRVCPG+++GL+TV LWLA+ L  FKW+P   V+L+
Sbjct  449   LGGQENDNFPIMGSDLRLAPFGSGRRVCPGKSMGLATVELWLAQLLHSFKWVPHGDVELA  508

Query  1530  ECLKLSLEMKKHL  1568
             E LKLS+EMK  L
Sbjct  509   ESLKLSMEMKNPL  521



>ref|XP_004490206.1| PREDICTED: cytochrome P450 78A3-like [Cicer arietinum]
Length=521

 Score =   500 bits (1287),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 264/476 (55%), Positives = 332/476 (70%), Gaps = 8/476 (2%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAF  338
             FW+  GG AW     + + + +    S+  L  +   G   HR LA +A S     LMAF
Sbjct  38    FWLTPGGLAWAFVQASSSARSVIPGPSFSGLSCILS-GQTPHRVLAKLARSYHAESLMAF  96

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S+G TR IISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++A
Sbjct  97    SIGLTRFIISSEPETAKEILGSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRISA  156

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              H+FSPRRI   EG R  +  +M+ +++  MGE G VEV+ V+  GSL NV+ +VFG   
Sbjct  157   THLFSPRRIYGFEGFRREVGSKMVERINFLMGEMGCVEVKKVLHFGSLNNVMMTVFGKSY  216

Query  699   GL---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                   G EL  MV EGYEL+G FNW D+FPL   +DF G +++C  L  +VN  VG+II
Sbjct  217   DFFDGDGVELEEMVSEGYELLGVFNWSDHFPLLGWMDFQGVRKRCRDLVLKVNVFVGKII  276

Query  870   EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWI  1049
             ++ K   + +        DF+ VLL L + D+L D+D++AVLWEMIFRGTDTVAIL+EWI
Sbjct  277   DEHK--MKRLSDGKTTVGDFVDVLLDLEENDKLNDSDMIAVLWEMIFRGTDTVAILLEWI  334

Query  1050  MARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWAR  1229
             +ARMVLH ++QAKAQ EID  VG S+ + D D+  + YL  IVKE LR+HPPGPLLSWAR
Sbjct  335   LARMVLHPEIQAKAQEEIDRVVGNSKTITDEDVQKMSYLHCIVKEALRVHPPGPLLSWAR  394

Query  1230  LAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAP  1409
             LAVHDV V    +P GTTAMVNMWAITHD K+W++P  F+PERFM E+VSIMGSDLRLAP
Sbjct  395   LAVHDVMVGDKHVPKGTTAMVNMWAITHDEKVWDEPEEFKPERFMNEDVSIMGSDLRLAP  454

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKHLA  1571
             FG+GRRVCPG+A+GL++VHLWLA+ LQ F+W+      VDL ECLKLS+EMK  L 
Sbjct  455   FGAGRRVCPGKAMGLASVHLWLAQLLQSFEWVKSDDSLVDLDECLKLSMEMKTPLV  510



>ref|XP_010936450.1| PREDICTED: cytochrome P450 78A5-like [Elaeis guineensis]
Length=508

 Score =   499 bits (1285),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 280/478 (59%), Positives = 346/478 (72%), Gaps = 19/478 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAF  338
              W   GG AW   + ++  + + GP   P +  L   G+ AHR LA +A S     LMAF
Sbjct  34    LWFHPGGLAW---ALSRVGRSIPGP---PGI-VLALSGTAAHRALAWLARSFQALPLMAF  86

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S+G TR ++SSHP+TA+EIL  S+F DRP+KESA  L+F RA+GFAP G YWR LRR++ 
Sbjct  87    SVGFTRFVVSSHPNTAREILNSSAFADRPIKESAYELLFHRAMGFAPFGEYWRNLRRIST  146

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS--  692
              ++FSPRRI+     R AI E+M+ ++   MG  G VEV+ V+  GSL NV+ SVFG   
Sbjct  147   TYLFSPRRISASGKHRRAIGEQMVDEVKGLMGRYGEVEVKRVLHFGSLNNVMMSVFGKRF  206

Query  693   -CLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                  +GEEL  +V+EGYEL+G FNW D+ P+   LD  G +++C RL GRVN  VG++I
Sbjct  207   EFGKGEGEELEGLVREGYELLGVFNWSDHIPVLGWLDLQGVRKRCRRLVGRVNVFVGKVI  266

Query  870   E---KRKRQFEG-IEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
             E   +++R F G +E  V    DF+ VLL L +E++L+D D+VAVLWEMIFRGTDTVAIL
Sbjct  267   EEHRQKRRNFGGSLEDGVG---DFVDVLLDL-EEEKLSDVDMVAVLWEMIFRGTDTVAIL  322

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EWIMARMVLH D+Q+KAQ EID  VG SR V D DIP LPYLQ+IVKE LR+HPPGPLL
Sbjct  323   LEWIMARMVLHPDIQSKAQSEIDAVVGNSRLVSDFDIPMLPYLQSIVKESLRMHPPGPLL  382

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDL  1397
             SWARLA+HDV V   F+PAGTTAMVNMWAITHD  IW +P  F+PERFM E VSI+GSDL
Sbjct  383   SWARLAIHDVNVGNHFVPAGTTAMVNMWAITHDESIWPEPGEFKPERFMAEGVSILGSDL  442

Query  1398  RLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKKHL  1568
             RLAPFGSGRRVCPG+A+ L+TVHLWLAR LQ FKW+P    VDLSECL++SLEMK  L
Sbjct  443   RLAPFGSGRRVCPGKAMALATVHLWLARLLQCFKWVPSEGGVDLSECLRMSLEMKNPL  500



>ref|XP_006417097.1| hypothetical protein EUTSA_v10007373mg [Eutrema salsugineum]
 gb|ESQ35450.1| hypothetical protein EUTSA_v10007373mg [Eutrema salsugineum]
Length=519

 Score =   498 bits (1282),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 268/484 (55%), Positives = 336/484 (69%), Gaps = 19/484 (4%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMG-SHAHRKLASMATSMGLNRL  329
             + F++  GG AW    +++N   + GP      G L     S  HR LA++A     + L
Sbjct  31    VAFFLSPGGLAWALTGSSKNRVSIPGPS-----GSLSVFSDSKPHRVLAALAKRFKASPL  85

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFS+G +R +ISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR
Sbjct  86    MAFSVGFSRFVISSEPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRR  145

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesg---fvevrgvvgegSLRNVVES  680
             ++A H+FSPRRIA  EGVR  I  +M+ K+   +        VEV+ V+  GSL NV+ +
Sbjct  146   ISATHLFSPRRIASFEGVRVGIGMKMVKKIKSVVMSEAGGGEVEVKKVIHFGSLNNVMTT  205

Query  681   VFGSCLGLQ-----GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRV  845
             VFG           G  L  +V EGYEL+G FNW DYF +    DF G +++C  L   V
Sbjct  206   VFGESYDFDEVNGDGCFLERLVSEGYELLGIFNWSDYFGVLRWFDFQGVRKRCRALVSEV  265

Query  846   NDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDT  1025
             N  VG+IIEK K +         N  DF+ VLL L KE++L+D+D++AVLWEMIFRGTDT
Sbjct  266   NTFVGRIIEKHKMKRSNNLTGEEN--DFVDVLLGLQKEEKLSDSDMIAVLWEMIFRGTDT  323

Query  1026  VAILVEWIMARMVLHQDVQAKAQLEIDTCVGP-SRHVQDSDIPNLPYLQAIVKEVLRLHP  1202
             VAILVEW++ARMVLHQD+QAK   EI +     +R + DSDIP LPYLQAIVKE LRLHP
Sbjct  324   VAILVEWVLARMVLHQDIQAKLYKEIASVTSNNTRSLSDSDIPKLPYLQAIVKETLRLHP  383

Query  1203  PGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME-EEVS  1379
             PGPLLSWARLA+HDV+V    +PAGT AMVNMW+ITHD KIW DP  F+PERF++ E+VS
Sbjct  384   PGPLLSWARLAIHDVHVGPNLVPAGTIAMVNMWSITHDAKIWTDPEEFKPERFVDGEDVS  443

Query  1380  IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEM  1556
             IMGSDLRLAPFGSGRRVCPG+A+GL+TVHLWL + +Q+F+W+ G   V+L+E LKLS+EM
Sbjct  444   IMGSDLRLAPFGSGRRVCPGKAMGLATVHLWLGQLIQNFEWVKGSCDVELTEVLKLSMEM  503

Query  1557  KKHL  1568
             KK L
Sbjct  504   KKPL  507



>ref|XP_008452229.1| PREDICTED: cytochrome P450 78A5-like [Cucumis melo]
Length=532

 Score =   498 bits (1283),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 261/479 (54%), Positives = 342/479 (71%), Gaps = 14/479 (3%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMAFSLGT  350
             GG AW   S  +N   + GP   PFLG +     S  HR LA++A ++    LM+FS+G 
Sbjct  39    GGLAWALISKPKNQSIIPGPCGTPFLGQVSTFTNSLTHRLLANLAHTLKAKSLMSFSIGF  98

Query  351   TRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMF  530
             TR +ISS+P TAKE+L  S+F DRP+KESA  L+F RA+GFAP G YWR LRR+++  +F
Sbjct  99    TRFVISSNPITAKELLNSSAFADRPIKESAYELLFHRAMGFAPYGEYWRNLRRISSTFLF  158

Query  531   SPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQG  710
             SP+RI     +R  I  +M+ +++  M ++G VEVR V+  GSL NV+ESVFG  +    
Sbjct  159   SPKRICGFGVLRERIGVKMMEEIEGLMVKNGEVEVRKVLHFGSLSNVMESVFGKSVEFGD  218

Query  711   EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK---RK  881
              E+  +V EGY+L+G FNW D+FP+   LD  G +++C  L G+VN  VG+IIE+   ++
Sbjct  219   WEIDELVTEGYDLLGSFNWSDHFPVLGWLDLQGVRKRCRVLVGKVNVFVGKIIEEHRMKR  278

Query  882   RQFEGIEINVNN-----NTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEW  1046
             R   G E N N+     + DF+ VLL L KE++L D+D++AVLWEMIFRGTDTVAIL+EW
Sbjct  279   RVIVGDEENKNSPNDNEDEDFVDVLLDLEKENKLTDSDMIAVLWEMIFRGTDTVAILLEW  338

Query  1047  IMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  1223
             I+ARMVLH D+QAK Q EID  V  + R++ + D+PNLPYL A+VKE LR+HPPGPLLSW
Sbjct  339   ILARMVLHPDIQAKLQYEIDQVVMKTGRNISNLDLPNLPYLHAVVKETLRMHPPGPLLSW  398

Query  1224  ARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRL  1403
             ARLA+HD +V   +IPAGTTAMVNMWAITHD +IW DP  + P RF++++V+IMGSDLRL
Sbjct  399   ARLAIHDTHVAGHYIPAGTTAMVNMWAITHDDQIWPDPTIYNPNRFIKDDVAIMGSDLRL  458

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSECLKLSLEMKKHL  1568
             APFGSGRRVCPG+A+GL+TV LWLA+ +  F+W+        VDLSECLKLSLEMK  L
Sbjct  459   APFGSGRRVCPGKAMGLATVELWLAQLVHKFEWVQADESKIKVDLSECLKLSLEMKHPL  517



>ref|XP_010695255.1| PREDICTED: cytochrome P450 78A5-like [Beta vulgaris subsp. vulgaris]
Length=538

 Score =   498 bits (1282),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 266/485 (55%), Positives = 340/485 (70%), Gaps = 22/485 (5%)
 Frame = +3

Query  174   GGFAWR----NYSNNQNPKKLNGPMSWPFLGF-LPQMGSHAHRKLASMATSMGLNRLMAF  338
             GG AW       +       + GP   PF+G          HR LA +A  +  + LMAF
Sbjct  44    GGLAWAVSLLKPTKAHPTSAIPGPNGLPFVGLGFAFTSDTTHRILAKLAYKLHASPLMAF  103

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S+G TR +I+S P+ AKEIL  S F DRP+KESA  L+F RA+GFAP G YWR LRR++A
Sbjct  104   SVGLTRYVIASQPEYAKEILNSSEFADRPIKESAYELLFNRAMGFAPFGEYWRNLRRISA  163

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              ++FSPRRI+    +R  I   M+ ++   MG++  VE++ V+  GSL NV+ SVFG   
Sbjct  164   TYLFSPRRISTFSVLREDIGRRMMEEVKVVMGKNDNVEIKNVLHFGSLNNVMMSVFGREY  223

Query  699   GLQG-------EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLV  857
                G       +EL  +VKEGYEL+G FNW D+F     LD  G +++C  LA +VN  V
Sbjct  224   DFFGNENKNEAQELEGLVKEGYELLGIFNWADHFTPLRWLDLQGVRKRCKSLAEKVNVFV  283

Query  858   GQIIEKRKRQFEGIEINVNNN-----TDFLSVLLSLPK-EDQLADADLVAVLWEMIFRGT  1019
             G+II++  R     +IN N++      DF+ VLL L   E++LAD+D++A+LWEMIFRGT
Sbjct  284   GKIIDEH-RNVRREKINNNDDIDGSSKDFVDVLLDLEDGENKLADSDMIALLWEMIFRGT  342

Query  1020  DTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLH  1199
             DTVAIL+EW++ARMVLH D+QAKAQ EIDT VG +  V DSD+P LPYLQAIVKE LR+H
Sbjct  343   DTVAILLEWVLARMVLHPDIQAKAQAEIDTIVG-TNQVTDSDLPKLPYLQAIVKETLRVH  401

Query  1200  PPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVS  1379
             PPGPLLSWARL++HD +V   F+PAGTTAMVNMWAITHD KIW++P  F PERFM+E+VS
Sbjct  402   PPGPLLSWARLSIHDTHVGPHFVPAGTTAMVNMWAITHDEKIWSNPNEFNPERFMKEDVS  461

Query  1380  IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLE  1553
             IMGSDLRLAPFG+GRRVCPG+A+GL+TV LWLA+ LQ+FKW+P     VDL+ECLK+S+E
Sbjct  462   IMGSDLRLAPFGAGRRVCPGKAMGLATVQLWLAQMLQNFKWVPSDEHGVDLTECLKMSME  521

Query  1554  MKKHL  1568
             MKK L
Sbjct  522   MKKSL  526



>gb|AAB37231.1| cytochrome P-450 [Phalaenopsis sp. SM9108]
Length=426

 Score =   491 bits (1263),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 248/418 (59%), Positives = 315/418 (75%), Gaps = 4/418 (1%)
 Frame = +3

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFS+G TR I+SSHP TAKEIL   +F DRP+KESA  L+F RA+GFAP G YWR LRR
Sbjct  1     MAFSVGLTRFIVSSHPKTAKEILSSPAFADRPIKESAYELLFNRAMGFAPFGDYWRNLRR  60

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +++ ++FSPRR++  E  RS I E M+  M + M  +G VEVR ++  GSL N++ +VFG
Sbjct  61    ISSTYLFSPRRVSSFEKQRSEIGEGMVRDMKRMMERNGVVEVRRMLHYGSLNNIMLTVFG  120

Query  690   SCLGL---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVG  860
                     +G EL L++KEGYEL+G FNWGD+ PL   LD  G +R+C  L  +VN  V 
Sbjct  121   KKFDFAKDEGLELELILKEGYELLGIFNWGDHLPLLGWLDLQGVRRRCRTLVAKVNVFVK  180

Query  861   QIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             +II++ KR+  G+ I+     DF+ VLL L ++D+L+++D+VAVLWEMIFRGTDTVAIL+
Sbjct  181   KIIDEHKRRANGVGIDEGEGEDFVDVLLGLEEKDRLSESDMVAVLWEMIFRGTDTVAILL  240

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EW +ARMVLH D+Q+KAQ+EID+ V  SR V DSDI  LPYLQ+IVKE LR+HPPGPLLS
Sbjct  241   EWTLARMVLHPDIQSKAQVEIDSVVDSSRPVLDSDIQRLPYLQSIVKETLRMHPPGPLLS  300

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WARLA+HDV VD   IPAGTTAMVNMWAITHD   W +P  F P+RF++E+V+I+GSDLR
Sbjct  301   WARLAIHDVPVDGHMIPAGTTAMVNMWAITHDECNWAEPNKFNPDRFIDEDVNILGSDLR  360

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMKKHLA  1571
             LAPFGSG+RVCPG+ + L+ VHLWLA+ L+ FK LP  + VDLSECLK+SLEMK  L 
Sbjct  361   LAPFGSGKRVCPGKTMALAAVHLWLAQLLKSFKLLPSRNGVDLSECLKMSLEMKNPLV  418



>emb|CDX73053.1| BnaC06g35010D [Brassica napus]
Length=530

 Score =   494 bits (1271),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 260/492 (53%), Positives = 332/492 (67%), Gaps = 22/492 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYS-------NNQNPKKLNGPMSWPFLGFLPQMGSHA--HRKLASMATS  311
             FW+  GGFAW  Y         ++    + GP   P +G L    ++A  HR LA++A S
Sbjct  31    FWLTPGGFAWALYKARFHTRPESKTLPAIPGPPGLPIIGLLLAFVNNALTHRILANIANS  90

Query  312   MGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSY  491
                  LMAFS+G+TR +I+S P TAKEIL  S+F DRPVKESA  L+F RA+GFAP G Y
Sbjct  91    RKAKALMAFSVGSTRFVITSEPGTAKEILNSSAFADRPVKESAYELLFHRAMGFAPFGDY  150

Query  492   WRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNV  671
             WR+LRR+++ H+FSP+RI+     R  I E M+G++   M   G V ++ ++  GSL NV
Sbjct  151   WRELRRISSTHLFSPKRISSFGESRRKIGENMVGEIKNAMASYGEVHIKRILHFGSLNNV  210

Query  672   VESVFGSCLGLQ-----GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLA  836
             + SVFG             +L  +V EGYEL+G FNW D+FP    LD  G +R+C  L 
Sbjct  211   MSSVFGKTYDFNDGSIVNSKLEHLVSEGYELLGIFNWSDHFPGMRWLDLQGVRRRCRSLV  270

Query  837   GRVNDLVGQIIE--KRKRQF-EGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMI  1007
             G+VN  VG IIE  K KR   +  E    N+ DF+ VLL +    +L+D+D++AVLWEMI
Sbjct  271   GKVNVFVGNIIEEHKSKRSLRDNKEEEGTNDDDFVDVLLGMQGNIKLSDSDMIAVLWEMI  330

Query  1008  FRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGP-SRHVQDSDIPNLPYLQAIVKE  1184
             FRGTDTVAIL+EWI+ARM+LH D+QAKAQ EID   G   R V DSD+  LPY++AIVKE
Sbjct  331   FRGTDTVAILLEWILARMILHPDIQAKAQAEIDAIEGEMGRQVSDSDLSKLPYIRAIVKE  390

Query  1185  VLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM  1364
              LR+HPPGPLLSWARL++HD  +   FIPAGTTAMVNMWAITHD K+W +   ++PERF+
Sbjct  391   TLRMHPPGPLLSWARLSIHDTQIGTHFIPAGTTAMVNMWAITHDEKVWPEAHEYKPERFL  450

Query  1365  EEEVS----IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSE  1532
               + S    IMGSDLRLAPFG+GRRVCPG+++G++TV LWLA+ L  FKW+P   VDLSE
Sbjct  451   GSQESDNFPIMGSDLRLAPFGAGRRVCPGKSMGIATVELWLAQLLGSFKWVPCGEVDLSE  510

Query  1533  CLKLSLEMKKHL  1568
              LKLSLEMK  L
Sbjct  511   TLKLSLEMKNSL  522



>ref|XP_010476396.1| PREDICTED: cytochrome P450 78A5-like [Camelina sativa]
Length=516

 Score =   492 bits (1267),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 259/483 (54%), Positives = 332/483 (69%), Gaps = 20/483 (4%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRL  329
             + F++  GG AW    +++N   + GP      G L    G++ HR LA++A     + L
Sbjct  31    VAFFLSPGGLAWAWTGSSKNQVAIPGPS-----GSLSVFSGANPHRALAALAKRFKASSL  85

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFS+G +R +ISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR
Sbjct  86    MAFSVGFSRFVISSEPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRR  145

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgeg--SLRNVVESV  683
             +++ H+FSPRRIA  EGVR  I  +M+ K+   +      EV         SL NV+ +V
Sbjct  146   ISSTHLFSPRRIASFEGVRVGIGMKMVKKIQSLVTSDASGEVEVKKVVHFGSLNNVMTTV  205

Query  684   FGSCLGLQ-----GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             FG           G  L  +V EGYEL+G FNW D+F L    DF G +++C  L   VN
Sbjct  206   FGESYDFDEVNGVGCFLERLVSEGYELLGIFNWSDHFWLLRSFDFQGVRKRCRALVSEVN  265

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               VG II+K K +    + N  N  DF+ VLL L K+++L+D+D++AVLWEMIFRGTDTV
Sbjct  266   TFVGGIIDKHKMK----KSNNLNGEDFVDVLLGLQKDEKLSDSDMIAVLWEMIFRGTDTV  321

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGP-SRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             AILVEW++ARMVLHQD+Q K   EI +     +R + DSDIP LPYLQAIVKE LRLHPP
Sbjct  322   AILVEWVLARMVLHQDIQDKLYKEIASATSNNTRSLSDSDIPKLPYLQAIVKETLRLHPP  381

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-EEEVSI  1382
             GPLLSWARLA+HDV+V    +PAGT AMVNMW+ITHD KIW DP  F P+RF+  E+VSI
Sbjct  382   GPLLSWARLAIHDVHVGPNLVPAGTVAMVNMWSITHDAKIWTDPEEFNPDRFIGGEDVSI  441

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMK  1559
             MGSDLRLAPFG+GRRVCPG+A+GL+TVHLW+A+ +Q+F+W+ G   V+L+E LKLS+EMK
Sbjct  442   MGSDLRLAPFGAGRRVCPGKAMGLATVHLWIAQLIQNFEWVKGSCDVELAEVLKLSMEMK  501

Query  1560  KHL  1568
             + L
Sbjct  502   QPL  504



>ref|XP_006390465.1| hypothetical protein EUTSA_v10019645mg [Eutrema salsugineum]
 gb|ESQ27751.1| hypothetical protein EUTSA_v10019645mg [Eutrema salsugineum]
Length=545

 Score =   493 bits (1269),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 259/496 (52%), Positives = 340/496 (69%), Gaps = 26/496 (5%)
 Frame = +3

Query  159   FWVVEGGFAW-----RNYSNNQNPKK--LNGPMSWPFLGFLPQMGSH--AHRKLASMATS  311
             FW+  GGFAW     R Y+  ++  +  + GP   P +G L    ++   HR LA++A S
Sbjct  42    FWLTPGGFAWALYKARFYTRQESKTRAAIPGPSGLPIIGLLLAFLNNALTHRILANIANS  101

Query  312   MGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSY  491
                  LMAFS+G+TR +I+S P TAKE+L  S+F DRPVKESA  L+F RA+GFAP GSY
Sbjct  102   CKAKALMAFSVGSTRFVITSEPGTAKELLNSSAFVDRPVKESAYELLFHRAMGFAPFGSY  161

Query  492   WRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNV  671
             WR+LRR+++ H+FSP+RI+     R  I + M+G++ K M   G V ++ ++  GSL NV
Sbjct  162   WRELRRISSTHLFSPKRISGFGESRGRIGQNMVGEIKKAMTSCGEVHIKRILHFGSLNNV  221

Query  672   VESVFGSCLGLQGE---------ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKC  824
             + SVFG                 EL  +V EGYEL+G FNW D+FP    LD  G +R+C
Sbjct  222   MSSVFGKTYDFNDGSIVNSKEIIELEYLVSEGYELLGIFNWSDHFPGMRWLDLQGVRRRC  281

Query  825   HRLAGRVNDLVGQIIEKRKRQ---FEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVL  995
               L  +VN  VG+II+  K +    +  E   +N+ DF+ VLL +    +L+D+D++AVL
Sbjct  282   RSLVRKVNVFVGKIIDDHKSKRSIHDNQEEESSNDDDFVDVLLGMQGNRKLSDSDMIAVL  341

Query  996   WEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQA  1172
             WEMIFRGTDTVAIL+EWI+ARM+LH D+QAKAQ EID  VG + R + DSD+  LPYL+A
Sbjct  342   WEMIFRGTDTVAILLEWILARMILHPDIQAKAQAEIDAIVGETGRQISDSDLSKLPYLRA  401

Query  1173  IVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRP  1352
             IVKE LR+HPPGPLLSWARL++HD  +   FIPAGTTAMVNMWAITHD K+W++   ++P
Sbjct  402   IVKETLRMHPPGPLLSWARLSIHDTQIGTHFIPAGTTAMVNMWAITHDEKVWSEAHEYKP  461

Query  1353  ERFMEEEVS----IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSV  1520
             ERF+  + S    IMGSDLRLAPFG+GRRVCPG+++GL+TV LWLA+ L+ FKW+P   V
Sbjct  462   ERFLGSQESDNFPIMGSDLRLAPFGAGRRVCPGKSMGLATVELWLAQLLRCFKWVPCGEV  521

Query  1521  DLSECLKLSLEMKKHL  1568
             DLSE LKLSLEMK  L
Sbjct  522   DLSETLKLSLEMKNPL  537



>ref|NP_172827.1| cytochrome P450, family 78, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
 sp|Q9LMX7.1|C78A5_ARATH RecName: Full=Cytochrome P450 78A5; AltName: Full=Protein KLUH 
[Arabidopsis thaliana]
 gb|AAF81298.1|AC027656_15 Strong similarity to cytochrome P-450 from Phalaenopsis sp. SM9108 
gb|U34744. It contains a cytochrome P450 domain PF|00067. 
EST gb|T45256 comes from this gene [Arabidopsis thaliana]
 gb|AAY25437.1| At1g13710 [Arabidopsis thaliana]
 gb|ABJ17153.1| At1g13710 [Arabidopsis thaliana]
 gb|AEE29060.1| cytochrome P450, family 78, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
Length=517

 Score =   492 bits (1266),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 263/482 (55%), Positives = 336/482 (70%), Gaps = 17/482 (4%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRL  329
             + F +  GG AW    ++++   + GP      G L    GS+ HR LA++A     + L
Sbjct  31    VAFLLSPGGLAWAWTGSSKSRVSIPGPS-----GSLSVFSGSNPHRVLAALAKRFKASPL  85

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFS+G +R +ISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR
Sbjct  86    MAFSVGFSRFVISSEPETAKEILSSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRR  145

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesg--fvevrgvvgegSLRNVVESV  683
             +++ H+FSPRRIA  EGVR  I  +M+ K+   +       VEV+ +V  GSL NV+ +V
Sbjct  146   ISSTHLFSPRRIASFEGVRVGIGMKMVKKIKSLVTSDACGEVEVKKIVHFGSLNNVMTTV  205

Query  684   FGSCLGL-----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             FG          +G  L  +V EGYEL+G FNW D+F      DF G +++C  L   VN
Sbjct  206   FGESYDFDEVNGKGCFLERLVSEGYELLGIFNWSDHFWFLRWFDFQGVRKRCRALVSEVN  265

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               VG IIEK K + +G  +N   N DF+ VLL L K+++L+D+D++AVLWEMIFRGTDTV
Sbjct  266   TFVGGIIEKHKMK-KGNNLNGEEN-DFVDVLLGLQKDEKLSDSDMIAVLWEMIFRGTDTV  323

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             AILVEW++ARMVLHQD+Q K   EI +    + R + DSDIP LPYLQAIVKE LRLHPP
Sbjct  324   AILVEWVLARMVLHQDIQDKLYREIASATSNNIRSLSDSDIPKLPYLQAIVKETLRLHPP  383

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIM  1385
             GPLLSWARLA+HDV+V    +PAGT AMVNMW+ITH+ KIW DP  F PERF+ E+VSIM
Sbjct  384   GPLLSWARLAIHDVHVGPNLVPAGTIAMVNMWSITHNAKIWTDPEAFMPERFISEDVSIM  443

Query  1386  GSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKK  1562
             GSDLRLAPFGSGRRVCPG+A+GL+TVHLW+ + +Q+F+W+ G   V+L+E LKLS+EMK 
Sbjct  444   GSDLRLAPFGSGRRVCPGKAMGLATVHLWIGQLIQNFEWVKGSCDVELAEVLKLSMEMKN  503

Query  1563  HL  1568
              L
Sbjct  504   PL  505



>ref|NP_177551.1| cytochrome P450, family 78, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
 gb|AAG52514.1|AC016662_8 putative cytochrome P-450; 4810-6511 [Arabidopsis thaliana]
 gb|ABE65769.1| cytochrome P450 family protein [Arabidopsis thaliana]
 gb|AEE35551.1| cytochrome P450, family 78, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
Length=537

 Score =   491 bits (1265),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 259/494 (52%), Positives = 332/494 (67%), Gaps = 24/494 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYS-------NNQNPKKLNGPMSWPFLGFLPQMGSHA--HRKLASMATS  311
             FW+  GGFAW  Y         ++    + GP   P  G L    ++A  HR LA++A +
Sbjct  36    FWLTPGGFAWALYKARFHTRPESKTGPAIPGPSGLPIFGLLLAFVNNALTHRILANIADT  95

Query  312   MGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSY  491
                  LMAFS+G+TR +I+S P+TAKE+L  S+F DRPVKESA  L+F+RA+GFAP G Y
Sbjct  96    CKAKALMAFSVGSTRFVITSEPETAKELLNSSAFADRPVKESAYELLFDRAMGFAPFGDY  155

Query  492   WRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNV  671
             WR+LRR+++ H+FSP+RI      R  I + M+G++   M   G V ++ ++  GSL NV
Sbjct  156   WRELRRISSTHLFSPKRIFSSGESRRKIGQNMVGEIKNAMECYGEVHIKKILHFGSLNNV  215

Query  672   VESVFGSCLGL--------QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCH  827
             + SVFG             +  EL  +V EGYEL+G FNW D+FP    LD  G +R+C 
Sbjct  216   MSSVFGKTYNFNEGIVYSKESNELEHLVSEGYELLGIFNWSDHFPGMRWLDLQGVRRRCR  275

Query  828   RLAGRVNDLVGQII--EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWE  1001
              L GRVN  VG+II   K KR           + DF+ VLL +    +L+D+D++AVLWE
Sbjct  276   SLVGRVNVFVGKIINDHKSKRSLRDNPEESTYDDDFVDVLLGMHGNSKLSDSDMIAVLWE  335

Query  1002  MIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIV  1178
             MIFRGTDTVAIL+EWI+ARMVLH D+QAKAQ EID  VG S R V DSD+P LPY++AIV
Sbjct  336   MIFRGTDTVAILLEWILARMVLHPDIQAKAQAEIDCIVGDSGRQVTDSDLPKLPYVRAIV  395

Query  1179  KEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPER  1358
             KE LR+HPPGPLLSWARL++HD  +   FIPAGTTAMVNMWAITHD K+W +   ++PER
Sbjct  396   KETLRMHPPGPLLSWARLSIHDTQIGTHFIPAGTTAMVNMWAITHDEKVWPEAHEYKPER  455

Query  1359  FMEEEVS----IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDL  1526
             F+  + S    IMGSDLRLAPFG+GRRVCPG+++GL+TV LWLA+ L  +KW+    VDL
Sbjct  456   FLGAQESNNFPIMGSDLRLAPFGAGRRVCPGKSMGLATVELWLAQLLGSYKWVSCGEVDL  515

Query  1527  SECLKLSLEMKKHL  1568
             SE LKLSLEMK  L
Sbjct  516   SETLKLSLEMKNTL  529



>emb|CDX98123.1| BnaA06g08740D [Brassica napus]
Length=516

 Score =   490 bits (1262),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 265/474 (56%), Positives = 335/474 (71%), Gaps = 16/474 (3%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMAFSLGT  350
             GG AW    +++    + GP      G L    GS+ HR LA++A     + LMAFS+G 
Sbjct  38    GGLAWAWTKSSKTRVSIPGPS-----GSLSIFSGSNPHRVLAALAKRFKASPLMAFSVGF  92

Query  351   TRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMF  530
             +R +ISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR+++ H+F
Sbjct  93    SRFVISSEPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRISSTHLF  152

Query  531   SPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQ-  707
             SPRRIA  EGVR  I  +M+ K+ K     G VEV+ V+  GSL NV+ +VFG       
Sbjct  153   SPRRIASFEGVRVGIGMKMVKKI-KNAAGDGDVEVKEVIHFGSLNNVMTTVFGESYDFDE  211

Query  708   ----GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK  875
                 G  L  +V EGYEL+G FNW D+F +    DF G +++C  L   VN  VG IIEK
Sbjct  212   VNGDGSFLERLVSEGYELLGIFNWSDHFGVLRWFDFQGVRKRCRALVSEVNTFVGGIIEK  271

Query  876   RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
              K + +         +DF+ VLL L K+++L+D+D++AVLWEMIFRGTDTVAILVEW++A
Sbjct  272   HKMK-KKNNNVNGEESDFVDVLLGLQKDEKLSDSDMIAVLWEMIFRGTDTVAILVEWVLA  330

Query  1056  RMVLHQDVQAKAQLEIDTCVGP-SRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             RMVLHQD+QA+   EI +     +R + DSDIP LPYLQA+VKE LRLHPPGPLLSWARL
Sbjct  331   RMVLHQDIQAELYKEIASVTSNNTRSLSDSDIPKLPYLQAVVKETLRLHPPGPLLSWARL  390

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME-EEVSIMGSDLRLAP  1409
             A+HDV+V    +PAGT AMVNMW+ITHD KIW DP  FRPERF++ E+VSIMGSDLRLAP
Sbjct  391   AIHDVHVGPNLVPAGTIAMVNMWSITHDAKIWTDPEEFRPERFIDGEDVSIMGSDLRLAP  450

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMKKHL  1568
             FGSGRRVCPG+A+GL+TVHLW+ + +Q+F+W+ G S VDL+E LKLS+EMKK L
Sbjct  451   FGSGRRVCPGKAMGLATVHLWVGQMIQNFEWVKGSSDVDLAEVLKLSMEMKKPL  504



>emb|CDY36404.1| BnaC05g10050D [Brassica napus]
Length=516

 Score =   490 bits (1262),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 264/474 (56%), Positives = 330/474 (70%), Gaps = 16/474 (3%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMAFSLGT  350
             GG AW    +++    + GP      G L    GS+ HR LAS+A     + LMAFS+G 
Sbjct  38    GGLAWAWTKSSKTRVSIPGPS-----GSLSIFSGSNPHRVLASLAKRFKASPLMAFSVGF  92

Query  351   TRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMF  530
             +R +ISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR+++ H+F
Sbjct  93    SRFVISSEPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRISSTHLF  152

Query  531   SPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQ-  707
             SPRRIA  EGVR  I   MI K  K +   G VEV+ V+  GSL NV+ +VFG       
Sbjct  153   SPRRIASFEGVRVGIGM-MIVKKIKNVAGGGEVEVKKVIHFGSLNNVMTTVFGESYDFDE  211

Query  708   ----GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK  875
                 G  L  +V EGYEL+G FNW D+F +    DF G +++C  L   VN  VG IIEK
Sbjct  212   VNGDGSFLERLVSEGYELLGIFNWSDHFGVLRWFDFQGVRKRCRALVSEVNTFVGGIIEK  271

Query  876   RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
              K +           +DF+ VLL L K+++L+D+D++AVLWEMIFRGTDTVAILVEW++A
Sbjct  272   HKMKMN-NNNLNGEESDFVDVLLGLQKDEKLSDSDMIAVLWEMIFRGTDTVAILVEWVIA  330

Query  1056  RMVLHQDVQAKAQLEIDTCVGP-SRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             RMVLHQD+QA    EI +     +R + DSDIP LPYLQA+VKE LRLHPPGPLLSWARL
Sbjct  331   RMVLHQDIQADLYKEIASVTSNNTRSLSDSDIPKLPYLQAVVKETLRLHPPGPLLSWARL  390

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME-EEVSIMGSDLRLAP  1409
             A+HD +V    +PAGT AMVNMW+ITHD +IW DP  FRPERF++ E+VSIMGSDLRLAP
Sbjct  391   AIHDAHVGPNLVPAGTIAMVNMWSITHDARIWTDPEEFRPERFIDGEDVSIMGSDLRLAP  450

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKKHL  1568
             FGSGRRVCPG+A+GL+TVHLW+ + +Q+F+W+ G   VDL+E LKLS+EMKK L
Sbjct  451   FGSGRRVCPGKAMGLATVHLWVGQMIQNFEWVKGSCDVDLTEVLKLSMEMKKPL  504



>ref|XP_010495542.1| PREDICTED: cytochrome P450 78A5-like [Camelina sativa]
Length=516

 Score =   490 bits (1261),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 262/483 (54%), Positives = 338/483 (70%), Gaps = 20/483 (4%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRL  329
             + F++  GG AW    ++++   + GP      G L    G++ HR LA++A     + L
Sbjct  31    VAFFLSPGGLAWAWTGSSKDRVAIPGPS-----GSLSVFSGANPHRVLAALAKRFKASPL  85

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFS+G +R +ISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR
Sbjct  86    MAFSVGFSRFVISSEPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRR  145

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesg--fvevrgvvgegSLRNVVESV  683
             +++ H+FSPRRIA  EGVR  I  +M+ K+   +       VEV+ +V  GSL NV+ +V
Sbjct  146   ISSTHLFSPRRIASFEGVRVGIGMKMVKKIKSLVTSDACGEVEVKKIVHFGSLNNVMTTV  205

Query  684   FGSCLGLQ-----GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             FG           G  L  +V EGYEL+G+FNW D+F L    DF G +++C  L   VN
Sbjct  206   FGESYDFDEVNGDGCFLERLVSEGYELLGKFNWSDHFWLLRWFDFQGVRKRCRALVSEVN  265

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               VG II+K K +    + N  N  DF+ VLL L K+++L+D+D++AVLWEMIFRGTDTV
Sbjct  266   TFVGGIIDKHKMK----KSNNLNGEDFVDVLLGLQKDEKLSDSDMIAVLWEMIFRGTDTV  321

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCV-GPSRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             AILVEW++ARMVLHQD+Q K   EI +     +R + DSDIP LPYLQAIVKE LRLHPP
Sbjct  322   AILVEWVLARMVLHQDIQDKLYKEIASATSNNTRSLSDSDIPKLPYLQAIVKETLRLHPP  381

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-EEEVSI  1382
             GPLLSWARLA+HDV+V    +PAGT AMVNMW+ITHD KIW DP  F P+RF+  E+VSI
Sbjct  382   GPLLSWARLAIHDVHVGPNLVPAGTIAMVNMWSITHDAKIWTDPEVFNPDRFIGGEDVSI  441

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMK  1559
             MGSDLRLAPFGSGRRVCPG+A+GL+TVHLW+A+ +Q+F+W+ G   V+L+E LKLS+EMK
Sbjct  442   MGSDLRLAPFGSGRRVCPGKAMGLATVHLWIAQLIQNFEWVKGSCDVELAEVLKLSMEMK  501

Query  1560  KHL  1568
             + L
Sbjct  502   QPL  504



>ref|XP_009123953.1| PREDICTED: cytochrome P450 78A5 [Brassica rapa]
Length=516

 Score =   489 bits (1260),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 263/474 (55%), Positives = 332/474 (70%), Gaps = 16/474 (3%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMAFSLGT  350
             GG AW    +++    + GP      G L    GS+ HR LA++A     + LMAFS+G 
Sbjct  38    GGLAWAWTKSSKTRVSIPGPS-----GSLSIFSGSNPHRVLAALAKRFKASPLMAFSVGF  92

Query  351   TRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMF  530
             +R +ISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR+++ H+F
Sbjct  93    SRFVISSEPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRISSTHLF  152

Query  531   SPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGL--  704
             SPRRIA  EGVR  I  +M+ K+ K     G VEV+ V+  GSL NV+ +VFG       
Sbjct  153   SPRRIASFEGVRVGIGMKMVKKI-KNAAGDGDVEVKKVIHFGSLNNVMTTVFGESYDFDE  211

Query  705   ---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK  875
                 G  L  +V EGYEL+G FNW D+F +    DF G +++C  L   VN  VG IIEK
Sbjct  212   VNGDGSFLERLVSEGYELLGIFNWSDHFGVLRWFDFQGVRKRCRALVSEVNTFVGGIIEK  271

Query  876   RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMA  1055
              K +           +DF+ VLL L K+++L+D+D++AVLWEMIFRGTDTVAILVEW++A
Sbjct  272   HKMKMN-NNNLNGEESDFVDVLLGLQKDEKLSDSDMIAVLWEMIFRGTDTVAILVEWVLA  330

Query  1056  RMVLHQDVQAKAQLEIDTCV-GPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             RMVLHQD+QA+   EI +     +R + DSDIP LPYLQA+VKE LRLHPPGP LSWARL
Sbjct  331   RMVLHQDIQAELYKEISSVTSNNTRSLSDSDIPKLPYLQAVVKETLRLHPPGPPLSWARL  390

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME-EEVSIMGSDLRLAP  1409
             A+HDV+V    +PAGT AMVNMW+ITHD KI  DP  FRPERF++ E+VSIMGSDLRLAP
Sbjct  391   AIHDVHVGPNLVPAGTIAMVNMWSITHDAKIGTDPEEFRPERFIDGEDVSIMGSDLRLAP  450

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMKKHL  1568
             FGSGRRVCPG+A+GL+TVHLW+ + +Q+F+W+ G S VDL+E LKLS+EMKK L
Sbjct  451   FGSGRRVCPGKAMGLATVHLWVGQMIQNFEWVKGSSDVDLAEVLKLSMEMKKPL  504



>emb|CBI27301.3| unnamed protein product [Vitis vinifera]
Length=499

 Score =   489 bits (1259),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 267/476 (56%), Positives = 330/476 (69%), Gaps = 27/476 (6%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
             FW+  GG AW   +  +    + GP   P  G L    GS AHR LA +A       LMA
Sbjct  36    FWLAPGGLAW-ALAKCRGRFAIPGPPGLPVTGLLHVFSGSEAHRVLAKLARRWDAVGLMA  94

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR ++SS P+TAK IL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++
Sbjct  95    FSVGLTRFVVSSDPETAKGILSSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRIS  154

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSP+RIA  EG R  I  +M+ ++   M E+G VEV+ V+  GSL NV+ +VFG  
Sbjct  155   ATHLFSPKRIAAFEGFRRDICLKMVDEIRGLMVENGEVEVKKVLHFGSLNNVMMTVFGRS  214

Query  696   L----GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                  G  G EL  +V+EGYEL+G FNW D+FPL  LLD  G +++C RLA +VN  VG+
Sbjct  215   YDFDEGGVGFELEKLVREGYELLGTFNWSDHFPLLGLLDLQGVRKRCRRLASKVNVFVGK  274

Query  864   IIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             IIE+ + +  G  ++VN   DF+ VLL L KED+L D+D++AVLWEMIFRGTDTVAIL+E
Sbjct  275   IIEEHRAKRVG-GLSVNGVEDFVDVLLDLEKEDKLTDSDMIAVLWEMIFRGTDTVAILLE  333

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  1223
             WI+ARMVLH ++Q+KAQ EID  VG SR V DSDIPNLPY+Q+IVKE LR+HPPGPLLSW
Sbjct  334   WILARMVLHPEIQSKAQSEIDAMVGNSRPVSDSDIPNLPYVQSIVKESLRVHPPGPLLSW  393

Query  1224  ARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRL  1403
             ARLA  DV++    +PAGTTAMVNMWAITHD K+W +P                   L L
Sbjct  394   ARLATDDVHIGDTLVPAGTTAMVNMWAITHDEKVWPEP-------------------LEL  434

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPG-PSVDLSECLKLSLEMKKHL  1568
             APFGSGRRVCPG+++GL+TVHLWLA+ LQ FKW+P   SVDLSE L LSLEMK  L
Sbjct  435   APFGSGRRVCPGKSMGLATVHLWLAQLLQSFKWVPSHHSVDLSETLNLSLEMKNPL  490



>ref|XP_003554680.1| PREDICTED: cytochrome P450 78A5-like [Glycine max]
Length=516

 Score =   489 bits (1259),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 259/441 (59%), Positives = 324/441 (73%), Gaps = 7/441 (2%)
 Frame = +3

Query  270   GSHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLL  449
             GS  H  L+ +A +    +LMAFS+G TR +ISS P+TAKEIL    F DRPVKESA  L
Sbjct  67    GSTPHSALSKLARTYHAEKLMAFSIGLTRFVISSEPETAKEILGSPGFADRPVKESAYEL  126

Query  450   MFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfv  629
             +F RA+GFAP G YWR LRR++A H+FSP+RI   E  RS +  +M+ ++ K M E+  V
Sbjct  127   LFHRAMGFAPYGEYWRNLRRISALHLFSPKRITSSESFRSKVGLKMVEQVKKTMSENQHV  186

Query  630   evrgvvgegSLRNVVESVFGSCLGL---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLD  800
             EV+ ++   SL NV+ +VFG C      +G EL  +V EGYEL+G FNW D+FP+   LD
Sbjct  187   EVKKILHFSSLNNVMMTVFGKCYEFYEGEGLELEGLVSEGYELLGVFNWSDHFPVLGWLD  246

Query  801   FGGTKRKCHRLAGRVNDLVGQII-EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADA  977
               G +++C  L  +VN  VG +I E R ++  G  +      DF+ VLL L KE++L++A
Sbjct  247   LQGVRKRCRCLVEKVNVFVGGVIKEHRVKRERGDCVKDEGAEDFVDVLLDLEKENRLSEA  306

Query  978   DLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNL  1157
             D++AVLWEMIFRGTDTVAIL+EWI+ARMVLH ++QAKAQ EID   G SR V ++DIPNL
Sbjct  307   DMIAVLWEMIFRGTDTVAILLEWILARMVLHPEIQAKAQREIDFVCGSSRLVSEADIPNL  366

Query  1158  PYLQAIVKEVLRLHPPGPLLSWARLAVHDVYV-DKCFIPAGTTAMVNMWAITHDPKIWND  1334
              YLQ IVKE LR+HPPGPLLSWARLAVHDV V  K  IP GTTAMVNMWAITHD ++W +
Sbjct  367   RYLQCIVKETLRVHPPGPLLSWARLAVHDVTVGGKHVIPKGTTAMVNMWAITHDERVWAE  426

Query  1335  PWTFRPERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--  1508
             P  FRPERF+EE+VSIMGSDLRLAPFGSGRRVCPG+ALGL++VHLWLA+ LQ+F W+   
Sbjct  427   PEKFRPERFVEEDVSIMGSDLRLAPFGSGRRVCPGKALGLASVHLWLAQLLQNFHWVSSD  486

Query  1509  GPSVDLSECLKLSLEMKKHLA  1571
             G SV+L E LKLS+EMKK L+
Sbjct  487   GVSVELDEFLKLSMEMKKPLS  507



>ref|XP_009106488.1| PREDICTED: cytochrome P450 78A5-like [Brassica rapa]
 emb|CDX96516.1| BnaA07g31270D [Brassica napus]
Length=530

 Score =   489 bits (1258),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 257/492 (52%), Positives = 330/492 (67%), Gaps = 22/492 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPK-------KLNGPMSWPFLGFLPQMGSHA--HRKLASMATS  311
             FW+  GGFAW  Y    + +        + GP   P +G L    ++A  HR LA++A S
Sbjct  31    FWLTPGGFAWALYKARSHTRPESKTLPAIPGPSGLPIIGLLLAFVNNALTHRILANIANS  90

Query  312   MGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSY  491
                  LMAFS+G+TR +I+S P TAKEIL  S+F DRPVKESA  L+F RA+GFAP G Y
Sbjct  91    CKAKALMAFSVGSTRFVITSEPGTAKEILNSSAFADRPVKESAYELLFHRAMGFAPFGDY  150

Query  492   WRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNV  671
             WR+LRR+++ H+FSP+RI+     R  I E M+ ++   M   G V ++ ++  GSL NV
Sbjct  151   WRELRRISSTHLFSPKRISSFGESRRKIGETMVEEIKNAMASYGEVHIKRILHFGSLNNV  210

Query  672   VESVFGSCLGLQ-----GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLA  836
             + SVFG             +L  +V EGYEL+G FNW D+FP    LD  G +R+C  L 
Sbjct  211   MSSVFGKTYDFNDGSIVNSKLEHLVSEGYELLGIFNWSDHFPGLRWLDLQGVRRRCRSLV  270

Query  837   GRVNDLVGQIIE--KRKRQF-EGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMI  1007
             G+VN  VG IIE  K KR   +  E    N+ DF+ VLL +    +L+D+D++AVLWEMI
Sbjct  271   GKVNVFVGNIIEEHKSKRSLRDNKEEEGTNDDDFVDVLLGMQGNIKLSDSDMIAVLWEMI  330

Query  1008  FRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKE  1184
             FRGTDTV IL+EWI+ARM+LH D+QAKAQ EID   G + R V DSD+  LPY++AIVKE
Sbjct  331   FRGTDTVTILLEWILARMILHPDIQAKAQAEIDAIEGETGREVSDSDLSKLPYIRAIVKE  390

Query  1185  VLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM  1364
              LR+HPPGPLLSWARL++HD  +   FIPAGTTAMVNMWAITHD K+W +   ++PERF+
Sbjct  391   TLRMHPPGPLLSWARLSIHDTQIGTHFIPAGTTAMVNMWAITHDEKVWPEAHEYKPERFL  450

Query  1365  ----EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSE  1532
                  +   IMGSDLRLAPFG+GRRVCPG+++G++TV LWLA+ L  FKW+P   VDLSE
Sbjct  451   GAQEGDNFPIMGSDLRLAPFGAGRRVCPGKSMGIATVELWLAQLLGSFKWVPCGEVDLSE  510

Query  1533  CLKLSLEMKKHL  1568
              LKLSLEMK  L
Sbjct  511   TLKLSLEMKNSL  522



>ref|XP_008243829.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 78A5 [Prunus 
mume]
Length=508

 Score =   488 bits (1256),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 256/477 (54%), Positives = 331/477 (69%), Gaps = 21/477 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMA  335
             FW+  GG AW  +   +  K + GP  +P +G L    GS  HR LA MA S+    LM+
Sbjct  37    FWLFPGGLAW-AFCKVRAFKAIPGPPGYPLIGSLTVFTGSTRHRVLAKMAKSLKAEALMS  95

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR +ISS P+TAKEIL  S+F +RP  E+A  L+F RA+GFAP G YWR LRR+A
Sbjct  96    FSVGLTRFVISSQPETAKEILNSSAFANRPANETAYELLFYRAMGFAPYGEYWRNLRRIA  155

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             A H+FSP+R+A  E  R     +M  ++   M E G V+++ V+  GSL NV+ +VFG C
Sbjct  156   ATHLFSPKRMAGSEVFRREAGLKMAEEIRSLMVEKGEVQMKNVLHFGSLNNVMMTVFGRC  215

Query  696   LGLQGEELGL----MVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
                     G     +V+EGYEL+G FNW ++FP    LD  G +++C  L  +VN  VG+
Sbjct  216   YEFGEGGEGHELEKLVREGYELLGLFNWNNHFPFLGWLDLQGVRKRCRILVSKVNAFVGK  275

Query  864   IIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             IIE+ + + +G   + + N DF+ VLL++  + +L D+D++AVLWEMIFRGTDTVA L+E
Sbjct  276   IIEEHRLKVKGDNFDTDCNGDFVDVLLAMENDHKLGDSDMIAVLWEMIFRGTDTVATLLE  335

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  1223
             W++ARMVLH ++QAKAQ EID+ VG SR V  SD              LR+HPPGPLLSW
Sbjct  336   WVLARMVLHPEIQAKAQSEIDSAVGASRPVLGSD-------------XLRVHPPGPLLSW  382

Query  1224  ARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRL  1403
             AR+A+HDVYV + FIPAGTTAMVNMWAITHD K+W++P  FRPERF+EEEVSI+G+DLRL
Sbjct  383   ARIAIHDVYVGENFIPAGTTAMVNMWAITHDEKVWSEPKLFRPERFLEEEVSIVGTDLRL  442

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPG--PSVDLSECLKLSLEMKKHL  1568
             APFGSGRRVCPGRALGL++V LWLA+ LQ+F W+P     VDLSECLKLS+EMK  L
Sbjct  443   APFGSGRRVCPGRALGLASVQLWLAQLLQNFNWVPSEKSDVDLSECLKLSMEMKSPL  499



>emb|CDY68665.1| BnaA09g57150D, partial [Brassica napus]
Length=482

 Score =   486 bits (1252),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 259/443 (58%), Positives = 319/443 (72%), Gaps = 14/443 (3%)
 Frame = +3

Query  273   SHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLM  452
             S+ HR LA+++     + LMAFS+G +R +ISS PDTAKEIL  S+F DRPVKESA  L+
Sbjct  31    SNPHRVLAALSQRFKASHLMAFSVGFSRFVISSEPDTAKEILNSSAFADRPVKESAYELL  90

Query  453   FERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesg--f  626
             F RA+GFAP G YWR LRR+A+ H+FSPRRIA  EGVR  I  +M+ K+      S    
Sbjct  91    FHRAMGFAPYGEYWRNLRRIASTHLFSPRRIAGFEGVRVGIGMKMVKKIKSVAMSSAGGE  150

Query  627   vevrgvvgegSLRNVVESVFGSCLGLQ-----GEELGLMVKEGYELIGEFNWGDYFPLGF  791
             VEV+ V+  GSL NV+ +VFG           G  L  +V EGYEL+G FNW D+F +  
Sbjct  151   VEVKKVIHFGSLNNVMTTVFGESYDFDEVNGDGCFLERLVSEGYELLGIFNWSDHFGVLR  210

Query  792   LLDFGGTKRKCHRLAGRVNDLVGQIIEKRKRQFEGIEINVN-NNTDFLSVLLSLPKEDQL  968
               DF G +++C  L   VN  VG IIEK K +      N+N    DF+ VLL L K+++L
Sbjct  211   WFDFQGVRKRCRALVSEVNTFVGSIIEKHKMKARN---NLNGEENDFVDVLLGLQKDEKL  267

Query  969   ADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCV-GPSRHVQDSD  1145
             +D+D++AVLWEMIFRGTDTVAILVEW++ARMVLHQD+QAK   EI +     +R + DSD
Sbjct  268   SDSDMIAVLWEMIFRGTDTVAILVEWVLARMVLHQDIQAKLFKEIASVTSNNTRSLSDSD  327

Query  1146  IPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKI  1325
             I  LPYLQAIVKE LRLHPPGPLLSWARLA+HDV V    IPAGT AMVNMW+ITHD KI
Sbjct  328   ISKLPYLQAIVKETLRLHPPGPLLSWARLAIHDVNVGPNLIPAGTIAMVNMWSITHDAKI  387

Query  1326  WNDPWTFRPERFME-EEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKW  1502
             W DP  F+PERF E E+VSIMGSDLRLAPFG+GRRVCPG+A+GL+TVHLW+A+ +Q+F+W
Sbjct  388   WTDPEEFKPERFTEGEDVSIMGSDLRLAPFGAGRRVCPGKAMGLATVHLWVAQMIQNFEW  447

Query  1503  LPGP-SVDLSECLKLSLEMKKHL  1568
             + G   VDL+E LKLS+EMKK L
Sbjct  448   VKGSCDVDLTEVLKLSMEMKKPL  470



>emb|CDY49134.1| BnaA02g16720D [Brassica napus]
Length=532

 Score =   488 bits (1257),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 255/489 (52%), Positives = 332/489 (68%), Gaps = 19/489 (4%)
 Frame = +3

Query  159   FWVVEGGFAW-----RNYSNNQNPKK--LNGPMSWPFLGFLPQMGSHA--HRKLASMATS  311
             FW+  GGFAW     R ++  Q+  +  + GP   P +G L    ++A  HR LAS+A S
Sbjct  36    FWLTPGGFAWALYKARVHTRQQSKARAAIPGPAGLPIIGLLLAFVNNASTHRILASIANS  95

Query  312   MGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSY  491
                  LMAFS+G+TR +I+S P+TAKE+L  S+F DRP+ ESA  L+F R++GFAP G Y
Sbjct  96    CNAKALMAFSVGSTRFVITSEPETAKELLNSSAFADRPLNESAYELLFHRSMGFAPFGDY  155

Query  492   WRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNV  671
             WR+LRR+++ H+FSP+RI+     R  I   M+  ++  M   G VE+R ++  GSL NV
Sbjct  156   WRELRRISSTHLFSPKRISGFAESRRKIGNSMVEDINSAMASYGEVEIRRILHFGSLNNV  215

Query  672   VESVFGSCLGLQG--EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRV  845
             + +VFG          EL   V EGYEL+G FNWGD+FP    LD  G +R+C  L G+V
Sbjct  216   MSTVFGRTYDFNDGTNELEHFVSEGYELLGIFNWGDHFPGARWLDLQGVRRRCRSLVGKV  275

Query  846   NDLVGQIIE---KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRG  1016
             N  VG II+    ++   +  E    N  DF+ VLL +    +L+++D++AVLWEMIFRG
Sbjct  276   NVFVGNIIDDHISKRSLHDSQEEESTNEDDFVDVLLGMQGNSKLSNSDMIAVLWEMIFRG  335

Query  1017  TDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKEVLR  1193
             TDTVAIL+EWI+ARM+LH D+QAKAQ EID  VG S R V DSD+  LPYL+AIVKE LR
Sbjct  336   TDTVAILLEWILARMILHPDIQAKAQAEIDVIVGESGRQVSDSDLSKLPYLRAIVKETLR  395

Query  1194  LHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEE  1373
             +HPPGPLL+WARL +HD  +   FIPAGTTAMVNMWAITHD K+W +   ++P+RF+   
Sbjct  396   MHPPGPLLAWARLTIHDTQIGTHFIPAGTTAMVNMWAITHDEKVWPEAHEYKPDRFLGAP  455

Query  1374  VS----IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLK  1541
              S    IMGSDLRLAPFG+GRRVCPG+++G++TV LWLA+ L  FKW+P   VDLSE LK
Sbjct  456   ESGNFPIMGSDLRLAPFGAGRRVCPGKSMGIATVELWLAQLLGRFKWVPCGEVDLSETLK  515

Query  1542  LSLEMKKHL  1568
             LSLEMK  L
Sbjct  516   LSLEMKNPL  524



>ref|XP_009128027.1| PREDICTED: cytochrome P450 78A5-like [Brassica rapa]
 ref|XP_009128028.1| PREDICTED: cytochrome P450 78A5-like [Brassica rapa]
Length=532

 Score =   488 bits (1256),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 255/489 (52%), Positives = 332/489 (68%), Gaps = 19/489 (4%)
 Frame = +3

Query  159   FWVVEGGFAW-----RNYSNNQNPKK--LNGPMSWPFLGFLPQMGSHA--HRKLASMATS  311
             FW+  GGFAW     R ++  Q+  +  + GP   P +G L    ++A  HR LAS+A S
Sbjct  36    FWLTPGGFAWALYKARVHTRQQSKARAAIPGPAGLPIIGLLLAFVNNASTHRILASIANS  95

Query  312   MGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSY  491
                  LMAFS+G+TR +I+S P+TAKE+L  S+F DRP+ ESA  L+F R++GFAP G Y
Sbjct  96    CNAKALMAFSVGSTRFVITSEPETAKELLNSSAFADRPLNESAYELLFHRSMGFAPFGDY  155

Query  492   WRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNV  671
             WR+LRR+++ H+FSP+RI+     R  I   M+  ++  M   G VE+R ++  GSL NV
Sbjct  156   WRELRRISSTHLFSPKRISGFAESRRKIGNSMVEDINSAMASYGEVEIRRILHFGSLNNV  215

Query  672   VESVFGSCLGLQG--EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRV  845
             + +VFG          EL   V EGYEL+G FNWGD+FP    LD  G +R+C  L G+V
Sbjct  216   MSTVFGRTFYFNDGTNELEHFVSEGYELLGIFNWGDHFPGARWLDLQGVRRRCRSLVGKV  275

Query  846   NDLVGQIIE---KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRG  1016
             N  VG II+    ++   +  E    N  DF+ VLL +    +L+++D++AVLWEMIFRG
Sbjct  276   NVFVGNIIDDHISKRSLHDSQEEESTNEDDFVDVLLGMQGNSKLSNSDMIAVLWEMIFRG  335

Query  1017  TDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKEVLR  1193
             TDTVAIL+EWI+ARM+LH D+QAKAQ EID  VG S R V DSD+  LPYL+AIVKE LR
Sbjct  336   TDTVAILLEWILARMILHPDIQAKAQAEIDVIVGESGRQVSDSDLSKLPYLRAIVKETLR  395

Query  1194  LHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEE  1373
             +HPPGPLL+WARL +HD  +   FIPAGTTAMVNMWAITHD K+W +   ++P+RF+   
Sbjct  396   MHPPGPLLAWARLTIHDTQIGTHFIPAGTTAMVNMWAITHDEKVWPEAHEYKPDRFLGAP  455

Query  1374  VS----IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLK  1541
              S    IMGSDLRLAPFG+GRRVCPG+++G++TV LWLA+ L  FKW+P   VDLSE LK
Sbjct  456   ESGNFPIMGSDLRLAPFGAGRRVCPGKSMGIATVELWLAQLLGRFKWVPCGEVDLSETLK  515

Query  1542  LSLEMKKHL  1568
             LSLEMK  L
Sbjct  516   LSLEMKNPL  524



>ref|XP_010458833.1| PREDICTED: cytochrome P450 78A5 [Camelina sativa]
Length=516

 Score =   487 bits (1254),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 262/483 (54%), Positives = 335/483 (69%), Gaps = 20/483 (4%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRL  329
             + F++  GG AW    +++N   + GP      G L    G + HR LA++A     + L
Sbjct  31    VAFFLSPGGLAWAWTGSSKNRVAIPGPS-----GSLSVFSGVNPHRVLAALAKRFKASPL  85

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFS+G +R +ISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR
Sbjct  86    MAFSVGFSRFVISSEPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRR  145

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesg--fvevrgvvgegSLRNVVESV  683
             +++ H+FSPRRI   EGVR  I  +M+ K+   +       VEV+ +V  GSL NV+ +V
Sbjct  146   ISSTHLFSPRRIVSFEGVRVGIGMKMVKKIKSLVTSDACGEVEVKKIVHFGSLNNVMTTV  205

Query  684   FGSCLGLQ-----GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             FG           G  L  +V EGYEL+G FNW D+F L    DF G +++C  L   VN
Sbjct  206   FGESYDFDEVNGVGCFLERLVSEGYELLGIFNWSDHFWLLRWFDFQGVRKRCRALVSEVN  265

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               VG II+K K +    + N  N  DF+ VLL L K+++L+D+D++AVLWEMIFRGTDTV
Sbjct  266   TFVGGIIDKHKMK----KSNNLNGEDFVDVLLGLQKDEKLSDSDMIAVLWEMIFRGTDTV  321

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCV-GPSRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             AILVEW++ARMVLHQD+Q K   EI +     +R + DSDIP LPYLQAIVKE LRLHPP
Sbjct  322   AILVEWVLARMVLHQDIQDKLYKEIASATSNNTRSLSDSDIPKLPYLQAIVKETLRLHPP  381

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-EEEVSI  1382
             GPLLSWARLA+HDV+V    +PAGT AMVNMW+ITHD KIW DP  F P+RF+  E+VSI
Sbjct  382   GPLLSWARLAIHDVHVGPNLVPAGTIAMVNMWSITHDAKIWTDPEVFNPDRFIGGEDVSI  441

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMK  1559
             MGSDLRLAPFGSGRRVCPG+A+GL+TVHLW+A+ +Q+F+W+ G   V+L+E LKLS+EMK
Sbjct  442   MGSDLRLAPFGSGRRVCPGKAMGLATVHLWIAQLIQNFEWVKGSCDVELAEVLKLSMEMK  501

Query  1560  KHL  1568
             + L
Sbjct  502   QPL  504



>ref|XP_008810738.1| PREDICTED: cytochrome P450 78A5-like [Phoenix dactylifera]
Length=510

 Score =   487 bits (1253),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 284/478 (59%), Positives = 349/478 (73%), Gaps = 18/478 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAF  338
             FW   GG AW   S ++  + + GP   P +  L   G+ AHR LA +A S+    LMAF
Sbjct  35    FWFYPGGLAW---SISRVGRSIPGP---PGI-ILALSGTAAHRALAGLARSLQAVPLMAF  87

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S+G TR ++SSHPDTAKEIL  S+F DRP+KESA  L+F RA+GFAP G YWR LRR++A
Sbjct  88    SVGFTRFVVSSHPDTAKEILNSSAFADRPIKESAYELLFHRAMGFAPFGEYWRNLRRISA  147

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              ++FSPRRI+     R  I E+M+ ++ + MG  G VEV+ ++  GSL NV+ SVFG   
Sbjct  148   TYLFSPRRISAFGQHRREIGEQMVNEVKELMGTYGEVEVKRLLHFGSLNNVMMSVFGKRF  207

Query  699   GL---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                  +G EL  +V+EGYEL+G FNW D+FP+   LD  G +++C RL  RVN  VG+II
Sbjct  208   DFGKGEGMELEGLVREGYELLGVFNWSDHFPVLGWLDLQGVRKRCRRLVRRVNVFVGKII  267

Query  870   E---KRKRQFEG-IEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
             E   + +R+F G +E  V    DF+ VLL L +E++L+DAD+VAVLWEMIFRGTDTVAIL
Sbjct  268   EEHRQNRRKFGGTLEDGVG---DFVDVLLDLEEEEKLSDADMVAVLWEMIFRGTDTVAIL  324

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EWIMARMVLH D+Q+KAQ EID  VG SR V DSDIPNLPYLQ+IVKE LR+HPPGPLL
Sbjct  325   LEWIMARMVLHPDIQSKAQSEIDAVVGNSRLVSDSDIPNLPYLQSIVKESLRMHPPGPLL  384

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDL  1397
             SWARLA+HDV V    +PAGTTAMVNMWAITHD  IW +P  F P+RFM E VSI+GSDL
Sbjct  385   SWARLAIHDVNVGNHLVPAGTTAMVNMWAITHDESIWPEPGEFDPKRFMAEGVSILGSDL  444

Query  1398  RLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKKHL  1568
             RLAPFGSGRRVCPG+A+ L+TVHLWLA+ LQ FKW+P    VDLSECLK+SLEMK  L
Sbjct  445   RLAPFGSGRRVCPGKAMALATVHLWLAQLLQCFKWVPSEGGVDLSECLKMSLEMKNPL  502



>ref|XP_006307257.1| hypothetical protein CARUB_v10008872mg [Capsella rubella]
 gb|EOA40155.1| hypothetical protein CARUB_v10008872mg [Capsella rubella]
Length=516

 Score =   487 bits (1253),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 263/476 (55%), Positives = 334/476 (70%), Gaps = 20/476 (4%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMAFSLGT  350
             GG AW    +++N   + GP      G L    GS+ HR L+++A     + LMAFS+G 
Sbjct  38    GGLAWAWTWSSKNHVSIPGPS-----GSLSVFSGSNPHRVLSALAKRFKASPLMAFSVGF  92

Query  351   TRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMF  530
             +R IISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR+++ H+F
Sbjct  93    SRFIISSEPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRISSTHLF  152

Query  531   SPRRIACLEGVRSAIAEEMIGKMDKEMgesg--fvevrgvvgegSLRNVVESVFGSCLGL  704
             SPRRIA  EGVR  I  +M+ K+   +       VEV+ +V  GSL NV+ +VFG     
Sbjct  153   SPRRIASFEGVRVGIGMKMVEKIKTLVTSDACGEVEVKKIVHFGSLNNVMTTVFGESYDF  212

Query  705   Q-----GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                   G  L  +V EGYEL+G FNW D+F L    DF G +++C  L   VN  VG II
Sbjct  213   DDVNGDGCFLERLVSEGYELLGIFNWSDHFWLLRWFDFQGVRKRCRALVSEVNTFVGGII  272

Query  870   EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWI  1049
             EK K +    + N  +  DF+ VLLSL K+++L+D+D++AVLWEMIFRGTDTVAILVEW+
Sbjct  273   EKHKVK----KSNSLSGEDFVDVLLSLQKDEKLSDSDMIAVLWEMIFRGTDTVAILVEWV  328

Query  1050  MARMVLHQDVQAKAQLEIDTCV-GPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWA  1226
             +ARMVLHQD+Q K   EI +     +R + DSDIP LPYLQAIVKE LR+HPPGPLLSWA
Sbjct  329   LARMVLHQDIQDKLYKEIASATSNNTRSLSDSDIPKLPYLQAIVKETLRIHPPGPLLSWA  388

Query  1227  RLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-EEEVSIMGSDLRL  1403
             RLA+HDV+V   F+PAGT AMVNMW+ITHD KIW DP  F P+RF+  E+VSIMGSDLRL
Sbjct  389   RLAIHDVHVGPNFVPAGTIAMVNMWSITHDAKIWTDPEEFNPDRFIGGEDVSIMGSDLRL  448

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKKHL  1568
             APFGSGRRVCPG+A+GL+TVHLW+ + +Q+F+W+ G   V+L+E LKLS+EMK+ L
Sbjct  449   APFGSGRRVCPGKAMGLATVHLWIGQLIQNFEWVRGSGDVELAEVLKLSMEMKQPL  504



>ref|XP_009616350.1| PREDICTED: cytochrome P450 78A5-like [Nicotiana tomentosiformis]
Length=527

 Score =   487 bits (1254),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 260/476 (55%), Positives = 326/476 (68%), Gaps = 10/476 (2%)
 Frame = +3

Query  174   GGFAWR-NYSNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRLMAFSLG  347
             GG AW  + S       + GP   P LG +    S   HR L+ ++ S+    LMAFS+G
Sbjct  43    GGLAWALSKSRVGFRPTIPGPSGLPVLGLVFTFTSSLTHRLLSKLSKSLSATSLMAFSVG  102

Query  348   TTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHM  527
              TR IISS P++AKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LR+M+A H+
Sbjct  103   FTRFIISSQPESAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRSLRKMSATHL  162

Query  528   FSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgeg-SLRNVVESVFGSCLGL  704
             FS +RI+ L   R  I  +M+ ++   M E+        +    SL NV+ SVFG C   
Sbjct  163   FSHKRISSLGECRREIGNKMVSEIMSLMAETEGKIKVKRILHFGSLNNVMSSVFGKCYDF  222

Query  705   ----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
                  G++L  +V EGYEL+G FNW D+FP    LD  G +R+C  LA +VN  VG+IIE
Sbjct  223   ITDNDGQKLEFLVCEGYELLGIFNWSDHFPFLGWLDLQGVRRRCRDLATKVNIFVGKIIE  282

Query  873   KR--KRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEW  1046
             +   KR   G  +     +DF+ VLL L K+++L++ D++AVLWEMIFRGTDTVAIL+EW
Sbjct  283   EHRVKRAENGGVVADEGLSDFVDVLLDLEKDNKLSNTDMIAVLWEMIFRGTDTVAILLEW  342

Query  1047  IMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWA  1226
             I+ARMVLH ++QAKAQ EID  VG ++ V D D+P L YLQAIVKE LR+HPPGPLLSWA
Sbjct  343   ILARMVLHPEIQAKAQQEIDNIVGTNKGVSDFDLPKLTYLQAIVKETLRIHPPGPLLSWA  402

Query  1227  RLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLA  1406
             RLA++D ++   FIPAGTTAMVNMWAIT D  IW  P  F PERF+EE+V+IMGSDLRLA
Sbjct  403   RLAMNDTFIGHHFIPAGTTAMVNMWAITRDENIWPQPEKFMPERFLEEDVAIMGSDLRLA  462

Query  1407  PFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-VDLSECLKLSLEMKKHLA  1571
             PFGSGRRVCPG+ +GL+TV LWLA+ LQ F W+   + VDLSECLKLSLEMK  L 
Sbjct  463   PFGSGRRVCPGKIMGLATVQLWLAQLLQSFNWIASDNGVDLSECLKLSLEMKHSLV  518



>ref|XP_004137603.1| PREDICTED: cytochrome P450 78A3-like [Cucumis sativus]
 gb|KGN64069.1| hypothetical protein Csa_1G039830 [Cucumis sativus]
Length=536

 Score =   487 bits (1254),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 261/482 (54%), Positives = 343/482 (71%), Gaps = 17/482 (4%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMAFSLGT  350
             GG AW   S  +N   + GP   PFLG +     S  HR LA++A ++    LM+FS+G 
Sbjct  39    GGLAWALISKPKNQPIIPGPSGTPFLGQVSTFTNSLTHRLLANLAHTLKAKSLMSFSIGF  98

Query  351   TRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMF  530
             TR +ISS+P TAKE+L  S+F DRP+KESA  L+F RA+GFAP G YWR LRR+++  +F
Sbjct  99    TRFVISSNPITAKELLNSSAFADRPIKESAYELLFHRAMGFAPYGEYWRNLRRISSTFLF  158

Query  531   SPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQG  710
             SP+RI     +R  I  +M+ +++  M ++G VEVR ++  GSL NV+ESVFG  +    
Sbjct  159   SPKRICGFGVLRERIGVKMMKEIEGLMVKNGKVEVRKLLHFGSLSNVMESVFGKSVEFGD  218

Query  711   EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK---RK  881
              E+  +V EGY+L+G FNW D+FP+   LD  G +++C  L G+VN  VG+IIE+   ++
Sbjct  219   WEIEELVSEGYDLLGSFNWSDHFPVLGWLDLQGVRKRCRVLVGKVNVFVGKIIEEHRMKR  278

Query  882   RQFEGIEINVNNNT--------DFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
             R   G E N NNN         DF+ VLL L KE++L D+D++AVLWEMIFRGTDTVAIL
Sbjct  279   RVIVGDEENNNNNNNPNDNEDGDFVDVLLDLEKENKLTDSDMIAVLWEMIFRGTDTVAIL  338

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             +EWI+ARMVLH D+QAK + EID  V  + R++ + D+PNLPYL A+VKE LR+HPPGPL
Sbjct  339   LEWILARMVLHPDIQAKLRSEIDQVVMKTGRNISNLDLPNLPYLHAVVKETLRMHPPGPL  398

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSD  1394
             LSWARLA+HD +V   F+PAGTTAMVNMWAITHD +IW DP  + P RF++++V+IMGSD
Sbjct  399   LSWARLAIHDTHVAGHFVPAGTTAMVNMWAITHDDQIWPDPTIYNPNRFIKDDVAIMGSD  458

Query  1395  LRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSECLKLSLEMKK  1562
             LRLAPFGSGRRVCPG+A+GL+TV LWLA+ +  F+W+   S    V+LSECLKLSLEMK 
Sbjct  459   LRLAPFGSGRRVCPGKAMGLATVELWLAQLVHKFEWVQASSSKNKVNLSECLKLSLEMKH  518

Query  1563  HL  1568
              L
Sbjct  519   PL  520



>ref|XP_003518773.1| PREDICTED: cytochrome P450 78A5-like [Glycine max]
Length=516

 Score =   486 bits (1252),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 259/441 (59%), Positives = 324/441 (73%), Gaps = 7/441 (2%)
 Frame = +3

Query  270   GSHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLL  449
             GS  HR L+ +A +    +LMAFS+G TR +ISS P+TAKEIL   SF DRPVKESA  L
Sbjct  67    GSTPHRALSKLARNYHAEKLMAFSIGLTRFVISSEPETAKEILGSPSFADRPVKESAYEL  126

Query  450   MFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfv  629
             +F RA+GFAP G YWR LRR++A H+FSP+RI   E  RS +  +M+ ++ K M E+  V
Sbjct  127   LFHRAMGFAPYGEYWRNLRRISALHLFSPKRITGSESFRSEVGLKMVEQVKKTMSENQHV  186

Query  630   evrgvvgegSLRNVVESVFGSCLGL---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLD  800
             EV+ ++   SL NV+ +VFG        +G EL  +V EGYEL+G FNW D+FP+   LD
Sbjct  187   EVKKILHFSSLNNVMMTVFGKSYEFYEGEGLELEGLVSEGYELLGVFNWSDHFPVLGWLD  246

Query  801   FGGTKRKCHRLAGRVNDLVGQII-EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADA  977
               G +++C  L  +VN  VG +I E R ++  G  +      DF+ VLL L KE++L++A
Sbjct  247   LQGVRKRCRCLVEKVNVFVGGVIKEHRVKRERGECVKDEGTGDFVDVLLDLEKENRLSEA  306

Query  978   DLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNL  1157
             D++AVLWEMIFRGTDTVAIL+EW +ARMVLH ++QAKAQ EID   G SR V ++DIPNL
Sbjct  307   DMIAVLWEMIFRGTDTVAILLEWTLARMVLHPEIQAKAQREIDFVCGSSRPVSEADIPNL  366

Query  1158  PYLQAIVKEVLRLHPPGPLLSWARLAVHDVYV-DKCFIPAGTTAMVNMWAITHDPKIWND  1334
              YLQ IVKE LR+HPPGPLLSWARLAVHDV V  K  IP GTTAMVNMWAITHD ++W +
Sbjct  367   RYLQCIVKETLRVHPPGPLLSWARLAVHDVTVGGKHVIPKGTTAMVNMWAITHDERVWAE  426

Query  1335  PWTFRPERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--  1508
             P  FRPERF+EE+VSIMGSDLRLAPFGSGRRVCPG+ALGL++VHLWLA+ LQ+F W+   
Sbjct  427   PEKFRPERFVEEDVSIMGSDLRLAPFGSGRRVCPGKALGLASVHLWLAQLLQNFHWVSSD  486

Query  1509  GPSVDLSECLKLSLEMKKHLA  1571
             G SV+L E LKLS+EMKK L+
Sbjct  487   GVSVELDEFLKLSMEMKKPLS  507



>emb|CDY16102.1| BnaC08g40210D [Brassica napus]
Length=484

 Score =   485 bits (1248),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 258/447 (58%), Positives = 318/447 (71%), Gaps = 22/447 (5%)
 Frame = +3

Query  273   SHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLM  452
             SH HR LA++A     + LMAFS+G +R +ISS PDTAKEIL  S+F DRPVKESA  L+
Sbjct  33    SHPHRVLAALAQRFKASHLMAFSVGFSRFVISSEPDTAKEILNSSAFADRPVKESAYELL  92

Query  453   FERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesg--f  626
             F RA+GFAP G YWR LRR+A+ H+FSPRRIA   GVR  I  +++ K+      S    
Sbjct  93    FHRAMGFAPYGEYWRNLRRIASTHLFSPRRIAGFVGVRVGIGMKIVKKIKSVAMSSAGGE  152

Query  627   vevrgvvgegSLRNVVESVFGSCLGLQ-----GEELGLMVKEGYELIGEFNWGDYFPLGF  791
             V+V+ V+  GSL NV+ +VFG           G  L  +V EGYEL+G FNW D+F +  
Sbjct  153   VDVKKVIHFGSLNNVMTTVFGESYDFDEVNGDGCFLERLVSEGYELLGIFNWSDHFGVLR  212

Query  792   LLDFGGTKRKCHRLAGRVNDLVGQIIEKRKRQFEGIEINVNNN-----TDFLSVLLSLPK  956
               DF G +++C  L   VN  VG IIEK K       +  +NN      DF+ VLL L K
Sbjct  213   WFDFQGVRKRCRALVSEVNTFVGSIIEKHK-------MKASNNLDGEENDFVDVLLGLQK  265

Query  957   EDQLADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCV-GPSRHV  1133
             +++L+D+D++AVLWEMIFRGTDTVAILVEW++ARMVLHQD+QAK   EI +     +R +
Sbjct  266   DEKLSDSDMIAVLWEMIFRGTDTVAILVEWVLARMVLHQDIQAKLFKEIASVTSNNTRSL  325

Query  1134  QDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITH  1313
              DSDI  LPYLQAIVKE LRLHPPGPLLSWARLA+HDV V    IPAGT AMVNMW+ITH
Sbjct  326   SDSDISKLPYLQAIVKETLRLHPPGPLLSWARLAIHDVNVGPNLIPAGTIAMVNMWSITH  385

Query  1314  DPKIWNDPWTFRPERFME-EEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQ  1490
             D KIW DP  F+PERF E E+VSIMGSDLRLAPFG+GRRVCPG+A+GL+TVHLW+A+ +Q
Sbjct  386   DAKIWTDPEEFKPERFTEGEDVSIMGSDLRLAPFGAGRRVCPGKAMGLATVHLWVAQMIQ  445

Query  1491  HFKWLPGP-SVDLSECLKLSLEMKKHL  1568
             +F+W+ G   VDL+E LKLS+EMKK L
Sbjct  446   NFEWVKGSCDVDLTEVLKLSMEMKKPL  472



>ref|XP_002888965.1| CYP78A10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65224.1| CYP78A10 [Arabidopsis lyrata subsp. lyrata]
Length=537

 Score =   486 bits (1252),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 253/495 (51%), Positives = 331/495 (67%), Gaps = 24/495 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYS-------NNQNPKKLNGPMSWPFLGFLPQMGSHA--HRKLASMATS  311
             FW+  GGFAW  Y         ++    + GP   P  G L    ++A  HR L ++A +
Sbjct  36    FWLTPGGFAWALYKARFHTRPESKTGPAIPGPSGLPIFGLLLAFVNNALTHRILTNIADT  95

Query  312   MGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSY  491
                  LMAFS+G+TR +I+S P+TAK +L  S+F DRPVKESA  L+F RA+GFAP G Y
Sbjct  96    CKAKALMAFSVGSTRFVITSEPETAKVLLNSSAFVDRPVKESAYELLFHRAMGFAPFGDY  155

Query  492   WRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNV  671
             WR+LRR+++ H+FSP+RI+     R  I ++M+G++   M   G V ++ ++  GSL NV
Sbjct  156   WRELRRISSTHLFSPKRISSFGESRRKIGQDMVGEIKNSMESYGEVHIKKILHFGSLNNV  215

Query  672   VESVFGSCLGL--------QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCH  827
             + SVFG             +  EL  +V EGYEL+G FNW D+FP    LD  G +R+C 
Sbjct  216   MSSVFGKTYNFNEGIVYSKESIELEHLVSEGYELLGIFNWSDHFPGMRWLDLQGVRRRCR  275

Query  828   RLAGRVNDLVGQII--EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWE  1001
              L G+VN  VG+II   K KR     +     + DF++VLL +    +L+D+D++AVLWE
Sbjct  276   SLVGKVNVFVGKIINDHKSKRSLRDNQEESTYDDDFVNVLLGMHGNSKLSDSDMIAVLWE  335

Query  1002  MIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVG-PSRHVQDSDIPNLPYLQAIV  1178
             MIFRGTDTVAIL+EWI+ RM+LH D+QAKAQ EID  VG P R V DSD+  LPY++AI+
Sbjct  336   MIFRGTDTVAILLEWILVRMILHPDIQAKAQAEIDGIVGDPERQVSDSDLSKLPYVRAII  395

Query  1179  KEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPER  1358
             KE LR+HPPGPLLSWAR ++HD  +   FIPAGTTAMVNMWAITHD K+W +   ++PER
Sbjct  396   KETLRMHPPGPLLSWARRSIHDTQIGTHFIPAGTTAMVNMWAITHDEKVWPEAHEYKPER  455

Query  1359  FM-EEEVS---IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDL  1526
             F+  +E+    IMGSDLRLAPFG+GRRVCPG+ +GL+TV LWLA+ L  FKW+P   VDL
Sbjct  456   FLGAQEIDNFPIMGSDLRLAPFGAGRRVCPGKTMGLATVELWLAQLLGSFKWVPCGEVDL  515

Query  1527  SECLKLSLEMKKHLA  1571
             SE LKLSLEMK  L 
Sbjct  516   SETLKLSLEMKNTLV  530



>ref|XP_009117978.1| PREDICTED: cytochrome P450 78A5-like [Brassica rapa]
Length=515

 Score =   485 bits (1249),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 266/483 (55%), Positives = 332/483 (69%), Gaps = 21/483 (4%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMG-SHAHRKLASMATSMGLNRL  329
             + F++  GG AW   +  ++   + GP      G L     S+ HR LA++A     + L
Sbjct  31    VAFFLSPGGLAW---ACTKSRVSIPGPS-----GSLAVFSRSNPHRVLAALAQRFKASHL  82

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFS+G +R +ISS PDTAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR
Sbjct  83    MAFSVGFSRFVISSEPDTAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRR  142

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesg--fvevrgvvgegSLRNVVESV  683
             +A+ H+FSPRRIA  EGVR  I  +M+ K+      S    VEV+ V+  GSL NV+ +V
Sbjct  143   IASTHLFSPRRIAGFEGVRVGIGMKMVKKIKSVAMSSAGGEVEVKKVIHFGSLNNVMTTV  202

Query  684   FGSCLGLQ-----GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             FG           G  L  +V EGYEL+G FNW D+F +    DF G +++C  L   VN
Sbjct  203   FGESYDFDEVNGDGCFLERLVSEGYELLGIFNWSDHFGVLRWFDFQGVRKRCRALVSEVN  262

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               VG IIEK K +         N  DF+ VLL L K+++L+D+D++AVLWEMIFRGTDTV
Sbjct  263   TFVGSIIEKHKMKARNNLTGEEN--DFVDVLLGLQKDEKLSDSDMIAVLWEMIFRGTDTV  320

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGP-SRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             AILVEW++ARMVLHQD+QAK   EI +     +R + DSDI  LPYLQAIVKE LRLHPP
Sbjct  321   AILVEWVLARMVLHQDIQAKLFKEIASVTSNNTRSLSDSDISKLPYLQAIVKETLRLHPP  380

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME-EEVSI  1382
             GPLLSWARLA+HDV V    IPAGT AMVNMW+ITHD KIW DP  F+PERF E E+VSI
Sbjct  381   GPLLSWARLAIHDVNVGPNLIPAGTIAMVNMWSITHDAKIWTDPEVFKPERFTEGEDVSI  440

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMK  1559
             MGSDLRLAPFG+G RVCPG+A+GL+T+HLW+A+ +Q+F+W+ G   VDL+E LKLS+EMK
Sbjct  441   MGSDLRLAPFGAGSRVCPGKAMGLATIHLWVAQMIQNFEWVKGSCDVDLTEVLKLSMEMK  500

Query  1560  KHL  1568
             K L
Sbjct  501   KPL  503



>gb|KCW83756.1| hypothetical protein EUGRSUZ_B00627 [Eucalyptus grandis]
Length=437

 Score =   482 bits (1241),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 252/426 (59%), Positives = 312/426 (73%), Gaps = 13/426 (3%)
 Frame = +3

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFS+G TR +ISS P++A+E+L  S+F DRPVKESA  L+F RA+GFAP G YWR LRR
Sbjct  1     MAFSVGLTRFVISSEPESAREMLSSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRR  60

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             ++A H+FSPRRIA     R+ I  +M+G +   M E G V VR V+  GSL NV+ +VFG
Sbjct  61    ISATHLFSPRRIAASGKSRARIGLQMVGDIRALMEERGEVGVRKVLHLGSLNNVMSTVFG  120

Query  690   SCL------GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVND  851
                      G  G EL  +V EGYEL+G FNWGD+FPL   LD  G +R+C RL  +VN 
Sbjct  121   RSYDFGDRNGGGGVELERLVSEGYELLGGFNWGDHFPLLRSLDLQGVRRRCRRLCEKVNA  180

Query  852   LVGQIIEK---RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTD  1022
              VG I+E    R+ + E  +    N  DF+ VLL L KE++L+D+D++AVLWEMIFRGTD
Sbjct  181   FVGAIVEDHRMRRLKVERSDEEDENAGDFVDVLLDLQKENRLSDSDMIAVLWEMIFRGTD  240

Query  1023  TVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHP  1202
             TVAIL+EWI+ARMVLH D+QAKAQ EID  +G +R V+DSD+P LPYL+AIVKE LR+HP
Sbjct  241   TVAILLEWILARMVLHPDIQAKAQSEIDAAIGSARPVEDSDLPRLPYLRAIVKETLRVHP  300

Query  1203  PGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME---EE  1373
             PGPLLSWARLAV D +V   F+PAGTTAMVNMWAITHD  +W DP  F+PERF+     E
Sbjct  301   PGPLLSWARLAVQDTHVGGHFVPAGTTAMVNMWAITHDEAVWPDPEEFKPERFVAGDGGE  360

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSL  1550
               IMGSDLRLAPFG+GRRVCPG+A+GL+TV LWLA+ LQ +KW+     VDLSE LKL++
Sbjct  361   FPIMGSDLRLAPFGAGRRVCPGKAMGLATVELWLAQLLQSYKWVGSDRGVDLSERLKLTM  420

Query  1551  EMKKHL  1568
             EMK+ L
Sbjct  421   EMKQSL  426



>ref|XP_004157482.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 78A3-like [Cucumis 
sativus]
Length=536

 Score =   486 bits (1250),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 260/482 (54%), Positives = 342/482 (71%), Gaps = 17/482 (4%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQM-GSHAHRKLASMATSMGLNRLMAFSLGT  350
             GG AW      +N   + GP   PFLG +     S  HR LA++A ++    LM+FS+G 
Sbjct  39    GGLAWAXNFKAKNQPIIPGPSGTPFLGQVSTFTNSLTHRLLANLAHTLKAKSLMSFSIGF  98

Query  351   TRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMF  530
             TR +ISS+P TAKE+L  S+F DRP+KESA  L+F RA+GFAP G YWR LRR+++  +F
Sbjct  99    TRFVISSNPITAKELLNSSAFADRPIKESAYELLFHRAMGFAPYGEYWRNLRRISSTFLF  158

Query  531   SPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQG  710
             SP+RI     +R  I  +M+ +++  M ++G VEVR ++  GSL NV+ESVFG  +    
Sbjct  159   SPKRICGFGVLRERIGVKMMKEIEGLMVKNGKVEVRKLLHFGSLSNVMESVFGKSVEFGD  218

Query  711   EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEK---RK  881
              E+  +V EGY+L+G FNW D+FP+   LD  G +++C  L G+VN  VG+IIE+   ++
Sbjct  219   WEIEELVSEGYDLLGSFNWSDHFPVLGWLDLQGVRKRCRVLVGKVNVFVGKIIEEHRMKR  278

Query  882   RQFEGIEINVNNNT--------DFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
             R   G E N NNN         DF+ VLL L KE++L D+D++AVLWEMIFRGTDTVAIL
Sbjct  279   RVIVGDEENNNNNNNPNDNEDGDFVDVLLDLEKENKLTDSDMIAVLWEMIFRGTDTVAIL  338

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             +EWI+ARMVLH D+QAK + EID  V  + R++ + D+PNLPYL A+VKE LR+HPPGPL
Sbjct  339   LEWILARMVLHPDIQAKLRSEIDQVVMKTGRNISNLDLPNLPYLHAVVKETLRMHPPGPL  398

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSD  1394
             LSWARLA+HD +V   F+PAGTTAMVNMWAITHD +IW DP  + P RF++++V+IMGSD
Sbjct  399   LSWARLAIHDTHVAGHFVPAGTTAMVNMWAITHDDQIWPDPTIYNPNRFIKDDVAIMGSD  458

Query  1395  LRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSECLKLSLEMKK  1562
             LRLAPFGSGRRVCPG+A+GL+TV LWLA+ +  F+W+   S    V+LSECLKLSLEMK 
Sbjct  459   LRLAPFGSGRRVCPGKAMGLATVELWLAQLVHKFEWVQASSSKNKVNLSECLKLSLEMKH  518

Query  1563  HL  1568
              L
Sbjct  519   PL  520



>ref|XP_010428380.1| PREDICTED: cytochrome P450 78A5-like [Camelina sativa]
Length=538

 Score =   485 bits (1248),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 256/495 (52%), Positives = 330/495 (67%), Gaps = 25/495 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYS--------NNQNPKKLNGPMSWPFLGFLPQMGSHA--HRKLASMAT  308
             FW+  GGFAW  Y         +   P  + GP   P +G L    ++A   R LA +A 
Sbjct  36    FWLTPGGFAWALYKVRFHTRPYSKTGPAAIPGPSGLPIIGLLLAFINNALTQRILADIAD  95

Query  309   SMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGS  488
             +     LMAFS+G+TR +I+S P+TAKE+L  S F DRPVKESA  L+F RA+GFAP G 
Sbjct  96    TCKAKALMAFSVGSTRFVITSEPETAKELLNSSVFADRPVKESAYELLFYRAMGFAPFGD  155

Query  489   YWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRN  668
             YWR+LRR+++ H+FSP+RI+ L   R  I + M+ ++   M   G V+++ ++  GSL N
Sbjct  156   YWRELRRISSTHLFSPKRISGLGESRQKIGQNMVREIKNAMETYGEVQIKKILHFGSLNN  215

Query  669   VVESVFGSCLGL--------QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKC  824
             V+ SVFG             +  EL  +V EGYEL+G FNW D+FP    LD  G +R+C
Sbjct  216   VMSSVFGKTYNFNDGFVYSKESNELEHLVSEGYELLGIFNWSDHFPGMRWLDLQGVRRRC  275

Query  825   HRLAGRVNDLVGQIIE--KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLW  998
               L  +VN  VG+II   K KR     +     + DF+ VLL +   ++L+D+D++AVLW
Sbjct  276   RSLVCKVNVFVGKIINDHKSKRSLRDNQEESTYDDDFVDVLLGIHGNNKLSDSDMIAVLW  335

Query  999   EMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAI  1175
             EMIFRGTDTVAIL+EWI+ARMVLH D+QAKAQ EID  +G S R V DSD+  LPY++AI
Sbjct  336   EMIFRGTDTVAILLEWILARMVLHPDIQAKAQAEIDAIIGDSGRQVSDSDLSKLPYIRAI  395

Query  1176  VKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPE  1355
             VKE LR+HPPGPLLSWARL++HD  +   FIPAGTTAMVNMWAITHD K+W     ++PE
Sbjct  396   VKETLRMHPPGPLLSWARLSIHDTQIGTHFIPAGTTAMVNMWAITHDEKVWPKAHEYKPE  455

Query  1356  RFMEEEVS----IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVD  1523
             RF+  + S    IMGSDLRLAPFG+GRRVCPG+++GL+TV LWLA+ L  FKW+    VD
Sbjct  456   RFLGVKESANFPIMGSDLRLAPFGAGRRVCPGKSMGLATVELWLAQLLGSFKWVSCGEVD  515

Query  1524  LSECLKLSLEMKKHL  1568
             LSE LKLSLEMK  L
Sbjct  516   LSETLKLSLEMKNTL  530



>ref|XP_006856424.1| hypothetical protein AMTR_s00047p00221540 [Amborella trichopoda]
 gb|ERN17891.1| hypothetical protein AMTR_s00047p00221540 [Amborella trichopoda]
Length=535

 Score =   484 bits (1246),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 263/482 (55%), Positives = 324/482 (67%), Gaps = 14/482 (3%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLG-FLPQMGSHAHRKLASMATSMGLNRLMAF  338
             W+  GGFAW      Q    +NGP  +PFLG F       AH KLAS A  +    LMAF
Sbjct  43    WLTPGGFAWSLVKTTQT--HINGPFGFPFLGQFFMFSSPLAHSKLASTAKYLNSTGLMAF  100

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             SLG TR+IISS P TAK+IL   SF +RP+KESA  LMF RA+GFAP G YWR LRR++A
Sbjct  101   SLGFTRVIISSSPLTAKDILNSPSFANRPIKESAYNLMFHRAMGFAPYGDYWRNLRRISA  160

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              ++FSPRRI      R    E MI ++   M     V VR ++  GSL +V++ VFG   
Sbjct  161   TYLFSPRRIEGSSFYRKVCGERMIEEIAVAMKRERVVAVRKILHLGSLNHVMKVVFGRDF  220

Query  699   GLQ---GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                   G EL  +V+EGYEL+G FNWGD+      LD  G +++   LA RV   VG+II
Sbjct  221   DFNRGDGIELMDLVREGYELLGSFNWGDHVHFLGWLDLNGVRKRSKNLACRVRSFVGKII  280

Query  870   EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWI  1049
             E+ + + E   +  +   DF+ VLL+L  E+ L D+D+VAVLWEMIFRGTDTVAIL+EWI
Sbjct  281   EEHRAKGEANGVLGDGGGDFVDVLLNLHGEEGLGDSDMVAVLWEMIFRGTDTVAILLEWI  340

Query  1050  MARMVLHQDVQAKAQLEIDTC----VGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +ARMVLH ++Q+KAQ EI+       G +    DS I  LPYLQAIVKE LRLHPPGPLL
Sbjct  341   LARMVLHPEIQSKAQFEIEEFAGRFTGKTIPTFDSGINELPYLQAIVKETLRLHPPGPLL  400

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDL  1397
             SWARLA+ DV++   FIP GT AMVNMWAITHD  IW +P  F PERFM E+V ++GSDL
Sbjct  401   SWARLAITDVHIGHSFIPQGTMAMVNMWAITHDENIWENPNNFEPERFMREKVGVLGSDL  460

Query  1398  RLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPG----PSVDLSECLKLSLEMKKH  1565
             RLAPFGSGRRVCPG+A+GL+TVHLWLA+ LQ+F+WLP      SVDLSE L LS+EM++ 
Sbjct  461   RLAPFGSGRRVCPGKAMGLATVHLWLAQLLQNFRWLPSLDEKESVDLSERLMLSMEMERP  520

Query  1566  LA  1571
             L 
Sbjct  521   LV  522



>gb|AJD25189.1| cytochrome P450 CYP78A113 [Salvia miltiorrhiza]
Length=511

 Score =   483 bits (1244),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 260/479 (54%), Positives = 330/479 (69%), Gaps = 18/479 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNY-SNNQNPKKLNGPMSWPFLGFLPQMGSHA--HRKLASMATSMGLNRL  329
              W+  GG AW  Y ++++    + GP   P +G       H+  HR LA ++ +     L
Sbjct  33    LWLTPGGLAWALYRAHSRAAASIPGPSGLPIVGLALSFTHHSLTHRTLARLSKAFKSKPL  92

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFS+G TR ++S   DTA+EIL  S+F DRPVKE+A++LMF+RA+GFAP G YWR LRR
Sbjct  93    MAFSVGFTRFVVSGDRDTAREILSSSAFADRPVKETARMLMFDRAMGFAPYGDYWRSLRR  152

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             ++A H+F PR++A    VR  IA  +      EMG  G V VR ++  GSL NV+ SVFG
Sbjct  153   ISAVHLFGPRQLARHGEVRRGIARRVAAGAAAEMGREGVVRVRSLLHLGSLNNVMMSVFG  212

Query  690   SC--LGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLV  857
                  G  GE  EL  +VKEGYEL+G  NW D+FPL     + G +++  RL  +     
Sbjct  213   KWYEFGESGEGLELEFLVKEGYELLGMLNWSDHFPLPGPFVWQGIRKRSMRLVEK-----  267

Query  858   GQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
                 E R ++   I    + + DF+ VLL L KE +L+D +++AVLWEMIFRGTDTVAIL
Sbjct  268   ----EHRVKRANMIHQEGDESHDFVDVLLDLEKESKLSDLEMIAVLWEMIFRGTDTVAIL  323

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EWI+ARM+LH ++QAKAQ EID  +G ++ V DSD+PNLPY+QAIVKE LRLHPPGPLL
Sbjct  324   LEWILARMILHPEIQAKAQNEIDNAIGLNKMVADSDLPNLPYIQAIVKETLRLHPPGPLL  383

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDL  1397
             SWARLA+HD +V   F+PAGTTAMVNMWAITHD  +W +P  FRPERF+EE+VSIMGSDL
Sbjct  384   SWARLAIHDTHVGPHFVPAGTTAMVNMWAITHDEGVWPEPERFRPERFLEEDVSIMGSDL  443

Query  1398  RLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKHL  1568
             RLAPFGSGRRVCPG+++GL+TV LWLA  L  FKW       VDLSECLKLSLEMK+ L
Sbjct  444   RLAPFGSGRRVCPGKSMGLATVQLWLAHLLHKFKWTACADRGVDLSECLKLSLEMKQPL  502



>ref|XP_006301501.1| hypothetical protein CARUB_v10021927mg [Capsella rubella]
 gb|EOA34399.1| hypothetical protein CARUB_v10021927mg [Capsella rubella]
Length=539

 Score =   483 bits (1243),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 255/494 (52%), Positives = 328/494 (66%), Gaps = 25/494 (5%)
 Frame = +3

Query  162   WVVEGGFAWRNYSN--------NQNPKKLNGPMSWPFLGFLPQMGSHA--HRKLASMATS  311
             W+  GGFAW  Y             P  + GP   P +G L     +A  HR LA +  +
Sbjct  38    WLTPGGFAWALYKARFHTRPDFKTGPVAIPGPSGLPIIGLLLAFTKNALTHRILADIDGT  97

Query  312   MGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSY  491
                  LMAFS+G+TR +I+S P+TAKE+L  S+F DRPVKESA  L+F RA+GFAP G Y
Sbjct  98    CKAKALMAFSVGSTRFVITSEPETAKELLNSSAFADRPVKESAYELLFHRAMGFAPFGDY  157

Query  492   WRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNV  671
             WR+LRR+++ H+FSP+RI+     R  I + M+ ++   M   G V++R ++  GSL NV
Sbjct  158   WRELRRISSTHLFSPKRISGFGESRKNIGQNMVKEIKSSMENFGQVQIREILHFGSLNNV  217

Query  672   VESVFGSCLGL--------QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCH  827
             + SVFG             +  EL  +V EGYEL+G FNW D+FP    LD  G +R+C 
Sbjct  218   MSSVFGKTYNFNDGIVYSKESNELKHLVSEGYELLGIFNWSDHFPGMRWLDLQGVRRRCR  277

Query  828   RLAGRVNDLVGQIIE--KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWE  1001
              L  +VN  VG+II   K KR     +     + DF+ VLL +   ++L+D+D++AVLWE
Sbjct  278   SLVCKVNVFVGKIINDHKSKRSLRDNQGESTYDDDFVDVLLGMHDNNKLSDSDMIAVLWE  337

Query  1002  MIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIV  1178
             MIFRGTDTVAIL+EWI+ARMVLH D+QAKAQ EID  +  S R V DSD+  LPYL+AIV
Sbjct  338   MIFRGTDTVAILLEWILARMVLHPDIQAKAQTEIDAIMCDSGRQVSDSDLSKLPYLRAIV  397

Query  1179  KEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPER  1358
             KE LR+HPPGPLLSWARL++HD  +   FIPAGTTAMVNMWAITHD K+W +   ++PER
Sbjct  398   KETLRMHPPGPLLSWARLSIHDTQIGSHFIPAGTTAMVNMWAITHDEKVWPEAHEYKPER  457

Query  1359  FM----EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDL  1526
             F+     +   IMGSDLRLAPFG+GRRVCPG+++GL+TV LWLA+ L +FKW+P   VDL
Sbjct  458   FLGAQENDNFPIMGSDLRLAPFGAGRRVCPGKSMGLATVELWLAQLLGNFKWVPCGEVDL  517

Query  1527  SECLKLSLEMKKHL  1568
             SE LKLSLEMK  L
Sbjct  518   SETLKLSLEMKNTL  531



>ref|XP_002449497.1| hypothetical protein SORBIDRAFT_05g016750 [Sorghum bicolor]
 gb|EES08485.1| hypothetical protein SORBIDRAFT_05g016750 [Sorghum bicolor]
Length=539

 Score =   483 bits (1243),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 253/473 (53%), Positives = 327/473 (69%), Gaps = 26/473 (5%)
 Frame = +3

Query  201   NNQNPKKLNGPMSWPFLG-FLPQMGSHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHP  377
             N      + GP  WP +G  L   G   HR+LA++A +    RLM+ +LG T ++ISSHP
Sbjct  59    NTDATTTIPGPRGWPLVGSLLVVSGPLMHRRLAALADAHSARRLMSLTLGATPVVISSHP  118

Query  378   DTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLE  557
             +TA++IL G++F DRP K +A+ LMF RAIGFAP+G YWR+LRR+    M SPRR+A L 
Sbjct  119   ETARDILSGAAFVDRPPKAAARELMFCRAIGFAPTGEYWRRLRRITGAGMLSPRRMAMLR  178

Query  558   GVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQG----EELGL  725
             G+R  +A+ MI ++  +M  SG V +R ++   SL    ES+ GS LGL+G    EELG 
Sbjct  179   GLRCRVADSMIQRVADQMERSGEVAMRALLQRASL----ESMVGSVLGLEGDAVCEELGE  234

Query  726   MVKEGYELIGEFNWGDYF---PLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEKRKRQFEG  896
             MV+EGYEL+G FN  D++     G L+D  G +  C  LA  V    G+II++R+     
Sbjct  235   MVREGYELVGMFNLEDHYYKTSWGPLMDLWGVRPMCRELAAMVRGYFGKIIQERR-----  289

Query  897   IEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQD  1076
             +  + +   D LS +LSLP+E++L D+D++AVLWEMIFRG D VAIL+EW MARM LH D
Sbjct  290   LAGDCHERADLLSYMLSLPEEEKLEDSDVIAVLWEMIFRGVDVVAILLEWAMARMSLHPD  349

Query  1077  VQAKAQLEIDTCVGPSRH--VQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVY  1250
             +Q+KAQ E+D  VG  R   + DSD+PNL +LQ I+KE LR+HPPGPLLSWARLAV D  
Sbjct  350   IQSKAQEEMDAAVGVRRRRAITDSDVPNLAFLQWILKETLRMHPPGPLLSWARLAVQDAR  409

Query  1251  VDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME----EEVSIMGSDLRLAPFGS  1418
             V K  +PAGTTAMVNMWAI+HD  IW DPW FRPERF      EEVS++GSDLRLAPFGS
Sbjct  410   VGKHVVPAGTTAMVNMWAISHDEAIWGDPWVFRPERFAAAAAGEEVSVLGSDLRLAPFGS  469

Query  1419  GRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS---VDLSECLKLSLEMKKHL  1568
             GRRVCPGR +GL+T  LWL R LQ ++WLP P+   V+L+ECL+LS+EMK  L
Sbjct  470   GRRVCPGRMMGLATAQLWLGRLLQEYRWLPPPANKPVELAECLRLSMEMKTPL  522



>gb|AED99879.1| cytochrome P450, partial [Panax notoginseng]
Length=535

 Score =   481 bits (1238),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 257/488 (53%), Positives = 320/488 (66%), Gaps = 23/488 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNY--------SNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSM  314
             +W   GG AW  Y        S   +   + GP   PF+G +  MG  AH K+A+MA + 
Sbjct  43    YWAHPGGPAWGKYKWRKTTSSSFFADKATIPGPKGVPFIGSMSLMGGLAHHKIAAMAKAC  102

Query  315   GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYW  494
             G NRLMAFSLG TR+I++ +PD AKEIL  S F DRPVKESA  LMF RAIGFAP G YW
Sbjct  103   GANRLMAFSLGETRVIVTCNPDVAKEILNSSVFADRPVKESAYSLMFNRAIGFAPYGVYW  162

Query  495   RQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVV  674
             R LRR+AA H+F P++I   E  R  IA +M      +  +   + VR  +   SL N++
Sbjct  163   RTLRRIAATHLFCPKQIKASEAQRFDIARQMAAMFSGDNEKGMTINVREALKTASLNNMM  222

Query  675   ESVFG------SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLA  836
              SVFG      SC      EL  +V EGYEL+G  NW D+ P     D    + +C  L 
Sbjct  223   CSVFGRKYHLDSC-NTDAGELRKLVDEGYELLGTLNWSDHLPWLSHFDPQKIRVRCSNLV  281

Query  837   GRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRG  1016
              +VN  V +II + +    G  +N+N   DF+ VLLSL   +QL+D+D++AVLWEMIFRG
Sbjct  282   PKVNRFVSRIISEHRADQTGGGLNLN--CDFVDVLLSLQGREQLSDSDMIAVLWEMIFRG  339

Query  1017  TDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRL  1196
             TDTVA+LVEW++ARMVLH DVQ++   E+DT VG SR V ++DI  + YL A+VKEV+RL
Sbjct  340   TDTVAVLVEWVLARMVLHPDVQSRVHDELDTIVGRSRAVSEADIATMVYLPAVVKEVVRL  399

Query  1197  HPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE--  1370
             HPPGPLLSWARLA+ D  VD   +PAGTTAMVNMWAIT DP +W DP  F+PERF+ E  
Sbjct  400   HPPGPLLSWARLAITDTTVDDYHVPAGTTAMVNMWAITRDPDVWKDPLAFKPERFVNEGM  459

Query  1371  --EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKL  1544
               E+S+MGSDLRLAPFG+GRR CPG+ALGL+TV+ W+A  LQ FKW  G S DLSE LKL
Sbjct  460   GMELSVMGSDLRLAPFGAGRRTCPGKALGLTTVNFWVASLLQEFKW--GGSGDLSEVLKL  517

Query  1545  SLEMKKHL  1568
             S EM   L
Sbjct  518   SCEMANPL  525



>ref|XP_009142616.1| PREDICTED: cytochrome P450 78A6-like [Brassica rapa]
Length=528

 Score =   481 bits (1237),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 254/484 (52%), Positives = 323/484 (67%), Gaps = 19/484 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSN----NQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLN  323
             FW   GG AW  + +    N+    + GP  +PF+G +  M S  AH ++A  A   G  
Sbjct  43    FWTYPGGPAWGKHLSRRLTNKTGTVIPGPRGFPFVGSMSLMSSTLAHHRIAEAAERYGAK  102

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RLMAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR L
Sbjct  103   RLMAFSLGETRVIVTCNPDVAKEILNSPIFADRPVKESAYSLMFNRAIGFAPHGVYWRTL  162

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             RR+A+NH+FSP++I   E     IA +M+G ++K+   +    VR ++   SL N++ SV
Sbjct  163   RRIASNHLFSPKQIKGAETQSRVIASQMVGLLEKQSSTNALCFVRELLKTASLSNMMCSV  222

Query  684   FGSCLGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLV  857
             FG    L  +  EL  +V+EGY+L+GE NW D+ P     D    + +C  L  +VN  V
Sbjct  223   FGQEYELDQDHVELRELVEEGYDLLGELNWTDHLPWLSEFDPQRIRSRCSALVPKVNRFV  282

Query  858   GQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
              +II + +RQ        ++  DF+ VLLSL   DQL+D D++AVLWEMIFRGTDTVA+L
Sbjct  283   SRIISEHRRQ------TGDSPRDFVDVLLSLHGSDQLSDPDIIAVLWEMIFRGTDTVAVL  336

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             VEWI+ARMVLH D+Q+  Q E+D+ VG SR V +SD+ +LPYL A+VKEVLR+HPPGPLL
Sbjct  337   VEWILARMVLHPDIQSTVQNELDSVVGKSRAVDESDLVSLPYLTAMVKEVLRMHPPGPLL  396

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSIM  1385
             SWARLA+ D  VD C +PAGTTAMVNMWAI HDP +W DP  F+PERF+    E E S++
Sbjct  397   SWARLAITDTIVDGCLVPAGTTAMVNMWAIAHDPHVWVDPLEFKPERFVAKEGEVEFSVL  456

Query  1386  GSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSLEMK  1559
             GSDLRLAPFGSGRR+CPG+ LGL+TV  W A  L  F+W    G  VDLSE L+LS EM 
Sbjct  457   GSDLRLAPFGSGRRICPGKNLGLTTVTFWTATLLHEFEWGSSVGNGVDLSEKLRLSCEMA  516

Query  1560  KHLA  1571
               LA
Sbjct  517   TPLA  520



>emb|CDY41546.1| BnaC04g00760D [Brassica napus]
Length=528

 Score =   481 bits (1237),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 254/484 (52%), Positives = 324/484 (67%), Gaps = 19/484 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSN----NQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLN  323
             FW   GG AW  + +    N+    + GP  +PF+G +  M S  AH ++A  A   G  
Sbjct  43    FWTYPGGPAWGKHLSRRLTNKTGTVIPGPRGFPFVGSMSLMSSTLAHHRIAEAAERYGAK  102

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RLMAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR L
Sbjct  103   RLMAFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPHGVYWRTL  162

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             RR+A+NH+FSP++I   E  R  IA +M+G ++K+   +    VR ++   SL N++ SV
Sbjct  163   RRIASNHLFSPKQIKRAETQRRVIASQMVGLLEKQSSTNRLCFVRELLKTASLSNMMCSV  222

Query  684   FGSCLGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLV  857
             FG    L  +  EL  +V+EGY+L+GE NW D+ P     D    + +C  L  +VN  V
Sbjct  223   FGQEYELDQDHVELRELVEEGYDLLGELNWTDHLPWLSEFDPQRIRSRCSVLVPKVNRFV  282

Query  858   GQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
              +II + + Q        ++  DF++VLLSL   DQL+D D++AVLWEMIFRGTDTVA+L
Sbjct  283   SRIISQHRTQ------TGDSPRDFVAVLLSLHGSDQLSDPDMIAVLWEMIFRGTDTVAVL  336

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             VEWI+ARMVLH D+Q+  Q E+D+ VG SR V +SD+ +LPYL A+VKEVLR+HPPGPLL
Sbjct  337   VEWILARMVLHPDIQSTVQNELDSVVGKSRAVDESDLVSLPYLTAMVKEVLRMHPPGPLL  396

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSIM  1385
             SWARLA+ D  VD C +PAGTTAMVNMWAI HDP +W DP  F+PERF+    E E S++
Sbjct  397   SWARLAITDTIVDGCLVPAGTTAMVNMWAIAHDPHVWVDPLEFKPERFVAKEGEVEFSVL  456

Query  1386  GSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSLEMK  1559
             GSDLRLAPFGSGRR+CPG+ LGL+TV  W A  L  F+W    G  VDLSE L+LS EM 
Sbjct  457   GSDLRLAPFGSGRRICPGKNLGLTTVTFWTATLLHEFEWGSSVGNGVDLSEKLRLSCEMA  516

Query  1560  KHLA  1571
               LA
Sbjct  517   NPLA  520



>ref|XP_002892768.1| CYP78A5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69027.1| CYP78A5 [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   480 bits (1235),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 260/486 (53%), Positives = 332/486 (68%), Gaps = 24/486 (5%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             + F+   GG AW    ++++   + GP            GS+ HR LA++A     + LM
Sbjct  31    VAFFFSPGGLAWAWTGSSKSRVSIPGPSG----SLSVLSGSNPHRVLAALAKRFKASPLM  86

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFS+G +R +ISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR+
Sbjct  87    AFSVGFSRFVISSEPETAKEILNSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRI  146

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesg--fvevrgvvgegSLRNVVESVF  686
             ++ H+FSPRRIA  E VR  I  +M+ K+   +       VEV+ +V  GSL NV+ +VF
Sbjct  147   SSTHLFSPRRIASFESVRVGIGMKMVKKIKSVVMSDAGGEVEVKKIVHFGSLNNVMTTVF  206

Query  687   GSCLGL-----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVND  851
             G           G  L  +V EGYEL+G FNW D+F +    DF G +++C  L   VN 
Sbjct  207   GESYDFDEVKGSGCFLERLVSEGYELLGIFNWSDHFWVLRWFDFQGVRKRCRALVSEVNT  266

Query  852   LVGQIIEKRKRQFEGIEINVNN----NTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGT  1019
              VG IIEK K +        NN      DF+ VLL L KE++L+D+D++AVLWEMIFRGT
Sbjct  267   FVGGIIEKHKMK------KSNNLKGEENDFVDVLLGLQKEEKLSDSDMIAVLWEMIFRGT  320

Query  1020  DTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGP-SRHVQDSDIPNLPYLQAIVKEVLRL  1196
             DTVAILVEW++ARMVLHQD+Q K   EI +     +R + DSDIP LPYLQAIVKE LRL
Sbjct  321   DTVAILVEWVLARMVLHQDIQDKLYKEIASATSNNTRSLSDSDIPELPYLQAIVKETLRL  380

Query  1197  HPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-EEE  1373
             HPPGPLLSWARLA+HDV+V    +PAGT AMVNMW+ITH+ KIW DP  F+PERF+  E+
Sbjct  381   HPPGPLLSWARLAIHDVHVGPNLVPAGTIAMVNMWSITHNAKIWTDPEAFKPERFIGSED  440

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSL  1550
             +SIMGSDLRLAPFGSGRRVCPG+A+GL+TVHLW+A+ +Q+F+W+ G   V+L+E LKLS+
Sbjct  441   MSIMGSDLRLAPFGSGRRVCPGKAMGLATVHLWIAQLIQNFEWVKGSCDVELAEVLKLSM  500

Query  1551  EMKKHL  1568
             EMK  L
Sbjct  501   EMKNPL  506



>ref|XP_010416244.1| PREDICTED: cytochrome P450 78A5-like [Camelina sativa]
Length=538

 Score =   479 bits (1233),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 252/495 (51%), Positives = 327/495 (66%), Gaps = 25/495 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPK--------KLNGPMSWPFLGFLPQMGSHA--HRKLASMAT  308
             FW+  GGFAW  Y    + +         + GP     +G L    ++A  H  LA +A 
Sbjct  36    FWLTPGGFAWALYKARFHTRPDSKIGQAAIPGPSGLSIIGLLLAFINNALTHIILADIAD  95

Query  309   SMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGS  488
             +     LMAFS+G+TR +I+S P+TAKE+L  S+F DRPVKESA  L+F RA+GFAP G 
Sbjct  96    TCKAKALMAFSVGSTRFVITSEPETAKELLNSSAFADRPVKESAYELLFYRAMGFAPFGD  155

Query  489   YWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRN  668
             YWR+LRR+++ H+FSP+RI+     R  I + M+ ++   M   G V+++ ++  GSL N
Sbjct  156   YWRELRRISSTHLFSPKRISGFGQSRQKIGQNMVKEIKNAMETYGEVQIKKILHFGSLNN  215

Query  669   VVESVFGSCLGL--------QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKC  824
             V+ SVFG             +  EL  +V EGYEL+G FNW D+FP    LD  G +R+C
Sbjct  216   VMSSVFGKTYNFNDGIVYSKESNELEHLVSEGYELLGIFNWSDHFPGMRWLDLQGVRRRC  275

Query  825   HRLAGRVNDLVGQII--EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLW  998
               L  +VN  VG+II   K KR     +     + DF+ VLL +    +L+D+D++AVLW
Sbjct  276   RSLVCKVNVFVGKIINEHKSKRSLRDNQEESTYDDDFVDVLLGMHGNSKLSDSDMIAVLW  335

Query  999   EMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAI  1175
             EMIFRGTDTVAIL+EWI+ARMVLH D+QAKAQ EID  +G S R V DSD+  LPYL++I
Sbjct  336   EMIFRGTDTVAILLEWILARMVLHPDIQAKAQAEIDAIIGDSGRQVSDSDLSKLPYLRSI  395

Query  1176  VKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPE  1355
             VKE LR+HPPGPLLSWARL++HD  +   FIPAGTTAMVNMWAITHD K+W     ++PE
Sbjct  396   VKETLRMHPPGPLLSWARLSIHDTQIGTHFIPAGTTAMVNMWAITHDEKVWPKAHEYKPE  455

Query  1356  RFM----EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVD  1523
             RF+     +   IMGSDLRLAPFG+GRRVCPG+++GL+TV LWLA+ L  FKW+    VD
Sbjct  456   RFLGVKESDNFPIMGSDLRLAPFGAGRRVCPGKSMGLATVELWLAQLLGRFKWVSYGEVD  515

Query  1524  LSECLKLSLEMKKHL  1568
             LSE LKLSLEMK  L
Sbjct  516   LSETLKLSLEMKNTL  530



>ref|XP_004984001.1| PREDICTED: cytochrome P450 78A4-like [Setaria italica]
Length=523

 Score =   478 bits (1231),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 247/441 (56%), Positives = 319/441 (72%), Gaps = 10/441 (2%)
 Frame = +3

Query  270   GSHAHRKLASMATSM-GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKL  446
             G  AHR LAS++ S+ G   L AFS+G TR++++S PDTA+E+L  ++F DRPVK++A+ 
Sbjct  77    GPTAHRALASLSRSLPGGAALSAFSVGLTRLVVASRPDTARELLSSAAFADRPVKDAARE  136

Query  447   LMFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgf  626
             L+F RA+GFAPSG YWR LRR+++ ++FSPR +A     R+AI E M+ ++    G    
Sbjct  137   LLFHRAMGFAPSGDYWRALRRISSAYLFSPRSVAASAPRRAAIGEGMLRRISG--GGGEA  194

Query  627   vevrgvvgegSLRNVVESVFGSCL---GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLL  797
             V +R V+   SL +V+ +VFGSC      +G EL  MVKEGY L+G FNWGD+ PL   L
Sbjct  195   VAMRRVLHAASLDHVMATVFGSCYDPESPEGVELEEMVKEGYHLLGVFNWGDHLPLLSWL  254

Query  798   DFGGTKRKCHRLAGRVNDLVGQIIEK-RKRQFEGIEINVNNNTDFLSVLLSLPKEDQLAD  974
             D  G +R+C  L GRVN  V +IIE+ R+R+  G         DF+ VLL L  E++L+D
Sbjct  255   DVQGVRRRCRTLVGRVNVFVARIIEEHRQRKKSGDNGEPAAAGDFVDVLLGLEGEEKLSD  314

Query  975   ADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVG-PSRHVQDSDIP  1151
             +D++AVLWEMIFRGTDTVAIL+EW+MARMVLH+D+Q+KAQ E+D  VG     + D+D+ 
Sbjct  315   SDMIAVLWEMIFRGTDTVAILLEWVMARMVLHRDIQSKAQAELDAVVGRGGAAMSDADVA  374

Query  1152  NLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWN  1331
              LPYLQ +VKE LR+HPPGPLLSWARLAVHD  V    +PAGTTAMVNMWAI  DP +W 
Sbjct  375   RLPYLQRVVKETLRVHPPGPLLSWARLAVHDAVVGGHLVPAGTTAMVNMWAIARDPAVWP  434

Query  1332  DPWTFRPERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP-  1508
             +P  FRPERF EE+VS+MG DLRLAPFG+GRRVCPG+A+ L+TVHLWLA+ L  F+W P 
Sbjct  435   EPEAFRPERFEEEDVSVMGGDLRLAPFGAGRRVCPGKAMALATVHLWLAQLLHRFEWAPA  494

Query  1509  -GPSVDLSECLKLSLEMKKHL  1568
              G  VDLSE L +SLEM+K L
Sbjct  495   DGGGVDLSERLGMSLEMEKPL  515



>emb|CDX80036.1| BnaA05g01200D [Brassica napus]
Length=528

 Score =   478 bits (1231),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 253/484 (52%), Positives = 325/484 (67%), Gaps = 19/484 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSN----NQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLN  323
             FW   GG AW  + +    N+    + GP  +PF+G +  M S  AH ++A  A   G  
Sbjct  43    FWTYPGGPAWGKHLSRRLTNKTGTVIPGPRGFPFVGSMSIMSSTLAHHRIAEAAERYGAK  102

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RLM+FSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR L
Sbjct  103   RLMSFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPHGVYWRTL  162

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             RR+A+NH+FSP++I   E  R  IA +M+G ++K+   +G   VR ++   SL N++ SV
Sbjct  163   RRIASNHLFSPKQIKRAETQRRVIASQMVGLLEKQSSTNGLCFVRELLKTASLSNMMCSV  222

Query  684   FGSCLGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLV  857
             FG    L  +  EL  +V+EGY+L+GE NW D+ P     D    + +C  L  +VN  V
Sbjct  223   FGQEYELDQDHVELRELVEEGYDLLGELNWTDHLPWLSEFDPQRIRSRCSALVPKVNRFV  282

Query  858   GQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
              +II + +RQ        ++  DF+ VLLSL   DQL+D D++AVLWEMIFRGTDTVA+L
Sbjct  283   SRIISEHRRQ------TGDSPRDFVDVLLSLHGSDQLSDPDIIAVLWEMIFRGTDTVAVL  336

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             VEWI+ARMVLH D+Q+  Q E+D+ VG SR V +SD+ +LPYL A+VKEVLR+HPPGPLL
Sbjct  337   VEWILARMVLHPDIQSTVQNELDSVVGKSRAVDESDLVSLPYLTAMVKEVLRMHPPGPLL  396

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSIM  1385
             SWARLA+ D  VD C +PAGTTAMVNMWAI HDP +W DP  F+PERF+    E E S++
Sbjct  397   SWARLAITDTIVDGCLVPAGTTAMVNMWAIAHDPHVWVDPLEFKPERFVAKEGEVEFSVL  456

Query  1386  GSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSLEMK  1559
             GSDLRLAPFGSGRR+CPG+ LGL+TV  W A  L  F+W    G  VDLSE L+LS E+ 
Sbjct  457   GSDLRLAPFGSGRRICPGKNLGLTTVTFWTATLLHEFEWGSSVGNGVDLSEKLRLSCELA  516

Query  1560  KHLA  1571
               L+
Sbjct  517   NPLS  520



>ref|XP_010471502.1| PREDICTED: cytochrome P450 78A5-like [Camelina sativa]
Length=538

 Score =   479 bits (1232),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 253/495 (51%), Positives = 329/495 (66%), Gaps = 25/495 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPK--------KLNGPMSWPFLGFLPQMGSHA--HRKLASMAT  308
             FW+  GGFAW  Y    + +         + GP   P +G L    ++A  HR LA +A 
Sbjct  36    FWLTPGGFAWALYKARFHTRPDSKIGQAAIPGPSGLPIIGLLLAFINNALTHRILADIAD  95

Query  309   SMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGS  488
             +     LMAFS+G+TR +I+S P+TAKE+L  S+F DRPVKESA  L+F RA+GFAP G 
Sbjct  96    TCKAKALMAFSVGSTRFVITSEPETAKELLNSSAFADRPVKESAYELLFYRAMGFAPFGD  155

Query  489   YWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRN  668
             YWR+LRR+++ H+F+P+RI+     R  I + M+ ++   M   G V+++ ++  GSL N
Sbjct  156   YWRELRRISSTHLFNPKRISGFGESRQKICQNMVREIKNAMETYGEVQIKKILHFGSLNN  215

Query  669   VVESVFGSCLGL--------QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKC  824
             V+ SVFG             +  EL  +V EGYEL+G FNW D+FP    LD  G +R+C
Sbjct  216   VMSSVFGKTYNFNDGIVYSKESNELEHLVSEGYELLGIFNWSDHFPGMRWLDLQGVRRRC  275

Query  825   HRLAGRVNDLVGQII--EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLW  998
               L  +VN  VG+II   K KR     +  +  + DF+ VLL +    +L+D+D++AVLW
Sbjct  276   RILVCKVNVSVGKIITDHKSKRSLRDNQEEITYDDDFVGVLLGMHGNSKLSDSDMIAVLW  335

Query  999   EMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAI  1175
             EMIFRGTDTVAIL+EWI+ARMVLH D+QAKA  EID  +G S R V DSD+  LPYL+AI
Sbjct  336   EMIFRGTDTVAILLEWILARMVLHPDIQAKAHAEIDAIMGDSGRQVSDSDLSKLPYLRAI  395

Query  1176  VKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPE  1355
             VKE LR+HPPGPLLSWARL++HD  +   FIPAGTTAMVNMWAITHD K+W     ++PE
Sbjct  396   VKETLRMHPPGPLLSWARLSIHDTQIGAHFIPAGTTAMVNMWAITHDEKVWPKAHEYKPE  455

Query  1356  RFM----EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVD  1523
             RF+     +   IMGSDLRLAPFG+GRRVCPG+++GL+TV LWLA+ L  FKW+    VD
Sbjct  456   RFLGVKESDNFPIMGSDLRLAPFGAGRRVCPGKSMGLATVELWLAQLLGRFKWVSCREVD  515

Query  1524  LSECLKLSLEMKKHL  1568
             LSE LKLSLEMK  L
Sbjct  516   LSETLKLSLEMKNPL  530



>gb|KHN29974.1| Cytochrome P450 78A1 [Glycine soja]
Length=430

 Score =   474 bits (1221),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 252/421 (60%), Positives = 313/421 (74%), Gaps = 7/421 (2%)
 Frame = +3

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFS+G TR +ISS P+TAKEIL   SF DRPVKESA  L+F RA+GFAP G YWR LRR
Sbjct  1     MAFSIGLTRFVISSEPETAKEILGSPSFADRPVKESAYELLFHRAMGFAPYGEYWRNLRR  60

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             ++A H+FSP+RI   E  RS +  +M+ ++ K M E+  VEV+ ++   SL NV+ +VFG
Sbjct  61    ISALHLFSPKRITGSESFRSEVGLKMVEQVKKTMSENQHVEVKKILHFSSLNNVMMTVFG  120

Query  690   SCLGL---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVG  860
                     +G EL  +V EGYEL+G FNW D+FP+   LD  G +++C  L  +VN  VG
Sbjct  121   KSYEFYEGEGLELEGLVSEGYELLGVFNWSDHFPVLGWLDLQGVRKRCRCLVEKVNVFVG  180

Query  861   QII-EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
              +I E R ++  G  +      DF+ VLL L KE++L++AD++AVLWEMIFRGTDTVAIL
Sbjct  181   GVIKEHRVKRERGECVKDEGTGDFVDVLLDLEKENRLSEADMIAVLWEMIFRGTDTVAIL  240

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EW +ARMVLH ++QAKAQ EID   G SR V ++DIPNL YLQ IVKE LR+HPPGPLL
Sbjct  241   LEWTLARMVLHPEIQAKAQREIDFVCGSSRLVSEADIPNLRYLQCIVKETLRVHPPGPLL  300

Query  1218  SWARLAVHDVYV-DKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSD  1394
             SWARLAVHDV V  K  IP GTTAMVNMWAITHD ++W +P  FRPERF+EE+VSIMGSD
Sbjct  301   SWARLAVHDVTVGGKHVIPKGTTAMVNMWAITHDERVWAEPEKFRPERFVEEDVSIMGSD  360

Query  1395  LRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSLEMKKHL  1568
             LRLAPFGSGRRVCPG+ALGL++VHLWLA+ LQ+F W+   G SV+L E LKLS+EMKK L
Sbjct  361   LRLAPFGSGRRVCPGKALGLASVHLWLAQLLQNFHWVSSDGVSVELDEFLKLSMEMKKPL  420

Query  1569  A  1571
             +
Sbjct  421   S  421



>tpg|DAA45811.1| TPA: putative cytochrome P450 superfamily protein, partial [Zea 
mays]
Length=518

 Score =   478 bits (1229),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 248/481 (52%), Positives = 324/481 (67%), Gaps = 23/481 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSM-GLNRLMA  335
              W+  GG AW   S ++       P   P L      G  AHR LAS++ S+ G   L A
Sbjct  39    LWLFPGGPAWAFVSRSRAT-----PPGAPGL-VTALAGPAAHRALASLSRSLPGGAALSA  92

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR++++S PDTA+E+L  ++F DRPVK++A+ L+F RA+GFAPSG YWR LRR++
Sbjct  93    FSVGLTRLVVASQPDTARELLASAAFADRPVKDAARGLLFHRAMGFAPSGDYWRALRRIS  152

Query  516   ANHMFSPRRIACLEGVRSAIAEEMI-----GKMDKEMgesgfvevrgvvgegSLRNVVES  680
             + ++FSPR +A     R+AI E M+     G   +E+     +         SL +V+ +
Sbjct  153   SAYLFSPRSVAAAGPRRAAIGERMLRDLLSGAAGREVVMRRVLHAA------SLDHVMAT  206

Query  681   VFGS---CLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVND  851
             VFG+       +G EL  MVKEGY+L+G FNWGD+ PL   LD  G +R+C  L GRVN 
Sbjct  207   VFGARYDAASPEGAELEEMVKEGYDLLGMFNWGDHLPLLRWLDLQGVRRRCRSLVGRVNV  266

Query  852   LVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVA  1031
              V +IIE+ + + +          DF+ VLL L  E++L+D+D++AVLWEMIFRGTDTVA
Sbjct  267   FVARIIEEHRHKKDDAIGEPAAAGDFVDVLLGLDGEEKLSDSDMIAVLWEMIFRGTDTVA  326

Query  1032  ILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGP  1211
             IL+EW+MARMVLH  +Q+KAQ E+D  VG  R V D+D+  LPYLQ +VKE LR+HPPGP
Sbjct  327   ILLEWVMARMVLHPGIQSKAQAELDAVVGRGRAVCDADVARLPYLQRVVKETLRVHPPGP  386

Query  1212  LLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGS  1391
             LLSWARLAV D  V    +PAGTTAMVNMWAI HDP +W +P  FRPERF EE+VS++G 
Sbjct  387   LLSWARLAVRDAVVGGHVVPAGTTAMVNMWAIAHDPAVWPEPSAFRPERFEEEDVSVLGG  446

Query  1392  DLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSLEMKKH  1565
             DLRLAPFG+GRRVCPG+ L L+TVHLWLA+ L  F+W P  G  VDL+E L +SLEM+K 
Sbjct  447   DLRLAPFGAGRRVCPGKTLALATVHLWLAQLLHRFRWAPADGRGVDLAERLGMSLEMEKP  506

Query  1566  L  1568
             L
Sbjct  507   L  507



>gb|KFK43629.1| hypothetical protein AALP_AA1G150900 [Arabis alpina]
Length=516

 Score =   477 bits (1228),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 257/479 (54%), Positives = 328/479 (68%), Gaps = 23/479 (5%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSLGTT  353
             GG AW    +++    + GP            GS+ HR L+++A      RLMAFS+G +
Sbjct  35    GGLAWAWTGSSKTRVSIPGPSG----SLSVLSGSNPHRVLSALAKRYKAVRLMAFSVGFS  90

Query  354   RMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMFS  533
             R +ISS P+TAKEIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR++A H+FS
Sbjct  91    RFVISSEPETAKEILSSSAFADRPVKESAYELLFHRAMGFAPYGEYWRNLRRISATHLFS  150

Query  534   PRRIACLEGVRSAIAEEMIGKMDKEMgesg--fvevrgvvgegSLRNVVESVFGSCLGL-  704
             PRRI+  EGVR AI  +M+ ++   +       VEV+ +V  GSL NV+ +VFG      
Sbjct  151   PRRISSFEGVRVAIGMKMVKQIKSIVMSQAGGEVEVKKLVHFGSLNNVMTTVFGESYDFD  210

Query  705   ----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
                  G  L  +V EGYEL+G FNW D+F +    DF G +++C  L   VN  VG IIE
Sbjct  211   EVNGDGCFLERLVSEGYELLGIFNWSDHFGVLRWFDFQGVRKRCKALVSEVNTFVGTIIE  270

Query  873   KRKRQFEGIEINVNN----NTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             K K     ++  +NN      DF+ VLL L KE++L+D+D++AVLWE+IFRGTDTVAILV
Sbjct  271   KHK-----VKKMINNLHGEENDFVDVLLGLQKEEKLSDSDMIAVLWELIFRGTDTVAILV  325

Query  1041  EWIMARMVLHQDVQAKAQLEID-TCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             EWI+ARMVLHQD+Q K   EI       +R + DSD   LPYLQA+VKE LR+HPPGPLL
Sbjct  326   EWILARMVLHQDIQEKLYKEIAFVTSNNTRPLTDSDTAKLPYLQAVVKETLRIHPPGPLL  385

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME-EEVSIMGSD  1394
             SWARLA+HDV V    +PAGT AMVNMW+ITHD KIW DP  F+PERF + E+VSIMGSD
Sbjct  386   SWARLAIHDVQVGPNLVPAGTIAMVNMWSITHDAKIWTDPEEFKPERFTDGEDVSIMGSD  445

Query  1395  LRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP-SVDLSECLKLSLEMKKHL  1568
             LRLAPFG+GRRVCPG+A+GL+TVHLW+ + +Q+F+W+ G   V+L+E LKLS+EMKK L
Sbjct  446   LRLAPFGAGRRVCPGKAMGLATVHLWIGQLIQNFEWVKGSCDVELTEVLKLSMEMKKPL  504



>ref|XP_008656985.1| PREDICTED: cytochrome P450 78A5-like [Zea mays]
 gb|AFS89608.1| cytochrome P450 protein [Zea mays]
 gb|AFV13293.1| cytochrome P450 protein [Zea mays]
 tpg|DAA45810.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=515

 Score =   476 bits (1226),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 248/481 (52%), Positives = 324/481 (67%), Gaps = 23/481 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSM-GLNRLMA  335
              W+  GG AW   S ++       P   P L      G  AHR LAS++ S+ G   L A
Sbjct  39    LWLFPGGPAWAFVSRSRAT-----PPGAPGL-VTALAGPAAHRALASLSRSLPGGAALSA  92

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FS+G TR++++S PDTA+E+L  ++F DRPVK++A+ L+F RA+GFAPSG YWR LRR++
Sbjct  93    FSVGLTRLVVASQPDTARELLASAAFADRPVKDAARGLLFHRAMGFAPSGDYWRALRRIS  152

Query  516   ANHMFSPRRIACLEGVRSAIAEEMI-----GKMDKEMgesgfvevrgvvgegSLRNVVES  680
             + ++FSPR +A     R+AI E M+     G   +E+     +         SL +V+ +
Sbjct  153   SAYLFSPRSVAAAGPRRAAIGERMLRDLLSGAAGREVVMRRVLHAA------SLDHVMAT  206

Query  681   VFGS---CLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVND  851
             VFG+       +G EL  MVKEGY+L+G FNWGD+ PL   LD  G +R+C  L GRVN 
Sbjct  207   VFGARYDAASPEGAELEEMVKEGYDLLGMFNWGDHLPLLRWLDLQGVRRRCRSLVGRVNV  266

Query  852   LVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVA  1031
              V +IIE+ + + +          DF+ VLL L  E++L+D+D++AVLWEMIFRGTDTVA
Sbjct  267   FVARIIEEHRHKKDDAIGEPAAAGDFVDVLLGLDGEEKLSDSDMIAVLWEMIFRGTDTVA  326

Query  1032  ILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGP  1211
             IL+EW+MARMVLH  +Q+KAQ E+D  VG  R V D+D+  LPYLQ +VKE LR+HPPGP
Sbjct  327   ILLEWVMARMVLHPGIQSKAQAELDAVVGRGRAVCDADVARLPYLQRVVKETLRVHPPGP  386

Query  1212  LLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGS  1391
             LLSWARLAV D  V    +PAGTTAMVNMWAI HDP +W +P  FRPERF EE+VS++G 
Sbjct  387   LLSWARLAVRDAVVGGHVVPAGTTAMVNMWAIAHDPAVWPEPSAFRPERFEEEDVSVLGG  446

Query  1392  DLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSLEMKKH  1565
             DLRLAPFG+GRRVCPG+ L L+TVHLWLA+ L  F+W P  G  VDL+E L +SLEM+K 
Sbjct  447   DLRLAPFGAGRRVCPGKTLALATVHLWLAQLLHRFRWAPADGRGVDLAERLGMSLEMEKP  506

Query  1566  L  1568
             L
Sbjct  507   L  507



>gb|AGT16621.1| phytochrome P450 [Saccharum hybrid cultivar R570]
Length=516

 Score =   475 bits (1223),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 237/443 (53%), Positives = 313/443 (71%), Gaps = 10/443 (2%)
 Frame = +3

Query  270   GSHAHRKLASMATSM--GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAK  443
             G  AHR LAS++ S+  G + L+AFS+G TR++++S PDTA+E+L  ++F DRPVK++A+
Sbjct  66    GPAAHRTLASLSQSLPGGGSALLAFSVGLTRLVVASQPDTARELLASAAFADRPVKDAAR  125

Query  444   LLMFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesg  623
              L+F RA+GFAPSG YWR LRR+++ ++FSPR ++     R AI E M+  +       G
Sbjct  126   GLLFHRAMGFAPSGDYWRALRRISSAYLFSPRSVSATAPRRVAIGERMLRDLSAAATGGG  185

Query  624   fvevrgvvg---egSLRNVVESVFGS---CLGLQGEELGLMVKEGYELIGEFNWGDYFPL  785
                   +       SL +V+ +VFG+       +G EL  MVKEGY+L+G FNWGD+ PL
Sbjct  186   GGGEVVMRRVLHAASLDHVMATVFGARYDADSAEGAELEEMVKEGYDLLGLFNWGDHLPL  245

Query  786   GFLLDFGGTKRKCHRLAGRVNDLVGQIIEKRKRQFEGIEINVNNNT-DFLSVLLSLPKED  962
                LD  G +R+C  L  RVN  V +IIE+ +++ +    N  +   DF+ VLL L  E+
Sbjct  246   LRWLDLQGVRRRCRSLVSRVNVFVARIIEEHRQKKKDDAANGESAAGDFVDVLLGLEGEE  305

Query  963   QLADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDS  1142
             +L+D+D++AVLWEMIFRGTDTVAIL+EW+MARMVLH  +Q+KAQ E+D  VG  R V D+
Sbjct  306   KLSDSDMIAVLWEMIFRGTDTVAILLEWVMARMVLHPGIQSKAQAELDAVVGRGRAVSDA  365

Query  1143  DIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPK  1322
             D+  LPYLQ +VKE LR+HPPGPLLSWARLAVHD  V    +PAGTTAMVNMWAI HDP 
Sbjct  366   DVARLPYLQRVVKETLRVHPPGPLLSWARLAVHDAVVGGHLVPAGTTAMVNMWAIAHDPV  425

Query  1323  IWNDPWTFRPERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKW  1502
             +W +P  FRPERF EE+VS++G DLRLAPFG+GRRVCPG+ L L+TVHLWLA+ L  F+W
Sbjct  426   VWAEPSAFRPERFEEEDVSVLGGDLRLAPFGAGRRVCPGKTLALATVHLWLAQLLHRFQW  485

Query  1503  LPGP-SVDLSECLKLSLEMKKHL  1568
              P    VDL+E L +SLEM+K L
Sbjct  486   APADGGVDLAERLGMSLEMEKPL  508



>gb|EYU23623.1| hypothetical protein MIMGU_mgv1a004353mg [Erythranthe guttata]
Length=531

 Score =   475 bits (1223),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 255/486 (52%), Positives = 327/486 (67%), Gaps = 16/486 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHA--HRKLASMATSMGLNRLM  332
             FW+  GG AW        P       S   L  L    +H+  HR L+ ++   G   LM
Sbjct  37    FWLTPGGLAWVLSRAQARPANAIPGPSGLPLLGLLLTFTHSLTHRILSDLSNKFGAKPLM  96

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFS+G TR ++SS P+TA+EIL  S+F DRPVKESA  L+F RA+GFAP G YWR LRR+
Sbjct  97    AFSVGLTRFVVSSTPETAREILNSSAFADRPVKESAYELLFHRAMGFAPYGDYWRNLRRI  156

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgeg--SLRNVVESVF  686
             +A H+FSPRR+A     R  I  +M  ++  +M ES    ++        SL NV+ SVF
Sbjct  157   SAAHLFSPRRVALFGNFRREIGLKMADEIASKMAESNRGLIQVKNVLHFGSLNNVMMSVF  216

Query  687   GSCLGLQGEE-----LGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVND  851
             G C     E      L  +V+EGYEL+G FN+ D+FP    LD  G +R+   L  +VN+
Sbjct  217   GKCYDFSDENSDGVVLEGLVREGYELLGIFNYSDHFPFLGWLDLQGVRRRSKILVAKVNN  276

Query  852   LVGQII-EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQ-LADADLVAVLWEMIFRGTDT  1025
              VG+II E R ++   I    +++ DF+ VLL L K+++ L+D+D++AVLWEMIFRGTDT
Sbjct  277   FVGKIIDEHRLKRGRPICDKEDDDCDFVDVLLDLEKKEKGLSDSDMIAVLWEMIFRGTDT  336

Query  1026  VAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSR-HVQDSDIPNLPYLQAIVKEVLRLHP  1202
             VAIL+EWI+ARM+LH ++Q+KAQ EID  +  +   + DSD+ +LPY+QAIVKE LR+HP
Sbjct  337   VAILLEWILARMILHPEIQSKAQQEIDRVIRKTDATISDSDLQSLPYIQAIVKETLRMHP  396

Query  1203  PGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSI  1382
             PGPLLSWARLAVHDV V   F+PAGTTAMVNMWAI HD K+W +P  FRPERF+EEEVSI
Sbjct  397   PGPLLSWARLAVHDVQVGPHFVPAGTTAMVNMWAIAHDEKVWPEPEIFRPERFLEEEVSI  456

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSECLKLSL  1550
             MG DLRLAPFGSGRRVCPG+ +G++TV LWLA+ L  F W    +    VDLSECLKLSL
Sbjct  457   MGGDLRLAPFGSGRRVCPGKNMGIATVQLWLAQLLHKFTWTSASNDNYGVDLSECLKLSL  516

Query  1551  EMKKHL  1568
             EMK+ L
Sbjct  517   EMKQPL  522



>ref|XP_010506682.1| PREDICTED: cytochrome P450 78A6-like, partial [Camelina sativa]
Length=515

 Score =   473 bits (1218),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 252/489 (52%), Positives = 325/489 (66%), Gaps = 26/489 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNY-------SNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSM  314
             FW   GG AW  Y        + +    + GP  +P +G +  M S  AHR++A +A   
Sbjct  27    FWTYPGGPAWGKYLFRRLASGSYKTGNVIPGPRGFPLVGSMSLMSSTLAHRRIADVAEKF  86

Query  315   GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYW  494
             G  RLMAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YW
Sbjct  87    GAKRLMAFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPHGVYW  146

Query  495   RQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVV  674
             R LRR+A+NH+FSP++I   E  R  I+ +M+  ++K+  ++G   VR ++   SL N++
Sbjct  147   RTLRRIASNHLFSPKQIRRAETQRRVISSQMVEFLEKQSSDNGLCSVRELLKTASLNNMM  206

Query  675   ESVFGSCLGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
              SVFG    L+ +  EL  +V+EGY+L+G  NW D+ P     D    + +C  L  +VN
Sbjct  207   CSVFGQEYELEQDHVELRELVEEGYDLLGTLNWTDHLPWLSEFDPQSIRSRCSTLVPKVN  266

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               V +II + + Q        ++  DF+ VLLSL   DQL+D D++AVLWEMIFRGTDTV
Sbjct  267   RFVSRIISQHRNQ------TGDSPRDFVDVLLSLHGSDQLSDPDIIAVLWEMIFRGTDTV  320

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             A+L+EWI+ARMVLH D+Q+  Q E+D  VG SR V +SD+ +LPYL A+VKEVLRLHPPG
Sbjct  321   AVLIEWILARMVLHPDIQSTVQDELDQVVGKSRAVDESDLASLPYLTAVVKEVLRLHPPG  380

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEV  1376
             PLLSWARLA+ D  VD   +PAGTTAMVNMWA++HDP +W DP  F+PERF+    E E 
Sbjct  381   PLLSWARLAITDTIVDGRLVPAGTTAMVNMWAVSHDPHVWVDPLEFKPERFVAKEGEAEF  440

Query  1377  SIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSECLKL  1544
             S++GSDLRLAPFGSGRR+CPG+ LGL+TV  W A  L  F+W  GPS    VDLSE L+L
Sbjct  441   SVLGSDLRLAPFGSGRRICPGKNLGLTTVTFWTATLLHEFQW--GPSDVNGVDLSEKLRL  498

Query  1545  SLEMKKHLA  1571
             S EM   LA
Sbjct  499   SCEMASPLA  507



>ref|XP_010413088.1| PREDICTED: cytochrome P450 78A6-like [Camelina sativa]
Length=531

 Score =   473 bits (1216),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 252/489 (52%), Positives = 324/489 (66%), Gaps = 26/489 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNY-------SNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSM  314
             FW   GG AW  Y        + +    + GP  +P +G +  M S  AHR++A +A   
Sbjct  43    FWTYPGGPAWGKYLFRRLASGSYKTGNVIPGPRGFPLVGSMSLMSSTLAHRRIADVAEKF  102

Query  315   GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYW  494
             G  RLMAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YW
Sbjct  103   GAKRLMAFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPHGVYW  162

Query  495   RQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVV  674
             R LRR+A+NH+FSP++I   E  R  I+ +M+  ++K+  ++G   VR ++   SL N++
Sbjct  163   RTLRRIASNHLFSPKQIRRAETQRRVISSQMVEFLEKQSSKNGLCSVRELLKTASLNNMM  222

Query  675   ESVFGSCLGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
              SVFG    L+ +  EL  +V+EGY+L+G  NW D+ P     D    + +C  L   VN
Sbjct  223   CSVFGQEYELEQDHVELRELVEEGYDLLGTLNWTDHLPWLSEFDPQSIRSRCSTLVPMVN  282

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               V +II + + Q        ++  DF+ VLLSL   DQL+D D++AVLWEMIFRGTDTV
Sbjct  283   RFVSRIISEHRNQ------TGDSPRDFVDVLLSLHGSDQLSDPDIIAVLWEMIFRGTDTV  336

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             A+L+EWI+ARMVLH D+Q+  Q E+D  VG SR V +SD+ +LPYL A+VKEVLRLHPPG
Sbjct  337   AVLIEWILARMVLHPDIQSTVQDELDRVVGKSRAVDESDLASLPYLTAVVKEVLRLHPPG  396

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEV  1376
             PLLSWARLA+ D  VD   +PAGTTAMVNMWA++HDP +W DP  F+PERF+    E E 
Sbjct  397   PLLSWARLAITDTIVDGRLVPAGTTAMVNMWAVSHDPHVWVDPLEFKPERFVAKEGEAEY  456

Query  1377  SIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSECLKL  1544
             S++GSDLRLAPFGSGRR+CPG+ LGL+TV  W A  L  F+W  GPS    VDLSE L+L
Sbjct  457   SVLGSDLRLAPFGSGRRICPGKNLGLTTVTFWTATLLHEFQW--GPSDVNGVDLSEKLRL  514

Query  1545  SLEMKKHLA  1571
             S EM   LA
Sbjct  515   SCEMASPLA  523



>ref|XP_004959817.1| PREDICTED: cytochrome P450 78A4-like [Setaria italica]
Length=520

 Score =   472 bits (1214),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 246/480 (51%), Positives = 327/480 (68%), Gaps = 18/480 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSM-GLNRLM  332
              W+  GG AW      + P   +GP      G +  + S  AHR LA+++ ++ G   LM
Sbjct  38    LWLSPGGPAWALSRCRRPP---SGPP-----GVVTALSSPVAHRTLAALSRAVDGGAALM  89

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSG-SYWRQLRR  509
             +FS+G TR+++SS PDTA+EIL   +F DRPVK++A+ L+F RA+GFAPSG ++WR LRR
Sbjct  90    SFSVGLTRLVVSSQPDTAREILVSPAFGDRPVKDAARHLLFHRAMGFAPSGDAHWRGLRR  149

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +AA H+F PR +A     R++I   M+  +   M   G V ++ V+   SL +++ +VFG
Sbjct  150   LAAAHLFGPRCVAGAAHHRASIGATMVSDVAAAMARHGEVSLKRVLHAASLNHMMATVFG  209

Query  690   ----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLV  857
                      +G  L  MV EGY+L+G FNW D+ PL   LD  G +R+C+RL  +V   V
Sbjct  210   KHSDDLASQEGALLEEMVTEGYDLLGTFNWADHLPLLKWLDLQGVRRRCNRLVQKVEVFV  269

Query  858   GQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
             G+II++ + +     +      DF+ VLL L  E++++D+D++AVLWEMIFRGTDTVAIL
Sbjct  270   GKIIQEHRARRANGGVADEFMGDFVDVLLGLEGEEKMSDSDMIAVLWEMIFRGTDTVAIL  329

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EWIMARMVLH D+QAKAQ E+D  VG  R V D+D+ NLPY+Q IVKE LR+HPPGPLL
Sbjct  330   MEWIMARMVLHPDIQAKAQAELDAVVGRGRGVADADVANLPYIQCIVKETLRMHPPGPLL  389

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDL  1397
             SWARLA+HD +V    +PAGTTAMVNMWAI HDP IW +P  FRPERF EE+VS++GSDL
Sbjct  390   SWARLAIHDAHVGGHLVPAGTTAMVNMWAIAHDPAIWAEPEAFRPERFQEEDVSVLGSDL  449

Query  1398  RLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP---GPSVDLSECLKLSLEMKKHL  1568
             RLAPFG+GRRVCPG+ L L+T HLW+A+ L  F+W P   G  VDLSE L +SLEM   L
Sbjct  450   RLAPFGAGRRVCPGKMLALATTHLWIAQLLHQFEWAPAAAGGGVDLSERLNMSLEMATPL  509



>ref|XP_008459740.1| PREDICTED: cytochrome P450 78A9-like, partial [Cucumis melo]
Length=539

 Score =   473 bits (1216),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 242/491 (49%), Positives = 319/491 (65%), Gaps = 27/491 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAF  338
             +W   GG AW    + ++   + GP  +P +G +  M   AH+K+AS+A S+   RLMAF
Sbjct  45    YWAHPGGPAWGRRRSRRSTAVIPGPRGFPVIGSMNLMTGLAHQKIASVAKSLQATRLMAF  104

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             SL  TR+I++ HPD AK+IL  S F DRP+KESA  LMF RAIGFAP G YWR LRR+A+
Sbjct  105   SLANTRVIVTCHPDIAKDILNSSVFADRPIKESAYSLMFNRAIGFAPYGVYWRTLRRIAS  164

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
             +H+FSP++I   E  R  IA +++  +      S    +R  +   SL N++ SVFG   
Sbjct  165   HHLFSPKQIKSSESQRRQIASQLVKILSSTATSSPHHRIRQTLKTASLNNMMGSVFGRFY  224

Query  699   GLQGEE-----LGLMVKEGYELIGEFNWGDYFPLGFLLDFG--GTKRKCHRLAGRVNDLV  857
              L         L  +V EGY+L+G  NW D+ P  FL DF     + +C RL  +VN+ V
Sbjct  225   NLSDSNPEVLLLQSLVDEGYDLLGLLNWSDHLP--FLRDFDPQNIRFRCSRLVPKVNNFV  282

Query  858   GQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
              +II++ ++            TDF+ VLLSL + + L+D+D+++VLWEMIFRGTDTVA+L
Sbjct  283   TRIIDEHRQNSN------RETTDFVDVLLSLQQNENLSDSDIISVLWEMIFRGTDTVAVL  336

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EWI+ RMV+H+DVQ K Q E+D  VG SR V +SDIP+L YL A+VKEVLRLHPPGPLL
Sbjct  337   IEWILGRMVVHKDVQEKVQEELDNVVGKSRAVMESDIPSLVYLTAVVKEVLRLHPPGPLL  396

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM--------EEE  1373
             SWAR+A+ D  +D   +P GTTAMVNMW+I  DP+IW+DP  F+PERF+        + E
Sbjct  397   SWARIAITDTTIDGYHVPRGTTAMVNMWSIARDPQIWSDPLQFKPERFLSGAGAGGGDVE  456

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP----SVDLSECLK  1541
              SIMGSDLRLAPFGSGRR CPG+AL  +TV  W+A  L  FKWLP P    +V+  E LK
Sbjct  457   FSIMGSDLRLAPFGSGRRTCPGKALAWTTVSFWVATLLHEFKWLPSPNQNEAVNFDEVLK  516

Query  1542  LSLEMKKHLAI  1574
             LS EM   L +
Sbjct  517   LSCEMANPLTV  527



>ref|XP_009142434.1| PREDICTED: cytochrome P450 78A6 [Brassica rapa]
Length=527

 Score =   471 bits (1212),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 252/484 (52%), Positives = 322/484 (67%), Gaps = 20/484 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSN----NQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLN  323
             FW   GG AW  + +    N+    + GP  +PF+G +  M S  AHR++A +A   G  
Sbjct  43    FWTYPGGPAWGKFLSRRLANKTGTVIPGPRGFPFVGSMSLMSSTLAHRRIADVAERFGAK  102

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RL+AFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR L
Sbjct  103   RLLAFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPHGVYWRTL  162

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             RR+A+NH+FSP++I   E  R  IA +M+G ++K+   +G   VR ++   SL N++ SV
Sbjct  163   RRIASNHLFSPKQIKRAETQRRVIASQMVGLLEKQ-STNGVCFVRELLKTASLNNMMCSV  221

Query  684   FGSCLGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLV  857
             FG    L  +  EL  +V+EGY+L+G  NW D+ P     D    + +C  L  +VN  V
Sbjct  222   FGQEYELDQDHSELRELVEEGYDLLGTLNWTDHLPWLSEFDPQRIRTRCSALVPKVNRFV  281

Query  858   GQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
              +I+ + + Q        ++  DF+ VLLSL   D L+D D++AVLWEMIFRGTDTVA+L
Sbjct  282   SRIVSEHRNQ------TGDSPRDFVDVLLSLHGSDHLSDPDIIAVLWEMIFRGTDTVAVL  335

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EWI+AR+VLH D+Q+  Q E+D  VG SR V +SD+ +LPYL A+VKEVLR+HPPGPLL
Sbjct  336   IEWILARIVLHPDIQSTVQSELDLVVGKSRAVDESDLASLPYLTAVVKEVLRMHPPGPLL  395

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSIM  1385
             SWARLA+ D  VD  FIPAGTTAMVNMWAI HDP +W DP  FRPERF+    E E S++
Sbjct  396   SWARLAITDTIVDGRFIPAGTTAMVNMWAIAHDPHVWVDPLEFRPERFVTKEGEVEFSVL  455

Query  1386  GSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKW--LPGPSVDLSECLKLSLEMK  1559
             GSDLRLAPFGSGRR CPG+ LGL+TV  W A  L  F+W    G  VDLSE L+LS EM 
Sbjct  456   GSDLRLAPFGSGRRTCPGKNLGLTTVTFWTATLLHEFEWGVSDGNGVDLSEKLRLSCEMA  515

Query  1560  KHLA  1571
               LA
Sbjct  516   NPLA  519



>emb|CDY61720.1| BnaA04g27100D [Brassica napus]
Length=527

 Score =   471 bits (1212),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 252/484 (52%), Positives = 322/484 (67%), Gaps = 20/484 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSN----NQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLN  323
             FW   GG AW  + +    N+    + GP  +PF+G +  M S  AHR++A +A   G  
Sbjct  43    FWTYPGGPAWGKFLSRRLANKTGTVIPGPRGFPFVGSMSLMSSTLAHRRIADVAERFGAK  102

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RL+AFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR L
Sbjct  103   RLLAFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPHGVYWRTL  162

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             RR+A+NH+FSP++I   E  R  IA +M+G ++K+   +G   VR ++   SL N++ SV
Sbjct  163   RRIASNHLFSPKQIKRAETQRRVIASQMVGLLEKQ-STNGVCFVRELLKTASLNNMMCSV  221

Query  684   FGSCLGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLV  857
             FG    L  +  EL  +V+EGY+L+G  NW D+ P     D    + +C  L  +VN  V
Sbjct  222   FGQEYELDQDHSELRELVEEGYDLLGTLNWTDHLPWLSEFDPQRIRTRCSALVPKVNRFV  281

Query  858   GQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
              +I+ + + Q        ++  DF+ VLLSL   D L+D D++AVLWEMIFRGTDTVA+L
Sbjct  282   SRIVSEHRNQ------TGDSPRDFVDVLLSLHGSDHLSDPDIIAVLWEMIFRGTDTVAVL  335

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EWI+AR+VLH D+Q+  Q E+D  VG SR V +SD+ +LPYL A+VKEVLR+HPPGPLL
Sbjct  336   IEWILARIVLHPDIQSTVQSELDLVVGKSRAVDESDLASLPYLTAVVKEVLRMHPPGPLL  395

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSIM  1385
             SWARLA+ D  VD  FIPAGTTAMVNMWAI HDP +W DP  FRPERF+    E E S++
Sbjct  396   SWARLAITDTIVDGRFIPAGTTAMVNMWAIAHDPHVWVDPLEFRPERFVTKEGEVEFSVL  455

Query  1386  GSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKW--LPGPSVDLSECLKLSLEMK  1559
             GSDLRLAPFGSGRR CPG+ LGL+TV  W A  L  F+W    G  VDLSE L+LS EM 
Sbjct  456   GSDLRLAPFGSGRRTCPGKNLGLTTVTFWTATLLHEFEWGVSDGNGVDLSEKLRLSCEMA  515

Query  1560  KHLA  1571
               LA
Sbjct  516   NPLA  519



>emb|CDY27309.1| BnaC04g50960D [Brassica napus]
Length=527

 Score =   470 bits (1210),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 252/484 (52%), Positives = 321/484 (66%), Gaps = 20/484 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSN----NQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLN  323
             FW   GG AW  + +    N+    + GP  +PF+G +  M S  AHR++A  A   G  
Sbjct  43    FWTYPGGPAWGKFLSRRLTNKTGTVIPGPRGFPFVGSMSLMSSTLAHRRIADSAERFGAK  102

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RL+AFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR L
Sbjct  103   RLLAFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPHGVYWRTL  162

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             RR+A+NH+FSP++I   E  R  IA +++G ++K+   +G   VR ++   SL N++ SV
Sbjct  163   RRIASNHLFSPKQIKRAETQRRVIASQVVGFLEKQ-STNGVCFVRELLKTASLNNMMCSV  221

Query  684   FGSCLGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLV  857
             FG    L  +  EL  +V+EGY+L+G  NW D+ P     D    + +C  L  +VN  V
Sbjct  222   FGQEYELDQDHSELRELVEEGYDLLGTLNWTDHLPWLLEFDPQRIRSRCSALVPKVNRFV  281

Query  858   GQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
              +II + + Q        +   DF+ VLLSL   D L+D D++AVLWEMIFRGTDTVA+L
Sbjct  282   SRIISEHRNQ------TGDTPRDFVDVLLSLHGSDHLSDPDIIAVLWEMIFRGTDTVAVL  335

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EWI+AR+VLH D+Q+  Q E+D  VG SR V +SD+ +LPYL A+VKEVLR+HPPGPLL
Sbjct  336   IEWILARIVLHPDIQSTIQSELDLVVGKSRAVDESDLASLPYLTAVVKEVLRMHPPGPLL  395

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSIM  1385
             SWARLA+ D  VD  FIPAGTTAMVNMWAI HDP +W DP  FRPERF+    E E S++
Sbjct  396   SWARLAITDTIVDGRFIPAGTTAMVNMWAIAHDPHVWVDPLEFRPERFVTKEGEVEFSVL  455

Query  1386  GSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKW--LPGPSVDLSECLKLSLEMK  1559
             GSDLRLAPFGSGRR+CPG+ LGL+TV  W A  L  F+W    G  VDLSE L+LS EM 
Sbjct  456   GSDLRLAPFGSGRRICPGKNLGLTTVTFWTATLLHEFEWGVSDGNGVDLSEKLRLSCEMA  515

Query  1560  KHLA  1571
               LA
Sbjct  516   NPLA  519



>gb|KFK41856.1| hypothetical protein AALP_AA2G179900 [Arabis alpina]
Length=438

 Score =   466 bits (1200),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 238/430 (55%), Positives = 303/430 (70%), Gaps = 17/430 (4%)
 Frame = +3

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFS+G TR +I+S P TAKE+L  S+F DRPVKESA  L+F RA+GFAP G YWR+LRR
Sbjct  1     MAFSIGMTRFVITSEPGTAKELLNSSAFADRPVKESAYELLFHRAMGFAPFGDYWRELRR  60

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +++ H+FSP+RI+     R  I E M+G++   M   G V ++ ++  GSL NV+ SVFG
Sbjct  61    ISSTHLFSPKRISGFGESRRKIGENMVGEIKNAMESHGEVNIKRILHFGSLNNVMSSVFG  120

Query  690   SCLGLQGEE---------LGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGR  842
                   G           L  +V EGYEL+G FNW D+FP    LD  G +RKC  L G+
Sbjct  121   KTYKFDGGSIINSKESNVLEHLVSEGYELLGIFNWSDHFPGMKWLDLQGVRRKCRSLVGK  180

Query  843   VNDLVGQIIEKRKRQ---FEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFR  1013
             VN  VG+II+  K +    E  E    ++ DF+ VLL +   ++L+D+D++AVLWEMIFR
Sbjct  181   VNVFVGKIIDDHKSKRSLHENQEEESPSDGDFVDVLLGMQGNNKLSDSDMIAVLWEMIFR  240

Query  1014  GTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKEVL  1190
             GTDTVAIL+EWI+ARM+LH D+QAKA  EID  VG S R V D D+  LPY++AIVKE L
Sbjct  241   GTDTVAILLEWILARMILHPDIQAKAHAEIDAIVGDSGRQVSDPDLSKLPYIRAIVKETL  300

Query  1191  RLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE  1370
             R+HPPGPLLSWARL++HD  +   FIPAGTTAMVNMWAITHD  +W +   ++PERF+  
Sbjct  301   RMHPPGPLLSWARLSIHDTKIGSHFIPAGTTAMVNMWAITHDENVWPEADEYKPERFLGS  360

Query  1371  EV----SIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECL  1538
             +V    SIMGSDLRLAPFG+GRRVCPG+++GL+TV LWLA+ L+ FKW+P   VDLSE L
Sbjct  361   QVSDNFSIMGSDLRLAPFGAGRRVCPGKSMGLATVELWLAQLLRSFKWVPCGEVDLSETL  420

Query  1539  KLSLEMKKHL  1568
             KLSLEMK  L
Sbjct  421   KLSLEMKNTL  430



>ref|XP_006660360.1| PREDICTED: cytochrome P450 78A9-like [Oryza brachyantha]
Length=542

 Score =   469 bits (1208),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 254/498 (51%), Positives = 319/498 (64%), Gaps = 32/498 (6%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQNP----KKLNGPMSWPFLGFLPQMGSHAHRKLAS---MATS  311
             +  WV  GG AW  Y  N+        + GP  +P +G +P M   AHRKLA+    A S
Sbjct  41    LAHWVAPGGPAWGRYWWNRKGVGIGHAIPGPRGFPVVGSMPLMAGLAHRKLAAAVATARS  100

Query  312   MGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSY  491
                 RLMAFS+G TR++++S PD A+E+L   +F DRPVKESA  ++F RAIGFAP G+Y
Sbjct  101   PAWRRLMAFSVGETRVVVTSDPDVARELLASPAFADRPVKESAYGMLFHRAIGFAPYGTY  160

Query  492   WRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvv--gegSLR  665
             WR LRR+A+ H+FSPR++A     R+ IA +M+  M      +G   V+        SL 
Sbjct  161   WRALRRVASTHLFSPRQVAASAAHRAVIARQMVDAMKSAAAGAGGGVVQARQFLKRASLH  220

Query  666   NVVESVFGSCLGL------QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCH  827
             NV+ SVFG    L      +  EL  MV+EGY+L+G+ NW D+ P     D   T+ +C 
Sbjct  221   NVMWSVFGRKYELAAPESEETAELRSMVEEGYDLLGQLNWSDHLPWLAPFDLQKTRSRCS  280

Query  828   RLAGRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMI  1007
              L  RV   V +II+  + +            DF  VLLSL   D+L+DAD+VAVLWEMI
Sbjct  281   SLVPRVTRFVTRIIDDHRARL------TLAADDFTDVLLSLHGNDKLSDADMVAVLWEMI  334

Query  1008  FRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEV  1187
             FRGTDTVA+L+EWIMAR+VLHQDVQA+   E+D  VGP R V +SD  NL YLQA++KEV
Sbjct  335   FRGTDTVAVLIEWIMARLVLHQDVQARVHGELDRVVGPDRAVTESDAANLVYLQAVIKEV  394

Query  1188  LRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-  1364
             LRLHPPGPLLSWARLA  DV+V   F+P+GTTAMVNMWAITHDP +W+DP  F+PERF+ 
Sbjct  395   LRLHPPGPLLSWARLATSDVHVAGFFVPSGTTAMVNMWAITHDPTVWDDPTEFKPERFVV  454

Query  1365  -----EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP---GP--  1514
                    E  I GSDLRLAPFGSGRR CPG++L ++TV  W+A  L  F+WLP   GP  
Sbjct  455   RSPDQATEFPITGSDLRLAPFGSGRRSCPGKSLAIATVGFWVATLLHEFEWLPPSDGPRR  514

Query  1515  SVDLSECLKLSLEMKKHL  1568
              VDLSE LKLS EM   L
Sbjct  515   GVDLSEVLKLSCEMTAPL  532



>tpg|DAA63513.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=520

 Score =   468 bits (1205),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 248/477 (52%), Positives = 325/477 (68%), Gaps = 15/477 (3%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSM-GLNRLM  332
              W+  GG AW      + P    GP      G +  + S  AHR LA+++ ++ G   LM
Sbjct  38    LWLSPGGPAWALSRCRRPPP---GPT-----GVVTALSSPVAHRTLAALSHAVDGGKALM  89

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSG-SYWRQLRR  509
             AFS+G TR+++SS PDTA+EIL   +F DRP+K++A+ L+F  A+GFAPSG ++WR LRR
Sbjct  90    AFSVGLTRLVVSSQPDTAREILASPAFGDRPIKDAARHLLFHHAMGFAPSGDAHWRGLRR  149

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +AANH+F PRR+A     R++I E M+  +   M   G V ++ V+   SL +V+ +VFG
Sbjct  150   LAANHLFGPRRVAGAAHHRASIGEAMVADVAAAMARHGEVPLKRVLHVASLNHVMATVFG  209

Query  690   SCLGL---QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVG  860
                 +   +G  L  MV EGY+L+G FNW D+ PL   LD  G +R+C+RL  +V   VG
Sbjct  210   KRYDMGSREGAVLDEMVAEGYDLLGTFNWADHLPLLKHLDPQGVRRRCNRLVQKVESFVG  269

Query  861   QII-EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
             +II E R R+  G  +      DF+ VLL L  E++L+D D++AVLWEMIFRG DTVAIL
Sbjct  270   KIIMEHRTRRANGGVVGDECMGDFVDVLLGLEGEEKLSDEDMIAVLWEMIFRGADTVAIL  329

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EW+MARM LH D+QAKAQ E+D  VG  R V D+D+ +LPY+Q IVKE LR+HPPGPLL
Sbjct  330   MEWVMARMALHPDIQAKAQAELDGVVGIGRGVADADVASLPYIQCIVKETLRMHPPGPLL  389

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDL  1397
             SWARLAVHD +V    +PAGTTAMVNMW+I HDP IW +P  FRPERF EE+VS++GSDL
Sbjct  390   SWARLAVHDAHVGGHLVPAGTTAMVNMWSIAHDPAIWAEPEKFRPERFQEEDVSVLGSDL  449

Query  1398  RLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHL  1568
             RLAPFG+GRR CPG+ L L+T HLW+A+ L  F+W  G  VDLSE L +SLEM   L
Sbjct  450   RLAPFGAGRRACPGKILALATTHLWVAQLLHKFEWAAGGGVDLSERLSMSLEMATPL  506



>ref|XP_002882080.1| CYP78A6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58339.1| CYP78A6 [Arabidopsis lyrata subsp. lyrata]
Length=530

 Score =   468 bits (1205),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 252/487 (52%), Positives = 322/487 (66%), Gaps = 23/487 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNY-------SNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSM  314
             FW   GG AW  +        + +    + GP   P +G +  M S  AHR++A +A   
Sbjct  43    FWTYPGGPAWGKFLFRRFTSGSYKTGNVIPGPRGLPLVGSMSLMSSTLAHRRIADVAEKF  102

Query  315   GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYW  494
             G  RLMAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YW
Sbjct  103   GAKRLMAFSLGETRVIVTCNPDVAKEILNCPVFADRPVKESAYSLMFNRAIGFAPHGVYW  162

Query  495   RQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVV  674
             R LRR+A+NH+FSP++I   E  R  IA +M+G + K+   +G   VR ++   SL N++
Sbjct  163   RTLRRIASNHLFSPKQIRRAETQRREIASQMVGFLGKQ-TSNGLCFVRELLKTASLNNMM  221

Query  675   ESVFGSCLGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
              SVFG    L+    EL  +V+EGY+L+G  NW D+ P  F  D    + +C  L  +VN
Sbjct  222   CSVFGQEYELEQNHVELRELVEEGYDLLGTLNWTDHLPWLFEFDPQRIRSRCSTLVPKVN  281

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               V +II + + Q        ++  DF+ VLLSL   D+L+D D++AVLWEMIFRGTDTV
Sbjct  282   RFVSRIISEHRHQ------TGDSPHDFVDVLLSLHGSDKLSDPDIIAVLWEMIFRGTDTV  335

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             A+L+EW++ARMVLH D+Q+  Q E+D  VG SR V +SD+ +LPYL A+VKEVLRLHPPG
Sbjct  336   AVLIEWVLARMVLHPDIQSTVQNELDQIVGKSRAVDESDLASLPYLTAVVKEVLRLHPPG  395

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEV  1376
             PLLSWARLA+ D  VD   +PAGTTAMVNMWA++HDP +W DP  F+PERF+    E E 
Sbjct  396   PLLSWARLAITDTIVDGRLVPAGTTAMVNMWAVSHDPHVWLDPLEFKPERFVAKQGEVEF  455

Query  1377  SIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSL  1550
             S++GSDLRLAPFGSGRRVCPG+ LGL+TV  W A  L  F+W P  G  VDLSE L+LS 
Sbjct  456   SVLGSDLRLAPFGSGRRVCPGKNLGLTTVTFWTATLLHEFEWGPSDGNGVDLSEKLRLSC  515

Query  1551  EMKKHLA  1571
             EM   LA
Sbjct  516   EMANPLA  522



>ref|XP_006290851.1| hypothetical protein CARUB_v10016961mg, partial [Capsella rubella]
 gb|EOA23749.1| hypothetical protein CARUB_v10016961mg, partial [Capsella rubella]
Length=551

 Score =   468 bits (1205),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 251/486 (52%), Positives = 320/486 (66%), Gaps = 21/486 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNY--SNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRL  329
             FW   GG AW  Y     Q    + GP   PF+G +  M S  AHR +A+ A   G  RL
Sbjct  61    FWSHPGGPAWGKYFFQRRQRTTLIPGPRGLPFVGSMSLMSSTLAHRCIAATAEKFGAKRL  120

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR LR+
Sbjct  121   MAFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRK  180

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +A+NH+FSP++I   E  RS IA+++   + K+    G    R ++   SL N++ SVFG
Sbjct  181   IASNHLFSPKQIKRSETQRSVIAKQITTCLAKQSNAKGLCFARDLIKTASLNNMMCSVFG  240

Query  690   SCLGLQGE-----ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
                 L+ E     EL  MV+EGY+L+G+ NW D+ PL   LD    + +C  L  +VN  
Sbjct  241   KEYELEHEHDEVNELREMVEEGYDLLGKLNWTDHLPLLSELDPQRIRSRCSSLVPKVNRF  300

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             V +II   + Q        ++  DF+ VLLSL   D+L+D D+VAVLWEMIFRGTDTVA+
Sbjct  301   VNRIISDHRDQTR------DSPNDFVDVLLSLDGPDKLSDPDIVAVLWEMIFRGTDTVAV  354

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EWI+ARMVLH D+Q+    E+D  VG SR V++SD+ +L YL A+VKEVLR+HPPGPL
Sbjct  355   LIEWILARMVLHPDIQSTVHNELDQIVGRSRAVEESDVASLVYLTAVVKEVLRVHPPGPL  414

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSI  1382
             LSW+RLA+ D  +D   +PAGTTAMVNMWAI HDP +W +P  F+PERF+    E E S+
Sbjct  415   LSWSRLAITDTIIDGRRVPAGTTAMVNMWAIAHDPHVWENPLEFKPERFVAKGGEVEFSV  474

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP---SVDLSECLKLSLE  1553
             +GSDLRLAPFGSGRR+CPG+ LGL+TV  W A  L  F+WLP     +VDLSE L+LS E
Sbjct  475   LGSDLRLAPFGSGRRICPGKNLGLATVTFWTATLLHEFEWLPPSHEKAVDLSEKLRLSCE  534

Query  1554  MKKHLA  1571
             M   LA
Sbjct  535   MANPLA  540



>ref|XP_010507986.1| PREDICTED: cytochrome P450 78A6 [Camelina sativa]
Length=532

 Score =   468 bits (1203),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 250/490 (51%), Positives = 322/490 (66%), Gaps = 27/490 (6%)
 Frame = +3

Query  159   FWVVEGGFAWRNY-------SNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSM  314
             FW   GG AW  Y        +++    + GP  +P  G +  M S  AHR++A  A   
Sbjct  43    FWTYPGGPAWGKYLFRRLASGSHKTGNVIPGPRGFPLFGSMSLMSSTLAHRRIADAAEKF  102

Query  315   GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYW  494
             G  RLMAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YW
Sbjct  103   GAKRLMAFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPHGVYW  162

Query  495   RQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfv-evrgvvgegSLRNV  671
             R LRR+A+NH+FSP++I   E  R  I+ +M+  ++K+      +  VR ++   SL N+
Sbjct  163   RTLRRIASNHLFSPKQIRRAETQRRVISSQMVEFLEKQSSSDNGLCFVRELLKTASLNNM  222

Query  672   VESVFGSCLGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRV  845
             + SVFG    L+ +  EL  +V+EGY+L+G  NW D+ P     D    + +C  L  +V
Sbjct  223   MCSVFGQEYELKQDHVELRELVEEGYDLLGTLNWTDHLPWLSEFDPQSIRSRCSTLVPKV  282

Query  846   NDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDT  1025
             N  V +II + + Q        ++  DF+ VLLSL   DQL+D D++AVLWEMIFRGTDT
Sbjct  283   NRFVSRIISEHRNQ------TGDSPRDFVDVLLSLHGSDQLSDPDIIAVLWEMIFRGTDT  336

Query  1026  VAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             VA+L+EWI+ARMVLH ++Q+  Q E+D  VG SR V +SD+ +LPYL A+VKEVLRLHPP
Sbjct  337   VAVLIEWILARMVLHPEIQSTVQDELDQVVGKSRAVDESDLASLPYLTAVVKEVLRLHPP  396

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEE  1373
             GPLLSWARLA+ D  VD   +PAGTTAMVNMWA++HDP +W DP  F+PERF+    E E
Sbjct  397   GPLLSWARLAITDTIVDGRLVPAGTTAMVNMWAVSHDPHVWVDPLEFKPERFVAKEGEAE  456

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSECLK  1541
              S++GSDLRLAPFGSGRR+CPG+ LGL+TV  W A  L  F+W  GPS    VDLSE L+
Sbjct  457   FSVLGSDLRLAPFGSGRRICPGKNLGLTTVTFWTATLLHEFQW--GPSDVNGVDLSEKLR  514

Query  1542  LSLEMKKHLA  1571
             LS EM   LA
Sbjct  515   LSCEMASPLA  524



>ref|XP_008390271.1| PREDICTED: cytochrome P450 78A9-like [Malus domestica]
Length=539

 Score =   468 bits (1203),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 249/493 (51%), Positives = 319/493 (65%), Gaps = 36/493 (7%)
 Frame = +3

Query  174   GGFAW-------RNYSN-----NQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMG  317
             GG AW       RN  N     N NP  + GP  +P +G +  M + AH KL   A   G
Sbjct  50    GGAAWGKLRWRKRNSCNKNEITNSNP--IPGPRGFPIIGSMNLMTNLAHHKLTKAAEVYG  107

Query  318   LNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWR  497
               RLMAFS+G TR I++  PD AKEIL  S F +RP+KESA  LMF RAIGFAP GSYWR
Sbjct  108   AKRLMAFSIGETRAIVTCDPDVAKEILNSSVFANRPIKESAYCLMFNRAIGFAPYGSYWR  167

Query  498   QLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVE  677
              LRR+AANH+F P++I+  E +RS IA++M+  +      S  V         SL +++ 
Sbjct  168   TLRRIAANHLFCPKQISTSEYLRSRIADQMVSLISTSCNNSFLVRDVLRKA--SLNSMMC  225

Query  678   SVFG-----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGR  842
             SVFG     S    + EEL  +V EGY+L+G  NW D+ P    LD    + +C++L  +
Sbjct  226   SVFGRKYELSSSNEETEELNRLVDEGYDLLGNLNWSDHLPWLAGLDLQSIRFRCNKLVPQ  285

Query  843   VNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTD  1022
             VN LV +II++ + Q         NN DF+ VLLSL   D+L D D+++VLWEMIFRGTD
Sbjct  286   VNRLVSRIIQEHRAQTGP------NNNDFVDVLLSLDGADKLCDNDMISVLWEMIFRGTD  339

Query  1023  TVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHP  1202
             TVA+L+EWI+ARMV+H D+Q+K   E+D  VG SR + +SDI +LPYLQA+VKEVLR+HP
Sbjct  340   TVAVLIEWILARMVMHHDIQSKVHEELDRVVGKSRALLESDIQSLPYLQAMVKEVLRMHP  399

Query  1203  PGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE----  1370
             PGPLLSWARLA+ D  VD  ++PAGTTAMVNMWAIT +PK+W+DP  FRPERF+      
Sbjct  400   PGPLLSWARLAITDTVVDGYYVPAGTTAMVNMWAITREPKVWSDPLEFRPERFVSTKKKA  459

Query  1371  --EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPG---PSVDLSEC  1535
               + S+ GSDLRLAPFGSGRR CPG+ LGLSTV+ W+   L  F+W        VDLSE 
Sbjct  460   DLQFSVFGSDLRLAPFGSGRRSCPGKTLGLSTVNYWVGLLLHEFEWFKSDLDAKVDLSEV  519

Query  1536  LKLSLEMKKHLAI  1574
             ++LS +M   L I
Sbjct  520   MRLSCQMANPLTI  532



>ref|XP_006293985.1| hypothetical protein CARUB_v10022976mg [Capsella rubella]
 gb|EOA26883.1| hypothetical protein CARUB_v10022976mg [Capsella rubella]
Length=531

 Score =   467 bits (1202),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 249/489 (51%), Positives = 322/489 (66%), Gaps = 26/489 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNY-------SNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSM  314
             FW   GG AW  Y        + +    + GP   P +G +  M S  AHR++A +A   
Sbjct  43    FWTYRGGPAWGKYLFRRLASGSYKTGNVIPGPRGLPLVGSMSLMSSTLAHRRIADVAEKF  102

Query  315   GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYW  494
             G  RLMAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YW
Sbjct  103   GAKRLMAFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPHGVYW  162

Query  495   RQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVV  674
             R LRR+A++H+FSP++I   E  R  I+ +M+  ++K+   +G   VR ++   SL N++
Sbjct  163   RTLRRIASSHLFSPKQIRRAEAQRRVISSQMVEFLEKQSSNNGLCFVRELLKSASLNNMM  222

Query  675   ESVFGSCLGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
              SVFG    L+ +  EL  +V+EGY+L+G  NW D+ P     D    + +C  L  +VN
Sbjct  223   CSVFGQEYELEQDHAELRELVEEGYDLLGTLNWSDHLPWLSEFDPQSIRSRCSTLVPKVN  282

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               V +II + + Q        ++  DF+ VLLSL   D+L+D D++AVLWEMIFRGTDTV
Sbjct  283   RFVSRIISEHRNQ------TGDSPRDFVDVLLSLHGSDKLSDPDIIAVLWEMIFRGTDTV  336

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             A+L+EWI+ARMVLH D+Q+    E+D  VG SR V +SD+ +LPYL A+VKEVLRLHPPG
Sbjct  337   AVLIEWILARMVLHPDIQSTVHDELDLVVGKSRAVDESDLASLPYLTAVVKEVLRLHPPG  396

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEV  1376
             PLLSWARLA+ D  VD   +PAGTTAMVNMWA++HDP +W DP  F+PERF+    E E 
Sbjct  397   PLLSWARLAITDTIVDGRLVPAGTTAMVNMWAVSHDPHVWVDPLEFKPERFVAKDGEVEF  456

Query  1377  SIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSECLKL  1544
             S++GSDLRLAPFGSGRR+CPG+ LGL+TV  W A  L  F+W  GPS    VDLSE L+L
Sbjct  457   SVLGSDLRLAPFGSGRRICPGKNLGLATVTFWTATLLHEFEW--GPSDVNGVDLSEKLRL  514

Query  1545  SLEMKKHLA  1571
             S EM   LA
Sbjct  515   SCEMASPLA  523



>ref|XP_010546209.1| PREDICTED: cytochrome P450 78A5-like [Tarenaya hassleriana]
Length=555

 Score =   468 bits (1204),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 255/511 (50%), Positives = 333/511 (65%), Gaps = 42/511 (8%)
 Frame = +3

Query  159   FWVVEGGFAWRNYS---------NNQNPKKLNGPMSWPFLGFLPQMGSH--AHRKLASMA  305
             FW+  GGFAW  Y           +QN   + GP   P LG L     +   HR L+ + 
Sbjct  38    FWLTPGGFAWGIYKIRTHFLTRPGSQNLASIPGPSGLPVLGLLFAFTGNNPTHRILSRVV  97

Query  306   TSM-GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPS  482
              S  G   LMAFS+G +R I+S+ P TAKE+L  S+F DRP+KESA  L+F RA+GFAP 
Sbjct  98    KSCPGSRSLMAFSVGLSRFIVSTDPGTAKELLNSSAFADRPIKESAYELLFHRAMGFAPY  157

Query  483   GSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSL  662
             G YWR LRR++A H+FSP+RI      R ++ E+MI  +   M     V+++ ++   SL
Sbjct  158   GDYWRTLRRISAVHLFSPKRIQRFSEFRRSMGEKMIRDVKAVMERHEEVKIKDILHWASL  217

Query  663   RNVVESVFGSCL--------GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKR  818
              NV+  VFG           G +G EL  +V+EGY+L+G FNW D+FP     DF G +R
Sbjct  218   SNVMMIVFGKSYDFSPERFSGEEGNELENLVQEGYDLLGIFNWSDHFPALARFDFQGVRR  277

Query  819   KCHRLAGRVNDLVGQIIEKRKRQFEGIEINVNNNTD-----------FLSVLLSLPKEDQ  965
             +C  L G+V+  V ++IE+R +   G + +  +              F+ VLL L +E++
Sbjct  278   RCRDLVGKVDVFVRKMIEERGKGTSGNKESYEHGDHLDLEPEEIGDHFVDVLLGLQEENK  337

Query  966   LADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSD  1145
             L+D+DLVAVLWEMIFRGTDTVAIL+EWI+ARMVLH +VQAKA+ EI   +   R V DSD
Sbjct  338   LSDSDLVAVLWEMIFRGTDTVAILLEWILARMVLHPNVQAKARAEIHAILA-GRPVTDSD  396

Query  1146  IPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKI  1325
             +P+LPYL+AIVKE LR+HPPGPLLSWARL++HD ++   F+PAGTTAMVNMWAI HD  I
Sbjct  397   LPSLPYLKAIVKETLRMHPPGPLLSWARLSIHDTWLGPHFVPAGTTAMVNMWAIAHDEAI  456

Query  1326  WNDPWTFRPERFMEEE--------VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLAR  1481
             W  P  FRPERF+EE+         ++MGSDLRLAPFGSGRRVCPG+ +GL+TV LWLA+
Sbjct  457   WPQPHIFRPERFLEEQGKLDNAIVSNVMGSDLRLAPFGSGRRVCPGKTMGLATVELWLAQ  516

Query  1482  FLQHFKWLPGPS--VDLSECLKLSLEMKKHL  1568
              LQ F+W+      VDL+E LKLS+EMKK L
Sbjct  517   LLQGFEWVEPADHHVDLTEVLKLSMEMKKPL  547



>emb|CBI27648.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   459 bits (1180),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 222/305 (73%), Positives = 255/305 (84%), Gaps = 6/305 (2%)
 Frame = +3

Query  657   SLRNVVESVFGSCLG-LQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRL  833
             SL N++ESVFG  LG ++GE LG MV EGYELI +FNW DYFPLGF+ DF G KR+C +L
Sbjct  58    SLSNIMESVFGRGLGSVEGEGLGFMVIEGYELIAKFNWEDYFPLGFI-DFYGVKRRCSKL  116

Query  834   AGRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFR  1013
             A +VN +VG++IE+RKR  E          DFLSVLLSLPKEDQL+D+D+VAVLWEMIFR
Sbjct  117   AAKVNGVVGKMIEERKRVGE----LSGGGNDFLSVLLSLPKEDQLSDSDMVAVLWEMIFR  172

Query  1014  GTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLR  1193
             GTDTVAIL+EWIMARMV+HQD+QAKAQ E+DTC+G   HVQDS I +LPYLQAIVKE LR
Sbjct  173   GTDTVAILLEWIMARMVIHQDIQAKAQEELDTCLGNQSHVQDSHIQSLPYLQAIVKEALR  232

Query  1194  LHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEE  1373
             +HPPGPLLSWARLA+HDV+V K F+PAGTTAMVNMWAI HDP IW DPW F+P+RF+ E+
Sbjct  233   MHPPGPLLSWARLAIHDVHVGKFFVPAGTTAMVNMWAIAHDPTIWKDPWAFKPDRFINED  292

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLE  1553
             VSIMGSDLRLAPFGSGRR CPG+ALGL+TVHLWLAR L  FKWLP   VDL ECL+LSLE
Sbjct  293   VSIMGSDLRLAPFGSGRRACPGKALGLATVHLWLARLLHQFKWLPTHPVDLGECLRLSLE  352

Query  1554  MKKHL  1568
             MKK L
Sbjct  353   MKKPL  357


 Score = 83.2 bits (204),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  267  MGSHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKL  446
            MGS AHRKLA+MA S G  RLMA SLG T +IISSHPDTAKEILCGSSF++R +++ +  
Sbjct  1    MGSLAHRKLATMAASCGATRLMALSLGVTPVIISSHPDTAKEILCGSSFSNRILQKGSLS  60

Query  447  LMFERAIG  470
             + E   G
Sbjct  61   NIMESVFG  68



>ref|XP_002518911.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF43444.1| cytochrome P450, putative [Ricinus communis]
Length=531

 Score =   464 bits (1194),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 251/490 (51%), Positives = 320/490 (65%), Gaps = 27/490 (6%)
 Frame = +3

Query  159   FWVVEGGFAWRNY--SNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             +W   GG AW  Y        K + GP   P LG +  M + AH K+A+MA      RLM
Sbjct  43    YWAHPGGHAWGKYFFKRGCKSKSIPGPRGIPILGSMSLMTNLAHHKIAAMANLFKAKRLM  102

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFSLG TR+I++ +PD AKEIL  S F DRPVKESA  LMF RAIGFAP G YWR LRR+
Sbjct  103   AFSLGETRVIVTCNPDVAKEILNSSVFADRPVKESAYGLMFNRAIGFAPYGVYWRTLRRI  162

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG-  689
             AA H+F P++I+  E  RS I  +M+ ++       G + VR ++   SL N++ SVFG 
Sbjct  163   AATHLFCPKQISSTEAQRSDIGSQMVSRI---ACHKGELRVRDILKRASLNNMMCSVFGR  219

Query  690   ----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLV  857
                 S    + EEL  +V+EGYEL+G+ NW D+ P    LD    + +C  L  +VN  V
Sbjct  220   RYELSSSNNETEELRGLVEEGYELLGKLNWSDHLPWIANLDLQKIRFRCCNLVPKVNHFV  279

Query  858   GQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
              +II++ + Q +G         DF+ VLLSL   D+L+D D+VAVLWEMIFRGTDTVA+L
Sbjct  280   NRIIQEHRTQLKG------QRNDFVDVLLSLQGPDKLSDQDMVAVLWEMIFRGTDTVAVL  333

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EWI+ARMVLH D+Q+K   E+D  VG SR + +SDI ++ YLQA+VKEVLRLHPPGPLL
Sbjct  334   IEWILARMVLHPDIQSKVHRELDKVVGRSRPLMESDIQSMVYLQAVVKEVLRLHPPGPLL  393

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERF---------MEE  1370
             SWARLA+ D  VD   +P GTTAMVNMWAIT DP++W DP  F PERF         ++ 
Sbjct  394   SWARLAITDTTVDGYEVPEGTTAMVNMWAITRDPQVWADPLRFWPERFVCNNENAGGVDM  453

Query  1371  EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKL  1544
             E S++GSDLRLAPFGSGRR CPG+ALGL+TV  W+   L  F+W+   G  VDLSE L+L
Sbjct  454   EFSVLGSDLRLAPFGSGRRTCPGKALGLATVSFWVGTLLHEFEWVQSDGDPVDLSEKLRL  513

Query  1545  SLEMKKHLAI  1574
             S EM   L++
Sbjct  514   SCEMANPLSV  523



>gb|AAP44628.1| putative cytochrome P-450 [Oryza sativa Japonica Group]
Length=515

 Score =   463 bits (1191),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 240/437 (55%), Positives = 311/437 (71%), Gaps = 10/437 (2%)
 Frame = +3

Query  282   HRKLASMATSM-GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFE  458
             HR LA+M+ S+ G   L +FS+G TR +++S PDTA+E+L  ++F DRPVK++A+ L+F 
Sbjct  73    HRALAAMSRSVPGGAALASFSVGLTRFVVASRPDTARELLSSAAFADRPVKDAARGLLFH  132

Query  459   RAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevr  638
             RA+GFAPSG YWR LRR++ANH+F+PRR+A     R AI E M+ ++       G + +R
Sbjct  133   RAMGFAPSGDYWRALRRVSANHLFTPRRVAASAPRRLAIGERMLDRLSA--LAGGEIGMR  190

Query  639   gvvgegSLRNVVESVFGSCL---GLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGG  809
              V+   SL +V+++VFG+       +G EL  MVKEGY+L+G FNWGD+ PL   LD  G
Sbjct  191   RVLHAASLDHVMDTVFGTRYDGDSQEGAELEAMVKEGYDLLGMFNWGDHLPLLKWLDLQG  250

Query  810   TKRKCHRLAGRVNDLVGQIIE---KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADAD  980
              +R+C  L  RV+  V  II+   +RKR+  G         DF+ VLL L  E+++ ++D
Sbjct  251   VRRRCRTLVQRVDVFVRSIIDEHRQRKRRTGGNGGGEELPGDFVDVLLGLQGEEKMTESD  310

Query  981   LVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLP  1160
             +VAVLWEMIFRGTDTVAIL+EWIMARMVLH D+QAKAQ E+D  VG  R V D D+  L 
Sbjct  311   MVAVLWEMIFRGTDTVAILLEWIMARMVLHPDIQAKAQAELDAVVGRGRAVSDGDVAGLR  370

Query  1161  YLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPW  1340
             YLQ +VKE LR+HPPGPLLSWARLAV D +V    +PAGTTAMVNMWAI HDP++W +P 
Sbjct  371   YLQCVVKEALRVHPPGPLLSWARLAVRDAHVGGHVVPAGTTAMVNMWAIAHDPELWPEPD  430

Query  1341  TFRPERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP-GPS  1517
              FRPERF EE+VS++G DLRLAPFG+GRR CPG+ L L+TVHLWLA+ L  F+W P G  
Sbjct  431   EFRPERFAEEDVSVLGGDLRLAPFGAGRRACPGKTLALATVHLWLAQLLHRFEWAPVGGG  490

Query  1518  VDLSECLKLSLEMKKHL  1568
             V L E L +SLEM+K L
Sbjct  491   VHLLERLNMSLEMEKPL  507



>ref|XP_004168367.1| PREDICTED: cytochrome P450 78A3-like, partial [Cucumis sativus]
Length=534

 Score =   464 bits (1193),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 247/494 (50%), Positives = 321/494 (65%), Gaps = 35/494 (7%)
 Frame = +3

Query  159   FWVVEGGFAW--RNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             +W   GG AW  R  S+   P    GP  +P +G +  M   AH+K+AS+A S+   RLM
Sbjct  44    YWAHPGGPAWGRRRRSSALIP----GPRGFPVIGSMNLMTGLAHQKIASVAKSLQATRLM  99

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFSL  TR+I++ HPD AK+IL  S F DRP+KESA  LMF RAIGFAP G YWR LRR+
Sbjct  100   AFSLANTRVIVTCHPDVAKDILNSSVFADRPIKESAYSLMFNRAIGFAPYGVYWRTLRRI  159

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             A+ H+FSP++I   E  R  IA +++  +      S    +R  +   SL +++ SVFG 
Sbjct  160   ASQHLFSPKQIKSSESQRRQIASQLVKILSSTATSSTHHRIRQTLKTASLNSMMGSVFGR  219

Query  693   CLGLQG-----EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRK--CHRLAGRVND  851
                L       E L  +V EGY+L+G  NW D+ P  FL DF   + +  C RL  +VN+
Sbjct  220   FYNLSDSNPEVELLQSLVDEGYDLLGLLNWSDHLP--FLGDFDPQRIRFRCSRLVPKVNN  277

Query  852   LVGQIIEKRKRQFEGIEINVNNNT-DFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
              V +II++ ++       N N  T DF+ VLLSL + + L+D+D+++VLWEMIFRGTDTV
Sbjct  278   FVTRIIDEHRQ-------NSNRETMDFVDVLLSLQQNENLSDSDIISVLWEMIFRGTDTV  330

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             A+L+EWI+ARMV+H+DVQ K + E+D  VG SR V +SDIP+L YL A+VKEVLRLHPPG
Sbjct  331   AVLIEWILARMVVHEDVQKKVEEELDNVVGKSRAVMESDIPSLVYLTAVVKEVLRLHPPG  390

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM--------  1364
             PLLSWAR+A+ D  +D   +P GTTAMVNMW+I  DP+IW+DP  F PERF+        
Sbjct  391   PLLSWARIAITDTTIDGYHVPRGTTAMVNMWSIARDPQIWSDPLEFMPERFLSAGPGGGG  450

Query  1365  EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSE  1532
             + E SIMGSDLRLAPFGSGRR CPG+AL  +TV  W+A  L  FKWLP P+    V+  E
Sbjct  451   DVEFSIMGSDLRLAPFGSGRRTCPGKALAWTTVTFWVATLLHEFKWLPSPNQNQVVNFDE  510

Query  1533  CLKLSLEMKKHLAI  1574
              LKLS EM   L +
Sbjct  511   VLKLSCEMANPLTV  524



>gb|KGN46546.1| hypothetical protein Csa_6G108440 [Cucumis sativus]
Length=535

 Score =   463 bits (1192),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 247/494 (50%), Positives = 321/494 (65%), Gaps = 35/494 (7%)
 Frame = +3

Query  159   FWVVEGGFAW--RNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             +W   GG AW  R  S+   P    GP  +P +G +  M   AH+K+AS+A S+   RLM
Sbjct  45    YWAHPGGPAWGRRRRSSALIP----GPRGFPVIGSMNLMTGLAHQKIASVAKSLQATRLM  100

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFSL  TR+I++ HPD AK+IL  S F DRP+KESA  LMF RAIGFAP G YWR LRR+
Sbjct  101   AFSLANTRVIVTCHPDVAKDILNSSVFADRPIKESAYSLMFNRAIGFAPYGVYWRTLRRI  160

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             A+ H+FSP++I   E  R  IA +++  +      S    +R  +   SL +++ SVFG 
Sbjct  161   ASQHLFSPKQIKSSESQRRQIASQLVKILSSTATSSTHHRIRQTLKTASLNSMMGSVFGR  220

Query  693   CLGLQG-----EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRK--CHRLAGRVND  851
                L       E L  +V EGY+L+G  NW D+ P  FL DF   + +  C RL  +VN+
Sbjct  221   FYNLSDSNPEVELLQSLVDEGYDLLGLLNWSDHLP--FLGDFDPQRIRFRCSRLVPKVNN  278

Query  852   LVGQIIEKRKRQFEGIEINVNNNT-DFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
              V +II++ ++       N N  T DF+ VLLSL + + L+D+D+++VLWEMIFRGTDTV
Sbjct  279   FVTRIIDEHRQ-------NSNRETMDFVDVLLSLQQNENLSDSDIISVLWEMIFRGTDTV  331

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             A+L+EWI+ARMV+H+DVQ K + E+D  VG SR V +SDIP+L YL A+VKEVLRLHPPG
Sbjct  332   AVLIEWILARMVVHEDVQKKVEEELDNVVGKSRAVMESDIPSLVYLTAVVKEVLRLHPPG  391

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM--------  1364
             PLLSWAR+A+ D  +D   +P GTTAMVNMW+I  DP+IW+DP  F PERF+        
Sbjct  392   PLLSWARIAITDTTIDGYHVPRGTTAMVNMWSIARDPQIWSDPLEFMPERFLSAGPGGGG  451

Query  1365  EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSE  1532
             + E SIMGSDLRLAPFGSGRR CPG+AL  +TV  W+A  L  FKWLP P+    V+  E
Sbjct  452   DVEFSIMGSDLRLAPFGSGRRTCPGKALAWTTVTFWVATLLHEFKWLPSPNQNQVVNFDE  511

Query  1533  CLKLSLEMKKHLAI  1574
              LKLS EM   L +
Sbjct  512   VLKLSCEMANPLTV  525



>gb|KFK35375.1| hypothetical protein AALP_AA5G277100 [Arabis alpina]
Length=533

 Score =   463 bits (1191),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 251/485 (52%), Positives = 318/485 (66%), Gaps = 20/485 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNY--SNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRL  329
             FW   GG AW  Y          + GP   PF+G +  M +  AHR +A+ A + G  RL
Sbjct  44    FWSHPGGPAWGKYFLHRRHVTTVIPGPRGLPFVGSMSLMSNTLAHRCIAATAETFGAKRL  103

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR LRR
Sbjct  104   MAFSLGDTRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRR  163

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +A+NH+FSP+ I   E  R  IA +++  + K+    G   VR VV   SL N++ SVFG
Sbjct  164   IASNHLFSPKMIKRSETQRFTIANQIVTCLKKQSCNKGLCFVREVVKTASLNNMMCSVFG  223

Query  690   SCLGLQG-----EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
                 L        EL  +V+EGY+L+G  NW D+ P     D    + +C  L  +VN  
Sbjct  224   KEYELDEEHEEVNELRGLVEEGYDLLGTLNWTDHLPWLSEFDPQRIRSRCSTLVPKVNQF  283

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             V +II   + Q        ++ +DF+ VLLSL   D+L+D D+VAVLWEMIFRGTDTVA+
Sbjct  284   VNRIISDHRDQLR------DSPSDFVDVLLSLNGPDKLSDPDIVAVLWEMIFRGTDTVAV  337

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EWI+ARMVLHQD+Q+    E+D  VG SR V++SD+ +LPYL A++KEVLR+HPPGPL
Sbjct  338   LIEWILARMVLHQDIQSTVHNELDQIVGRSRTVEESDVASLPYLTAVIKEVLRVHPPGPL  397

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSI  1382
             LSWARLA+ D  +D   +PAGTTAMVNMWAI +DP +W +P  F+PERFM    E E S+
Sbjct  398   LSWARLAIEDTIIDGRRVPAGTTAMVNMWAIANDPHVWENPLEFKPERFMVKEGEVEFSV  457

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSLEM  1556
             +GSDLRLAPFGSGRRVCPG+ LGL+TV  W+A  L  F+WLP    +VDLSE L+LS EM
Sbjct  458   LGSDLRLAPFGSGRRVCPGKNLGLTTVTFWIATLLHEFEWLPFDEKTVDLSEKLRLSCEM  517

Query  1557  KKHLA  1571
                LA
Sbjct  518   ACPLA  522



>ref|XP_002878418.1| CYP78A9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54677.1| CYP78A9 [Arabidopsis lyrata subsp. lyrata]
Length=541

 Score =   463 bits (1191),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 249/486 (51%), Positives = 317/486 (65%), Gaps = 21/486 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNY--SNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRL  329
             FW   GG AW  Y     +    + GP   PF+G +  M S  AHR +A+ A   G  RL
Sbjct  44    FWSHPGGPAWGKYFLHRRRQTTVIPGPRGLPFVGSMSLMSSALAHRCIAATAEKFGAKRL  103

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR LRR
Sbjct  104   MAFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRR  163

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +A+NH+FSP++I   E  R  IA +++  + K+    G    R ++   SL N++ SVFG
Sbjct  164   IASNHLFSPKQIKRSETQRREIANQIVKCLAKQSNTKGLCFARDLIKTASLNNMMCSVFG  223

Query  690   SCLGLQG-----EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
                 L+       EL  +V+EGY+L+G  NW D+ P     D    + +C  L  +VN  
Sbjct  224   KEYELENEHEEVSELRGLVEEGYDLLGTLNWTDHLPWLSEFDPQRIRSRCSNLVPKVNRF  283

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             V +II   + Q        ++ +DF+ VLLSL   D+L+D D+VAVLWEMIFRGTDTVA+
Sbjct  284   VNRIISDHRDQTR------DSPSDFVDVLLSLDGPDKLSDPDIVAVLWEMIFRGTDTVAV  337

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EWI+ARMVLH D+Q+    E+D  VG SR V++SD+ +L YL A+VKEVLRLHPPGPL
Sbjct  338   LIEWILARMVLHPDIQSTVHNELDQIVGRSRAVEESDVASLEYLTAVVKEVLRLHPPGPL  397

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSI  1382
             LSWARLA+ D  +D C +PAGTTAMVNMWAI+HDP +W +P  F+PERF+    E E S+
Sbjct  398   LSWARLAITDTIIDGCRVPAGTTAMVNMWAISHDPHVWENPLEFKPERFVAKEGEVEFSV  457

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP---SVDLSECLKLSLE  1553
             +GSDLRLAPFGSGRRVCPG+ LGL+TV  W A  L  F+WL      +VDLSE L+LS E
Sbjct  458   LGSDLRLAPFGSGRRVCPGKNLGLTTVTFWTATLLHEFEWLTPSDEKTVDLSEKLRLSCE  517

Query  1554  MKKHLA  1571
             M   LA
Sbjct  518   MANPLA  523



>ref|XP_006849151.1| hypothetical protein AMTR_s00027p00127290 [Amborella trichopoda]
 gb|ERN10732.1| hypothetical protein AMTR_s00027p00127290 [Amborella trichopoda]
Length=526

 Score =   462 bits (1189),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 241/485 (50%), Positives = 315/485 (65%), Gaps = 19/485 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQN-----PKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLN  323
             +W   GG AW  Y + +         + GP  WP +G L  M    HR+L + A+ +G  
Sbjct  41    YWAWPGGPAWGKYWSAKGLFRRAGPTIPGPRGWPLIGSLNLMTGLPHRRLQATASRLGAV  100

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RLMAFSLG TR II+SHPD AKEIL  S+F DRP+KESA  LMF RAIGFAP G YWR L
Sbjct  101   RLMAFSLGETRAIITSHPDVAKEILNSSAFADRPIKESAYGLMFHRAIGFAPYGPYWRGL  160

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             RR+AA H+FS ++I   E  R  IA  M   + +   +     +R ++   SL NV+ +V
Sbjct  161   RRIAATHVFSRKQINGSEPRRLEIAALMTDALAEAAKDGRDFRIRRLLKRASLNNVMATV  220

Query  684   FGSCLGL-----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             FG          +  EL  +V+EGYE++G  NW D+  L   LD  G +R+C +L   VN
Sbjct  221   FGRRYEFDQAEPEAVELSQLVEEGYEILGTLNWSDHLSLLDGLDLQGVRRRCSKLVPHVN  280

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               V  ++E+ +    G         +F  VL+S+   ++L++ D+VAVLWEMIFRGTDTV
Sbjct  281   RFVKGLLEENRVGLAG------ETANFARVLMSMEGSEKLSEDDMVAVLWEMIFRGTDTV  334

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             AIL+EW +AR+ LH DVQA+   E+D  VGP+RH+ ++D+PNLPYL A++KE +RLHPPG
Sbjct  335   AILIEWALARLALHPDVQARVHEELDIVVGPTRHISEADLPNLPYLNALLKETVRLHPPG  394

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME-EEVSIM  1385
             PLLSWARL+  D  VD   +P GTTAMVNMWAI  DP +W DP  FRPERF++ E+ SIM
Sbjct  395   PLLSWARLSTVDTTVDGRHVPQGTTAMVNMWAIARDPSLWPDPLAFRPERFLDGEDFSIM  454

Query  1386  GSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMK  1559
             GSDLRLAPFGSGRR CPG+ALGL +V +W+A  L  F+W P     VDL+E ++LS EMK
Sbjct  455   GSDLRLAPFGSGRRSCPGKALGLKSVTIWVAYLLHEFEWRPSDKEPVDLTEVMRLSCEMK  514

Query  1560  KHLAI  1574
             + LA+
Sbjct  515   RPLAV  519



>ref|XP_010245857.1| PREDICTED: cytochrome P450 78A7-like [Nelumbo nucifera]
Length=533

 Score =   462 bits (1188),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 248/480 (52%), Positives = 322/480 (67%), Gaps = 18/480 (4%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRLMAFSLGT  350
             GG AW+N  + +    + G    P  G L  +    AHR LASMA+S+G  +LMAFSLG+
Sbjct  51    GGVAWKNGRHRKGRVPIPGARGLPVFGSLFSLSRGLAHRTLASMASSLGATQLMAFSLGS  110

Query  351   TRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMF  530
               ++++S P TA+EIL    F DRP+K+SAK LMF RAIGFAP+G+YWR LRR+A++H+F
Sbjct  111   APVVVASDPHTAREILTSPFFADRPLKQSAKKLMFSRAIGFAPNGTYWRLLRRIASSHLF  170

Query  531   SPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQG  710
             SP+RIA  E  R A    M+  + KE    G V +R  +   +L N++ SVFG    ++ 
Sbjct  171   SPKRIAAHEPGRQADCSAMLNGIAKEQSVRGSVALRKHLQSAALNNIMGSVFGKRYDVEQ  230

Query  711   E-----ELGLMVKEGYELIGEFNWGDYFP-LGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
             +     EL  MVKEG+EL+G FNW DY P L +  D      +C  L  RV  LV  IIE
Sbjct  231   DSQEMSELREMVKEGFELLGAFNWSDYLPWLSYFYDPFHINERCSALVPRVRKLVRGIIE  290

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             + + +  G     ++N DF++VLLSL  E++L + D+VAVLWEMIFRGTDT A+L EW+M
Sbjct  291   EHRLRGSG---KASDNADFVNVLLSLDGEEKLEEDDMVAVLWEMIFRGTDTTALLTEWVM  347

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             A +VL+  VQAK Q E+D  VG  + V D+D+ NLPYLQA+VKE LR+HPPGPLLSWARL
Sbjct  348   AELVLNPSVQAKLQSELDRVVG-DKSVTDADVANLPYLQAVVKESLRIHPPGPLLSWARL  406

Query  1233  AVHDVYV-DKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEE----VSIMGSDL  1397
             +  DV + +   IPA TTAMVNMWAITHD K+W +P  F+PERFME E    + + G+D+
Sbjct  407   STSDVQMSNGMLIPANTTAMVNMWAITHDSKVWEEPLVFKPERFMESEGGINLDVRGNDM  466

Query  1398  RLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKHLA  1571
             RLAPFG GRRVCPG+ LGL TV LW+A+ + HFKW+  P   VDLSE LKLS EMK  L+
Sbjct  467   RLAPFGGGRRVCPGKNLGLVTVSLWVAKLVHHFKWVVDPENPVDLSEVLKLSCEMKNPLS  526



>ref|XP_010261110.1| PREDICTED: cytochrome P450 78A7-like [Nelumbo nucifera]
Length=538

 Score =   461 bits (1187),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 246/480 (51%), Positives = 323/480 (67%), Gaps = 18/480 (4%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRLMAFSLGT  350
             GG AW++  N +    + GP   P  G L  +    AHR LASMA+++G  +LMAFSL +
Sbjct  52    GGIAWKSGRNQRGRASIPGPRGLPVFGSLFSLSRGLAHRTLASMASTLGATQLMAFSLAS  111

Query  351   TRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMF  530
             T ++++S P TA+EIL    F DRP+K+SAK LMF RAIGFAP+G+YWR LRR+A++H+F
Sbjct  112   TPVVVASDPHTAREILTSPYFADRPLKQSAKKLMFSRAIGFAPNGTYWRLLRRIASSHLF  171

Query  531   SPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQG  710
             +P+ IA  E  R      M+  + +E    G V +R  +   +L N++ SVFG    ++ 
Sbjct  172   APKHIAAHETGRQMDCSAMLNGIAREQSARGAVTLRKHLQAAALNNIMGSVFGKRYDVEQ  231

Query  711   E-----ELGLMVKEGYELIGEFNWGDYFP-LGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
             +     EL  MVKEG+EL+G FNW DY P L +L D     ++C  L  RV  LV  IIE
Sbjct  232   DSEEVRELREMVKEGFELLGAFNWSDYLPWLSYLYDPFRINQRCSALVPRVRKLVRGIIE  291

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             + +R+  G    V++N DF+ VLLSL  E++L + D+VAVLWEMIFRGTDT A+L EW M
Sbjct  292   EHRRRGSG---KVSDNADFVDVLLSLDGEEKLGEDDMVAVLWEMIFRGTDTTALLTEWAM  348

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             A +VL+  +QAK Q E+D  VG  R V D+D+ NLPYLQA+VKE LR+HPPGPLLSWARL
Sbjct  349   AELVLNPSMQAKLQSELDMVVG-GRCVTDADVANLPYLQAVVKETLRVHPPGPLLSWARL  407

Query  1233  AVHDVYV-DKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEE----VSIMGSDL  1397
             +  DV + +   IPA T AMVNMWAITHD K+W DP  F+PERF+E E    + + G+D 
Sbjct  408   STSDVELSNGMLIPANTVAMVNMWAITHDSKVWEDPLAFKPERFVESEGGINLDVRGNDT  467

Query  1398  RLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKHLA  1571
             RLAPFG+GRRVCPG+ LGL TV LW+A+ + +FKW+  P   VDLSE LKLS EMKK L+
Sbjct  468   RLAPFGAGRRVCPGKNLGLVTVSLWVAKLVHNFKWVVDPENPVDLSEMLKLSCEMKKPLS  527



>ref|XP_007039393.1| Cytochrome P450 78A3 [Theobroma cacao]
 gb|EOY23894.1| Cytochrome P450 78A3 [Theobroma cacao]
Length=530

 Score =   460 bits (1183),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 250/490 (51%), Positives = 320/490 (65%), Gaps = 27/490 (6%)
 Frame = +3

Query  159   FWVVEGGFAWRNY------SNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGL  320
             FW   GG AW  Y      ++ +    + GP  +P LG +  M + AHRKL + A S G 
Sbjct  43    FWKCPGGPAWGKYWLRKRAASTKPNNIIPGPRGFPVLGSMDLMVNLAHRKLFAAAKSFGA  102

Query  321   NRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQ  500
              RLMAFSLG TR+II+ +PD AKEIL  S F DRPVKESA  LMF RAIGFAP G YWR 
Sbjct  103   KRLMAFSLGDTRVIITCNPDVAKEILNSSVFADRPVKESAYSLMFNRAIGFAPYGVYWRT  162

Query  501   LRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVES  680
             LRR+AA H+F P++I+  E  R  IA +M+  +       G   VR V+ + SL N++ S
Sbjct  163   LRRIAATHLFCPKQISSTEAQRLDIASQMVSVI---AYRGGEFSVRDVLKKASLNNMMCS  219

Query  681   VFGSCLGL-----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRV  845
             VFG    L     + EEL  +V+EGY+L+G+ NW D+ P    LD    + +C  L  +V
Sbjct  220   VFGIKYQLGSSNSETEELSQLVEEGYDLLGKLNWSDHLPWLAGLDLQKIRLRCSELVPKV  279

Query  846   NDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDT  1025
             N  V +II++ K Q          N DF+ VLLSL   D+L+D D++AVLWEMIFRGTDT
Sbjct  280   NKFVNRIIQEHKHQ------TGKRNHDFVDVLLSLNGPDRLSDHDMIAVLWEMIFRGTDT  333

Query  1026  VAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             VA+L+EWI+ARMVLH ++Q+K Q E+D  VG SR + +SDI ++ +L A+VKEVLRLHPP
Sbjct  334   VAVLIEWILARMVLHPEIQSKVQAELDQVVGRSRPLMESDIRSMVFLPAVVKEVLRLHPP  393

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE-----  1370
             GPLLSWARLA+ D  +D   +PAGTTAMVNMWAIT DP +W DP  F PERF+ +     
Sbjct  394   GPLLSWARLAITDTAIDGYHVPAGTTAMVNMWAITRDPDVWADPLKFMPERFVSKDRADV  453

Query  1371  EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKL  1544
             E S++GSDLRLAPFGSGRR CPG+ LGL+TV  W+A  L  F+W+      VDL+E L+L
Sbjct  454   EFSVLGSDLRLAPFGSGRRSCPGKTLGLATVSFWVASLLHEFEWVQSDDNPVDLTETLRL  513

Query  1545  SLEMKKHLAI  1574
             S EM   L +
Sbjct  514   SCEMANPLKV  523



>ref|XP_008233084.1| PREDICTED: cytochrome P450 78A9 [Prunus mume]
Length=550

 Score =   461 bits (1185),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 255/496 (51%), Positives = 323/496 (65%), Gaps = 34/496 (7%)
 Frame = +3

Query  159   FWVVEGGFAW-RNYSN--------NQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATS  311
             +W   GG AW RN+ N        ++    + GP   P +G +  M S AHRK+A+MA S
Sbjct  44    YWSHPGGPAWGRNFKNIIPLLLKSSKTKPIIPGPRGLPLIGSMALMTSLAHRKIAAMARS  103

Query  312   MGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSY  491
                 RLMAFSLG TR++++ HPD A+EIL  S F DRPVKESA  LMF RAIGFAP G Y
Sbjct  104   CNAKRLMAFSLGQTRVVVTCHPDVAREILNSSVFADRPVKESAYSLMFNRAIGFAPYGVY  163

Query  492   WRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNV  671
             WR LRR++A H+FSP++I   E  R  +A +M+            + +R VV   SL N+
Sbjct  164   WRTLRRISAAHLFSPKQIKNSEVQRRELASQMVAMFGTH---KEKLAIREVVKRASLNNM  220

Query  672   VESVFG--------SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRK--  821
             + SVFG        + +  + EEL  +V EGY+L+G  NW D+ P  +L DF G K +  
Sbjct  221   MCSVFGRKYELEFGASMNNEVEELKGLVDEGYDLLGMLNWSDHLP--WLADFDGQKIRFR  278

Query  822   CHRLAGRVNDLVGQIIEKRKRQFE-GIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLW  998
             C  L  RVN  V +II + +   E G +  V    DF+ VLLSL   D+L+D+D++AVLW
Sbjct  279   CSNLVPRVNRFVSRIISEHRTDVEAGKDEKV---PDFVDVLLSLQGPDKLSDSDMIAVLW  335

Query  999   EMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIV  1178
             EMIFRGTDTVA+L+EWIMARMVLH DVQ+    E+D  VG SR V +SDI  L YL A+V
Sbjct  336   EMIFRGTDTVAVLIEWIMARMVLHPDVQSTVHDELDKVVGRSRAVNESDISELVYLTAVV  395

Query  1179  KEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPER  1358
             KEVLRLHPPGPLLSWARLA+ D  +D   +P GTTAMVNMWAI+ D ++W DP  F+P+R
Sbjct  396   KEVLRLHPPGPLLSWARLAITDTTIDGYHVPLGTTAMVNMWAISRDSEVWVDPLEFKPDR  455

Query  1359  FM----EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSV  1520
             F+    E E S+ GSDLRLAPFGSGRR CPG+ALGL+TV  W+A  L  ++WLP    +V
Sbjct  456   FVARDGELEFSVFGSDLRLAPFGSGRRTCPGKALGLTTVTYWVASLLHEYEWLPLDENAV  515

Query  1521  DLSECLKLSLEMKKHL  1568
             DLSE L+LS EM K L
Sbjct  516   DLSEVLRLSCEMAKPL  531



>gb|KDO86564.1| hypothetical protein CISIN_1g009292mg [Citrus sinensis]
Length=538

 Score =   460 bits (1183),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 250/491 (51%), Positives = 320/491 (65%), Gaps = 29/491 (6%)
 Frame = +3

Query  159   FWVVEGGFAWRNY------SNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGL  320
             +W   GG AW  Y      S+    K + GP   P +G +  M S +HRK+A+ A S   
Sbjct  43    YWAHPGGPAWGKYKFKRGSSSFVKAKPIPGPRGLPVIGNMNLMMSLSHRKIAAAAESCKA  102

Query  321   NRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQ  500
              RLMAFSLG TR+I++S+PD AKEIL  S F DRPVKESA  LMF RAIGFAP G YWR 
Sbjct  103   KRLMAFSLGDTRVIVTSNPDVAKEILNSSVFADRPVKESAYSLMFNRAIGFAPYGVYWRT  162

Query  501   LRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVES  680
             LRR+AA H+F P++I   E  R AIA +M+       G      VR  +   SL N++ S
Sbjct  163   LRRIAATHLFCPKQIKGAEAQRLAIASQMVATF---AGYKQGFCVREALKRASLNNMMCS  219

Query  681   VFG-----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRK--CHRLAG  839
             VFG       L  + +EL  +V EGYE++G  NW D+ P  +L DF   K +  C +LA 
Sbjct  220   VFGREYKLDSLNDEVKELRALVDEGYEILGILNWTDHLP--WLADFDPQKIRFRCSKLAP  277

Query  840   RVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGT  1019
             +VN  VG+I+ + K     ++ N   N DF+ VLLSL   D+L+D+D++AVLWEMIFRGT
Sbjct  278   KVNRFVGRIVAQHK-----VQSNKQKNLDFVDVLLSLQGSDKLSDSDMIAVLWEMIFRGT  332

Query  1020  DTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLH  1199
             DTVA+L+EWI+AR+VLH DVQ++   E+D  VG SR V +SD+  L YL A++KEVLRLH
Sbjct  333   DTVAVLIEWILARLVLHCDVQSRVHDELDKVVGRSRAVAESDLGELIYLAAVIKEVLRLH  392

Query  1200  PPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE---  1370
             PPGPLLSWARLA+ D  +D   +P GTTAMVNMWAI+ DP +W +P  F PERF+ +   
Sbjct  393   PPGPLLSWARLAITDTTIDGYHVPRGTTAMVNMWAISRDPDVWKNPLEFIPERFLPKEGG  452

Query  1371  -EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP--SVDLSECLK  1541
              E S++GSDL LAPFGSGRRVCPG+ LGL+TV  W+A  L  + WLP    +VDLSE L+
Sbjct  453   VEFSVLGSDLTLAPFGSGRRVCPGKNLGLTTVSFWVASLLHEYAWLPSAQNTVDLSEVLR  512

Query  1542  LSLEMKKHLAI  1574
             LS EM   L +
Sbjct  513   LSCEMASPLTV  523



>ref|XP_006397858.1| hypothetical protein EUTSA_v10001398mg [Eutrema salsugineum]
 gb|ESQ39311.1| hypothetical protein EUTSA_v10001398mg [Eutrema salsugineum]
Length=527

 Score =   459 bits (1182),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 247/484 (51%), Positives = 319/484 (66%), Gaps = 20/484 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYS----NNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLN  323
             FW   GG AW  +      N+    + GP  +PF+G +  M S  AH ++A +A  +G  
Sbjct  43    FWSYPGGPAWGKFFFRRLTNKTGTVIPGPRGFPFVGSMSLMSSTLAHHRIAHVAEKLGAK  102

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RLMAFSLG TR+I++ +P+ AKEIL    F DRPVKESA  LMF RAIGFAP G YWR L
Sbjct  103   RLMAFSLGETRVIVTCNPEVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPHGVYWRTL  162

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             RR+A+NH+FSP++I   E  R  IA +M+  ++K+   +G   VR ++   SL N++ SV
Sbjct  163   RRIASNHLFSPKQIRRAETQRRVIASQMVRFLEKQ-STNGLCFVRELLKTASLNNMMSSV  221

Query  684   FGSCLGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLV  857
             FG    L  +  EL  +V+EGY+L+G  NW D+ P     D    + +C  L  +VN  V
Sbjct  222   FGEECELDKDHGELRELVEEGYDLLGTLNWTDHLPWLSEFDPQRIRSRCSTLVPKVNRFV  281

Query  858   GQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAIL  1037
              ++I + + Q        ++  DF+ VLLSL   D L+D D++AVLWEMIFRGTDTVA+L
Sbjct  282   SRVISEHRNQ------TSDSPRDFVDVLLSLHGSDNLSDPDIIAVLWEMIFRGTDTVAVL  335

Query  1038  VEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             +EWI+ARMVLH D+Q+  Q E+D  VG SR V +SD+ +L YL A++KEVLRLHPPGPLL
Sbjct  336   IEWILARMVLHPDIQSMVQNELDLVVGKSRAVDESDLASLHYLTAMIKEVLRLHPPGPLL  395

Query  1218  SWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSIM  1385
             SWARLA+ D  VD   +PAGTTAMVNMWAI HDP +W DP  F+PERF+    E E S++
Sbjct  396   SWARLAITDTIVDGRLVPAGTTAMVNMWAIAHDPHVWADPLEFKPERFVAKEGEMEFSVL  455

Query  1386  GSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSLEMK  1559
             GSDLRLAPFGSGRR+CPG+ LGL TV  W A  L  F+W P  G  VDLSE L+LS EM 
Sbjct  456   GSDLRLAPFGSGRRICPGKNLGLITVTYWTATLLHEFEWGPSDGNGVDLSEKLRLSCEMA  515

Query  1560  KHLA  1571
               L+
Sbjct  516   NPLS  519



>sp|O65012.1|C78A4_PINRA RecName: Full=Cytochrome P450 78A4 [Pinus radiata]
 gb|AAC05148.1| cytochrome P450 [Pinus radiata]
Length=553

 Score =   460 bits (1184),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 248/482 (51%), Positives = 318/482 (66%), Gaps = 16/482 (3%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMG-SHAHRKLASMATSMGLNRLMAF  338
             W+  GG AW    + +    + GP  WP +G L  M     HRKL S+A   G  +LM+F
Sbjct  60    WLSPGGCAWAG-RHKRGRVAIPGPKGWPIIGSLMDMSVGLPHRKLESLARLHGAKQLMSF  118

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             SLG T  +I+S P+ A+E+L    F +RP+K+SA+ L+F RAIGFAP+G YWR LRR+A+
Sbjct  119   SLGCTPAVITSDPEVARELLTSPHFANRPLKQSAQQLLFGRAIGFAPNGGYWRLLRRIAS  178

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              H+F+PRRIA  E  R A    M+  + KE    G V VR  +   +L N++ SVFG   
Sbjct  179   AHLFAPRRIAAHEAGRQADVVAMLDDIQKEYHSKGVVRVRRHLQGAALNNIMGSVFGRRF  238

Query  699   GLQGE-----ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
              +  E     +L  MV EG++L+G FNW D+ P    LD      +C RL  RV   V  
Sbjct  239   DMSHENEEVKKLREMVDEGFQLLGAFNWADHLPWLRPLDPLRIHARCARLVPRVTTFVSN  298

Query  864   IIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             IIE+ +R+ +  E    +  DF+ VLLSL  ED+L + D++AVLWEMIFRGTDT A+L E
Sbjct  299   IIEQHRREEQRRE--SGDQCDFVDVLLSLQGEDKLDEEDMIAVLWEMIFRGTDTTALLTE  356

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  1223
             W MA +VLH + Q KAQ E+D  VG  R V+DSDIP LPY+QA+VKE LR+HPPGPLLSW
Sbjct  357   WTMAELVLHPEAQKKAQAELDAVVGHDRSVKDSDIPKLPYIQAVVKEALRMHPPGPLLSW  416

Query  1224  ARLAVHDVYV-DKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSIMG  1388
             ARL+  DV + D   +PAGTTAMVNMW+ITHDP IW  P+ FRPERF+     EEV + G
Sbjct  417   ARLSTEDVNMGDGMCVPAGTTAMVNMWSITHDPNIWESPYEFRPERFVVFEGGEEVDVRG  476

Query  1389  SDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKK  1562
             +DLRLAPFG+GRRVCPG+ALGL+TV+LW+A+ L HF+WLP     VDLSE LKLS EM +
Sbjct  477   NDLRLAPFGAGRRVCPGKALGLATVNLWVAKLLHHFEWLPHAEHPVDLSEVLKLSCEMAR  536

Query  1563  HL  1568
              L
Sbjct  537   PL  538



>ref|XP_006491339.1| PREDICTED: cytochrome P450 78A9-like [Citrus sinensis]
Length=538

 Score =   459 bits (1182),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 250/491 (51%), Positives = 320/491 (65%), Gaps = 29/491 (6%)
 Frame = +3

Query  159   FWVVEGGFAWRNY------SNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGL  320
             +W   GG AW  Y      S+    K + GP   P +G +  M S +HRK+A+ A S   
Sbjct  43    YWAHPGGPAWGKYKFKRGSSSFVKAKPIPGPRGLPVIGNMNLMMSLSHRKIAAAAESCKA  102

Query  321   NRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQ  500
              RLMAFSLG TR+I++S+PD AKEIL  S F DRPVKESA  LMF RAIGFAP G YWR 
Sbjct  103   KRLMAFSLGDTRVIVTSNPDVAKEILNSSVFADRPVKESAYSLMFNRAIGFAPYGVYWRT  162

Query  501   LRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVES  680
             LRR+AA H+F P++I   E  R AIA +M+       G      VR  +   SL N++ S
Sbjct  163   LRRIAATHLFCPKQIKGAEAQRLAIASQMVATF---AGYKQGFCVREALKRASLNNMMCS  219

Query  681   VFG-----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRK--CHRLAG  839
             VFG       L  + +EL  +V EGYE++G  NW D+ P  +L DF   K +  C +LA 
Sbjct  220   VFGREYKLDSLNDEVKELRALVDEGYEILGILNWTDHLP--WLADFDPQKIRFRCSKLAP  277

Query  840   RVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGT  1019
             +VN  VG+I+ + K     ++ N   N DF+ VLLSL   D+L+D+D++AVLWEMIFRGT
Sbjct  278   KVNRFVGRIVAQHK-----VQSNNQKNLDFVDVLLSLQGSDKLSDSDMIAVLWEMIFRGT  332

Query  1020  DTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLH  1199
             DTVA+L+EWI+AR+VLH DVQ++   E+D  VG SR V +SD+  L YL A++KEVLRLH
Sbjct  333   DTVAVLIEWILARLVLHCDVQSRVHDELDKVVGRSRAVAESDLGELIYLAAVIKEVLRLH  392

Query  1200  PPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE---  1370
             PPGPLLSWARLA+ D  +D   +P GTTAMVNMWAI+ DP +W +P  F PERF+ +   
Sbjct  393   PPGPLLSWARLAITDTTIDGYHVPRGTTAMVNMWAISRDPDVWKNPLEFIPERFLPKEGG  452

Query  1371  -EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP--SVDLSECLK  1541
              E S++GSDL LAPFGSGRRVCPG+ LGL+TV  W+A  L  + WLP    +VDLSE L+
Sbjct  453   VEFSVLGSDLTLAPFGSGRRVCPGKNLGLTTVSFWVASLLHEYAWLPSAQNTVDLSEVLR  512

Query  1542  LSLEMKKHLAI  1574
             LS EM   L +
Sbjct  513   LSCEMASPLTV  523



>ref|XP_009607111.1| PREDICTED: cytochrome P450 78A3 [Nicotiana tomentosiformis]
Length=597

 Score =   461 bits (1186),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 247/504 (49%), Positives = 321/504 (64%), Gaps = 40/504 (8%)
 Frame = +3

Query  159   FWVVEGGFAWRNYS-------------NNQN-------PKKLNGPMSWPFLGFLPQMGSH  278
             +W   GG AW  Y              NN N        K + GP  +PF+G +  M   
Sbjct  85    YWSHPGGPAWGKYKWRKNSAGLASFNINNYNNIDHLQVSKPIPGPRGFPFIGSMNLMSGL  144

Query  279   AHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFE  458
             AHRK+A+MA +    RLM+ S+G TR+I++ +PD AKEIL  S F DRPVKESA  LMF 
Sbjct  145   AHRKIAAMAEACQAKRLMSLSVGETRVIVTCNPDVAKEILNSSVFADRPVKESAYRLMFN  204

Query  459   RAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevr  638
             RA+GFAP G YWR LR++AA H+F P++I   +  RS IA EM+     ++G    + VR
Sbjct  205   RAVGFAPYGVYWRTLRKIAAAHLFCPKQILASQAQRSQIATEMVAMF--QLGGRDIIRVR  262

Query  639   gvvgegSLRNVVESVFG-----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDF  803
               +   SL N++ SVFG      C   + EELG +V EGY+L+G  NW D+ P    LD 
Sbjct  263   DALKLASLNNMMCSVFGRKYNLDCSNSETEELGKLVNEGYDLLGLLNWSDHLPWLAELDP  322

Query  804   GGTKRKCHRLAGRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADL  983
                + +C +L  +VN  V +II++ + Q   +E       DF+ VLLSL   ++L+D+D+
Sbjct  323   QKIRLRCSQLVPKVNKFVSRIIDQHRAQSADVE------HDFVHVLLSLQGSEKLSDSDM  376

Query  984   VAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPY  1163
             +AVLWEMIFRGTDTVA+L+EWI+ARMV+H  VQ+K Q E+D  VG SR V +SD+  + Y
Sbjct  377   IAVLWEMIFRGTDTVAVLIEWILARMVIHPQVQSKVQNELDKIVGESRAVTESDVSEMTY  436

Query  1164  LQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWT  1343
             L AI+KEVLRLHPPGPLLSWARLA+ D  VD   +PAGTTAMVNMWAIT DP +W DP  
Sbjct  437   LPAIIKEVLRLHPPGPLLSWARLAITDTTVDGYHVPAGTTAMVNMWAITRDPDVWADPLE  496

Query  1344  FRPERFMEE----EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP-  1508
             F+PERF+      + S++GSDLRLAPFGSGRR CPG+ LGL+TV  W+A  L  F++ P 
Sbjct  497   FKPERFVNRAETLDFSVLGSDLRLAPFGSGRRTCPGKILGLTTVTFWVASLLHEFRFGPI  556

Query  1509  --GPSVDLSECLKLSLEMKKHLAI  1574
                  VDLSE L+LS EM   L +
Sbjct  557   DNNSPVDLSEVLRLSCEMDNPLTL  580



>ref|XP_002460977.1| hypothetical protein SORBIDRAFT_02g038670 [Sorghum bicolor]
 gb|EER97498.1| hypothetical protein SORBIDRAFT_02g038670 [Sorghum bicolor]
Length=517

 Score =   458 bits (1179),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 241/479 (50%), Positives = 328/479 (68%), Gaps = 19/479 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSM-GLNRLM  332
              W+  GG AW      + P   +GP      G +  + S  AHR LA+++ ++ G   LM
Sbjct  38    LWLSPGGPAWALSRCRRPP---SGPT-----GVVTALSSPVAHRTLAALSHAVDGGKALM  89

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSG-SYWRQLRR  509
             AFS+G TR+++SS PDTA+EIL   +F+DRP+K++A+ L+F RA+GFAPSG ++WR LRR
Sbjct  90    AFSVGLTRLVVSSQPDTAREILVNPAFSDRPIKDAARHLLFHRAMGFAPSGDAHWRGLRR  149

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +AANH+F PRR+A     R +I E M+  +   M   G V ++ V+   SL +++ +VFG
Sbjct  150   LAANHLFGPRRVAAAAHHRVSIGEAMVADVAAAMARHGEVSLKRVLHIASLNHIMATVFG  209

Query  690   SCLGLQGEE---LGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVG  860
                 +  +E   L  MV EGY+L+G FNW D+ PL   LD  G +R+C+RL  +V   VG
Sbjct  210   KHYDMDSQEGVLLEEMVTEGYDLLGTFNWADHLPLIKHLDLQGVRRRCNRLVQKVEVFVG  269

Query  861   QIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
             +II++ + +     ++     DF+ VLL L  E++L+++D++AVLWEMIFRG DTVAIL+
Sbjct  270   KIIQEHRARRANGGVDDEYMGDFVDVLLDLEGEEKLSESDMIAVLWEMIFRGADTVAILM  329

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EWIMARM LH ++Q+KAQ E+D  V     V D+D+ NLPY+Q IVKE LR+HPPGPLLS
Sbjct  330   EWIMARMALHPEIQSKAQAELDGVVVGG--VADADVGNLPYIQCIVKETLRMHPPGPLLS  387

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLR  1400
             WARLA+HD +V    +PAGTTAMVNMW+I HDP IW +P  FRPERF EE+VS++GSDLR
Sbjct  388   WARLAIHDAHVGGHLVPAGTTAMVNMWSIAHDPAIWAEPEKFRPERFQEEDVSVLGSDLR  447

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS---VDLSECLKLSLEMKKHL  1568
             LAPFG+GRRVCPG+ L L+T HLW+A+ L  F+W P  +   VDLSE L +SLEM   L
Sbjct  448   LAPFGAGRRVCPGKMLALATTHLWIAQLLHEFEWAPAAANGGVDLSERLNMSLEMATPL  506



>ref|XP_010267448.1| PREDICTED: cytochrome P450 78A9 [Nelumbo nucifera]
Length=528

 Score =   459 bits (1180),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 255/488 (52%), Positives = 318/488 (65%), Gaps = 25/488 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNY----SNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNR  326
             +W   GG AW  Y        + K + GP   P +G +  M S AHR+LA+ A     NR
Sbjct  43    YWAYPGGSAWGKYWFWLKKGPSAKPIPGPRGLPVVGSINLMASLAHRQLAAAAQQCLANR  102

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LMAFSLG TR+II+ +PD AKEIL  S F DRPVKESA  LMF RAIGFAP G YWR LR
Sbjct  103   LMAFSLGETRVIITCNPDVAKEILNSSVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLR  162

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVF  686
             R+AA H+F P++I   E  R  IA +M+  +       G   VR  +   SL N++ SVF
Sbjct  163   RIAATHLFCPKQINGSEDQRFRIAAQMVSMVGHR---KGEFSVRDTLKRASLNNMMSSVF  219

Query  687   GSCLGL-----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVND  851
             G    L     + +EL  +V+EGY+L+G+ NW D+ P    LD+   + +C +L  +VN 
Sbjct  220   GRQYELSSSCEETDELSRLVEEGYDLLGKLNWSDHLPWLAGLDYQNIRSRCSKLVPKVNR  279

Query  852   LVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVA  1031
              V +II + + +         NN DF+ VLLSL   D+L+D D+VAVLWEMIFRGTDTVA
Sbjct  280   FVNRIIAEHRTK------TGKNNQDFVDVLLSLQGSDKLSDPDMVAVLWEMIFRGTDTVA  333

Query  1032  ILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGP  1211
             IL+EWI+ARMVLH D+Q+K Q E+D  VG SR V + DI  + YL A+VKEVLRLHPPGP
Sbjct  334   ILIEWILARMVLHPDIQSKVQQELDEVVGKSRPVLEPDIQAMVYLPAVVKEVLRLHPPGP  393

Query  1212  LLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-----EEEV  1376
             LLSWARLA+ D  VD   +PAGTTAMVNMWAIT DP++W+DP  F PERF+     E E 
Sbjct  394   LLSWARLAITDTTVDGKQVPAGTTAMVNMWAITRDPQVWSDPLKFMPERFVSRKEDEVEF  453

Query  1377  SIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSL  1550
             S+MGSDLRLAPFGSGRR CPG+ALGL+TV  W+A  L  F+W+      VDLSE L+LS 
Sbjct  454   SVMGSDLRLAPFGSGRRTCPGKALGLTTVTFWVATLLHEFEWIGSVQNPVDLSEILRLSC  513

Query  1551  EMKKHLAI  1574
             EM   L +
Sbjct  514   EMANPLTV  521



>gb|KHG03059.1| Cytochrome P450 [Gossypium arboreum]
Length=497

 Score =   457 bits (1175),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 247/490 (50%), Positives = 315/490 (64%), Gaps = 27/490 (6%)
 Frame = +3

Query  159   FWVVEGGFAWRNY------SNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGL  320
             FW   GG AW  Y      + ++    + GP  +P +G +  M + AHRKL++ A     
Sbjct  10    FWFYPGGPAWGKYNWLTKRAASKAKNTIPGPRGFPIVGSMNLMVNLAHRKLSTAANCFRA  69

Query  321   NRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQ  500
              RLMAFSLG TR+II+ +PD AKEIL  S F DRPVKESA  LMF RAIGFAP G YWR 
Sbjct  70    RRLMAFSLGDTRVIITCNPDVAKEILNSSVFADRPVKESAYSLMFNRAIGFAPYGVYWRT  129

Query  501   LRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVES  680
             LRR+AA H+F P++I+  E  R  IA +M+  +       G   +R ++ + SL N++ S
Sbjct  130   LRRIAATHLFCPKQISSTEAQRLDIASQMVSII---ACRRGEFTIRNMLKKASLNNMMCS  186

Query  681   VFGSCLGLQG-----EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRV  845
             VFG+   L+      EELG +V+EGY+L+G  NW D+ P    LD    + +C  L  RV
Sbjct  187   VFGTKYQLESSNTETEELGQLVEEGYDLLGNLNWSDHLPWLACLDLQNIRLRCSELVPRV  246

Query  846   NDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDT  1025
             N  V +II+      E I        DF+ VLLSL   D+L+D D++AVLWEMIFRGTDT
Sbjct  247   NKFVNKIIQ------EHILKTGTRAPDFVDVLLSLNGPDRLSDNDMIAVLWEMIFRGTDT  300

Query  1026  VAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             VA+L+EWI+ARMVLH ++Q++ Q E+D  VG S  + +SDI ++ YL A+VKEVLRLHPP
Sbjct  301   VAVLIEWILARMVLHPEIQSRVQAELDQVVGKSWELLESDIQSMVYLPAVVKEVLRLHPP  360

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE-----  1370
             GPLLSWARLA+ D  VD   +PAGTTAMVNMWAIT DP  W DP  F PERF+ +     
Sbjct  361   GPLLSWARLAITDTTVDGYHVPAGTTAMVNMWAITRDPDFWVDPLKFNPERFVSKESADV  420

Query  1371  EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKL  1544
             E S++GSDLRL+PFGSGRR CPG+ LGL+TV  W+   L  FKW+      VDLSE LKL
Sbjct  421   EFSVLGSDLRLSPFGSGRRSCPGKTLGLATVTFWVGTLLHEFKWVASDDNPVDLSEVLKL  480

Query  1545  SLEMKKHLAI  1574
             S EM   L +
Sbjct  481   SCEMANPLKV  490



>ref|XP_001771134.1| predicted protein [Physcomitrella patens]
 gb|EDQ63983.1| predicted protein [Physcomitrella patens]
Length=550

 Score =   459 bits (1180),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 247/481 (51%), Positives = 318/481 (66%), Gaps = 20/481 (4%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFS  341
             W+  GG +W      +  + + GP  +P +G L  MG  AHR+LA +A +     LMA S
Sbjct  57    WISPGGSSWGRL---RGKRTIPGPRGFPIIGSLLDMGGLAHRRLAQLAVAYKAMPLMALS  113

Query  342   LGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAAN  521
             LG TR++I+S PDTA+EIL  + F DRP+K+SA  LMF RAIGFA  G YWR LRR+AAN
Sbjct  114   LGETRVVIASQPDTAREILHSAGFADRPLKQSADQLMFSRAIGFASHGKYWRSLRRIAAN  173

Query  522   HMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLG  701
             H+FSP+RIA  E  R A +E M+  ++ ++   G V++RG +   SL N++ SVFG    
Sbjct  174   HLFSPKRIAEHEDSRVAESEFMLQSIENDLLVLGSVQIRGHLQRASLNNIMRSVFGRRYD  233

Query  702   L-----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQI  866
                   +  +L  MV EG++L+G FNW D+ P    LD     ++C  L  RV   V +I
Sbjct  234   FVTGSEEATQLRAMVDEGFDLLGAFNWADHLPALKFLDAQKIHQRCADLVPRVRTFVQKI  293

Query  867   I-EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             I E R      +  +    TDF+ VLLSL  ++QLAD D++AVLWEMIFRGTDT AIL E
Sbjct  294   IDEHRNENNSRVGADERRETDFVDVLLSLKGDEQLADEDMIAVLWEMIFRGTDTTAILTE  353

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPN----LPYLQAIVKEVLRLHPPGP  1211
             WIMA MVLH ++Q K Q E+D+ V P+     +   N    LPYL+A+VKE LRLHPPGP
Sbjct  354   WIMAEMVLHPEIQRKVQFELDS-VFPTGICNCASFENMLSRLPYLKAVVKETLRLHPPGP  412

Query  1212  LLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME----EEVS  1379
             LLSWARL+V DV V    IPAGTTAMVNMWAITHDP++W +P  F PERF+     ++V 
Sbjct  413   LLSWARLSVQDVCVAGHTIPAGTTAMVNMWAITHDPEVWANPSVFSPERFLPSHGGQDVD  472

Query  1380  IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP--SVDLSECLKLSLE  1553
             + G+DLRLAPFG+GRRVCPGRALGL+TVHLW+A+ L +F+W P P   VDL+E LKLS E
Sbjct  473   VRGNDLRLAPFGAGRRVCPGRALGLATVHLWVAQLLHNFEWTPAPVCEVDLTEVLKLSSE  532

Query  1554  M  1556
             M
Sbjct  533   M  533



>ref|XP_002462709.1| hypothetical protein SORBIDRAFT_02g030640 [Sorghum bicolor]
 gb|EER99230.1| hypothetical protein SORBIDRAFT_02g030640 [Sorghum bicolor]
Length=551

 Score =   458 bits (1178),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 250/493 (51%), Positives = 319/493 (65%), Gaps = 22/493 (4%)
 Frame = +3

Query  162   WVVEGGFAW-RNYSNNQNPKKLN----GPMSWPFLGFLPQMGSHAHRKLASMATSMGLNR  326
             W   GG AW R +   Q  +       GP   P +G +  M   AHRKLA+ A S+   R
Sbjct  51    WCFPGGPAWGRWWWTTQARRVAAAAVPGPRGLPVVGSMWLMTGLAHRKLAAAADSLRARR  110

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LMAFSLG TR+++++HPD A+EIL   +F DRP+KESA  L+F RAIGFAP G+YWR LR
Sbjct  111   LMAFSLGGTRVVVAAHPDVAREILNSPAFADRPIKESAYGLLFHRAIGFAPYGAYWRALR  170

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfve----vrgvvgegSLRNVV  674
             R+A+ H+FSP ++A     R+ IA +M+  M +E+  S        VR V+  GSL NV+
Sbjct  171   RVASTHLFSPWQVAASAAQRAVIARQMVAAMKQELSSSSSASAGFEVRRVLRRGSLHNVM  230

Query  675   ESVFGSCLGLQ---------GEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCH  827
              SVFG    L+           EL  +V EGY+L+G+ NW D+ P     D   T+ +C 
Sbjct  231   WSVFGRRYDLELDPAKESPETRELRSLVDEGYDLLGQLNWSDHLPWLARFDLQSTRSRCD  290

Query  828   RLAGRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMI  1007
             RL   VN  VG II+  + + +      +   DF  VLLSLP +D+L D+D++AVLWEM+
Sbjct  291   RLVPLVNRFVGGIIDAHRARNDLRSAPPHAVMDFTDVLLSLPADDRLTDSDMIAVLWEMV  350

Query  1008  FRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEV  1187
             FRGTDTVA+L+EW++AR+VLH DVQA+   E+D  VG  R V +SD  +L YL A++KEV
Sbjct  351   FRGTDTVAVLIEWVLARLVLHPDVQARVHDELDRVVGRDRAVTESDSGSLVYLHAVIKEV  410

Query  1188  LRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME  1367
             LR+HPPGPLLSWARLA  DV VD   IPAGTTAMVNMWAITHDP +W +P  F+PERFM 
Sbjct  411   LRMHPPGPLLSWARLATSDVQVDGHLIPAGTTAMVNMWAITHDPDVWAEPAEFQPERFMG  470

Query  1368  E----EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSEC  1535
                  E  IMGSDLRLAPFG+GRR CPG++L ++TV LWLA  L  F+ LP   V LSE 
Sbjct  471   STTGGEFPIMGSDLRLAPFGAGRRSCPGKSLAMATVALWLATLLHEFELLPARGVYLSEV  530

Query  1536  LKLSLEMKKHLAI  1574
             LKLS EM   LA+
Sbjct  531   LKLSCEMAVPLAV  543



>ref|XP_007048116.1| Cytochrome P450, family 78, subfamily A, polypeptide 7 [Theobroma 
cacao]
 gb|EOX92273.1| Cytochrome P450, family 78, subfamily A, polypeptide 7 [Theobroma 
cacao]
Length=539

 Score =   457 bits (1177),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 243/473 (51%), Positives = 321/473 (68%), Gaps = 14/473 (3%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRLMAFSLGT  350
             GG AW+N  N +    + GP   P  G L  +    AHR LA+MA +    +LMAFSLG+
Sbjct  52    GGIAWKNGRNQKGRLPIPGPKGLPVFGSLFTLSRGLAHRSLAAMAWNRTNTQLMAFSLGS  111

Query  351   TRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMF  530
             T ++++S P TA+EIL    F DRPVK+SAK LMF RAIGFAPSG+YWR LRR+A++H+F
Sbjct  112   TPVVVASDPHTAREILTSPHFADRPVKQSAKSLMFSRAIGFAPSGAYWRLLRRIASSHLF  171

Query  531   SPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQG  710
             +P RI   E  R      M+  +  E    GFV +R  +   +L N++ SVFG     + 
Sbjct  172   APTRIIAHEAGRQLDCTIMLRNIANEQNLQGFVSLRKHLQLAALSNIMGSVFGKRYDHKK  231

Query  711   E-----ELGLMVKEGYELIGEFNWGDYFP-LGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
             +     EL  MVKEG+EL+G FNW DY P L +  D     ++C +L  RV  LV  IIE
Sbjct  232   DNKELDELRDMVKEGFELLGAFNWSDYLPWLSYFYDPFRINQRCLKLVPRVRKLVKGIIE  291

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             + ++  E  +++  +N DF+ VLLSL  E++L + D++AVLWEMIFRGTDT A+L EW+M
Sbjct  292   QHQQLSESKKLS--DNADFVDVLLSLDGEEKLQEDDMIAVLWEMIFRGTDTTALLTEWVM  349

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             A +VLH +VQAK QLEID+ V  ++ + D+D+  LPYLQA+VKE LR+HPPGPLLSWARL
Sbjct  350   AELVLHPEVQAKLQLEIDSAVT-NKTLTDADVAKLPYLQAVVKETLRIHPPGPLLSWARL  408

Query  1233  AVHDVYV-DKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRLAP  1409
             +  DV + +   +PA TTAMVNMWAITHDP +W +P  F+PERF+E +V + GSDLRLAP
Sbjct  409   STSDVQLSNGMVVPANTTAMVNMWAITHDPHVWEEPLEFKPERFLEADVDVRGSDLRLAP  468

Query  1410  FGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS---VDLSECLKLSLEMK  1559
             FG+GRRVCPG+ LGL TV+LW+A+ + HF W+   +   VDLSE LKLS EMK
Sbjct  469   FGAGRRVCPGKNLGLVTVNLWVAKLVHHFNWVEDSARHPVDLSEVLKLSCEMK  521



>emb|CDX89135.1| BnaA04g00510D [Brassica napus]
Length=536

 Score =   457 bits (1177),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 247/489 (51%), Positives = 320/489 (65%), Gaps = 23/489 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKK--LNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRL  329
             +W   GG AW  Y  ++  +   + GP   PF+G +  M +  AHR +A+ A   G  RL
Sbjct  44    YWSHPGGPAWGKYFFHRRHRTTVIPGPRGLPFVGSMSLMSNALAHRCIAATAEKFGAKRL  103

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR LRR
Sbjct  104   MAFSLGDTRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRR  163

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesg-fvevrgvvgegSLRNVVESVF  686
             +A+ H+FSP++I   E  R  IA +M+  + K+   +G     R ++   SL N++ SVF
Sbjct  164   IASYHLFSPKQIKRSETQRRVIANQMVTCLAKQSSSNGGLCYARDLIKTASLNNMMCSVF  223

Query  687   GSCLGLQGE-----ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVND  851
             G    L+ E     EL  +V+EGY+L+G  NW D+ P     D  G + +C  L  +VN 
Sbjct  224   GKEYELEHEHDEVNELRGLVEEGYDLLGTLNWTDHLPWLSEFDPQGIRSRCFSLVPKVNR  283

Query  852   LVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVA  1031
              V +II   + Q        ++ +DF+ VLLSL   ++L+D D+VAVLWEMIFRGTDTVA
Sbjct  284   FVNRIISDHRDQTR------DSPSDFVDVLLSLDGPNKLSDPDMVAVLWEMIFRGTDTVA  337

Query  1032  ILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGP  1211
             +L+EWI+ARMVLHQD+Q     E+D  VG SR V++SD+ +L YL A++KEVLRLHPPGP
Sbjct  338   VLIEWILARMVLHQDIQTTVHNELDQVVGRSRAVEESDVASLTYLTAVIKEVLRLHPPGP  397

Query  1212  LLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE----EVS  1379
             LLSWARLA+ D  +D   +PAGTTAMVNMWAI HDP +W +P  F PERF+ +    E S
Sbjct  398   LLSWARLAITDTIIDGRRVPAGTTAMVNMWAIAHDPHVWENPLEFEPERFVAKEGDVEFS  457

Query  1380  IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSECLKLS  1547
             ++GSDLRLAPFGSGRRVCPG+ LGL+TV  W+A  L  F+WL   S    VDLSE L+LS
Sbjct  458   VLGSDLRLAPFGSGRRVCPGKNLGLTTVTFWIATLLHEFEWLAPSSDDKTVDLSEKLRLS  517

Query  1548  LEMKKHLAI  1574
              EM   LA+
Sbjct  518   CEMANPLAV  526



>ref|XP_003554779.1| PREDICTED: cytochrome P450 78A3-like [Glycine max]
 gb|KHN35404.1| Cytochrome P450 78A3 [Glycine soja]
Length=523

 Score =   457 bits (1175),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 244/484 (50%), Positives = 313/484 (65%), Gaps = 20/484 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNP-KKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMA  335
             +W   GG AW  Y     P   + GP  +P +G +  M S AH ++A+ A +    RLMA
Sbjct  41    YWSHPGGPAWGKYYTYSPPLSIIPGPKGFPLIGSMGLMISLAHHRIAAAAATCRAKRLMA  100

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FSLG TR+I++ HPD AKEIL  S F DRPVKESA  LMF RAIGFA  G YWR LRR+A
Sbjct  101   FSLGDTRVIVTCHPDVAKEILNSSVFADRPVKESAYSLMFNRAIGFASYGVYWRSLRRIA  160

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             +NH F PR+I   E  RS IA +M+  ++ +      + VR V+ + SL N++ SVFG  
Sbjct  161   SNHFFCPRQIKASELQRSQIAAQMVHILNNK--RHRSLRVRQVLKKASLSNMMCSVFGQE  218

Query  696   LGLQG-----EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVG  860
               L       E+LG++V +GY+L+G FNW D+ P     D    + +C  L   VN  VG
Sbjct  219   YKLHDPNSGMEDLGILVDQGYDLLGLFNWADHLPFLAHFDAQNIRFRCSNLVPMVNRFVG  278

Query  861   QIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
              II + +            N DF+ VLLSLP+ DQL+D+D++AVLWEMIFRGTDTVA+L+
Sbjct  279   TIIAEHRAS------KTETNRDFVDVLLSLPEPDQLSDSDMIAVLWEMIFRGTDTVAVLI  332

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EWI+ARM LH  VQ+K Q E+D  VG +R V + D+  + YL A+VKEVLRLHPPGPLLS
Sbjct  333   EWILARMALHPHVQSKVQEELDAVVGKARAVAEDDVAVMTYLPAVVKEVLRLHPPGPLLS  392

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSIMG  1388
             WARL+++D  +D   +PAGTTAMVNMWAI  DP +W DP  F PERF+    + E SI+G
Sbjct  393   WARLSINDTTIDGYHVPAGTTAMVNMWAICRDPHVWKDPLEFMPERFVTAGGDAEFSILG  452

Query  1389  SDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPG--PSVDLSECLKLSLEMKK  1562
             SD RLAPFGSGRR CPG+ LG +TV+ W+A  L  F+W+P     VDL+E LKLS EM  
Sbjct  453   SDPRLAPFGSGRRACPGKTLGWATVNFWVASLLHEFEWVPSDEKGVDLTEVLKLSSEMAN  512

Query  1563  HLAI  1574
              L +
Sbjct  513   PLTV  516



>gb|KDO81784.1| hypothetical protein CISIN_1g047310mg, partial [Citrus sinensis]
Length=459

 Score =   454 bits (1168),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 242/428 (57%), Positives = 304/428 (71%), Gaps = 7/428 (2%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQ-MGSHAHRKLASMATSMGLNRLMAF  338
             W+  GG AW   +  + PK + GP  +P +G L   +GS  HR LA +AT+     LMAF
Sbjct  33    WLSPGGLAWAR-ARAKAPKSIAGPPGYPLIGSLTVFVGSTPHRVLAKLATAFRAVPLMAF  91

Query  339   SLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAA  518
             S+G TR +ISS P+TAKEIL   +F DRPVKESA  L+F RA+GFAP G YWR LRR++A
Sbjct  92    SVGLTRFVISSEPETAKEILSSPAFADRPVKESAYELLFHRAMGFAPYGDYWRNLRRISA  151

Query  519   NHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCL  698
              H+FSPRRIA +E  R  +  +M+ ++   M  +G V+V+ V+   SL NV+ SVFG   
Sbjct  152   THLFSPRRIAGIESFRREVGLKMVEQVKSLMAGNGEVKVKKVLHFASLNNVMMSVFGKRY  211

Query  699   GLQGEELGLMVKEG---YELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQII  869
                  E  L+ +     YEL+G FNW D+FPL   LD  G K++C  L  +VN  V +II
Sbjct  212   DFDESEGLLLEELVSEGYELLGVFNWSDHFPLLGWLDLQGVKKRCRILVSKVNVFVEKII  271

Query  870   -EKRKRQFEGIEINVNNNT-DFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
              E R ++  G+  +      DF+ VLL L KE +L D+D++AVLWEMIFRGTDTVAIL+E
Sbjct  272   QEHRLKRTAGVSDDHKICVGDFVDVLLDLEKEAKLNDSDMIAVLWEMIFRGTDTVAILLE  331

Query  1044  WIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSW  1223
             WI+ARMVLH ++Q+KAQ EI + VG SR VQDSDIP+LPYLQAIVKE LR+HPPGPLLSW
Sbjct  332   WILARMVLHPEIQSKAQAEIISVVGNSRPVQDSDIPSLPYLQAIVKETLRIHPPGPLLSW  391

Query  1224  ARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRL  1403
             ARLAV DVYV   F+PAGTTAMVNMWAITHDP++W +P  F+PERF+EE++SIMGSDLRL
Sbjct  392   ARLAVRDVYVGDNFVPAGTTAMVNMWAITHDPRVWAEPEKFKPERFIEEDISIMGSDLRL  451

Query  1404  APFGSGRR  1427
             APFGSGRR
Sbjct  452   APFGSGRR  459



>ref|XP_006444772.1| hypothetical protein CICLE_v10019326mg [Citrus clementina]
 gb|ESR58012.1| hypothetical protein CICLE_v10019326mg [Citrus clementina]
Length=619

 Score =   459 bits (1182),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 250/491 (51%), Positives = 320/491 (65%), Gaps = 29/491 (6%)
 Frame = +3

Query  159   FWVVEGGFAWRNY------SNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGL  320
             +W   GG AW  Y      S+    K + GP   P +G +  M S +HRK+A+ A S   
Sbjct  124   YWAHPGGPAWGKYKFKRGSSSFVKAKPIPGPRGLPVIGNMNLMMSLSHRKIAAAAESCKA  183

Query  321   NRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQ  500
              RLMAFSLG TR+I++S+PD AKEIL  S F DRPVKESA  LMF RAIGFAP G YWR 
Sbjct  184   KRLMAFSLGDTRVIVTSNPDVAKEILNSSVFADRPVKESAYSLMFNRAIGFAPYGVYWRT  243

Query  501   LRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVES  680
             LRR+AA H+F P++I   E  R AIA +M+       G      VR  +   SL N++ S
Sbjct  244   LRRIAATHLFCPKQIKGAEAQRLAIASQMVATF---AGYKQGFCVREALKRASLNNMMCS  300

Query  681   VFG-----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTK--RKCHRLAG  839
             VFG       L  + +EL  +V EGYE++G  NW D+ P  +L DF   K   +C +LA 
Sbjct  301   VFGREYKLDSLNDEVKELRALVDEGYEILGILNWTDHLP--WLADFDPQKIRFRCSKLAP  358

Query  840   RVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGT  1019
             +VN  VG+I+ + K     ++ N   N DF+ VLLSL   D+L+D+D++AVLWEMIFRGT
Sbjct  359   KVNRFVGRIVAQHK-----VQSNKQKNLDFVDVLLSLQGSDKLSDSDMIAVLWEMIFRGT  413

Query  1020  DTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLH  1199
             DTVA+L+EWI+AR+VLH DVQ++   E+D  VG SR V +SD+  L YL A++KEVLRLH
Sbjct  414   DTVAVLIEWILARLVLHCDVQSRVHDELDKVVGRSRTVAESDLGELIYLAAVIKEVLRLH  473

Query  1200  PPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE---  1370
             PPGPLLSWARLA+ D  +D   +P GTTAMVNMWAI+ DP +W +P  F PERF+ +   
Sbjct  474   PPGPLLSWARLAITDTTIDGYHVPRGTTAMVNMWAISRDPDVWKNPLEFIPERFLPKEGG  533

Query  1371  -EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP--SVDLSECLK  1541
              E S++GSDL LAPFGSGRRVCPG+ LGL+TV  W+A  L  + WLP    +VDLSE L+
Sbjct  534   VEFSVLGSDLTLAPFGSGRRVCPGKNLGLTTVSFWVASLLHEYAWLPSAQNTVDLSEVLR  593

Query  1542  LSLEMKKHLAI  1574
             LS EM   L +
Sbjct  594   LSCEMASPLTV  604



>ref|NP_001142261.1| putative cytochrome P450 superfamily protein [Zea mays]
 gb|ACF88031.1| unknown [Zea mays]
 gb|AFW65647.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=543

 Score =   457 bits (1175),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 256/491 (52%), Positives = 321/491 (65%), Gaps = 25/491 (5%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNP------KKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMG-L  320
             W   GG AW  Y   +          + GP   P +G +  M   AHRKL++ A      
Sbjct  45    WASPGGPAWGWYWWTRRAGLGIVRAAIPGPRGLPVVGSMGLMTGLAHRKLSAAAERQASR  104

Query  321   NRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQ  500
              RLMAFSLG TR+++++ PD A+E+L  ++F DRPVKESA  L+F RAIGFAP G+YWR 
Sbjct  105   RRLMAFSLGETRVVVTADPDVARELLASAAFADRPVKESAYGLLFHRAIGFAPHGAYWRA  164

Query  501   LRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVES  680
             LRR+A+ H+FSPR+IA     R+AIA +M+         +  V  R  +   SL NV+ S
Sbjct  165   LRRVASAHLFSPRQIAASAAQRAAIARQMVDATTTAAAHAPVVVARRFLKRASLHNVMWS  224

Query  681   VFGSCLGL-----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRV  845
             VFG    L     + EEL  +V EGY+L+G+ NW D+ P     D   T+ +C  L  RV
Sbjct  225   VFGRRYDLMADSREAEELKALVDEGYDLLGQLNWSDHLPWLARFDLQKTRARCCALVPRV  284

Query  846   NDLVGQII-EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTD  1022
             N  VG II E R R   G++  V    DF  VLLSL  +D+L+DAD++AVLWEMIFRGTD
Sbjct  285   NRFVGNIIGEHRARLGRGVDTAV---MDFTDVLLSLQGDDKLSDADMIAVLWEMIFRGTD  341

Query  1023  TVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHP  1202
             TVA+L+EW++AR+VLHQDVQ+K Q E+D  VG  + V +SD  +LPYLQA++KEVLRLHP
Sbjct  342   TVAVLIEWVLARLVLHQDVQSKVQEELDRVVGLGQAVTESDTASLPYLQAVIKEVLRLHP  401

Query  1203  PGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM---EEE  1373
             PGPLLSWARLA  DV+V    +PAGTTAMVNMWAITHDP +W +P  FRPERFM    E+
Sbjct  402   PGPLLSWARLATSDVHVGGYLVPAGTTAMVNMWAITHDPSLWPEPMEFRPERFMGPAAED  461

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP------GPSVDLSEC  1535
             V IMGSDLRLAPFGSGRR CPG++L ++TV  W+A  L  FKWLP      G  VDLSE 
Sbjct  462   VPIMGSDLRLAPFGSGRRSCPGKSLAVATVGFWVATLLYEFKWLPPSDEPRGGGVDLSEV  521

Query  1536  LKLSLEMKKHL  1568
             L+LS EM   L
Sbjct  522   LRLSCEMAAPL  532



>gb|ADE77659.1| unknown [Picea sitchensis]
Length=432

 Score =   452 bits (1164),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 232/422 (55%), Positives = 298/422 (71%), Gaps = 16/422 (4%)
 Frame = +3

Query  342   LGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAAN  521
             +G TR +I S P+ AK IL  S+F DRP+KESA  LMF+RAIGFAP   YW+ LRR+AA 
Sbjct  1     MGCTRAVICSQPEVAKAILNSSAFADRPIKESAYQLMFDRAIGFAPYSEYWKNLRRIAAL  60

Query  522   HMFSPRRIACLEGVRSAIAEEMIGKMD--KEMgesgfvevrgvvgegSLRNVVESVFG--  689
             H+FS RRI+  E  R A+   M+  ++   +   +  V++RG++ + SL N++ SVFG  
Sbjct  61    HLFSARRISAFESHRQALTNSMLESIELLAQSQPNSSVKIRGILQKTSLNNIMGSVFGRS  120

Query  690   ---SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVG  860
                 C   + EEL  MVKEGY+L+G FNW D+ PL   LD  G +R+C  L  RV   V 
Sbjct  121   YSFGCGDSESEELASMVKEGYDLLGIFNWADHLPLLGFLDLQGIRRRCSDLVPRVYAFVQ  180

Query  861   QIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
              IIE+ +      +     ++DF+ VLLSL   ++L+D+D+VAVLWEMIFRGTDTVAIL+
Sbjct  181   NIIEEHRASPANRD---KGDSDFVDVLLSLQGTEKLSDSDMVAVLWEMIFRGTDTVAILL  237

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EWI+AR++LH D+QAK   E+D+ VG +R + +SDIP L YLQA+VKEVLR+HPPGPLLS
Sbjct  238   EWILARLILHPDIQAKIHEELDSVVGNTRQLTESDIPKLHYLQAVVKEVLRIHPPGPLLS  297

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE----EVSIMG  1388
             WAR ++HDV+V    IPAGTTA VNMW+ITHD KIW DP +F+P+RF+      +V+IMG
Sbjct  298   WARRSIHDVHVGGHLIPAGTTAYVNMWSITHDEKIWEDPLSFKPDRFLPSAGGVDVNIMG  357

Query  1389  SDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKK  1562
             SDLRLAPFGSGRR CPG+ALGL TVH WLAR L HF+WLP     VDL+E L+LS EMK 
Sbjct  358   SDLRLAPFGSGRRACPGKALGLQTVHTWLARMLHHFQWLPSQDHPVDLTEVLRLSCEMKA  417

Query  1563  HL  1568
              L
Sbjct  418   PL  419



>sp|O48927.1|C78A3_SOYBN RecName: Full=Cytochrome P450 78A3 [Glycine max]
 gb|AAB94592.1| CYP78A3p [Glycine max]
Length=523

 Score =   456 bits (1172),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 243/484 (50%), Positives = 313/484 (65%), Gaps = 20/484 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNP-KKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMA  335
             +W   GG AW  Y     P   + GP  +P +G +  M S AH ++A+ A +    RLMA
Sbjct  41    YWSHPGGPAWGKYYTYSPPLSIIPGPKGFPLIGSMGLMTSLAHHRIAAAAATCRAKRLMA  100

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FSLG TR+I++ HPD AKEIL  S F DRPVKESA  LMF RAIGFA  G YWR LRR+A
Sbjct  101   FSLGDTRVIVTCHPDVAKEILNSSVFADRPVKESAYSLMFNRAIGFASYGVYWRSLRRIA  160

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             +NH+F PR+I   E  RS IA +M+  ++ +      + VR V+ + SL N++ SVFG  
Sbjct  161   SNHLFCPRQIKASELQRSQIAAQMVHILNNK--RHRSLRVRQVLKKASLSNMMCSVFGQE  218

Query  696   LGLQG-----EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVG  860
               L       E+LG++V +GY+L+G FNW D+ P     D    + +C  L   VN  VG
Sbjct  219   YKLHDPNSGMEDLGILVDQGYDLLGLFNWADHLPFLAHFDAQNIRFRCSNLVPMVNRFVG  278

Query  861   QIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILV  1040
              II + +            N DF+ VLLSLP+ DQL+D+D++AVLWEMIFRGTDTVA+L+
Sbjct  279   TIIAEHRAS------KTETNRDFVDVLLSLPEPDQLSDSDMIAVLWEMIFRGTDTVAVLI  332

Query  1041  EWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLS  1220
             EWI+ARM LH  VQ+K Q E+D  VG +R V + D+  + YL A+VKEVLRLHPPGPLLS
Sbjct  333   EWILARMALHPHVQSKVQEELDAVVGKARAVAEDDVAVMTYLPAVVKEVLRLHPPGPLLS  392

Query  1221  WARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSIMG  1388
             WARL+++D  +D   +PAGTTAMVN WAI  DP +W DP  F PERF+    + E SI+G
Sbjct  393   WARLSINDTTIDGYHVPAGTTAMVNTWAICRDPHVWKDPLEFMPERFVTAGGDAEFSILG  452

Query  1389  SDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPG--PSVDLSECLKLSLEMKK  1562
             SD RLAPFGSGRR CPG+ LG +TV+ W+A  L  F+W+P     VDL+E LKLS EM  
Sbjct  453   SDPRLAPFGSGRRACPGKTLGWATVNFWVASLLHEFEWVPSDEKGVDLTEVLKLSSEMAN  512

Query  1563  HLAI  1574
              L +
Sbjct  513   PLTV  516



>gb|KHG09414.1| Cytochrome P450 [Gossypium arboreum]
Length=499

 Score =   455 bits (1170),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 248/490 (51%), Positives = 327/490 (67%), Gaps = 25/490 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYS--NNQNPKKLN---GPMSWPFLGFLPQMGSHAHRKLASMATSMGLN  323
             FW+  GG AW  Y     +   K N   GP  +P LG +  M + AH K+++ A      
Sbjct  10    FWLYPGGPAWGKYRWLRKRGAAKHNIIPGPRGFPVLGSMNIMLNLAHHKISAAAKCFDAK  69

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RLMAFSLG TR++++ +PD AKEIL  S F DRPVKESA  LMF RAIGFAP G YWR L
Sbjct  70    RLMAFSLGDTRVMVTCNPDVAKEILNSSIFADRPVKESAYSLMFNRAIGFAPYGVYWRTL  129

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             RR+AA H+F P++I+  E  RS IA +M   +    G +G + VR ++ + SL N++ SV
Sbjct  130   RRIAATHLFCPKQISFAEAQRSDIASQMRSIIACR-GGTGEISVRDILKKASLNNMMCSV  188

Query  684   FGSCLGL-----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             FGS   L     + E+L  +V+EGY+L+G+ NW D+ P    LD    + +C +L  +VN
Sbjct  189   FGSKYQLGSSNTETEQLNQLVEEGYDLLGKLNWSDHLPWLAGLDLQKIRLRCTQLVPKVN  248

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               V +II++ K Q E I      N DF+ VLLSL    +L+D D++AVLWEMIFRGTDTV
Sbjct  249   KFVSRIIQQHKLQPETI------NHDFVHVLLSLTGPHRLSDNDMIAVLWEMIFRGTDTV  302

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             A+L+EWI+ARMVLH ++Q++ Q E+D  VG SR + +SDI ++ YLQA+VKEVLR+HPPG
Sbjct  303   AVLIEWILARMVLHPEIQSRVQAELDEVVGKSRALMESDIESMVYLQAVVKEVLRMHPPG  362

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE------  1370
             PLLSWARLA+ D  +D   +PAGTTAMVNMWAIT DP+IW DP  F PERF+ +      
Sbjct  363   PLLSWARLAITDATIDGYHVPAGTTAMVNMWAITRDPEIWVDPLKFMPERFVSKDNITDV  422

Query  1371  EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKL  1544
             E S++GSDLRLAPFGSGRR CPG+ LGL+TV+ W+   L  F+W+   +  VDL+E L+L
Sbjct  423   EFSVLGSDLRLAPFGSGRRTCPGKTLGLATVNFWVGSLLHEFEWVQSDANPVDLTERLRL  482

Query  1545  SLEMKKHLAI  1574
             S EM   L +
Sbjct  483   SCEMANPLKV  492



>dbj|BAK05332.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=505

 Score =   455 bits (1170),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 238/437 (54%), Positives = 310/437 (71%), Gaps = 7/437 (2%)
 Frame = +3

Query  279   AHRKLASMATSM-GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMF  455
             AHR +A+++ S+ G   LM+FS+G TR+++SS  DTA+EIL   +F DRPVK++A+ L+F
Sbjct  62    AHRVMATLSRSVRGGAALMSFSVGLTRVVVSSRQDTAREILVNPAFGDRPVKDAARHLLF  121

Query  456   ERAIGFAPSG-SYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfve  632
              RA+GFAPSG ++WR LRR+AA H+F PRR+A     RS+I   M+G +   M   G V 
Sbjct  122   HRAMGFAPSGDAHWRALRRLAAAHLFGPRRVAASAPHRSSIGARMLGDVASIMARHGEVA  181

Query  633   vrgvvgegSLRNVVESVFG----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLD  800
              R  +   SL +V+  VFG         +G  +  +V EGY+L+G FNW D+ P    LD
Sbjct  182   PRRFLHAASLNHVMAVVFGKRYDDFTSQEGVVVEEVVNEGYDLLGTFNWADHLPFLKCLD  241

Query  801   FGGTKRKCHRLAGRVNDLVGQIIEKRK-RQFEGIEINVNNNTDFLSVLLSLPKEDQLADA  977
               G +R+C+RL  +V   VG II++ K R+     I    + DF+ VLL L  ED+++++
Sbjct  242   LQGVRRRCNRLVRQVEAYVGNIIQEHKARRDSASGIADELSGDFVDVLLGLDGEDKMSES  301

Query  978   DLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNL  1157
             D++AVLWEMIFRGTDTVAIL+EWIMARMVLH ++Q+KA+ E+D  VG  R V D D+  L
Sbjct  302   DMIAVLWEMIFRGTDTVAILMEWIMARMVLHPEIQSKARAELDAVVGRGRAVTDEDVSRL  361

Query  1158  PYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDP  1337
             PY+Q IVKE LR+HPPGPLLSWARLAVHD +V    +PAGTTAMVNMWAI HD  +W +P
Sbjct  362   PYIQCIVKETLRMHPPGPLLSWARLAVHDAHVGGHLVPAGTTAMVNMWAIAHDAAVWPEP  421

Query  1338  WTFRPERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS  1517
               FRPERFMEE+VS++GSDLRLAPFG+GRRVCPG+ L L+TVHLWLA+ L  F+W P  S
Sbjct  422   ELFRPERFMEEDVSVLGSDLRLAPFGAGRRVCPGKMLALATVHLWLAQLLHRFEWAPSGS  481

Query  1518  VDLSECLKLSLEMKKHL  1568
             VDLSE LK+SLEM   L
Sbjct  482   VDLSERLKMSLEMATPL  498



>ref|NP_182189.1| cytochrome P450, family 78, subfamily A, polypeptide 6 [Arabidopsis 
thaliana]
 sp|Q9ZNR0.1|C78A6_ARATH RecName: Full=Cytochrome P450 78A6; AltName: Full=Protein ENHANCER 
OF DA1-1 [Arabidopsis thaliana]
 gb|AAC69923.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAM15240.1| putative cytochrome P450 [Arabidopsis thaliana]
 dbj|BAE98862.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC10736.1| cytochrome P450, family 78, subfamily A, polypeptide 6 [Arabidopsis 
thaliana]
Length=530

 Score =   455 bits (1171),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 245/486 (50%), Positives = 315/486 (65%), Gaps = 23/486 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNY-------SNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSM  314
              W   GG AW  Y        + +    + GP  +P +G +  M S  AHR++A  A   
Sbjct  43    LWTYPGGPAWGKYLFGRLISGSYKTGNVIPGPKGFPLVGSMSLMSSTLAHRRIADAAEKF  102

Query  315   GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYW  494
             G  RLMAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YW
Sbjct  103   GAKRLMAFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPHGVYW  162

Query  495   RQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVV  674
             R LRR+A+NH+FS ++I   E  R  I+ +M+  ++K+   +    VR ++   SL N++
Sbjct  163   RTLRRIASNHLFSTKQIRRAETQRRVISSQMVEFLEKQ-SSNEPCFVRELLKTASLNNMM  221

Query  675   ESVFGSCLGLQGE--ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
              SVFG    L+    EL  MV+EGY+L+G  NW D+ P     D    + +C  L  +VN
Sbjct  222   CSVFGQEYELEKNHVELREMVEEGYDLLGTLNWTDHLPWLSEFDPQRLRSRCSTLVPKVN  281

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               V +II + + Q   +        DF+ VLLSL   D+L+D D++AVLWEMIFRGTDTV
Sbjct  282   RFVSRIISEHRNQTGDLP------RDFVDVLLSLHGSDKLSDPDIIAVLWEMIFRGTDTV  335

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             A+L+EWI+ARMVLH D+Q+  Q E+D  VG SR + +SD+ +LPYL A+VKEVLRLHPPG
Sbjct  336   AVLIEWILARMVLHPDMQSTVQNELDQVVGKSRALDESDLASLPYLTAVVKEVLRLHPPG  395

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEV  1376
             PLLSWARLA+ D  VD   +PAGTTAMVNMWA++HDP +W DP  F+PERF+    E E 
Sbjct  396   PLLSWARLAITDTIVDGRLVPAGTTAMVNMWAVSHDPHVWVDPLEFKPERFVAKEGEVEF  455

Query  1377  SIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSECLKLSL  1550
             S++GSDLRLAPFGSGRR+CPG+ LG +TV  W A  L  F+W P  G  VDLSE L+LS 
Sbjct  456   SVLGSDLRLAPFGSGRRICPGKNLGFTTVMFWTAMMLHEFEWGPSDGNGVDLSEKLRLSC  515

Query  1551  EMKKHL  1568
             EM   L
Sbjct  516   EMANPL  521



>ref|XP_002300886.1| hypothetical protein POPTR_0002s06170g [Populus trichocarpa]
 gb|EEE80159.1| hypothetical protein POPTR_0002s06170g [Populus trichocarpa]
Length=534

 Score =   456 bits (1172),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 243/480 (51%), Positives = 322/480 (67%), Gaps = 18/480 (4%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRLMAFSLGT  350
             GG AW+N  N++    + GP   PF G L  +    AHR LA MA+S    +LMAFSLG+
Sbjct  52    GGLAWKNGRNHKGSVSIPGPRGLPFFGSLFSLSRGLAHRTLACMASSQAATQLMAFSLGS  111

Query  351   TRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMF  530
             T  I++S P  A+EIL    F DRP+K SAK LMF RAIGFAP+G+YWR +RR+A+ H+F
Sbjct  112   TPAIVTSDPQIAREILTSPHFADRPIKLSAKSLMFSRAIGFAPNGAYWRLMRRIASTHLF  171

Query  531   SPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGL--  704
             +PRRIA  E  R     +M+  +  +    G V +R  + + SL N++ +VFG    L  
Sbjct  172   APRRIAAHEPWRQLDCAKMLSGIYDDQSLHGVVYLRKHLQDASLNNIMGTVFGKRYDLMQ  231

Query  705   ---QGEELGLMVKEGYELIGEFNWGDYFP-LGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
                + +EL  +V EG+EL+G FNW DY P L +  D    K +C +L  RV  LV QIIE
Sbjct  232   FNEEAKELQELVIEGFELLGAFNWSDYLPWLNYFYDPFRIKERCCQLVPRVKKLVKQIIE  291

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             + + +      NV +N DF+ VLLSL  E++L + D+VAVLWEMIFRGTDT A+L EW+M
Sbjct  292   EHRIKKPK---NVFDNADFVDVLLSLEGEEKLEEDDMVAVLWEMIFRGTDTTALLTEWVM  348

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             A +VL+Q++QAK   E++  VG +R V D+D+ +LPYLQA++KE LR+HPPGPLLSWARL
Sbjct  349   AELVLNQEIQAKLGKELNLVVG-NRSVTDADVADLPYLQAVIKETLRVHPPGPLLSWARL  407

Query  1233  AVHDVYV-DKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEE----VSIMGSDL  1397
             +  DV++ +   +P  TTAMVNMWAITHDP++W D   F+PERFME +    V + G DL
Sbjct  408   STSDVHLSNGMVVPVNTTAMVNMWAITHDPRVWEDALVFKPERFMESQGGADVDVRGGDL  467

Query  1398  RLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPG--PSVDLSECLKLSLEMKKHLA  1571
             RLAPFG+GRRVCPG+ LGL TV LW+A+ + HF+W+      VDLSE LKLS EMKK L+
Sbjct  468   RLAPFGAGRRVCPGKNLGLVTVSLWVAKLVHHFEWVQDMHSPVDLSEMLKLSCEMKKPLS  527



>ref|XP_009615499.1| PREDICTED: cytochrome P450 78A6-like [Nicotiana tomentosiformis]
Length=530

 Score =   455 bits (1171),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 244/487 (50%), Positives = 323/487 (66%), Gaps = 24/487 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNP----KKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNR  326
             +W   GG AW  +    N     K + GP  +P +G +  M   AH K+ +MA ++   R
Sbjct  43    YWSYPGGPAWGKHKLKNNSSLVSKPIPGPKGFPIIGSINLMVGLAHHKILAMAENLQAKR  102

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LM+FSLG TR+I++ +PD AKEIL  S F DRPVKESA  LMF RAIGFA  G YWR LR
Sbjct  103   LMSFSLGETRVIVTCNPDVAKEILNSSVFADRPVKESAYRLMFNRAIGFASYGVYWRTLR  162

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVF  686
             +++A H+FSP++I   E  RS IA++++  M K+   +  + VR  +   SL N++ SVF
Sbjct  163   KISAAHLFSPKQIIASEKPRSQIAKQLV-TMFKD-SPNDILRVRDGLKLASLNNMMSSVF  220

Query  687   G------SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             G      SC  ++ EEL  +V EGYEL+G  NW D+       D    K++C  +  +VN
Sbjct  221   GKFYNLDSC-NMEIEELIKLVDEGYELLGMLNWSDHLSWLSEFDPQKIKQRCSEIVPKVN  279

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               V +IIE+ K Q      +  N+ DF+ VLLSL   + L+++D++AVLWEMIFRGTDTV
Sbjct  280   KFVRRIIEEHKAQ------SGENHRDFVDVLLSLQGSESLSESDMIAVLWEMIFRGTDTV  333

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
              +L+EWI+AR+VLH +VQ+K Q EID  VG SR V +SDI  + YL A+VKEVLRLHPPG
Sbjct  334   TVLLEWILARIVLHPNVQSKVQAEIDRIVGRSRAVTESDITEMTYLPAVVKEVLRLHPPG  393

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE-----E  1373
             PLLSW+RL++ D  VD   +PAGTTAMVNMWAIT D ++W DP TF+PERF+ +     +
Sbjct  394   PLLSWSRLSITDTIVDGYHVPAGTTAMVNMWAITRDAEVWTDPLTFKPERFVSKAHTDVD  453

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLE  1553
              S++GSDLRLAPFGSGRR CPG+ LGL+TV  W+A  L  F++ PG +VDLSE LKLS E
Sbjct  454   FSVLGSDLRLAPFGSGRRSCPGKTLGLTTVTFWVATLLHEFEFGPGSNVDLSEVLKLSCE  513

Query  1554  MKKHLAI  1574
             M   L +
Sbjct  514   MAHPLMV  520



>ref|XP_004230013.1| PREDICTED: cytochrome P450 78A3-like [Solanum lycopersicum]
Length=538

 Score =   456 bits (1172),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 246/496 (50%), Positives = 319/496 (64%), Gaps = 33/496 (7%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPK--------------KLNGPMSWPFLGFLPQMGSHAHRKLA  296
             +W   GG AW  Y+ ++  +               ++GP  +P +G +  M   AHRK+A
Sbjct  40    YWSHPGGPAWGKYNWSKKFRLASFNINNNNNDNYNISGPRGFPIIGSMNLMSGLAHRKIA  99

Query  297   SMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFA  476
              MA S    RLM+FSL  TR+II+ +PD AKEIL  S F DRPVKESA  LMF RAIGFA
Sbjct  100   EMAQSCVAKRLMSFSLSETRVIITCNPDVAKEILNSSVFADRPVKESAYSLMFNRAIGFA  159

Query  477   PSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgeg  656
             P G YWR LR++AA H+F P++I   E  R  IA +M+     ++G    V VR  +   
Sbjct  160   PYGVYWRTLRKIAATHLFCPKQIKASEAQRFQIARQMVTMF--QLGGQDVVRVRDALKLA  217

Query  657   SLRNVVESVFG-----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRK  821
             SL N++ SVFG      C   + EELG +V+EGYEL+G  NW D+ P     D    + +
Sbjct  218   SLNNMMCSVFGRKYSLDCCNAETEELGKLVEEGYELLGMLNWSDHLPWLAEFDPQKIRLR  277

Query  822   CHRLAGRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWE  1001
             C RL  RVN  V +II + K Q   +      + DF+ VLL L   ++L+D+D++AVLWE
Sbjct  278   CSRLVPRVNKFVSRIINEHKAQSGDV------HHDFVHVLLCLQGSERLSDSDMIAVLWE  331

Query  1002  MIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVK  1181
             MIFRGTDTVA+L+EWI+ARM++H  VQ+K Q E+D+ VG SR + +SD+  + YL A++K
Sbjct  332   MIFRGTDTVAVLIEWILARMIIHPQVQSKVQAELDSVVGKSRALMESDVSEMTYLPAVIK  391

Query  1182  EVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERF  1361
             EVLRLHPPGPLLSWARLA+ D  VD   +PAGTTAMVNMWAIT DP +W DP  F+PERF
Sbjct  392   EVLRLHPPGPLLSWARLAITDTTVDGYHVPAGTTAMVNMWAITRDPDVWADPLEFKPERF  451

Query  1362  ME-EEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP----GPSVDL  1526
                 + S++GSDLRLAPFGSGRR CPG+ LGL+TV  W+A  L  F++ P    GP VDL
Sbjct  452   FNGPDFSVLGSDLRLAPFGSGRRTCPGKTLGLTTVTFWVATLLHEFRFEPIDNNGP-VDL  510

Query  1527  SECLKLSLEMKKHLAI  1574
             SE L+LS EM   L +
Sbjct  511   SEVLRLSCEMVNPLTV  526



>ref|XP_009348537.1| PREDICTED: cytochrome P450 78A6-like [Pyrus x bretschneideri]
 ref|XP_009348538.1| PREDICTED: cytochrome P450 78A6-like [Pyrus x bretschneideri]
Length=542

 Score =   455 bits (1171),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 244/492 (50%), Positives = 317/492 (64%), Gaps = 31/492 (6%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNP----KKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNR  326
             +W   GG AW + S    P      + GP   P +G +  M S AHRK+AS A S+   R
Sbjct  45    YWSHPGGPAWGHSSKIIGPFYKRATIPGPRGLPLIGSMSLMTSLAHRKIASAAQSLHATR  104

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LMAFSLG TR++++ HPD A+EIL  S F DRPVKESA  LMF RAIGFAP+G YWR LR
Sbjct  105   LMAFSLGQTRVVVTCHPDVAREILNSSVFADRPVKESAYSLMFNRAIGFAPNGVYWRALR  164

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEM---IGKMDKEMgesgfvevrgvvgegSLRNVVE  677
             R++A H+FSP++I   E  R  IA +M    G  ++++     ++        SL N++ 
Sbjct  165   RISAAHLFSPKQIKASEAQRRNIASQMAAMFGSHEEKLAVRNVIKRA------SLNNMMC  218

Query  678   SVFG--------SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRL  833
             SVFG        + +  + EEL  +V EGY+L+G  NW D+ P    +D    + +C  L
Sbjct  219   SVFGWKYKLEVGAAVDSEVEELKGLVDEGYDLLGMLNWSDHLPWLADVDAQKIRFRCSNL  278

Query  834   AGRVNDLVGQIIEKRKRQFEGIEINVNNNT-DFLSVLLSLPKEDQLADADLVAVLWEMIF  1010
               +VN  V +II + +    G++   +    DF+ VLLSL   D L+D D++AVLWEMIF
Sbjct  279   VPKVNRFVSRIISEHR---TGLKSKKDEKAPDFVDVLLSLQGTDTLSDTDMIAVLWEMIF  335

Query  1011  RGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVL  1190
             RGTDTVA+L+EWI+ARMVLH  VQ+    E+D  VG SR V+++DI  L YL A+VKEVL
Sbjct  336   RGTDTVAVLIEWILARMVLHPVVQSTIHDELDKVVGRSRAVEETDISQLVYLTAVVKEVL  395

Query  1191  RLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM--  1364
             R+HPPGPLLSWARLA+ D  +D   +PAGTTAMVNMWAI+ DP+ W DP  F+PERF+  
Sbjct  396   RMHPPGPLLSWARLAITDTMIDGYHVPAGTTAMVNMWAISRDPEFWPDPLEFKPERFVAQ  455

Query  1365  --EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSE  1532
               E E S+ GSDLRLAPFGSGRR CPG+ALGL+TV  W+A  L  ++W P  G +VDLSE
Sbjct  456   EGEHEFSVFGSDLRLAPFGSGRRTCPGKALGLTTVTFWVALLLHEYEWQPSDGNTVDLSE  515

Query  1533  CLKLSLEMKKHL  1568
              L+LS EM   L
Sbjct  516   VLRLSCEMASPL  527



>gb|KHG00006.1| Cytochrome P450 [Gossypium arboreum]
Length=530

 Score =   454 bits (1169),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 247/490 (50%), Positives = 316/490 (64%), Gaps = 27/490 (6%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKK----LNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNR  326
             FW   GG AW  Y   +  +     + GP  +P LG +  M + A+RKL S A      R
Sbjct  43    FWFYPGGPAWGKYYRLRQKRTTKTIIPGPRGFPVLGSMDLMVNLAYRKLCSAAICFSAKR  102

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LMAFSLG TR+II+ +PD AKEIL  S F DRP+K+SA  LMF RAIGFAP G YWR LR
Sbjct  103   LMAFSLGDTRVIITCNPDVAKEILNSSVFADRPMKQSAYSLMFNRAIGFAPYGVYWRTLR  162

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVF  686
             R+AA H+FSP++I      R  IA +M+  +       G   VR ++ + SL N++ SVF
Sbjct  163   RIAATHLFSPKQIISTASQRLDIASQMVSMIASR---GGEFTVRDILKKASLNNMMRSVF  219

Query  687   G-----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVND  851
             G     S    + EEL  +V+EGYEL+G+ NW D+ P    LD    + +C RL  +VN 
Sbjct  220   GCNYQLSSSNCETEELSRLVEEGYELLGKLNWSDHLPWLGGLDLQKIRHRCSRLVPKVNK  279

Query  852   LVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVA  1031
              V  IIE+ K +      +   N DF+ VLLSL   D+L+D D++AVLWE+IFRGTDTVA
Sbjct  280   FVKGIIEEHKLK------SGERNHDFVDVLLSLSGTDRLSDNDMIAVLWEIIFRGTDTVA  333

Query  1032  ILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGP  1211
             +L+EWI+ARMVLH +VQ+K Q E+D  VG S  + + D+ ++ YLQA+VKEVLRLHPPGP
Sbjct  334   VLMEWILARMVLHPEVQSKVQGELDEIVGKSGPLTEPDVQSMVYLQAVVKEVLRLHPPGP  393

Query  1212  LLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME------EE  1373
             LLSWARL++ D  +D   +PAGTTAMVNMWAIT DP +W DP  F PERF+       E 
Sbjct  394   LLSWARLSIIDTTIDGHHVPAGTTAMVNMWAITRDPDVWVDPLKFMPERFVSKDSGDVEV  453

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWL---PGPSVDLSECLKL  1544
             VS++GSDLRLAPFGSGRR CPG+ LGL+TV  W+A  L  + W+     P VDLSE L+L
Sbjct  454   VSVLGSDLRLAPFGSGRRACPGKTLGLATVTFWVASLLHQYVWVQSDENPVVDLSEMLRL  513

Query  1545  SLEMKKHLAI  1574
             S EM   L +
Sbjct  514   SCEMANPLKV  523



>ref|XP_009771499.1| PREDICTED: cytochrome P450 78A6-like [Nicotiana sylvestris]
Length=597

 Score =   457 bits (1175),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 246/504 (49%), Positives = 321/504 (64%), Gaps = 40/504 (8%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNP--------------------KKLNGPMSWPFLGFLPQMGSH  278
             +W   GG AW  Y  ++N                     K + GP  +P +G +  M   
Sbjct  85    YWSHPGGPAWGKYKWSKNSAGLTSFNINNYNNNDHFLVSKPIPGPRGFPIIGSMNLMSGL  144

Query  279   AHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFE  458
             AHRK+A+MA +    RLM+ S+G TR+I++ +PD AKEIL  S F DRPVKESA  LMF 
Sbjct  145   AHRKIAAMAEACQAKRLMSLSVGETRVIVTCNPDVAKEILNSSVFADRPVKESAYRLMFN  204

Query  459   RAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevr  638
             RAIGFAP G YWR LR++AA H+F P++I   E  RS IA++M+     ++G    + VR
Sbjct  205   RAIGFAPYGVYWRTLRKIAATHLFCPKQIKTSEAQRSQIAKQMVTMF--QLGGRDIIRVR  262

Query  639   gvvgegSLRNVVESVFG-----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDF  803
               +   SL N++ SVFG      C   + EELG +V EGY+L+G  NW D+ P    LD 
Sbjct  263   DALKLASLNNMMCSVFGRKYNLDCSNSETEELGKLVNEGYDLLGLLNWSDHLPWLAELDP  322

Query  804   GGTKRKCHRLAGRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADL  983
                + +C +L  +VN  V +II++ K Q   +E       DF+ VLLSL   ++L+D+D+
Sbjct  323   QKIRLRCSQLVPKVNRFVSRIIDEHKAQSGDVE------HDFVHVLLSLQGSEKLSDSDM  376

Query  984   VAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPY  1163
             +AVLWEMIFRGTDTVA+L+EWI+ARMV+H  VQ K Q E+D  VG SR V +SD+  + Y
Sbjct  377   IAVLWEMIFRGTDTVAVLIEWILARMVIHPQVQFKVQNELDKIVGESRAVTESDVSEMIY  436

Query  1164  LQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWT  1343
             L A++KEVLRLHPPGPLLSWARLA+ D  VD   +PAGTTAMVNMWAIT DP +W DP  
Sbjct  437   LPAVIKEVLRLHPPGPLLSWARLAITDTKVDGYHVPAGTTAMVNMWAITRDPDVWADPLE  496

Query  1344  FRPERFMEE----EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP-  1508
             F+PERF+      + S++GSDLRLAPFGSGRR CPG+ LGL+TV  W+A  L  F++ P 
Sbjct  497   FKPERFVNGAEGLDFSVLGSDLRLAPFGSGRRTCPGKTLGLTTVTFWVATLLHEFRFGPV  556

Query  1509  --GPSVDLSECLKLSLEMKKHLAI  1574
                 SVDLSE L+LS EM   L +
Sbjct  557   DNNSSVDLSEVLRLSCEMVNPLTV  580



>ref|XP_010692663.1| PREDICTED: cytochrome P450 78A3-like [Beta vulgaris subsp. vulgaris]
Length=532

 Score =   454 bits (1169),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 245/490 (50%), Positives = 316/490 (64%), Gaps = 27/490 (6%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQ----NPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNR  326
             +W   GG AW  Y          K + GP  WP +G +  M   AHRK+ + A +   NR
Sbjct  43    YWANPGGPAWGKYRLTHIFHWTKKPIPGPRGWPVIGSMGLMIGLAHRKITAKAQTFNANR  102

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LMAFSLG TR+I++ H D AKEIL  S+F DRP+KESA  LMF RAIGFAP G YWR LR
Sbjct  103   LMAFSLGDTRVIVTCHHDVAKEILHSSNFADRPIKESAYSLMFNRAIGFAPYGVYWRTLR  162

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVF  686
             R+A+ HMFSP++I   E  R +I E M      +    G  + R V+   SL N++ SVF
Sbjct  163   RVASTHMFSPKQIKASEAQRCSIVESMAAHFGVQ---HGPFQPRDVLRRASLSNMMGSVF  219

Query  687   G-SCLGLQG------EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRV  845
             G  C  ++G      EEL  MV EGY+L+G  NWGD+       D    + +C +L  +V
Sbjct  220   GRKCSPVEGPENKESEELKEMVGEGYDLLGMLNWGDHLSWLSDFDLQKIRFRCSQLVPKV  279

Query  846   NDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDT  1025
             N  VG++I + +         V  N DF+ VLLSL   D+L+D+D+++VLWEMIFRGTDT
Sbjct  280   NRFVGRVINEHRVN------PVRPNRDFVDVLLSLQDLDKLSDSDMISVLWEMIFRGTDT  333

Query  1026  VAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             VA+L+EWI+AR+VLH DVQ+    E+D  VG SR V +SDI +L YL A++KEVLR+HPP
Sbjct  334   VAVLIEWILARLVLHPDVQSMVHNELDNVVGRSRAVSESDITSLVYLTAVIKEVLRVHPP  393

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEE  1373
             GPLLSWARLA+ D  VD   +PAGTTAMV+MWAIT +P  W +P  F P+RF+    E E
Sbjct  394   GPLLSWARLAIEDTTVDGHHVPAGTTAMVDMWAITRNPTNWPEPNKFNPDRFLGSGAENE  453

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP---GPSVDLSECLKL  1544
              S++GSDLRLAPFGSGRR CPG+ALGL+TV  W+A  L  ++W+    G +VDL+E LKL
Sbjct  454   FSVLGSDLRLAPFGSGRRACPGKALGLATVSFWVASLLHKYEWVASGDGSTVDLTEVLKL  513

Query  1545  SLEMKKHLAI  1574
             S EM   L +
Sbjct  514   SCEMAHPLTV  523



>ref|XP_004148459.1| PREDICTED: cytochrome P450 78A4-like [Cucumis sativus]
 ref|XP_004161810.1| PREDICTED: cytochrome P450 78A4-like [Cucumis sativus]
Length=531

 Score =   454 bits (1169),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 243/480 (51%), Positives = 324/480 (68%), Gaps = 16/480 (3%)
 Frame = +3

Query  162   WVVE-GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMG-SHAHRKLASMATSMGLNRLMA  335
             WV   GG AWRN  N +    + GP   PFLG L  +  S  HR LA++A++   + LMA
Sbjct  49    WVFSPGGTAWRNGRNRRGLLPIPGPRGLPFLGSLFTLTHSLPHRTLAALASTRCESNLMA  108

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FSLG+T ++++S P+TAKEIL    F DRP+K+SAK LMF RAIGFAP+G+YWR LRR+A
Sbjct  109   FSLGSTPVVVASDPNTAKEILTSPHFADRPLKQSAKSLMFGRAIGFAPNGTYWRMLRRIA  168

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             ++H+FSP+RIA  E  R     EMI  +  E    G V +R  V   SL+NV+ SVFG  
Sbjct  169   SSHLFSPKRIAAHESARQRQCAEMIRNIHHEQIVHGSVGLRKHVQVASLKNVMWSVFGKR  228

Query  696   LGLQGEELGL---MVKEGYELIGEFNWGDYFP-LGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
             L     EL +   +V+EG+EL+G FNW DY P L +  D     ++C +L  +VN+ VG 
Sbjct  229   LEEGDMELEMVRDLVREGFELLGAFNWSDYMPWLSWFYDPFRINQRCAKLVPKVNEFVGG  288

Query  864   IIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             +I++ +R        +++++DF+ VLLSL  +++L D D++AVLWEMIFRGTDT A+L E
Sbjct  289   VIDEHRRC-----KTLSDDSDFVDVLLSLDGDEKLKDDDMIAVLWEMIFRGTDTTALLTE  343

Query  1044  WIMARMVLHQDVQAKAQLEIDTCV--GPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             W+MA +VLH ++Q + + E++  V  G   ++ D+++  LPYLQA+VKE LRLHPPGPLL
Sbjct  344   WVMAELVLHGEIQEEVRKELERVVGGGEESNITDAEVAKLPYLQAVVKETLRLHPPGPLL  403

Query  1218  SWARLAVHDVYV-DKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSD  1394
             SWARL+  DV + +   IP  TTAMVNMWAITHDP +W  P  F P RF+  +V I GSD
Sbjct  404   SWARLSSSDVQLSNGMLIPQNTTAMVNMWAITHDPHVWEQPHVFNPARFLNADVDIRGSD  463

Query  1395  LRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKHL  1568
             LRLAPFG+GRR CPG+ LGL TV LW+A+ + HFKW P P+  VDL+E LKLS EMK  L
Sbjct  464   LRLAPFGAGRRACPGKNLGLVTVTLWVAKLVHHFKWAPDPAHPVDLTELLKLSSEMKNPL  523



>gb|KGN62106.1| hypothetical protein Csa_2G298280 [Cucumis sativus]
Length=533

 Score =   454 bits (1168),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 243/480 (51%), Positives = 324/480 (68%), Gaps = 16/480 (3%)
 Frame = +3

Query  162   WVVE-GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMG-SHAHRKLASMATSMGLNRLMA  335
             WV   GG AWRN  N +    + GP   PFLG L  +  S  HR LA++A++   + LMA
Sbjct  49    WVFSPGGTAWRNGRNRRGLLPIPGPRGLPFLGSLFTLTHSLPHRTLAALASTRCESNLMA  108

Query  336   FSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMA  515
             FSLG+T ++++S P+TAKEIL    F DRP+K+SAK LMF RAIGFAP+G+YWR LRR+A
Sbjct  109   FSLGSTPVVVASDPNTAKEILTSPHFADRPLKQSAKSLMFGRAIGFAPNGTYWRMLRRIA  168

Query  516   ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSC  695
             ++H+FSP+RIA  E  R     EMI  +  E    G V +R  V   SL+NV+ SVFG  
Sbjct  169   SSHLFSPKRIAAHESARQRQCAEMIRNIHHEQIVHGSVGLRKHVQVASLKNVMWSVFGKR  228

Query  696   LGLQGEELGL---MVKEGYELIGEFNWGDYFP-LGFLLDFGGTKRKCHRLAGRVNDLVGQ  863
             L     EL +   +V+EG+EL+G FNW DY P L +  D     ++C +L  +VN+ VG 
Sbjct  229   LEEGDMELEMVRDLVREGFELLGAFNWSDYMPWLSWFYDPFRINQRCAKLVPKVNEFVGG  288

Query  864   IIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVE  1043
             +I++ +R        +++++DF+ VLLSL  +++L D D++AVLWEMIFRGTDT A+L E
Sbjct  289   VIDEHRRC-----KTLSDDSDFVDVLLSLDGDEKLKDDDMIAVLWEMIFRGTDTTALLTE  343

Query  1044  WIMARMVLHQDVQAKAQLEIDTCV--GPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLL  1217
             W+MA +VLH ++Q + + E++  V  G   ++ D+++  LPYLQA+VKE LRLHPPGPLL
Sbjct  344   WVMAELVLHGEIQEEVRKELERVVGGGEESNITDAEVAKLPYLQAVVKETLRLHPPGPLL  403

Query  1218  SWARLAVHDVYV-DKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSD  1394
             SWARL+  DV + +   IP  TTAMVNMWAITHDP +W  P  F P RF+  +V I GSD
Sbjct  404   SWARLSSSDVQLSNGMLIPQNTTAMVNMWAITHDPHVWEQPHVFNPARFLNADVDIRGSD  463

Query  1395  LRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKHL  1568
             LRLAPFG+GRR CPG+ LGL TV LW+A+ + HFKW P P+  VDL+E LKLS EMK  L
Sbjct  464   LRLAPFGAGRRACPGKNLGLVTVTLWVAKLVHHFKWAPDPAHPVDLTELLKLSSEMKNPL  523



>ref|XP_009359545.1| PREDICTED: cytochrome P450 78A9-like [Pyrus x bretschneideri]
Length=558

 Score =   455 bits (1170),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 247/509 (49%), Positives = 318/509 (62%), Gaps = 52/509 (10%)
 Frame = +3

Query  174   GGFAW-------RNYSN-----NQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMG  317
             GG AW       RN  N     N NP  + GP  +P  G +  M + AH KL   A   G
Sbjct  50    GGAAWGKLRWRKRNSCNKNEITNSNP--IPGPRGFPITGSMNLMTNLAHHKLTKAAEVYG  107

Query  318   LNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGF--------  473
               RLMAFS+G TR I++  PD AKEIL  S F +RP+KESA  LMF RAIGF        
Sbjct  108   AKRLMAFSIGETRAIVTCDPDVAKEILNSSVFANRPIKESAYCLMFNRAIGFDPFGKYWR  167

Query  474   --------APSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfv  629
                     AP GSYWR LRR+AANH+F P++I+  E +RS IA++M+  +      S  V
Sbjct  168   TLRRIAANAPYGSYWRPLRRIAANHLFCPKQISTSEYLRSRIADQMVSLISTSCNNSFLV  227

Query  630   evrgvvgegSLRNVVESVFG-----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFL  794
                      SL +++ SVFG     S    + EEL  +V EGY+L+G  NW D+ P    
Sbjct  228   RDVLRKA--SLNSMMCSVFGRKYELSSSNEETEELSRLVDEGYDLLGNLNWSDHLPWLAG  285

Query  795   LDFGGTKRKCHRLAGRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLAD  974
             LD    + +C++L  +VN LV +II++ + Q         NN DF+ VLLSL   D+L D
Sbjct  286   LDLQSIRLRCNKLVPQVNRLVSRIIQEHRAQTGP------NNNDFVDVLLSLDGADKLCD  339

Query  975   ADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPN  1154
              D+++VLWEMIFRGTDTVA+L+EWI+AR+V+H D+Q+K   E+D  VG SR + +SDI +
Sbjct  340   NDMISVLWEMIFRGTDTVAVLIEWILARVVMHHDIQSKVHEELDRVVGKSRALLESDIQS  399

Query  1155  LPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWND  1334
             LPYLQA+VKEVLR+HPPGPLLSWAR+++ D  VD  ++PAGTTAMVNMWAIT DPK+W+D
Sbjct  400   LPYLQAVVKEVLRMHPPGPLLSWARISITDTVVDGYYVPAGTTAMVNMWAITRDPKVWSD  459

Query  1335  PWTFRPERFMEE------EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHF  1496
             P  FRPERF+        + S+ GSDLRLAPFGSGRR CPG+ LGLSTV+ W+   L  F
Sbjct  460   PQEFRPERFVSTNKKADLQFSVFGSDLRLAPFGSGRRSCPGKTLGLSTVNYWVGLLLHEF  519

Query  1497  KWLPG---PSVDLSECLKLSLEMKKHLAI  1574
             +W        VDLSE ++LS +M   L I
Sbjct  520   EWFKSDLDAQVDLSEVMRLSCQMANPLTI  548



>ref|XP_007051469.1| Cytochrome P450, family 78, subfamily A, polypeptide 6 [Theobroma 
cacao]
 gb|EOX95626.1| Cytochrome P450, family 78, subfamily A, polypeptide 6 [Theobroma 
cacao]
Length=535

 Score =   454 bits (1167),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 248/492 (50%), Positives = 316/492 (64%), Gaps = 31/492 (6%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNP-------KKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSM  314
             +W   GG AW  Y   +         K++ GP   P +G +  M S  AH ++A+ A + 
Sbjct  43    YWAHPGGPAWGKYRFKKCSSLWVAANKQIPGPRGLPLIGSMNLMASSLAHHRIAAAAETC  102

Query  315   GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYW  494
                RLMAFSLG TR+I++ +PD A+EIL  S F DRPVKESA  LMF RAIGFAP G YW
Sbjct  103   KAKRLMAFSLGDTRVIVTCNPDVAREILSSSVFADRPVKESAYSLMFNRAIGFAPYGVYW  162

Query  495   RQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVV  674
             R LRR+AA H+F P++I   E  R  IA EM+  +      S    VR V+   SL N++
Sbjct  163   RTLRRIAATHLFCPKQIKGAEDQRRVIASEMVALLGHH---SQSFRVRQVLKRASLNNMM  219

Query  675   ESVFGSCLGLQG----EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTK--RKCHRLA  836
              S+FG    L      EEL  +V EGY+L+G  NW D+ P  +L DF   K   +C +L 
Sbjct  220   CSIFGRKYTLDSNNEVEELRALVDEGYDLLGTLNWSDHLP--WLADFDPQKIRVRCSKLV  277

Query  837   GRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRG  1016
              +VN  V  II + + Q  G         DF+ VLLSL   D+L+D+D++AVLWEMIFRG
Sbjct  278   PKVNRFVSGIISEHRAQPNG------KTGDFVDVLLSLQGADKLSDSDMIAVLWEMIFRG  331

Query  1017  TDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRL  1196
             TDTVA+L+EWI+AR+VLH DVQ++   E+D  VG SR V +SD+ N+ YL A++KEVLRL
Sbjct  332   TDTVAVLIEWILARIVLHPDVQSRVHDELDNVVGTSRAVDESDVMNMIYLPAVIKEVLRL  391

Query  1197  HPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----  1364
             HPPGPLLSWARLA+ D  +D   +P GTTAMVNMWAIT DPK W DP  F P+RF+    
Sbjct  392   HPPGPLLSWARLAITDTTIDGYHVPEGTTAMVNMWAITRDPKEWADPLEFVPDRFVTKEG  451

Query  1365  EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPG--PSVDLSECL  1538
             E E S++GSDLRLAPFGSGRR CPG+ LGL+TV  W+A  L  F+WLP    +VDLSE L
Sbjct  452   EVEFSVLGSDLRLAPFGSGRRTCPGKNLGLTTVSFWVATLLHEFEWLPSDQTTVDLSEVL  511

Query  1539  KLSLEMKKHLAI  1574
             +LS EM   L++
Sbjct  512   RLSCEMANPLSV  523



>gb|ACG28027.1| cytochrome P450 CYP78A52 [Zea mays]
Length=546

 Score =   454 bits (1168),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 250/496 (50%), Positives = 313/496 (63%), Gaps = 32/496 (6%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNP------KKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLN  323
             W   GG AW  Y   +          + GP   P +G +  M   AHRKLA+ A S G +
Sbjct  46    WACPGGPAWGRYWWTRRGGLGIVRAAIPGPRGLPVVGSMGLMTGLAHRKLAAAAVSQGSS  105

Query  324   R---LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYW  494
             R   LMA SLG TR +++  PD A+E+L  ++F DRPVKESA  L+F RAIGFAP G+YW
Sbjct  106   RRRRLMALSLGETRAVVTGDPDVARELLGSAAFADRPVKESAYGLLFHRAIGFAPHGAYW  165

Query  495   RQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvv--gegSLRN  668
             R LRR+A+ H+FSPR++A     R+ IA +M+  +      +    V         SL N
Sbjct  166   RALRRVASAHLFSPRQVAASSAQRAVIARQMVDAVTTTTTTTAPAVVVARRFLKRASLHN  225

Query  669   VVESVFGS----CLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLA  836
             V+ SVFG      L   GEEL  +V EGY+L+G+ NW D+ P     D   T+ +C  L 
Sbjct  226   VMWSVFGRRYDLLLAADGEELKALVDEGYDLLGQLNWSDHLPWLARFDLQRTRARCSALV  285

Query  837   GRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRG  1016
              RVN  VG II++ + +     +     TDF  VLLSL   D+L+DAD+VAVLWEMIFRG
Sbjct  286   PRVNRFVGNIIDEHRARLGDTGV-----TDFTDVLLSLQGVDKLSDADMVAVLWEMIFRG  340

Query  1017  TDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGP---SRHVQDSDIPNLPYLQAIVKEV  1187
             TDTVA+L+EW++AR+VLHQDVQ+K Q E+D  VGP   +  V +SD  +L YLQA++KEV
Sbjct  341   TDTVAVLMEWVLARLVLHQDVQSKVQEELDRVVGPPGQAASVTESDTASLVYLQAVIKEV  400

Query  1188  LRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-  1364
             LRLHPPGPLLSWARLA  D  V    +PAGTTAMVNMWAITHDP +W +P  FRPERF+ 
Sbjct  401   LRLHPPGPLLSWARLATSDARVGGYHVPAGTTAMVNMWAITHDPSVWAEPTEFRPERFVG  460

Query  1365  -------EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPG-PSV  1520
                    E+   IMGSDLRLAPFGSGRR CPG++L L+TV  W+A  L  FKWLP    V
Sbjct  461   APAGAGAEDVPMIMGSDLRLAPFGSGRRSCPGKSLALATVGFWVATLLHEFKWLPPCRGV  520

Query  1521  DLSECLKLSLEMKKHL  1568
             DLSE L+LS EM   L
Sbjct  521   DLSEVLRLSCEMAAPL  536



>ref|XP_010676906.1| PREDICTED: cytochrome P450 78A3-like [Beta vulgaris subsp. vulgaris]
Length=542

 Score =   454 bits (1168),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 246/493 (50%), Positives = 327/493 (66%), Gaps = 21/493 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKKLN----GPMSWPFLGFLPQMGSHAHRKLASMATSMGLNR  326
             +WV  GG AW  + +  +P   +    GP  +P +G +  M   +H KL +MA  +G  R
Sbjct  43    YWVEPGGPAWGKFRHKLSPPTTSARPPGPRGYPLIGSMNLMMGLSHHKLTAMANLLGARR  102

Query  327   LMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLR  506
             LMAFSLG TR++I+ + + AK+ILC S F DRP+KESA  LMF RA+GFAP G YWR LR
Sbjct  103   LMAFSLGDTRVVITCNHEVAKDILCSSVFADRPIKESAYNLMFNRAMGFAPYGVYWRTLR  162

Query  507   RMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrg------vvgegSLRN  668
             R+AA HMF P++I+  +  R+ IA +M+  ++     +             ++   SL N
Sbjct  163   RIAATHMFCPKQISFGQRQRAEIASQMVEIINNNNNNNNGECTTSPFCVREMLKLASLTN  222

Query  669   VVESVFG-------SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCH  827
             ++ESVFG       + L  +  +L  +V+EGYEL+G+ NW DYFPL   LD  G + +C 
Sbjct  223   MMESVFGRRYDLVTASLNQEAIQLSQLVQEGYELLGKLNWSDYFPLFGSLDLQGIRERCS  282

Query  828   RLAGRVNDLVGQII-EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEM  1004
              L  RVN  V  II E + R+ + +  + +++ D + VLLSL   D+L+D D+VAVLWEM
Sbjct  283   GLVPRVNRFVNGIISEHQVRKHKQVFGDSDDDQDLVDVLLSLDGPDKLSDGDMVAVLWEM  342

Query  1005  IFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKE  1184
             IFRGTDTVA+L+EWI+ARMVLH D+Q+K Q E+D  VG SR + ++DIP+L YLQA++KE
Sbjct  343   IFRGTDTVAVLIEWILARMVLHPDIQSKVQDELDRVVGKSRPLIEADIPSLGYLQAMIKE  402

Query  1185  VLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM  1364
             VLRLHPPGPLLSWARLA++D  +D   IPAGTTAMVNMWAI  DP+IW DP  F PERF+
Sbjct  403   VLRLHPPGPLLSWARLAINDTTLDGYHIPAGTTAMVNMWAIARDPQIWADPLRFYPERFV  462

Query  1365  EE-EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPSVDLSEC  1535
             +  + S+MGSDLRLAPFGSGRR CPG+ALGL+TV  W+   L  F W      SV L+E 
Sbjct  463   DNVDFSVMGSDLRLAPFGSGRRSCPGKALGLTTVTYWVGTLLHEFVWTQCHHNSVTLNEV  522

Query  1536  LKLSLEMKKHLAI  1574
             +KLS EM   L +
Sbjct  523   MKLSCEMANPLTV  535



>ref|XP_008374120.1| PREDICTED: cytochrome P450 78A9-like [Malus domestica]
Length=539

 Score =   454 bits (1167),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 236/476 (50%), Positives = 315/476 (66%), Gaps = 24/476 (5%)
 Frame = +3

Query  189   RNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSLGTTRMIIS  368
             +N   N NP  + GP  +P +G +  M + AH KL   A   G  RLMAFS+G TR I++
Sbjct  67    KNEITNSNP--IPGPRGFPIIGSMNLMTNLAHHKLTKAAEVFGAKRLMAFSMGETRAIVT  124

Query  369   SHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMFSPRRIA  548
               PD AKEIL  S F +RP+KESA  LMF RAIGFAP GSYWR LR +AA H+F P++I+
Sbjct  125   CDPDVAKEILNSSVFANRPIKESAYCLMFNRAIGFAPYGSYWRTLRCIAATHLFCPKQIS  184

Query  549   CLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG-----SCLGLQGE  713
               EG+RS IA++M+  +      +    VR  + + SL +++ SVFG     S    + E
Sbjct  185   TSEGLRSRIADQMVSLI--WTSCNNSFLVRDXLRKASLNSMMCSVFGRKXELSSSNEETE  242

Query  714   ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEKRKRQFE  893
             EL  +V EGY+++G+ NW D+ P    LD    + +C++L  +VN LV +II++ + Q  
Sbjct  243   ELSRLVDEGYDMLGKLNWSDHLPWLAGLDLQSIRLRCNKLVPQVNGLVSRIIQEHRAQ--  300

Query  894   GIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQ  1073
                 +   N DFL VLLS    D+L D D+++VLWEMIFRGTDT+A+L+EWI+ARMV+H 
Sbjct  301   ----SGPRNNDFLDVLLSFDGADKLCDNDMISVLWEMIFRGTDTIAVLIEWILARMVMHH  356

Query  1074  DVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYV  1253
             D+Q+K   E+D  VG SR + +SDI  LPYLQA+VKE LR+HPPGPLLSWARL++ D  V
Sbjct  357   DIQSKVHEELDRVVGKSRSLVESDIQXLPYLQAVVKEGLRMHPPGPLLSWARLSITDTIV  416

Query  1254  DKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE------EVSIMGSDLRLAPFG  1415
             D   +PAGTTAMVNMWAIT DP++W DP+ F+PERF+        + S+ GSDLRLAPFG
Sbjct  417   DGYHVPAGTTAMVNMWAITRDPEVWLDPFEFKPERFVSNNKEADFQFSVFGSDLRLAPFG  476

Query  1416  SGRRVCPGRALGLSTVHLWLARFLQHFKWL---PGPSVDLSECLKLSLEMKKHLAI  1574
             SGRR CPG+ALGL+TV+ W+   L  F+W    P   VDLSE ++LS +M   L +
Sbjct  477   SGRRSCPGKALGLTTVNYWVGLLLYEFEWFKSDPNAPVDLSEVMRLSCQMANPLTV  532



>ref|XP_010469033.1| PREDICTED: cytochrome P450 78A9-like [Camelina sativa]
Length=529

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 245/486 (50%), Positives = 318/486 (65%), Gaps = 21/486 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKK--LNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRL  329
             +W   GG AW  Y +++  +   + GP   PF+G +  M +  AHR +A+ A   G  RL
Sbjct  39    YWSHPGGPAWGKYFSHRRHQTTVIPGPRGLPFIGSMSLMSNTLAHRCIAATAEKFGAKRL  98

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TRMI++ +PD AKEIL  S F DRPVKESA  LMF RAIGFAP G YWR LR+
Sbjct  99    MAFSLGETRMIVTCNPDVAKEILNSSVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRK  158

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +A+NH+FSPR+I   E  RS IA ++   + K+    G    R ++   SL N++ SVFG
Sbjct  159   IASNHLFSPRQIKRSETQRSVIANQITRCLAKQSSTEGLCFARDLIKTASLNNMMCSVFG  218

Query  690   SCLGLQGEELGL-----MVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
                 L+ E   +     +V EGY+L+G+ NW D+ P    LD    + +C  L  +VN  
Sbjct  219   KEYELEHEHEEVRELSELVDEGYDLLGKLNWTDHLPWLSELDPQRIRSRCSTLVPKVNRF  278

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             V +II   + Q   +       +DF+ VLLSL   D+L+D D++AVLWEMIFRGT TVA+
Sbjct  279   VNRIISYHRAQARDLP------SDFVDVLLSLDGPDKLSDPDMIAVLWEMIFRGTGTVAV  332

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EWI+ARMVLH DVQ+    E+D  VG SR V++SD+ +L YL A+VKEVLRLHPPGPL
Sbjct  333   LIEWILARMVLHPDVQSTVHRELDQIVGRSRAVEESDVASLVYLTAVVKEVLRLHPPGPL  392

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEE----VSI  1382
             LSW+RLA+ D  +D   +PAGTTAMVNMWAI HDP++W  P  F+PERF+ +E     S+
Sbjct  393   LSWSRLAITDTTIDGHRVPAGTTAMVNMWAIAHDPQVWESPLEFKPERFVAKEGEVGFSV  452

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP---SVDLSECLKLSLE  1553
             +GSDLRLAPFGSGRR+CPG+ LGL+TV  W A  L  F+W P     +VDLSE L+LS E
Sbjct  453   LGSDLRLAPFGSGRRICPGKNLGLATVTFWTATLLHEFEWRPPSDEKTVDLSEKLRLSCE  512

Query  1554  MKKHLA  1571
             M   LA
Sbjct  513   MANPLA  518



>ref|XP_006402432.1| hypothetical protein EUTSA_v10005883mg [Eutrema salsugineum]
 gb|ESQ43885.1| hypothetical protein EUTSA_v10005883mg [Eutrema salsugineum]
Length=534

 Score =   453 bits (1165),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 249/487 (51%), Positives = 315/487 (65%), Gaps = 23/487 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKK--LNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRL  329
             FW   GG AW  Y  ++  +   + GP   PF+G +  M +  AHR +A+ A   G  RL
Sbjct  44    FWSHPGGPAWGKYFIHRRHRTTVIPGPRGLPFVGSMSLMSNALAHRCIAATAERFGAKRL  103

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TR+I++  PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR LRR
Sbjct  104   MAFSLGDTRVIVTCDPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRR  163

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +A+NH+FSP++I   E  R  IA +++  + K+    GF   R ++   SL N++ SVFG
Sbjct  164   IASNHLFSPKQIKRSETQRRVIANQIVRCLAKQSSNEGFCFARDLIKTASLNNMMCSVFG  223

Query  690   SCLGLQGE-----ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
                 L+ E     EL  +V+EGY+L+   NW D+ P  F  D    + +C  L  +VN  
Sbjct  224   KEYELEQEHDEVNELRGLVEEGYDLLATLNWTDHLPWLFEFDPQRIRSRCTNLVPKVNRF  283

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             V +II   + Q        ++ +DF+ VLLSL   DQL+D D+VAVLWEMIFRGTDTVA+
Sbjct  284   VNRIISDHRDQTR------DSPSDFVDVLLSLDGPDQLSDPDIVAVLWEMIFRGTDTVAV  337

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EWI+ARMVLH D+Q+    E+D  VG SR V++SD+ +L YL A+VKEVLRLHPPGPL
Sbjct  338   LIEWILARMVLHPDIQSTVHNELDKIVGRSRAVEESDVASLTYLTAVVKEVLRLHPPGPL  397

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSI  1382
             LSW+RLA+ D  +D   +PAGTTAMVNMWAI  DP +W +P  F P RF+    E E S+
Sbjct  398   LSWSRLAITDTIIDGRRVPAGTTAMVNMWAIAQDPHVWENPLEFNPGRFVAKEGEAEFSV  457

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSECLKLSL  1550
             +GSDLRLAPFGSGRRVCPG+ LGLSTV  W+A  L  F WL  PS    VDLSE L+LS 
Sbjct  458   LGSDLRLAPFGSGRRVCPGKNLGLSTVTYWIATLLHEFVWL-APSDDKTVDLSEKLRLSC  516

Query  1551  EMKKHLA  1571
             EM   L 
Sbjct  517   EMANPLT  523



>gb|ACG29756.1| cytochrome P450 CYP78A54 [Zea mays]
Length=543

 Score =   453 bits (1166),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 256/491 (52%), Positives = 319/491 (65%), Gaps = 25/491 (5%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNP------KKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMG-L  320
             W   GG AW  Y   +          + GP   P +G +  M   AHRKL++ A      
Sbjct  45    WASPGGPAWGWYWWTRRAGLGIVRAAIPGPRGLPVVGSMGLMTGLAHRKLSAAAERQASR  104

Query  321   NRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQ  500
              RLMAFSLG TR+++++  D A+E+L  ++F DRPVKESA  L+F RAIGFAP G+YWR 
Sbjct  105   RRLMAFSLGETRVVVTADLDVARELLASAAFADRPVKESAYGLLFHRAIGFAPHGAYWRA  164

Query  501   LRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVES  680
             LRR+A+ H+FSPR+IA     R+AIA +M+         +  V  R  +   SL NV+ S
Sbjct  165   LRRVASAHLFSPRQIAASAAQRAAIARQMVDATTTAAAHAPVVVARRFLKRASLHNVMWS  224

Query  681   VFGSCLGL-----QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRV  845
             VFG    L     + EEL  +V EGY+L+G+ NW D+ P     D   T+ +C  L  RV
Sbjct  225   VFGRRYDLMADSREAEELKALVDEGYDLLGQLNWSDHLPWLARFDLQKTRARCCALVPRV  284

Query  846   NDLVGQII-EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTD  1022
             N  VG II E R R   G +  V    DF  VLLSL  +D+L+DAD++AVLWEMIFRGTD
Sbjct  285   NRFVGNIIGEHRARLGRGGDTAV---MDFTDVLLSLQGDDKLSDADMIAVLWEMIFRGTD  341

Query  1023  TVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHP  1202
             TVA+L+EW++AR+VLHQDVQ+K Q E+D  VG  + V +SD  +LPYLQA++KEVLRLHP
Sbjct  342   TVAVLIEWVLARLVLHQDVQSKVQEELDRVVGLGQAVTESDTASLPYLQAVIKEVLRLHP  401

Query  1203  PGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM---EEE  1373
             PGPLLSWARLA  DVYV    +PAGTTAMVNMWAITHDP +W +P  FRPERFM    E+
Sbjct  402   PGPLLSWARLATSDVYVSGYLVPAGTTAMVNMWAITHDPSLWPEPMEFRPERFMGPAAED  461

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP------GPSVDLSEC  1535
             V IMGSDLRLAPFGSGRR CPG++L ++TV  W+A  L  FKWLP      G  VDLSE 
Sbjct  462   VPIMGSDLRLAPFGSGRRSCPGKSLAVATVGFWVATLLYEFKWLPPSDEPRGGGVDLSEV  521

Query  1536  LKLSLEMKKHL  1568
             L+LS EM   L
Sbjct  522   LRLSCEMAAPL  532



>tpg|DAA40592.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=561

 Score =   454 bits (1167),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 251/466 (54%), Positives = 317/466 (68%), Gaps = 18/466 (4%)
 Frame = +3

Query  222   LNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILC  401
             L GP   P +G +  M   AHRKLA+ A S+G  RLMAFSLG TR++++SHPD A+EIL 
Sbjct  79    LPGPRGLPVVGSMWLMTGLAHRKLAAAAGSLGARRLMAFSLGGTRVVVASHPDVAREILS  138

Query  402   GSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAE  581
               +F DRP+KESA  L+F RAIGFAP G+YWR LRR+A+ H+FSPR++A     R+ IA 
Sbjct  139   SPAFADRPIKESAYGLLFHRAIGFAPYGAYWRALRRVASTHLFSPRQVAASAAQRAVIAR  198

Query  582   EMIGKMDKEMgesgf-----vevrgvvgegSLRNVVESVFGSCLGLQ---------GEEL  719
             +M+G + KE+  +       VEVR V+  GSL +V+ SVFG    L+           EL
Sbjct  199   QMVGAV-KELSAASPGRRGGVEVRRVLRRGSLHSVMWSVFGRRYDLELDPARESPETREL  257

Query  720   GLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIEKRKRQFEGI  899
               +V EGY+L+G+ NW D+ P    LD   T+ +C RL   V   VG I+++  R    +
Sbjct  258   RRLVDEGYDLLGQINWSDHLPGLACLDLQSTRARCDRLVPLVTRFVGGIVDE-HRARNHL  316

Query  900   EINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDV  1079
                     DF  VLLSLP +D+L DAD++AVLWEM+FRGTDTVA+L+EW +AR+VLH DV
Sbjct  317   RSAPPAVVDFTDVLLSLPADDRLTDADMIAVLWEMVFRGTDTVAVLMEWALARLVLHPDV  376

Query  1080  QAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDK  1259
             QA+   E+D  VGP R V +SD  +L YL A++KEVLR+HPPGPLLSWARLA  DV+VD 
Sbjct  377   QARVHDELDRVVGPHRAVTESDTASLVYLHAVIKEVLRMHPPGPLLSWARLATSDVHVDG  436

Query  1260  CFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-EEEVSIMGSDLRLAPFGSGRRVCP  1436
               IPAGTTAMVNMWAITHDP +W +P  F+PERFM   E  IMGSDLRLAPFG+GRR CP
Sbjct  437   HLIPAGTTAMVNMWAITHDPDVWAEPTEFQPERFMGSTEFPIMGSDLRLAPFGAGRRSCP  496

Query  1437  GRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLEMKKHLAI  1574
             G++L ++TV  WLA  L  F+ LP P VDLSE LKLS EM   LA+
Sbjct  497   GKSLAMATVAFWLATLLHEFELLPSP-VDLSEVLKLSCEMAVPLAL  541



>ref|NP_001062428.1| Os08g0547300 [Oryza sativa Japonica Group]
 dbj|BAD09934.1| putative cytochrome p450 (CYP78A9) [Oryza sativa Japonica Group]
 dbj|BAF24342.1| Os08g0547300 [Oryza sativa Japonica Group]
 dbj|BAG92850.1| unnamed protein product [Oryza sativa Japonica Group]
Length=551

 Score =   453 bits (1166),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 246/494 (50%), Positives = 312/494 (63%), Gaps = 28/494 (6%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQN-----PKKLNGPMSWPFLGFLPQMGSHAHRKLASMAT-SMGLN  323
             W+  GG AW  Y  N+         + GP   P LG +  M   AHRKLA+ A  S    
Sbjct  51    WLSPGGPAWGRYWWNRRGGLGIAAAIPGPRGLPVLGSMSLMAGLAHRKLAAAAGGSPARR  110

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RLMA SLG TR+++++ P  A+E+L  ++F DRPVKESA  ++F RAIGFAP G+YWR L
Sbjct  111   RLMALSLGETRVVVTADPGVARELLASAAFADRPVKESAYGMLFHRAIGFAPYGTYWRAL  170

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgv--vgegSLRNVVE  677
             RR+A+ H+FSPR+++     R+ IA +M+  M      +    V     +   SL NV+ 
Sbjct  171   RRVASTHLFSPRQVSASAAQRAVIARQMVEAMRSAAAAAAGGGVAARPFLKRASLHNVMW  230

Query  678   SVFGSCLGL------QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAG  839
             SVFG    L      +  EL  MV EGY+L+G+ NW D+ P     D   T+ +C  L  
Sbjct  231   SVFGRKYELAAPESEETAELRSMVDEGYDLLGQLNWSDHLPWLAPFDLKKTRSRCSSLVP  290

Query  840   RVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGT  1019
             RVN  V +II++ + +   + + V+   DF  VLLSL   D+L+DAD+VAVLWEMIFRGT
Sbjct  291   RVNRFVTRIIDEHRAR---LSLAVDAAVDFTDVLLSLHGGDKLSDADMVAVLWEMIFRGT  347

Query  1020  DTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLH  1199
             DTVA+L+EW+ AR+VLHQDVQA+   E+D  VG  R V +SD   L YLQA++KEVLRLH
Sbjct  348   DTVAVLIEWVAARLVLHQDVQARVHDELDRVVGSDRAVTESDASKLVYLQAVIKEVLRLH  407

Query  1200  PPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-----  1364
             PPGPLLSWARLA  DV+V    IP+GTTAMVNMWAITHDP +W DP  F+PERF+     
Sbjct  408   PPGPLLSWARLATSDVHVGGFLIPSGTTAMVNMWAITHDPAVWPDPNEFKPERFVAGPSS  467

Query  1365  --EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP----GPSVDL  1526
                 E  IMGSDLRLAPFGSGRR CPG++L ++TV  W+A  L  F WLP       VDL
Sbjct  468   DQATEFPIMGSDLRLAPFGSGRRSCPGKSLAIATVGFWVATLLHEFDWLPLSDKSRGVDL  527

Query  1527  SECLKLSLEMKKHL  1568
             SE LKLS EM   L
Sbjct  528   SEVLKLSCEMATPL  541



>gb|EEC83990.1| hypothetical protein OsI_30143 [Oryza sativa Indica Group]
Length=549

 Score =   453 bits (1166),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 246/494 (50%), Positives = 312/494 (63%), Gaps = 28/494 (6%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQN-----PKKLNGPMSWPFLGFLPQMGSHAHRKLASMAT-SMGLN  323
             W+  GG AW  Y  N+         + GP   P LG +  M   AHRKLA+ A  S    
Sbjct  49    WLSPGGPAWGRYWWNRRGGLGIAAAIPGPRGLPVLGSMSLMAGLAHRKLAAAAGGSPARR  108

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RLMA SLG TR+++++ P  A+E+L  ++F DRPVKESA  ++F RAIGFAP G+YWR L
Sbjct  109   RLMALSLGETRVVVTADPGVARELLASAAFADRPVKESAYGMLFHRAIGFAPYGTYWRAL  168

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgv--vgegSLRNVVE  677
             RR+A+ H+FSPR+++     R+ IA +M+  M      +    V     +   SL NV+ 
Sbjct  169   RRVASTHLFSPRQVSASAAQRAVIARQMVEAMRSAAAAAAGGGVAARPFLKRASLHNVMW  228

Query  678   SVFGSCLGL------QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAG  839
             SVFG    L      +  EL  MV EGY+L+G+ NW D+ P     D   T+ +C  L  
Sbjct  229   SVFGRKYELAAPESEETAELRSMVDEGYDLLGQLNWSDHLPWLAPFDLQKTRSRCSSLVP  288

Query  840   RVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGT  1019
             RVN  V +II++ + +   + + V+   DF  VLLSL   D+L+DAD+VAVLWEMIFRGT
Sbjct  289   RVNRFVTRIIDEHRAR---LSLAVDAAVDFTDVLLSLHGGDKLSDADMVAVLWEMIFRGT  345

Query  1020  DTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLH  1199
             DTVA+L+EW+ AR+VLHQDVQA+   E+D  VG  R V +SD   L YLQA++KEVLRLH
Sbjct  346   DTVAVLIEWVAARLVLHQDVQARVHDELDRVVGSDRAVTESDASKLVYLQAVIKEVLRLH  405

Query  1200  PPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM-----  1364
             PPGPLLSWARLA  DV+V    IP+GTTAMVNMWAITHDP +W DP  F+PERF+     
Sbjct  406   PPGPLLSWARLATSDVHVGGFLIPSGTTAMVNMWAITHDPAVWPDPNEFKPERFVAGPSS  465

Query  1365  --EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP----GPSVDL  1526
                 E  IMGSDLRLAPFGSGRR CPG++L ++TV  W+A  L  F WLP       VDL
Sbjct  466   DQAAEFPIMGSDLRLAPFGSGRRSCPGKSLAIATVGFWVATLLHEFDWLPLSDKSRGVDL  525

Query  1527  SECLKLSLEMKKHL  1568
             SE LKLS EM   L
Sbjct  526   SEVLKLSCEMATPL  539



>ref|XP_010413334.1| PREDICTED: cytochrome P450 78A9 [Camelina sativa]
Length=534

 Score =   452 bits (1164),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 244/486 (50%), Positives = 316/486 (65%), Gaps = 21/486 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNN--QNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRL  329
             FW   GG AW  Y ++       + GP   PF+G +  M +  AHR +A+ A   G  RL
Sbjct  44    FWSHPGGPAWGKYFSHCRHQTTVVPGPRGLPFIGSMSLMSNTLAHRCIAATAEKFGAKRL  103

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TRMI++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR LR+
Sbjct  104   MAFSLGETRMIVTCNPDVAKEILNSPIFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRK  163

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +A+NH+FSP++I   E  RS IA ++   + K+    G    R ++   SL N++ SVFG
Sbjct  164   IASNHLFSPKQIKRSETQRSVIANQITKCLAKQSSTEGLCFARDLIKTASLNNMMCSVFG  223

Query  690   SCLGLQGEELGL-----MVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
                 L+ E   +     +V EGY+L+G+ NW D+ P    LD    + +C  L  +VN  
Sbjct  224   KEYELEHEHEEVRELSELVDEGYDLLGKLNWTDHLPWLSELDPQRIRSRCSTLVPKVNRF  283

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             V +II   + Q        ++ +DF+ VLLSL   D+L+D D++AVLWEMIFRGTDTVA+
Sbjct  284   VNRIISDHRAQAR------DSPSDFVDVLLSLDGPDKLSDPDMIAVLWEMIFRGTDTVAV  337

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EWI ARMVLH D+Q+    E+D  VG SR V++SD+ +L YL A+VKEVLRLHPPGPL
Sbjct  338   LIEWIFARMVLHPDIQSTVHRELDQIVGKSRAVEESDVASLVYLTAVVKEVLRLHPPGPL  397

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSI  1382
             LSW+RLA+ D  +D   +PAGTTAMVNMWAI  DP++W +P  F+PERF+    E E S+
Sbjct  398   LSWSRLAITDTTIDGHRVPAGTTAMVNMWAIARDPQVWENPLEFKPERFVAKEGEVEFSV  457

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP---SVDLSECLKLSLE  1553
             +GSDLRLAPFGSGRR+CPG+ LGL+TV  W A  L  F+W P     +VDLSE L+LS E
Sbjct  458   LGSDLRLAPFGSGRRICPGKNLGLATVTFWTATLLHEFEWRPPSDEKTVDLSEKLRLSCE  517

Query  1554  MKKHLA  1571
             M   LA
Sbjct  518   MANPLA  523



>ref|XP_009804294.1| PREDICTED: cytochrome P450 78A3-like [Nicotiana sylvestris]
Length=532

 Score =   452 bits (1164),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 247/490 (50%), Positives = 325/490 (66%), Gaps = 23/490 (5%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQ---NPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLN  323
             M +W   GG AW  Y   +    PK + GP  +P +G +  M   AH+K+A++A S    
Sbjct  42    MIYWTHPGGPAWGKYKWRKYFVAPKPIPGPRGFPLIGSMNLMTGLAHQKIAAVAKSCQAK  101

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RLM+FSLG TR+I++ +P  AKEIL  S+F DRPV ESA  LMF R+IGFA  G YWR L
Sbjct  102   RLMSFSLGETRVIVTCNPVVAKEILNSSAFIDRPVNESAYRLMFNRSIGFASYGVYWRTL  161

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             R++AA H+F P++I   E  R  I ++M+ ++ K  G    + VR V+ + S+ N++ SV
Sbjct  162   RKIAATHLFCPKQIKASETQRCEIVKQMV-EILKGGGSRDNIRVRDVLKKASVNNMMCSV  220

Query  684   FG---SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
             FG   S L    EEL  +V EGYEL+G  NW D+ P     D    + +C RL  +VN  
Sbjct  221   FGRNYSLLDDCNEELSELVDEGYELLGMLNWSDHLPWLAEFDPQKIQLRCSRLVPKVNQF  280

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             VG+II++ + Q        N + DF+ VLLSLP  ++L+D+D++AVLWEMIFRG+DTVA+
Sbjct  281   VGKIIDEHRAQPS------NGHRDFVDVLLSLPDSERLSDSDMIAVLWEMIFRGSDTVAV  334

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPS-RHVQDSDIPNLPYLQAIVKEVLRLHPPGP  1211
             L+EWI+ARMVLH DVQ+K Q E+D  VG S R + +SD+ N+ YL A+VKEVLRLHPPGP
Sbjct  335   LIEWILARMVLHPDVQSKVQEELDRIVGRSCRPIMESDVTNMVYLPAVVKEVLRLHPPGP  394

Query  1212  LLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE------E  1373
             LLSWARLA+  V VD   +PAGTTAMVNMWAIT   ++W DP  F+PERFM E      +
Sbjct  395   LLSWARLAIKHVIVDGYHVPAGTTAMVNMWAITRSEEVWTDPLEFKPERFMNESESELVD  454

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP---GPSVDLSECLKL  1544
              S++GSDLRLAPFGSGRR CPG+ LGL+TV  W+A  LQ F++ P     +VDLSE L+L
Sbjct  455   FSVLGSDLRLAPFGSGRRACPGKTLGLTTVTFWVASLLQEFQFGPTDETKTVDLSEVLRL  514

Query  1545  SLEMKKHLAI  1574
             S EM   L +
Sbjct  515   SCEMVNPLTV  524



>ref|XP_004306631.1| PREDICTED: cytochrome P450 78A3-like [Fragaria vesca subsp. vesca]
Length=531

 Score =   452 bits (1163),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 245/489 (50%), Positives = 315/489 (64%), Gaps = 28/489 (6%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKK---LNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRL  329
             +W   GG AW     N    K   + GP   P +G +  M   AHRK+A+MA +    RL
Sbjct  43    YWAHPGGPAWGRTVKNIFTSKTAMIPGPRGLPLIGSMSLMTGLAHRKIAAMAEACNAKRL  102

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TR+I++ +PD A+EIL  S F DRPVKESA  LMF RAIGFAP G YWR LRR
Sbjct  103   MAFSLGQTRVIVTCNPDVAREILNSSVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRR  162

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             ++A H+F P++I   E  RS IA +M+         +  + VR  +   SL N++ SVFG
Sbjct  163   ISAAHLFCPKQIKASESQRSEIASQMVAMFG---FHAQKLRVRDALKRASLNNMMCSVFG  219

Query  690   SCLGLQG-----EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRK--CHRLAGRVN  848
                 L       EEL  +V EGY+L+G+ NW D+ P  +L DF   K +  C  L  +VN
Sbjct  220   RKYDLDSVSEEVEELKSLVDEGYDLLGKLNWSDHLP--WLADFDAQKIRFRCSELVPKVN  277

Query  849   DLVGQII-EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDT  1025
               V +II E R R  +       ++ DF+ VLLSL   D+L+D+D++AVLWEMIFRGTDT
Sbjct  278   RFVTRIISEHRARTGD------KSSPDFVDVLLSLQGADKLSDSDMIAVLWEMIFRGTDT  331

Query  1026  VAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             VA+L+EWI+AR+VLH +VQ+    E+D  VG SR V +SD+  + YL A+VKEVLRLHPP
Sbjct  332   VAVLIEWILARLVLHPEVQSAVHAELDKVVGRSRTVDESDVNEMAYLTAVVKEVLRLHPP  391

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEE  1373
             GPLLSWARLA+ D  +D   +P GT AMV+MW+I+ DP +W DP  F+PERF+    E E
Sbjct  392   GPLLSWARLAITDTMIDGRHVPQGTIAMVDMWSISRDPDVWADPLEFKPERFVAQRGEME  451

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP--SVDLSECLKLS  1547
              S+ GSDLRLAPFGSGRR CPG+ LGL+TV  W+A  L  ++WLP    SVDLSE L+LS
Sbjct  452   FSVFGSDLRLAPFGSGRRTCPGKTLGLTTVTYWVASLLHEYEWLPSDQNSVDLSEVLRLS  511

Query  1548  LEMKKHLAI  1574
              EM K L +
Sbjct  512   CEMAKPLTV  520



>gb|KHN43231.1| Cytochrome P450 78A4 [Glycine soja]
Length=490

 Score =   451 bits (1159),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 246/438 (56%), Positives = 307/438 (70%), Gaps = 27/438 (6%)
 Frame = +3

Query  270   GSHAHRKLASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLL  449
             GS  H  L+ +A +    +LMAFS+G TR +ISS P+TAKEIL    F DRPVKESA  L
Sbjct  67    GSTPHSALSKLARTYHAEKLMAFSIGLTRFVISSEPETAKEILGSPGFADRPVKESAYEL  126

Query  450   MFERAIGFAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfv  629
             +F RA+GFAP G YWR LRR++A H+FSP+RI   E  RS +  +M+ ++ K M E+  V
Sbjct  127   LFHRAMGFAPYGEYWRNLRRISALHLFSPKRITSSESFRSKVGLKMVEQVKKTMSENQHV  186

Query  630   evrgvvgegSLRNVVESVFGSCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGG  809
             EV+ ++   SL NV+ +VFG C               YE         Y   G  L+  G
Sbjct  187   EVKKILHFSSLNNVMMTVFGKC---------------YEF--------YEGEGLELEGLG  223

Query  810   TKRKCHRLAGRVNDLVGQII-EKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLV  986
              +++C  L  +VN  VG +I E R ++  G  +      DF+ VLL L KE++L++AD++
Sbjct  224   VRKRCRCLVEKVNVFVGGVIKEHRVKRERGDCVKDEGAEDFVDVLLDLEKENRLSEADMI  283

Query  987   AVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYL  1166
             AVLWEMIFRGTDTVAIL+EWI+ARMVLH ++QAKAQ EID   G SR V ++DIPNL YL
Sbjct  284   AVLWEMIFRGTDTVAILLEWILARMVLHPEIQAKAQREIDFVCGSSRLVSEADIPNLRYL  343

Query  1167  QAIVKEVLRLHPPGPLLSWARLAVHDVYV-DKCFIPAGTTAMVNMWAITHDPKIWNDPWT  1343
             Q IVKE LR+HPPGPLLSWARLAVHDV V  K  IP GTTAMVNMWAITHD ++W +P  
Sbjct  344   QCIVKETLRVHPPGPLLSWARLAVHDVTVGGKHVIPKGTTAMVNMWAITHDERVWAEPEK  403

Query  1344  FRPERFMEEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP--GPS  1517
             FRPERF+EE+VSIMGSDLRLAPFGSGRRVCPG+ALGL++VHLWLA+ LQ+F W+   G S
Sbjct  404   FRPERFVEEDVSIMGSDLRLAPFGSGRRVCPGKALGLASVHLWLAQLLQNFHWVSSDGVS  463

Query  1518  VDLSECLKLSLEMKKHLA  1571
             V+L E LKLS+EMKK L+
Sbjct  464   VELDEFLKLSMEMKKPLS  481



>gb|AJD25191.1| cytochrome P450 CYP78A115 [Salvia miltiorrhiza]
Length=526

 Score =   452 bits (1162),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 242/479 (51%), Positives = 314/479 (66%), Gaps = 17/479 (4%)
 Frame = +3

Query  162   WVVEGGFAWRNYS---NNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             W   GG AW  Y     N N   + GP   P +G +  M   AHRK+A+ A S G  RLM
Sbjct  44    WSHPGGPAWGAYKWRRRNSNSPPIPGPRGLPVIGSMDLMTGLAHRKIAAAAASCGAKRLM  103

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFSLG TR +++ +P+ A+EIL   +F+DRPVKESA  LMF R+IGFAP G YW  LR+M
Sbjct  104   AFSLGQTRAVVTCNPEVAREILNSGTFSDRPVKESAYHLMFNRSIGFAPYGVYWTALRKM  163

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             AA H+F PR++   E  R  IA ++   +   +   G V VR  +   SL N++ SVFGS
Sbjct  164   AAQHLFCPRQVRAAEKQRLDIANQVAALLAASISGGGGVRVRDALKVASLNNMMCSVFGS  223

Query  693   CLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
               G    EL  +V++GY L+G  NW D+      LD    + +C RL  RVN  V +II+
Sbjct  224   A-GADAAELHDLVEQGYHLLGLINWSDHLSFLADLDLQKIRLRCSRLVPRVNRFVARIIQ  282

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             +RK +  G          FL VLLSL   D+L+D+D++AVLWEMIFRGTDTVA+L+EWI+
Sbjct  283   QRKAEGGGAA--------FLDVLLSLRDPDRLSDSDMIAVLWEMIFRGTDTVAVLMEWIL  334

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWARL  1232
             AR+VLH DVQ+K Q E+D  VG SR V +SD+  L YL A+VKEVLRLHPPGPLLSW+RL
Sbjct  335   ARLVLHPDVQSKVQDELDKVVGRSRAVSESDLTELVYLTAVVKEVLRLHPPGPLLSWSRL  394

Query  1233  AVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSIMGSDLR  1400
             ++ D  VD   +PAGTTA+VNMWAI  DP++W+DP TF P+RF+      + S+ GSDLR
Sbjct  395   SIRDSLVDGYHVPAGTTAIVNMWAIMTDPRVWDDPLTFNPDRFLAPDFNTDFSVFGSDLR  454

Query  1401  LAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKW-LPGPSVDLSECLKLSLEMKKHLAI  1574
             +APFGSGRR CPG+ALG++TV+ W+A  LQ F++   G  VDLSE L+LS EM   L +
Sbjct  455   IAPFGSGRRSCPGKALGMTTVNFWVATLLQQFQFHSSGQRVDLSELLRLSCEMANPLVV  513



>ref|XP_004309538.1| PREDICTED: cytochrome P450 78A3-like [Fragaria vesca subsp. vesca]
Length=532

 Score =   452 bits (1163),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 238/490 (49%), Positives = 312/490 (64%), Gaps = 25/490 (5%)
 Frame = +3

Query  159   FWVVEGGFAW-------RNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMG  317
             FW   GG AW        ++    NP  + GP  +P LG +  M   AHR L   A   G
Sbjct  43    FWAFPGGPAWGKHHWKKTDHQMTNNP--IPGPRGFPILGSMSLMAKLAHRNLTKAADQFG  100

Query  318   LNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWR  497
               RLMAFSLG +R+II+ +P+ AKEIL  S F DRP+KESA  LMF R+IGFAP G YW 
Sbjct  101   ARRLMAFSLGDSRVIITCNPEVAKEILHSSVFADRPIKESAYSLMFNRSIGFAPYGMYWT  160

Query  498   QLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVE  677
              LRR+A+ H+F P++I   E  R  +A EM+  +      +    VR V+   SL N++ 
Sbjct  161   TLRRIASTHLFCPKQICASEPQRFQLAAEMVSIVAARGSNARKFCVRDVLRRASLNNMMC  220

Query  678   SVFGSC-----LGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGR  842
             SVFG       L  + EEL  +V+EGY+L+G+ NW D+ P    LD    + +C +L  R
Sbjct  221   SVFGRKYELGELNKETEELSQLVQEGYDLLGKLNWSDHLPWLAGLDLQSIRHRCSKLVPR  280

Query  843   VNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTD  1022
             VN  V +II++ +      E   +N+ DF+ VLLSL   ++L+D D++AVLWEMIFRGTD
Sbjct  281   VNSFVSRIIKEHR-----AETGRHNHNDFVDVLLSLQGPEKLSDHDMIAVLWEMIFRGTD  335

Query  1023  TVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHP  1202
             TVA+L+EWI+ARMVLH D+Q+K   E+D  VG SR + ++DI  + YL A++KEVLRLHP
Sbjct  336   TVAVLIEWILARMVLHPDIQSKVHAELDRVVGKSRPLTETDIHAMVYLPAVIKEVLRLHP  395

Query  1203  PGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEE---  1373
             PGPLLSWARLA+ D  VD   +PAGTTAMVNMWAI   P++W+DP  F PERF+  +   
Sbjct  396   PGPLLSWARLAITDTVVDGYHVPAGTTAMVNMWAIMRSPQVWSDPLEFSPERFVSSKESA  455

Query  1374  ---VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKL  1544
                 S++GSDLRLAPFGSGRR CPG++LGL+ V  W+   L  F+W    +VDLSE LKL
Sbjct  456   DVSFSVLGSDLRLAPFGSGRRSCPGKSLGLAMVSFWVGSLLHEFEWKRAEAVDLSEVLKL  515

Query  1545  SLEMKKHLAI  1574
             S EM   L +
Sbjct  516   SCEMANPLTV  525



>ref|XP_004248458.1| PREDICTED: cytochrome P450 78A6-like [Solanum lycopersicum]
Length=525

 Score =   452 bits (1162),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 237/487 (49%), Positives = 320/487 (66%), Gaps = 26/487 (5%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQ---NPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLN  323
             M +W   GG AW  ++  +   NP  + GP  +P +G +  M   AH K+A +A ++  +
Sbjct  41    MIYWAHPGGPAWGKHTWKKLRSNP--IPGPKGFPIIGSMNLMSGLAHHKIAKIAKTLKAS  98

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RLM FSLG TR+I++ +P+ AKEIL  S F DRP+KESA  LMF RAIGFA  G YWR L
Sbjct  99    RLMCFSLGETRVIVTCNPEVAKEILNSSVFADRPIKESAYRLMFNRAIGFASYGVYWRTL  158

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             R++++NH+FSP++I   E  R  IA+++I   +K    +  + VR  +   SL N++  V
Sbjct  159   RKISSNHLFSPKQIKFYEKPRFQIAKQLISMFEKN-SPNDILRVRDGLKLASLNNMMCCV  217

Query  684   FG-----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             FG      C  L+ +EL  +V EGYEL+G  NW D+       D    K++C  L  +VN
Sbjct  218   FGKSYDFDCCNLETKELMKLVDEGYELLGMLNWSDHISWLGEFDLQRIKQRCSELVPKVN  277

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               V +I+++          +VN + DF+ VLLSL   ++L++ D++AVLWEMIFRGTDTV
Sbjct  278   KFVKKILDE----------HVNQSGDFVDVLLSLQGSERLSENDMIAVLWEMIFRGTDTV  327

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             A+LVEWI+ARM LH D+Q+K Q+EID  VG SR + +SD+  + YL A+VKEVLRLHPPG
Sbjct  328   AVLVEWILARMTLHPDIQSKVQVEIDRIVGQSRTMTESDVSEMIYLPAVVKEVLRLHPPG  387

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE-----E  1373
             PLLSWARLA+ D  +D   +PAGTTAMVNMWAIT D  +W DP  F+PERF+ E     +
Sbjct  388   PLLSWARLAITDTIIDGYHVPAGTTAMVNMWAITRDADVWADPLIFKPERFLNEAHSDMD  447

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLE  1553
              S++GSD+RLAPFGSGRR CPG+ LGL+TV  W+A  L  F++ P  +VDLSE LKLS E
Sbjct  448   FSVLGSDMRLAPFGSGRRSCPGKTLGLTTVTYWVATLLHEFEFGPSSNVDLSEVLKLSCE  507

Query  1554  MKKHLAI  1574
             M   L +
Sbjct  508   MAHPLKV  514



>emb|CDO33954.1| cyp450 [Hordeum vulgare]
Length=567

 Score =   453 bits (1166),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 248/490 (51%), Positives = 317/490 (65%), Gaps = 27/490 (6%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKK--LNGPMSWPFLGFLPQMGSHAHRKLASMATSMG--LNRL  329
             W   GG AW  +   +  K   L GP   P +G +  M   AHRKLA+ A  +G    RL
Sbjct  77    WCFPGGAAWGRWWLTRRLKGSLLPGPRGLPLIGSMWLMTGLAHRKLAAEAARLGGRAKRL  136

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TRM++++HPD A+EIL   +F DRP+KESA  L+F RAIGFAP G+YWR LRR
Sbjct  137   MAFSLGETRMVVAAHPDVAREILNSPAFADRPIKESAYGLLFHRAIGFAPHGAYWRALRR  196

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +A+ H+FSP +I      R+ IA +M+  +   +G    VEVR V+   SL NV+ SVFG
Sbjct  197   VASTHLFSPWQITASAPQRAVIASQMVTAL---VGAGAGVEVRRVLRRASLHNVMWSVFG  253

Query  690   SCLGLQG-------EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
                 L          EL  +V EGY+L+G+ NW D+ P     D  GT+ +C  L  RVN
Sbjct  254   RRYDLDSNKESEEVRELSHLVDEGYDLLGQLNWSDHLPWLARFDLQGTRARCSGLVPRVN  313

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               V +II+  +       +      DF  VLLSL   D+LADAD++AVLWEM+FRGTDTV
Sbjct  314   RFVRRIIDDHRSAAASAGVK-----DFTDVLLSLQGGDKLADADMIAVLWEMVFRGTDTV  368

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             A+L+EW++AR+VLH+DVQA+   E+D  VG  R V +SD  +L YL A++KE LR+HPPG
Sbjct  369   AVLMEWVLARLVLHRDVQARVHEELDRVVGRDRAVDESDAASLAYLHAVIKETLRVHPPG  428

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME----EEV  1376
             PLLSWARLA  DV VD   IPAGTTAMVNMWAITHDP +W +P  FRPERF+E     E+
Sbjct  429   PLLSWARLATSDVRVDGFLIPAGTTAMVNMWAITHDPDVWAEPEEFRPERFVEGQPAAEL  488

Query  1377  SIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSECLKL  1544
             S+MGSDLRLAPFG+GRR CPG++L ++TV  WLA  L   ++LP P     V+L E L+L
Sbjct  489   SVMGSDLRLAPFGAGRRSCPGKSLAMATVAFWLATLLHELEFLPSPDPAGGVNLGETLRL  548

Query  1545  SLEMKKHLAI  1574
             S EM   LA+
Sbjct  549   SCEMAAPLAV  558



>ref|XP_010100687.1| Cytochrome P450 78A3 [Morus notabilis]
 gb|EXB83849.1| Cytochrome P450 78A3 [Morus notabilis]
Length=532

 Score =   452 bits (1163),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 249/486 (51%), Positives = 325/486 (67%), Gaps = 22/486 (5%)
 Frame = +3

Query  159   FWVVEGGFAWR--NYSNNQNPKKL-NGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRL  329
             +W   GG AW    + ++Q+ K +  GP   PF+G +  M S AHR+LA+ A+S+G  RL
Sbjct  42    YWAHPGGPAWGYFRFRHHQHRKPIIPGPRGLPFVGSMGLMASLAHRRLAAAASSLGAKRL  101

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TR +++ HPD AKEIL  + F DRPVKESA  LMF RAIGFAP G YWR LRR
Sbjct  102   MAFSLGETRAVVTCHPDVAKEILNSAVFADRPVKESAYKLMFNRAIGFAPYGVYWRTLRR  161

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +AANH+F P++I   E  R  IA++M+  + K    +    VRG++   SL N++ SVFG
Sbjct  162   IAANHLFCPKQIKSSENQRRQIADQMVQNLIKN--STSSFSVRGILKRASLNNMMWSVFG  219

Query  690   SCLGLQG-----EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
                G++      EE+  +V+EGYEL+G  NW D+ P     D      +C RL  +VN  
Sbjct  220   QMYGIEETINEVEEVRGLVEEGYELLGVLNWSDHLPWAAEFDAQRIGFRCSRLVPKVNRF  279

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             VG I+ + +R+      N  +  DF+ VLLSL   D+L+D+D++AVLWEMIFRGTDTVA+
Sbjct  280   VGGIVAEHRRK------NGESGNDFVDVLLSLNGPDKLSDSDMIAVLWEMIFRGTDTVAV  333

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EWI+AR++LH D+Q+    E+D  VG SR V +SD+  L YL A++KEVLRLHPPGPL
Sbjct  334   LIEWILARVILHPDIQSTVHDELDRVVGRSRSVSESDMSELVYLTAVIKEVLRLHPPGPL  393

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSI  1382
             LSWARLA+ D  +D   +P GTTAMVNMWAI+ DP+ W DP  ++P+RFM    E E S+
Sbjct  394   LSWARLAITDTTIDGYLVPKGTTAMVNMWAISRDPEFWVDPLEYKPQRFMTKENEPEFSV  453

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPG--PSVDLSECLKLSLEM  1556
              GSDLRLAPFGSGRR CPG+ LGL+TV  W+A  L  F+WLP    SVDLSE L+LS EM
Sbjct  454   FGSDLRLAPFGSGRRTCPGKTLGLTTVAFWVASLLHEFEWLPDGQNSVDLSEVLRLSCEM  513

Query  1557  KKHLAI  1574
                L +
Sbjct  514   ANPLTV  519



>gb|EEC82405.1| hypothetical protein OsI_26780 [Oryza sativa Indica Group]
Length=525

 Score =   452 bits (1162),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 237/444 (53%), Positives = 310/444 (70%), Gaps = 11/444 (2%)
 Frame = +3

Query  270   GSHAHRKLASMATSM-GLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKL  446
             G  AHR LA M+ ++ G   +M+ S+G TR++++S P+TA+EIL   +F DRPVK++A+ 
Sbjct  74    GPAAHRVLAGMSRAVEGGAAVMSLSVGLTRLVVASRPETAREILVSPAFGDRPVKDAARQ  133

Query  447   LMFERAIGFAPSG-SYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesg  623
             L+F RA+GFAPSG ++WR LRR++A H+F PRR+A     R AI   ++G +   M   G
Sbjct  134   LLFHRAMGFAPSGDAHWRGLRRVSAAHLFGPRRVAGSAPEREAIGARIVGDVASLMSRRG  193

Query  624   fvevrgvvgegSLRNVVESVFGSCLG----LQGEELGLMVKEGYELIGEFNWGDYFPLGF  791
              V +R V+   SL +V+ +VFG   G      GE L  MV EGY+L+G+FNW D+ PL  
Sbjct  194   EVPLRRVLHAASLDHVMATVFGKRHGDLSIQDGELLEEMVTEGYDLLGKFNWADHLPLLR  253

Query  792   LLDFGGTKRKCHRLAGRVNDLVGQIIE--KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQ  965
              LD  G +R+C+RL  +V   VG+II+  K KR   G+ +      DF+ VLL L  E++
Sbjct  254   WLDLQGIRRRCNRLVQKVEVFVGKIIQEHKAKRAAGGVAVADGVLGDFVDVLLDLQGEEK  313

Query  966   LADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRH-VQDS  1142
             ++D+D++AVLWEMIFRGTDTVAIL+EW+MARMV+H ++QAKAQ E+D  VG  R  V D 
Sbjct  314   ISDSDMIAVLWEMIFRGTDTVAILMEWVMARMVMHPEIQAKAQAEVDAAVGGRRGGVADG  373

Query  1143  DIPNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPK  1322
             D+ +LPY+Q+IVKE LR+HPPGPLLSWARLAVHD  V    +PAGTTAMVNMWAI HD  
Sbjct  374   DVASLPYIQSIVKETLRMHPPGPLLSWARLAVHDARVGGHAVPAGTTAMVNMWAIAHDAA  433

Query  1323  IWNDPWTFRPERFME-EEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFK  1499
             +W +P  FRPERF E E+V ++G DLRLAPFG+GRRVCPGR L L+T HLWLA+ L  F 
Sbjct  434   VWPEPEAFRPERFSEGEDVGVLGGDLRLAPFGAGRRVCPGRMLALATAHLWLAQLLHAFD  493

Query  1500  WLP-GPSVDLSECLKLSLEMKKHL  1568
             W P    VDLSE L +SLEM   L
Sbjct  494   WSPTAAGVDLSERLGMSLEMAAPL  517



>ref|XP_009138745.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 78A9-like [Brassica 
rapa]
Length=562

 Score =   453 bits (1165),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 243/489 (50%), Positives = 315/489 (64%), Gaps = 23/489 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNY--SNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRL  329
             +W   GG AW  Y          + GP   PF+G +  M +  AHR +A+ A   G  RL
Sbjct  70    YWSHPGGPAWGKYFLHRRHRTTVIPGPRGLPFVGSMSLMSNALAHRCIAATAEKFGAKRL  129

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR LRR
Sbjct  130   MAFSLGDTRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRR  189

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesg-fvevrgvvgegSLRNVVESVF  686
             +A+ H+FSP++I   E  R  IA +++  ++K+   +      R ++   SL + + SVF
Sbjct  190   IASYHLFSPKQIKRSETQRRVIANQIVKCLEKQSSGNEGLCFARDLIKTASLNSXMCSVF  249

Query  687   GSCLGLQGE-----ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVND  851
             G    L+ E     EL  +V+EGY+L+G  NW D+ P     D  G + +C  L  +VN 
Sbjct  250   GKEYELEHEHDEVNELRGLVEEGYDLLGTLNWTDHLPWLSEFDPQGIRSRCFSLVPKVNR  309

Query  852   LVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVA  1031
              V +II   + Q        ++ +DF+ VLLSL   ++L+D D+VAVLWEMIFRGTDTVA
Sbjct  310   FVNRIISDHRDQTR------DSPSDFVDVLLSLDGPNKLSDPDMVAVLWEMIFRGTDTVA  363

Query  1032  ILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGP  1211
             +L+EWI+ARMV HQD+Q     E+D  VG SR V++SD+ +L YL A++KEVLRLHPPGP
Sbjct  364   VLIEWILARMVFHQDIQTTVHNELDQVVGRSRAVEESDVASLTYLTAVIKEVLRLHPPGP  423

Query  1212  LLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEE----VS  1379
             LLSWARLA+ D  +D   +PAGTTAMVNMWAI HDP +W +P  F PERF+ +E     S
Sbjct  424   LLSWARLAITDTIIDGRRVPAGTTAMVNMWAIAHDPHVWENPLEFEPERFVAKEGDVDFS  483

Query  1380  IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSECLKLS  1547
             ++GSDLRLAPFGSGRRVCPG+ LGL+TV  W+A  L  F+WL   S    VDLSE L+LS
Sbjct  484   VLGSDLRLAPFGSGRRVCPGKNLGLTTVTFWIATLLHEFEWLAPSSDDKTVDLSEKLRLS  543

Query  1548  LEMKKHLAI  1574
              EM   LA+
Sbjct  544   CEMANPLAV  552



>emb|CDX71698.1| BnaC08g31760D [Brassica napus]
Length=532

 Score =   452 bits (1162),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 243/488 (50%), Positives = 322/488 (66%), Gaps = 22/488 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKK--LNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRL  329
             +W   GG AW  Y  ++  +   + GP   PF G +  M +  AHR +A+ A   G  RL
Sbjct  44    YWSHPGGPAWGKYFLHRRHRTAVIPGPRGLPFFGSMSLMSNALAHRCIAAAAEKFGAKRL  103

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             +AFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR LR+
Sbjct  104   LAFSLGDTRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFSRAIGFAPYGVYWRTLRK  163

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfv-evrgvvgegSLRNVVESVF  686
             +A++H+FSP++I   E  R  IA +++  ++K+   +  +   R ++   SL N++ SVF
Sbjct  164   IASSHLFSPKQIKRSETQRRVIANQIVKCLEKQSSGNEGLCFARDLIKTASLNNMMCSVF  223

Query  687   GSCLGLQGE-----ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVND  851
             G    L+ E     EL  +V+EGY+L+G  NW D+ P     D    + +C  L  +VN 
Sbjct  224   GKEYELEHEHDEVNELRGLVEEGYDLLGTLNWTDHLPWLSEFDPQRIRSRCSNLVPKVNR  283

Query  852   LVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVA  1031
              V +II   + Q        ++ +DF+ VLLSL  +D+L+D D+VAVLWEMIFRGTDTVA
Sbjct  284   FVNRIISDHRDQTR------DSPSDFVDVLLSLDGQDKLSDPDMVAVLWEMIFRGTDTVA  337

Query  1032  ILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGP  1211
             +L+EWI+ARMVLH D+Q+    E+D  VG SR V++SD+ +L YL A+VKEVLRLHPPGP
Sbjct  338   VLIEWILARMVLHPDIQSMVHNELDQNVGRSRAVEESDVASLTYLTAVVKEVLRLHPPGP  397

Query  1212  LLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVS  1379
             LLSWARLA+ D  +D   +PAGTTAMVNMWAI HDP++W +P  F+P RF+    E E S
Sbjct  398   LLSWARLAITDTIIDGRRVPAGTTAMVNMWAIAHDPQVWENPLEFKPARFVAKEGEVEFS  457

Query  1380  IMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP---GPSVDLSECLKLSL  1550
             ++GSDLRLAPFGSGRRVCPG+ LGLSTV  W+A  L  F+WL      +VDLSE L+LS 
Sbjct  458   VLGSDLRLAPFGSGRRVCPGKNLGLSTVMYWIATLLHEFEWLAPTGEKTVDLSEKLRLSC  517

Query  1551  EMKKHLAI  1574
             EM   LA+
Sbjct  518   EMANPLAV  525



>ref|XP_002310601.1| hypothetical protein POPTR_0007s06570g [Populus trichocarpa]
 gb|EEE91051.1| hypothetical protein POPTR_0007s06570g [Populus trichocarpa]
Length=534

 Score =   452 bits (1162),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 244/474 (51%), Positives = 311/474 (66%), Gaps = 15/474 (3%)
 Frame = +3

Query  174   GGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRLMAFSLGT  350
             GG AW+N  N +  + + GP   P  G L  +    AHR LASMA      +LMAFSLG+
Sbjct  52    GGIAWKNGRNRKGHRSIPGPRGLPIFGSLFTLSRGLAHRTLASMAWRRANTQLMAFSLGS  111

Query  351   TRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHMF  530
             T ++++S P  A+EIL    F DRP+K+SAK LMF RAIGFAPSG+YWR LRR+A+ H+F
Sbjct  112   TPVVVASDPHIAREILTSPYFADRPIKQSAKSLMFSRAIGFAPSGAYWRLLRRIASTHLF  171

Query  531   SPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGSCLGLQG  710
             SPRRI   E +R   +  M+  +  E   +GFV +R  +   SL N++ SVFG    +  
Sbjct  172   SPRRILAHESLRQLESTTMLRNITNEQRRNGFVTLRKHLQFASLNNIMGSVFGKTYDMSQ  231

Query  711   -----EELGLMVKEGYELIGEFNWGDYFP-LGFLLDFGGTKRKCHRLAGRVNDLVGQIIE  872
                  EEL  MV EG+EL+G FNW DY   L +  D    +++C +L  RV  LV  IIE
Sbjct  232   DRQELEELRDMVSEGFELLGAFNWCDYLTWLNYFYDPFRIQKRCSKLVPRVRKLVKDIIE  291

Query  873   KRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEWIM  1052
             + +    G    V ++ DF+ VLLSL  E++L D D+VAVLWEMIFRGTDT A+L EW+M
Sbjct  292   EHRLGEPG---KVGDDGDFVDVLLSLEGEEKLQDDDMVAVLWEMIFRGTDTTALLTEWVM  348

Query  1053  ARMVLHQDVQAKAQLEIDTCVGPSR--HVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWA  1226
             A +VLH +VQ K + E+D  V       + DS++  LPYLQA+VKE LR+HPPGPLLSWA
Sbjct  349   AELVLHTEVQEKLRRELDMAVKDRSLSELTDSEVSKLPYLQAVVKEALRVHPPGPLLSWA  408

Query  1227  RLAVHDVYV-DKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEEEVSIMGSDLRL  1403
             RL   DV + +   IPA TTAMVNMWAITHDP +W DP  F+PERF+E +V + G DLRL
Sbjct  409   RLCSSDVQLSNGMVIPADTTAMVNMWAITHDPHVWEDPLEFKPERFIEADVDVRGGDLRL  468

Query  1404  APFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMK  1559
             APFG+GRRVCPG+ LGL TV LW+A+ + HFKW+      VDLSE LKLS EMK
Sbjct  469   APFGAGRRVCPGKNLGLVTVTLWVAKLVHHFKWVHDGEHPVDLSEVLKLSCEMK  522



>ref|XP_010100198.1| Cytochrome P450 78A3 [Morus notabilis]
 gb|EXB81869.1| Cytochrome P450 78A3 [Morus notabilis]
Length=561

 Score =   452 bits (1164),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 250/509 (49%), Positives = 321/509 (63%), Gaps = 39/509 (8%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQNPKK----------------LNGPMSWPFLGFLPQMGSHAHRK  290
             +W   GG AW  Y  N   +K                + GP  +P LG L  M + AHR+
Sbjct  44    YWAHPGGPAWGRYRWNNGGRKRKITPTANVAAITNPTIPGPRGFPILGSLHLMANLAHRR  103

Query  291   LASMATSMGLNRLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIG  470
             LAS A   G  RLMA SLG TR++I+S PD A+EIL  S+F DRP+KESA  LMF RAIG
Sbjct  104   LASAAAQFGSKRLMACSLGETRVVITSDPDVAREILNSSAFADRPIKESAYSLMFNRAIG  163

Query  471   FAPSGSYWRQLRRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfve------  632
             FAP G YWR LRR+AA H+FSP++I+  E  R  IA++M+  +   +     +       
Sbjct  164   FAPYGVYWRTLRRIAATHLFSPKQISASETQRFRIADQMVAMIKNNIACDYDIHDDHDRG  223

Query  633   ---vrgvvgegSLRNVVESVFGSCLGL-----QGEELGLMVKEGYELIGEFNWGDYFPLG  788
                VR V+ + SL N++ SVFG    L        EL  +V+EGY+L+G+ NW D+ P  
Sbjct  224   RFCVRDVLKQASLHNMMGSVFGREYELGSWNADSNELSRLVEEGYKLLGKLNWSDHLPWI  283

Query  789   FLLDFGGTKRKCHRLAGRVNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQL  968
               LD    + +C +L  +VN  V +II++ +        N ++  DF+ VLLSL   D++
Sbjct  284   GSLDLQRIRFRCSQLVPKVNRFVSRIIQEHRANNNNSGGNNHH--DFVDVLLSLHGPDKI  341

Query  969   ADADLVAVLWEMIFRGTDTVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDI  1148
             +D D++AVLWEMIFRGTDTVA+L+EWI+ARMVLH D+Q+K   E+D  VG SR + +SDI
Sbjct  342   SDHDMIAVLWEMIFRGTDTVAVLIEWILARMVLHPDIQSKVHDELDRVVGRSRPLTESDI  401

Query  1149  PNLPYLQAIVKEVLRLHPPGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIW  1328
                 YL A+VKEVLRLHPPGPLLSWARLA+ D  VD   +PAGTTAMVNMWAIT DP +W
Sbjct  402   AATVYLPAVVKEVLRLHPPGPLLSWARLAIIDTVVDCYHVPAGTTAMVNMWAITRDPHVW  461

Query  1329  NDPWTFRPERFMEE-----EVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQH  1493
              DP  F+PERF+       E S+MGSDLRLAPFGSGRR CPG+ALGL+TV  W+   L  
Sbjct  462   PDPLEFKPERFVSRRESDVEFSVMGSDLRLAPFGSGRRACPGKALGLATVTFWVGTLLHE  521

Query  1494  FKWLPGPS--VDLSECLKLSLEMKKHLAI  1574
             F+W+      VDLSE L+LS EM   LA+
Sbjct  522   FEWVGSARNPVDLSEVLRLSCEMANPLAV  550



>ref|XP_004140614.1| PREDICTED: cytochrome P450 78A3-like [Cucumis sativus]
Length=509

 Score =   451 bits (1159),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 237/478 (50%), Positives = 312/478 (65%), Gaps = 31/478 (6%)
 Frame = +3

Query  159   FWVVEGGFAW--RNYSNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLNRLM  332
             +W   GG AW  R  S+   P    GP  +P +G +  M   AH+K+AS+A S+   RLM
Sbjct  45    YWAHPGGPAWGRRRRSSALIP----GPRGFPVIGSMNLMTGLAHQKIASVAKSLQATRLM  100

Query  333   AFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRM  512
             AFSL  TR+I++ HPD AK+IL  S F DRP+KESA  LMF RAIGFAP G YWR LRR+
Sbjct  101   AFSLANTRVIVTCHPDVAKDILNSSVFADRPIKESAYSLMFNRAIGFAPYGVYWRTLRRI  160

Query  513   AANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS  692
             A+ H+FSP++I   E  R  IA +++  +      S    +R  +   SL +++ SVFG 
Sbjct  161   ASQHLFSPKQIKSSESQRRQIASQLVKILSSTATSSTHHRIRQTLKTASLNSMMGSVFGR  220

Query  693   CLGLQG-----EELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRK--CHRLAGRVND  851
                L       E L  +V EGY+L+G  NW D+ P  FL DF   + +  C RL  +VN+
Sbjct  221   FYNLSDSNPEVELLQSLVDEGYDLLGLLNWSDHLP--FLGDFDPQRIRFRCSRLVPKVNN  278

Query  852   LVGQIIEKRKRQFEGIEINVNNNT-DFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
              V +II++ ++       N N  T DF+ VLLSL + + L+D+D+++VLWEMIFRGTDTV
Sbjct  279   FVTRIIDEHRQ-------NSNRETMDFVDVLLSLQQNENLSDSDIISVLWEMIFRGTDTV  331

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             A+L+EWI+ARMV+H+DVQ K + E+D  VG SR V +SDIP+L YL A+VKEVLRLHPPG
Sbjct  332   AVLIEWILARMVVHEDVQKKVEEELDNVVGKSRAVMESDIPSLVYLTAVVKEVLRLHPPG  391

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM--------  1364
             PLLSWAR+A+ D  +D   +P GTTAMVNMW+I  DP+IW+DP  F PERF+        
Sbjct  392   PLLSWARIAITDTTIDGYHVPRGTTAMVNMWSIARDPQIWSDPLEFMPERFLSAGPGGGG  451

Query  1365  EEEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECL  1538
             + E SIMGSDLRLAPFGSGRR CPG+AL  +TV  W+A  L  FKW+P   + + + L
Sbjct  452   DVEFSIMGSDLRLAPFGSGRRTCPGKALAWTTVTFWVATLLHEFKWIPSIKLKMMKLL  509



>gb|EMS50564.1| Cytochrome P450 78A3 [Triticum urartu]
Length=549

 Score =   452 bits (1162),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 241/497 (48%), Positives = 317/497 (64%), Gaps = 34/497 (7%)
 Frame = +3

Query  162   WVVEGGFAWRNY-----SNNQNPKKLNGPMSWPFLGFLPQMGSHAHRKLASMAT-SMGLN  323
             W  +GG AW  Y            ++ GP  +P +G +  M   AHRKLA+ A+ ++   
Sbjct  49    WASQGGAAWGRYWWTSKGLGIGEARIAGPRGFPVIGSMGLMTGLAHRKLAAAASGNVRRR  108

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RLMAFS+G TR+++++ PD A+E+L   +F DRPVKESA  LMF RAIGFAP G+YWR L
Sbjct  109   RLMAFSMGETRVVVTADPDVARELLASPAFADRPVKESAYGLMFHRAIGFAPYGAYWRTL  168

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDK-EMgesgfvevrgvvgegSLRNVVES  680
             RR++++H+FSPRR+A     R+ IA +M+  M          VE R  +   SL NV+ S
Sbjct  169   RRVSSSHLFSPRRVAASAAQRAVIARQMVDAMRPVGGAGVKHVEARRFLKRASLHNVMWS  228

Query  681   VFGSCLGL------QGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGR  842
             VFG    L      +  EL  +V EGY+L+G+ NW D+ P     D    + +C  L  R
Sbjct  229   VFGRGYELDEAGSGEAAELKSLVDEGYDLLGQLNWSDHLPWLARFDLQKIRSRCSALVPR  288

Query  843   VNDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTD  1022
             VN  VG+II++ +          +   DF  VLLSL   D+L+DAD++AVLWEMIFRGTD
Sbjct  289   VNRFVGRIIDEHR------AARNDAVVDFTDVLLSLQGGDKLSDADMIAVLWEMIFRGTD  342

Query  1023  TVAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHP  1202
             TVA+++EW++AR+VLHQDVQA+   E+D  VGP+R V +SD  +L +LQA+VKEVLRLHP
Sbjct  343   TVAVVIEWVLARLVLHQDVQARVHEELDRVVGPNRAVTESDAGSLVFLQAVVKEVLRLHP  402

Query  1203  PGPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFME-----  1367
             PGPLLSWARLA  DV+V    +PAGTTAMVNMWAITHDP +W+ P  F+PERF+      
Sbjct  403   PGPLLSWARLATSDVHVGGLLVPAGTTAMVNMWAITHDPAVWDKPAVFKPERFLAGPSSD  462

Query  1368  -----EEVSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS-----  1517
                   E  + GSDLRLAPFGSGRR CPG++L ++T+  W+A  L  F+W P  S     
Sbjct  463   HAAAGAEFFVTGSDLRLAPFGSGRRSCPGKSLAIATIGFWVATLLHEFEWTPPASNRPGG  522

Query  1518  VDLSECLKLSLEMKKHL  1568
             VDLSE L+LS EM   L
Sbjct  523   VDLSEVLRLSCEMAAPL  539



>ref|XP_006362126.1| PREDICTED: cytochrome P450 78A6-like isoform X1 [Solanum tuberosum]
Length=525

 Score =   451 bits (1159),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 237/487 (49%), Positives = 318/487 (65%), Gaps = 26/487 (5%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQ---NPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLN  323
             M +W   GG AW  +   +   NP  + GP  +P +G +  M   AH K+A MA ++  +
Sbjct  41    MIYWAHPGGPAWGKHIWKKLVSNP--IPGPKGFPIIGSMNLMTGLAHHKIAKMAKTLKAS  98

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RLM FSLG TR+I++ +P+ AKEIL  S F DRP+KESA  LMF RAIGFA  G YWR L
Sbjct  99    RLMCFSLGETRVIVTCNPEVAKEILNSSVFADRPIKESAYRLMFNRAIGFASYGVYWRTL  158

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             R++++NH+FSP++I   E  R  IA+++I   +K    +  + VR  +   SL N++  V
Sbjct  159   RKISSNHLFSPKQIKIYEKPRFQIAKQLISMFEKN-SPNDILRVRDGLKLASLNNMMCCV  217

Query  684   FG-----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             FG      C  L+ +EL  +V EGYEL+G  NW D+       D    K++C  L  +VN
Sbjct  218   FGKSYDFDCCNLETKELMKLVDEGYELLGMLNWSDHISWLGEFDLQRIKQRCSELVPKVN  277

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               V +I+++          ++N + DF+ VLLSL   ++L++ D++AVLWEMIFRGTDTV
Sbjct  278   KFVKKILDE----------HMNQSGDFVDVLLSLQGSERLSENDMIAVLWEMIFRGTDTV  327

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
              ILVEWI+ARM LH D+Q+K Q+EID  VG SR + +SD+  + YL A++KEVLRLHPPG
Sbjct  328   TILVEWILARMTLHPDIQSKVQVEIDRIVGQSRTMTESDVSKMIYLPAVIKEVLRLHPPG  387

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE-----E  1373
             PLLSWARLA+ D  +D   +PAGTTAMVNMWAIT D  +W DP  F+PERF+ E     +
Sbjct  388   PLLSWARLAITDTTIDGYQVPAGTTAMVNMWAITRDADVWADPLMFKPERFLNEAHSDMD  447

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLE  1553
              S++GSD+RLAPFGSGRR CPG+ LGL+TV  W+A  L  FK+ P  +VDLSE LKLS E
Sbjct  448   FSVLGSDMRLAPFGSGRRSCPGKTLGLTTVTYWVATLLHEFKFGPSSNVDLSEVLKLSCE  507

Query  1554  MKKHLAI  1574
             M   L +
Sbjct  508   MAHPLKV  514



>ref|XP_006473879.1| PREDICTED: cytochrome P450 78A7-like [Citrus sinensis]
Length=545

 Score =   451 bits (1161),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 239/481 (50%), Positives = 322/481 (67%), Gaps = 18/481 (4%)
 Frame = +3

Query  171   EGGFAWRNYSNNQNPKKLNGPMSWPFLGFLPQMG-SHAHRKLASMATSMGLNRLMAFSLG  347
              GG AW+N         + G    P +G L  +    AHR LA MA +    +LMA SLG
Sbjct  53    SGGLAWKNGRTQMGRIPIPGHRGLPLVGSLFGLSLGLAHRTLACMAYNQATKKLMALSLG  112

Query  348   TTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRRMAANHM  527
             +  ++++S P  A+E+L    F +RP+K+SAK LMF RAIGFAP+GSYWR LRR+A+ H+
Sbjct  113   SAPLVVTSDPVIARELLTSPHFANRPIKQSAKSLMFSRAIGFAPNGSYWRLLRRIASTHL  172

Query  528   FSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFGS-----  692
             FSP+RIA  E  R      M+  + KE   SGFV +R  +   SL N++ +VFG      
Sbjct  173   FSPKRIAAHESGRQLDCFAMLNAIAKEQSISGFVVLRNHLQVASLNNIMGTVFGKRFDAA  232

Query  693   -CLGLQGEELGLMVKEGYELIGEFNWGDYFP-LGFLLDFGGTKRKCHRLAGRVNDLVGQI  866
               L  + +EL  +V+EG+E++G FNW DY P L F  D    K +C  L  RV DLV QI
Sbjct  233   MQLSDEAKELHEIVREGFEILGAFNWSDYLPWLNFFYDPFRIKERCSVLVPRVKDLVKQI  292

Query  867   IEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAILVEW  1046
             I  ++RQ    + ++++N+DF+ VLLSL  +++L + D+VAVLWEMIFRGTDT AIL EW
Sbjct  293   I--KERQLNKDKSSLSDNSDFVDVLLSLDGDEKLNEDDMVAVLWEMIFRGTDTTAILTEW  350

Query  1047  IMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPLLSWA  1226
             +MA M+L+ +VQ K Q E+D  VG ++ + D+D+  LPYLQA++KE LRLHPPGPLLSWA
Sbjct  351   VMAEMILNPNVQTKLQRELDLVVG-NKTLTDADVAKLPYLQAVIKETLRLHPPGPLLSWA  409

Query  1227  RLAVHDVYV-DKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE----EVSIMGS  1391
             RL+  DV++ +   IPA TTAMVNMWAITHDP +W++PW F+PERF +     +V + G+
Sbjct  410   RLSTSDVHLSNDMVIPANTTAMVNMWAITHDPNVWDEPWVFKPERFSKSHGGTDVDVRGN  469

Query  1392  DLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS--VDLSECLKLSLEMKKH  1565
             DLRLAPFG+GRRVCPG+ LGL TV LW+A+ +Q F+W+   +  VDL+E LKLS EMK  
Sbjct  470   DLRLAPFGAGRRVCPGKNLGLVTVSLWVAKLVQQFEWVQAEAHLVDLTELLKLSCEMKNP  529

Query  1566  L  1568
             L
Sbjct  530   L  530



>ref|NP_191747.1| cytochrome p450 78a9 [Arabidopsis thaliana]
 sp|Q9SLP1.1|C78A9_ARATH RecName: Full=Cytochrome P450 78A9 [Arabidopsis thaliana]
 dbj|BAA88569.1| cytochrome P450 [Arabidopsis thaliana]
 emb|CAB71895.1| cytochrome p450 (CYP78A9) [Arabidopsis thaliana]
 gb|AAL32826.1| cytochrome p450 (CYP78A9) [Arabidopsis thaliana]
 gb|AAP68330.1| At3g61880 [Arabidopsis thaliana]
 gb|AEE80273.1| cytochrome p450 78a9 [Arabidopsis thaliana]
Length=534

 Score =   451 bits (1160),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 245/486 (50%), Positives = 315/486 (65%), Gaps = 21/486 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNY--SNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRL  329
             FW   GG AW  Y     +    + GP   PF+G +  M +  AHR +A+ A      RL
Sbjct  44    FWSHPGGPAWGKYFLHRRRQTTVIPGPRGLPFVGSMSLMSNTLAHRCIAATAEKFRAERL  103

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR LR+
Sbjct  104   MAFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRK  163

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +A+NH+FSP++I   E  RS IA +++  + K+    G    R ++   SL N++ SVFG
Sbjct  164   IASNHLFSPKQIKRSETQRSVIANQIVKCLTKQSNTKGLCFARDLIKTASLNNMMCSVFG  223

Query  690   SCLGLQGEE-----LGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
                 L+ E      L  +V+EGY+L+G  NW D+ P     D    + +C  L  +VN  
Sbjct  224   KEYELEEEHEEVSELRELVEEGYDLLGTLNWTDHLPWLSEFDPQRIRSRCSNLVPKVNRF  283

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             V +II   + Q        ++ +DF+ VLLSL   D+L+D D++AVLWEMIFRGTDTVA+
Sbjct  284   VNRIISDHREQTR------DSPSDFVDVLLSLDGPDKLSDPDIIAVLWEMIFRGTDTVAV  337

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EWI+ARMVLH D+Q+    E+D  VG SR V++SD+ +L YL A+VKEVLRLHPPGPL
Sbjct  338   LIEWILARMVLHPDIQSTVHNELDQIVGRSRAVEESDVVSLVYLTAVVKEVLRLHPPGPL  397

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSI  1382
             LSWARLA+ D  +D   +PAGTTAMVNMWAI HDP +W +P  F+PERF+    E E S+
Sbjct  398   LSWARLAITDTIIDGRRVPAGTTAMVNMWAIAHDPHVWENPLEFKPERFVAKEGEVEFSV  457

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP---SVDLSECLKLSLE  1553
             +GSDLRLAPFGSGRRVCPG+ LGL+TV  W A  L  F+WL      +VDLSE L+LS E
Sbjct  458   LGSDLRLAPFGSGRRVCPGKNLGLTTVTFWTATLLHEFEWLTPSDEKTVDLSEKLRLSCE  517

Query  1554  MKKHLA  1571
             M   LA
Sbjct  518   MANPLA  523



>ref|XP_010512566.1| PREDICTED: cytochrome P450 78A9-like [Camelina sativa]
Length=537

 Score =   451 bits (1160),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 247/489 (51%), Positives = 319/489 (65%), Gaps = 24/489 (5%)
 Frame = +3

Query  159   FWVVEGGFAWRNYSNNQ--NPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRL  329
             +W   GG AW  Y +++    K + GP   PF+G +  M +  AHR +A+ A   G  RL
Sbjct  44    YWSHPGGPAWGKYFSHRRHQTKVIPGPRGLPFIGSMSLMSNTLAHRCIAATAEKFGAKRL  103

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TRMI++ +PD AKEIL  S F DRPVKESA  LMF RAIGFAP G YWR LR+
Sbjct  104   MAFSLGETRMIVTCNPDVAKEILNSSVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRK  163

Query  510   MA---ANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVES  680
             +A   +NH+FSPR+I   E  RS IA ++   + K+    G    R ++   SL N++ S
Sbjct  164   IAKIASNHLFSPRQIKRSETQRSVIANQITRCLVKQSNTEGLCFARDLIKTASLNNMMCS  223

Query  681   VFGSCLGLQGEELGL-----MVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRV  845
             VFG    L+ E   +     +V EGY+L+G+ NW D+ P    LD    + +C  L  +V
Sbjct  224   VFGKEYELEHEHEEVRELSELVDEGYDLLGKLNWTDHLPWLSELDPQRIRSRCSTLVPKV  283

Query  846   NDLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDT  1025
             N  V +II   + Q        ++ +DF+ VLLSL   D+L+D D++AVLWEMIFRGTDT
Sbjct  284   NRFVNRIISDHRAQAR------DSPSDFVDVLLSLDGPDKLSDPDMIAVLWEMIFRGTDT  337

Query  1026  VAILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPP  1205
             VA+L+EWI+ARMVLH DVQ+    E+D  VG SR V++SD+ +L YL A+VKEVLRLHPP
Sbjct  338   VAVLIEWILARMVLHPDVQSTVHRELDQIVGRSRAVEESDVASLVYLTAVVKEVLRLHPP  397

Query  1206  GPLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEE  1373
             GPLLSW+RLA+ D  +D   +PAGTTAMVNMWAI  DP++W  P  F+PERF+    E E
Sbjct  398   GPLLSWSRLAITDTTIDGHRVPAGTTAMVNMWAIARDPQVWESPLEFKPERFVAKEGEVE  457

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGP---SVDLSECLKL  1544
              S++GSDLRLAPFGSGRR+CPG+ LGL+TV  W A  L  F+W P     +VDLSE L+L
Sbjct  458   FSVLGSDLRLAPFGSGRRICPGKNLGLATVTFWTATLLHEFEWRPPSDEKTVDLSEKLRL  517

Query  1545  SLEMKKHLA  1571
             S EM   LA
Sbjct  518   SCEMANPLA  526



>dbj|BAK02559.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   451 bits (1160),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 247/490 (50%), Positives = 316/490 (64%), Gaps = 27/490 (6%)
 Frame = +3

Query  162   WVVEGGFAWRNYSNNQNPKK--LNGPMSWPFLGFLPQMGSHAHRKLASMATSMG--LNRL  329
             W   GG AW  +   +  K   L GP   P +G +  M   AHRKLA+ A  +G    RL
Sbjct  47    WCFPGGAAWGRWWLTRRLKGSLLPGPRGLPLIGSMWLMTGLAHRKLAAEAARLGGRAKRL  106

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TRM++++HPD A+EIL   +F DRP+KESA  L+F RAIGFAP G+YWR LRR
Sbjct  107   MAFSLGETRMVVAAHPDVAREILNSPAFADRPIKESAYGLLFHRAIGFAPHGAYWRALRR  166

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +A+ H+FSP +I      R+ IA +M+  +   +G    VEVR V+   SL NV+ SVFG
Sbjct  167   VASTHLFSPWQITASAPQRAVIASQMVSAL---VGAGAGVEVRRVLRRASLHNVMWSVFG  223

Query  690   SCLGLQGE-------ELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
                 L          EL  +V EGY+L+G+ NW D+ P     D  GT+ +C  L  RVN
Sbjct  224   RRYDLDSNKESEEVRELSHLVDEGYDLLGQLNWSDHLPWLARFDLQGTRARCSGLVPRVN  283

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               V +II+  +       +      DF  VLLSL   D+LADAD++AVLWEM+FRGTDTV
Sbjct  284   RFVRRIIDDHRSAAASAGVK-----DFTDVLLSLQGGDKLADADMIAVLWEMVFRGTDTV  338

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
             A+L+EW++AR+VLH+DVQA+   E+D  VG  R V +SD  +L YL A++KE LR+HPPG
Sbjct  339   AVLMEWVLARLVLHRDVQARVHEELDRVVGRDRAVDESDAASLAYLHAVIKETLRVHPPG  398

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEV  1376
             PLLSWARLA  DV VD   IPAGTTAMVNMWAITHDP +W +P  FRPERF+      E+
Sbjct  399   PLLSWARLATSDVRVDGFLIPAGTTAMVNMWAITHDPDVWAEPEEFRPERFVAGQPAAEL  458

Query  1377  SIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPS----VDLSECLKL  1544
             S+MGSDLRLAPFG+GRR CPG++L ++TV  WLA  L   ++LP P     V+L E L+L
Sbjct  459   SVMGSDLRLAPFGAGRRSCPGKSLAMATVAFWLATLLHELEFLPSPDPAGGVNLGETLRL  518

Query  1545  SLEMKKHLAI  1574
             S EM   LA+
Sbjct  519   SCEMAAPLAV  528



>ref|NP_001190156.1| cytochrome p450 78a9 [Arabidopsis thaliana]
 gb|AEE80274.1| cytochrome p450 78a9 [Arabidopsis thaliana]
Length=555

 Score =   451 bits (1161),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 245/486 (50%), Positives = 315/486 (65%), Gaps = 21/486 (4%)
 Frame = +3

Query  159   FWVVEGGFAWRNY--SNNQNPKKLNGPMSWPFLGFLPQMGSH-AHRKLASMATSMGLNRL  329
             FW   GG AW  Y     +    + GP   PF+G +  M +  AHR +A+ A      RL
Sbjct  44    FWSHPGGPAWGKYFLHRRRQTTVIPGPRGLPFVGSMSLMSNTLAHRCIAATAEKFRAERL  103

Query  330   MAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQLRR  509
             MAFSLG TR+I++ +PD AKEIL    F DRPVKESA  LMF RAIGFAP G YWR LR+
Sbjct  104   MAFSLGETRVIVTCNPDVAKEILNSPVFADRPVKESAYSLMFNRAIGFAPYGVYWRTLRK  163

Query  510   MAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESVFG  689
             +A+NH+FSP++I   E  RS IA +++  + K+    G    R ++   SL N++ SVFG
Sbjct  164   IASNHLFSPKQIKRSETQRSVIANQIVKCLTKQSNTKGLCFARDLIKTASLNNMMCSVFG  223

Query  690   SCLGLQGEE-----LGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVNDL  854
                 L+ E      L  +V+EGY+L+G  NW D+ P     D    + +C  L  +VN  
Sbjct  224   KEYELEEEHEEVSELRELVEEGYDLLGTLNWTDHLPWLSEFDPQRIRSRCSNLVPKVNRF  283

Query  855   VGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTVAI  1034
             V +II   + Q        ++ +DF+ VLLSL   D+L+D D++AVLWEMIFRGTDTVA+
Sbjct  284   VNRIISDHREQTR------DSPSDFVDVLLSLDGPDKLSDPDIIAVLWEMIFRGTDTVAV  337

Query  1035  LVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPGPL  1214
             L+EWI+ARMVLH D+Q+    E+D  VG SR V++SD+ +L YL A+VKEVLRLHPPGPL
Sbjct  338   LIEWILARMVLHPDIQSTVHNELDQIVGRSRAVEESDVVSLVYLTAVVKEVLRLHPPGPL  397

Query  1215  LSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFM----EEEVSI  1382
             LSWARLA+ D  +D   +PAGTTAMVNMWAI HDP +W +P  F+PERF+    E E S+
Sbjct  398   LSWARLAITDTIIDGRRVPAGTTAMVNMWAIAHDPHVWENPLEFKPERFVAKEGEVEFSV  457

Query  1383  MGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLP---GPSVDLSECLKLSLE  1553
             +GSDLRLAPFGSGRRVCPG+ LGL+TV  W A  L  F+WL      +VDLSE L+LS E
Sbjct  458   LGSDLRLAPFGSGRRVCPGKNLGLTTVTFWTATLLHEFEWLTPSDEKTVDLSEKLRLSCE  517

Query  1554  MKKHLA  1571
             M   LA
Sbjct  518   MANPLA  523



>ref|XP_006362127.1| PREDICTED: cytochrome P450 78A6-like isoform X2 [Solanum tuberosum]
Length=529

 Score =   451 bits (1159),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 237/487 (49%), Positives = 318/487 (65%), Gaps = 26/487 (5%)
 Frame = +3

Query  153   MKFWVVEGGFAWRNYSNNQ---NPKKLNGPMSWPFLGFLPQMGSHAHRKLASMATSMGLN  323
             M +W   GG AW  +   +   NP  + GP  +P +G +  M   AH K+A MA ++  +
Sbjct  41    MIYWAHPGGPAWGKHIWKKLVSNP--IPGPKGFPIIGSMNLMTGLAHHKIAKMAKTLKAS  98

Query  324   RLMAFSLGTTRMIISSHPDTAKEILCGSSFTDRPVKESAKLLMFERAIGFAPSGSYWRQL  503
             RLM FSLG TR+I++ +P+ AKEIL  S F DRP+KESA  LMF RAIGFA  G YWR L
Sbjct  99    RLMCFSLGETRVIVTCNPEVAKEILNSSVFADRPIKESAYRLMFNRAIGFASYGVYWRTL  158

Query  504   RRMAANHMFSPRRIACLEGVRSAIAEEMIGKMDKEMgesgfvevrgvvgegSLRNVVESV  683
             R++++NH+FSP++I   E  R  IA+++I   +K    +  + VR  +   SL N++  V
Sbjct  159   RKISSNHLFSPKQIKIYEKPRFQIAKQLISMFEKN-SPNDILRVRDGLKLASLNNMMCCV  217

Query  684   FG-----SCLGLQGEELGLMVKEGYELIGEFNWGDYFPLGFLLDFGGTKRKCHRLAGRVN  848
             FG      C  L+ +EL  +V EGYEL+G  NW D+       D    K++C  L  +VN
Sbjct  218   FGKSYDFDCCNLETKELMKLVDEGYELLGMLNWSDHISWLGEFDLQRIKQRCSELVPKVN  277

Query  849   DLVGQIIEKRKRQFEGIEINVNNNTDFLSVLLSLPKEDQLADADLVAVLWEMIFRGTDTV  1028
               V +I+++          ++N + DF+ VLLSL   ++L++ D++AVLWEMIFRGTDTV
Sbjct  278   KFVKKILDE----------HMNQSGDFVDVLLSLQGSERLSENDMIAVLWEMIFRGTDTV  327

Query  1029  AILVEWIMARMVLHQDVQAKAQLEIDTCVGPSRHVQDSDIPNLPYLQAIVKEVLRLHPPG  1208
              ILVEWI+ARM LH D+Q+K Q+EID  VG SR + +SD+  + YL A++KEVLRLHPPG
Sbjct  328   TILVEWILARMTLHPDIQSKVQVEIDRIVGQSRTMTESDVSKMIYLPAVIKEVLRLHPPG  387

Query  1209  PLLSWARLAVHDVYVDKCFIPAGTTAMVNMWAITHDPKIWNDPWTFRPERFMEE-----E  1373
             PLLSWARLA+ D  +D   +PAGTTAMVNMWAIT D  +W DP  F+PERF+ E     +
Sbjct  388   PLLSWARLAITDTTIDGYQVPAGTTAMVNMWAITRDADVWADPLMFKPERFLNEAHSDMD  447

Query  1374  VSIMGSDLRLAPFGSGRRVCPGRALGLSTVHLWLARFLQHFKWLPGPSVDLSECLKLSLE  1553
              S++GSD+RLAPFGSGRR CPG+ LGL+TV  W+A  L  FK+ P  +VDLSE LKLS E
Sbjct  448   FSVLGSDMRLAPFGSGRRSCPGKTLGLTTVTYWVATLLHEFKFGPSSNVDLSEVLKLSCE  507

Query  1554  MKKHLAI  1574
             M   L +
Sbjct  508   MAHPLKV  514



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4897607409344